(data stored in SCRATCH3701 zone)

EMBL: CP002189

ID   CP002189; SV 2; circular; genomic DNA; STD; PRO; 722585 BP.
XX
AC   CP002189;
XX
PR   Project:PRJNA50045;
XX
DT   26-JAN-2011 (Rel. 107, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Candidatus Blochmannia vafer str. BVAF, complete genome.
XX
KW   .
XX
OS   Candidatus Blochmannia vafer str. BVAF
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; ant endosymbionts; Candidatus Blochmannia.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-722585
RX   DOI; 10.1186/1471-2164-11-720.
RX   PUBMED; 21126349.
RA   Williams L.E., Wernegreen J.J.;
RT   "Unprecedented loss of ammonia assimilation capability in a urease-encoding
RT   bacterial mutualist";
RL   BMC Genomics 11:687-687(2010).
XX
RN   [2]
RP   1-722585
RA   Williams L.E., Wernegreen J.J.;
RT   ;
RL   Submitted (01-SEP-2010) to the INSDC.
RL   Illumina, Inc., 25861 Industrial Blvd., Hayward, CA 94545, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-722585
RA   Williams L.E., Wernegreen J.J.;
RT   ;
RL   Submitted (28-NOV-2011) to the INSDC.
RL   Illumina, Inc., 25861 Industrial Blvd., Hayward, CA 94545, USA
XX
DR   MD5; 77f7547db3db115d22288947260f0709.
DR   BioSample; SAMN02603466.
DR   EnsemblGenomes-Gn; BVAF_038.
DR   EnsemblGenomes-Gn; BVAF_053.
DR   EnsemblGenomes-Gn; BVAF_055.
DR   EnsemblGenomes-Gn; BVAF_068.
DR   EnsemblGenomes-Gn; BVAF_076.
DR   EnsemblGenomes-Gn; BVAF_102.
DR   EnsemblGenomes-Gn; BVAF_103.
DR   EnsemblGenomes-Gn; BVAF_172.
DR   EnsemblGenomes-Gn; BVAF_173.
DR   EnsemblGenomes-Gn; BVAF_186.
DR   EnsemblGenomes-Gn; BVAF_187.
DR   EnsemblGenomes-Gn; BVAF_188.
DR   EnsemblGenomes-Gn; BVAF_189.
DR   EnsemblGenomes-Gn; BVAF_223.
DR   EnsemblGenomes-Gn; BVAF_228.
DR   EnsemblGenomes-Gn; BVAF_309.
DR   EnsemblGenomes-Gn; BVAF_322.
DR   EnsemblGenomes-Gn; BVAF_323.
DR   EnsemblGenomes-Gn; BVAF_324.
DR   EnsemblGenomes-Gn; BVAF_368.
DR   EnsemblGenomes-Gn; BVAF_414.
DR   EnsemblGenomes-Gn; BVAF_415.
DR   EnsemblGenomes-Gn; BVAF_417.
DR   EnsemblGenomes-Gn; BVAF_418.
DR   EnsemblGenomes-Gn; BVAF_457.
DR   EnsemblGenomes-Gn; BVAF_458.
DR   EnsemblGenomes-Gn; BVAF_459.
DR   EnsemblGenomes-Gn; BVAF_502.
DR   EnsemblGenomes-Gn; BVAF_505.
DR   EnsemblGenomes-Gn; BVAF_506.
DR   EnsemblGenomes-Gn; BVAF_551.
DR   EnsemblGenomes-Gn; BVAF_554.
DR   EnsemblGenomes-Gn; BVAF_555.
DR   EnsemblGenomes-Gn; BVAF_556.
DR   EnsemblGenomes-Gn; BVAF_584.
DR   EnsemblGenomes-Gn; BVAF_585.
DR   EnsemblGenomes-Gn; BVAF_586.
DR   EnsemblGenomes-Gn; BVAF_587.
DR   EnsemblGenomes-Gn; BVAF_596.
DR   EnsemblGenomes-Gn; BVAF_597.
DR   EnsemblGenomes-Gn; BVAF_598.
DR   EnsemblGenomes-Gn; BVAF_631.
DR   EnsemblGenomes-Gn; EBG00001271308.
DR   EnsemblGenomes-Gn; EBG00001271309.
DR   EnsemblGenomes-Gn; EBG00001271311.
DR   EnsemblGenomes-Gn; EBG00001271312.
DR   EnsemblGenomes-Gn; EBG00001271313.
DR   EnsemblGenomes-Gn; EBG00001271314.
DR   EnsemblGenomes-Gn; EBG00001271315.
DR   EnsemblGenomes-Gn; EBG00001271316.
DR   EnsemblGenomes-Gn; EBG00001271317.
DR   EnsemblGenomes-Gn; EBG00001271318.
DR   EnsemblGenomes-Gn; EBG00001271319.
DR   EnsemblGenomes-Gn; EBG00001271320.
DR   EnsemblGenomes-Gn; EBG00001271321.
DR   EnsemblGenomes-Gn; EBG00001271322.
DR   EnsemblGenomes-Gn; EBG00001271323.
DR   EnsemblGenomes-Gn; EBG00001271324.
DR   EnsemblGenomes-Gn; EBG00001271325.
DR   EnsemblGenomes-Gn; EBG00001271326.
DR   EnsemblGenomes-Gn; EBG00001271327.
DR   EnsemblGenomes-Gn; EBG00001271328.
DR   EnsemblGenomes-Gn; EBG00001271329.
DR   EnsemblGenomes-Gn; EBG00001271330.
DR   EnsemblGenomes-Gn; EBG00001271331.
DR   EnsemblGenomes-Gn; EBG00001271332.
DR   EnsemblGenomes-Gn; EBG00001271333.
DR   EnsemblGenomes-Gn; EBG00001271334.
DR   EnsemblGenomes-Gn; EBG00001271335.
DR   EnsemblGenomes-Gn; EBG00001271336.
DR   EnsemblGenomes-Gn; EBG00001271337.
DR   EnsemblGenomes-Gn; EBG00001271338.
DR   EnsemblGenomes-Gn; EBG00001271339.
DR   EnsemblGenomes-Gn; EBG00001271340.
DR   EnsemblGenomes-Gn; EBG00001271341.
DR   EnsemblGenomes-Gn; EBG00001271342.
DR   EnsemblGenomes-Gn; EBG00001271343.
DR   EnsemblGenomes-Gn; EBG00001271344.
DR   EnsemblGenomes-Gn; EBG00001271345.
DR   EnsemblGenomes-Gn; EBG00001271346.
DR   EnsemblGenomes-Gn; EBG00001271347.
DR   EnsemblGenomes-Gn; EBG00001271348.
DR   EnsemblGenomes-Gn; EBG00001271349.
DR   EnsemblGenomes-Gn; EBG00001271350.
DR   EnsemblGenomes-Gn; EBG00001271351.
DR   EnsemblGenomes-Gn; EBG00001271352.
DR   EnsemblGenomes-Gn; EBG00001271353.
DR   EnsemblGenomes-Gn; EBG00001271354.
DR   EnsemblGenomes-Tr; BVAF_038-1.
DR   EnsemblGenomes-Tr; BVAF_053-1.
DR   EnsemblGenomes-Tr; BVAF_055-1.
DR   EnsemblGenomes-Tr; BVAF_068-1.
DR   EnsemblGenomes-Tr; BVAF_076-1.
DR   EnsemblGenomes-Tr; BVAF_102-1.
DR   EnsemblGenomes-Tr; BVAF_103-1.
DR   EnsemblGenomes-Tr; BVAF_172-1.
DR   EnsemblGenomes-Tr; BVAF_173-1.
DR   EnsemblGenomes-Tr; BVAF_186-1.
DR   EnsemblGenomes-Tr; BVAF_187-1.
DR   EnsemblGenomes-Tr; BVAF_188-1.
DR   EnsemblGenomes-Tr; BVAF_189-1.
DR   EnsemblGenomes-Tr; BVAF_223-1.
DR   EnsemblGenomes-Tr; BVAF_228-1.
DR   EnsemblGenomes-Tr; BVAF_309-1.
DR   EnsemblGenomes-Tr; BVAF_322-1.
DR   EnsemblGenomes-Tr; BVAF_323-1.
DR   EnsemblGenomes-Tr; BVAF_324-1.
DR   EnsemblGenomes-Tr; BVAF_368-1.
DR   EnsemblGenomes-Tr; BVAF_414-1.
DR   EnsemblGenomes-Tr; BVAF_415-1.
DR   EnsemblGenomes-Tr; BVAF_417-1.
DR   EnsemblGenomes-Tr; BVAF_418-1.
DR   EnsemblGenomes-Tr; BVAF_457-1.
DR   EnsemblGenomes-Tr; BVAF_458-1.
DR   EnsemblGenomes-Tr; BVAF_459-1.
DR   EnsemblGenomes-Tr; BVAF_502-1.
DR   EnsemblGenomes-Tr; BVAF_505-1.
DR   EnsemblGenomes-Tr; BVAF_506-1.
DR   EnsemblGenomes-Tr; BVAF_551-1.
DR   EnsemblGenomes-Tr; BVAF_554-1.
DR   EnsemblGenomes-Tr; BVAF_555-1.
DR   EnsemblGenomes-Tr; BVAF_556-1.
DR   EnsemblGenomes-Tr; BVAF_584-1.
DR   EnsemblGenomes-Tr; BVAF_585-1.
DR   EnsemblGenomes-Tr; BVAF_586-1.
DR   EnsemblGenomes-Tr; BVAF_587-1.
DR   EnsemblGenomes-Tr; BVAF_596-1.
DR   EnsemblGenomes-Tr; BVAF_597-1.
DR   EnsemblGenomes-Tr; BVAF_598-1.
DR   EnsemblGenomes-Tr; BVAF_631-1.
DR   EnsemblGenomes-Tr; EBT00001803608.
DR   EnsemblGenomes-Tr; EBT00001803610.
DR   EnsemblGenomes-Tr; EBT00001803611.
DR   EnsemblGenomes-Tr; EBT00001803612.
DR   EnsemblGenomes-Tr; EBT00001803613.
DR   EnsemblGenomes-Tr; EBT00001803614.
DR   EnsemblGenomes-Tr; EBT00001803615.
DR   EnsemblGenomes-Tr; EBT00001803616.
DR   EnsemblGenomes-Tr; EBT00001803617.
DR   EnsemblGenomes-Tr; EBT00001803618.
DR   EnsemblGenomes-Tr; EBT00001803619.
DR   EnsemblGenomes-Tr; EBT00001803620.
DR   EnsemblGenomes-Tr; EBT00001803621.
DR   EnsemblGenomes-Tr; EBT00001803622.
DR   EnsemblGenomes-Tr; EBT00001803623.
DR   EnsemblGenomes-Tr; EBT00001803624.
DR   EnsemblGenomes-Tr; EBT00001803625.
DR   EnsemblGenomes-Tr; EBT00001803627.
DR   EnsemblGenomes-Tr; EBT00001803628.
DR   EnsemblGenomes-Tr; EBT00001803629.
DR   EnsemblGenomes-Tr; EBT00001803630.
DR   EnsemblGenomes-Tr; EBT00001803631.
DR   EnsemblGenomes-Tr; EBT00001803632.
DR   EnsemblGenomes-Tr; EBT00001803633.
DR   EnsemblGenomes-Tr; EBT00001803635.
DR   EnsemblGenomes-Tr; EBT00001803637.
DR   EnsemblGenomes-Tr; EBT00001803638.
DR   EnsemblGenomes-Tr; EBT00001803639.
DR   EnsemblGenomes-Tr; EBT00001803640.
DR   EnsemblGenomes-Tr; EBT00001803641.
DR   EnsemblGenomes-Tr; EBT00001803642.
DR   EnsemblGenomes-Tr; EBT00001803643.
DR   EnsemblGenomes-Tr; EBT00001803644.
DR   EnsemblGenomes-Tr; EBT00001803645.
DR   EnsemblGenomes-Tr; EBT00001803648.
DR   EnsemblGenomes-Tr; EBT00001803649.
DR   EnsemblGenomes-Tr; EBT00001803651.
DR   EnsemblGenomes-Tr; EBT00001803653.
DR   EnsemblGenomes-Tr; EBT00001803654.
DR   EnsemblGenomes-Tr; EBT00001803655.
DR   EnsemblGenomes-Tr; EBT00001803656.
DR   EnsemblGenomes-Tr; EBT00001803657.
DR   EnsemblGenomes-Tr; EBT00001803658.
DR   EnsemblGenomes-Tr; EBT00001803659.
DR   EnsemblGenomes-Tr; EBT00001803660.
DR   EnsemblGenomes-Tr; EBT00001803662.
DR   EuropePMC; PMC3017870; 21126349.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002189.
DR   SILVA-SSU; CP002189.
XX
CC   On Nov 28, 2011 this sequence version replaced gi:318038864.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..722585
FT                   /organism="Candidatus Blochmannia vafer str. BVAF"
FT                   /strain="BVAF"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:859654"
FT   gene            1..1911
FT                   /gene="mnmG"
FT                   /gene_synonym="gidA"
FT                   /gene_synonym="trmF"
FT                   /locus_tag="BVAF_001"
FT   CDS_pept        1..1911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnmG"
FT                   /gene_synonym="gidA"
FT                   /gene_synonym="trmF"
FT                   /locus_tag="BVAF_001"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_001"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33415"
FT                   /db_xref="GOA:E8Q5U6"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5U6"
FT                   /protein_id="ADV33415.1"
FT                   /translation="MSYLTNFDVIVVGGGHAGTEAALAASQLKCHTLLITHNIDTLGQM
FT                   SCNPSIGGIGKGHLVKEIDAMGGIMANAIDRSGIQFRILNSSKGAAVKSTRAQADKILY
FT                   KQIIRQSLEDQSYLYILQASVEDVIIRHNKVMGVIIPNIEMKIFARSVILTTGTFLNGK
FT                   IYIGMNNFEGGRAGDLESSSLLSRRLQELSLKVNRLKTGTSPRIYAKGVNFECMVEQHS
FT                   DCPIPVFSFIGSSKQHPKQIPCYITHTNSKTHDIIRSNLHHSPVYAGLINGIPPRYCPS
FT                   IEDKVIRFPDKDTHQIFLEPEGLTTSEIYLNGVATSLPFNVQIQIIQSIKGLENARILR
FT                   PGYAIEYDFFNPIDLKLTLESKFISGLFLSGQINGTTGYEEAAAQGLLSGINAARYAQN
FT                   KTEWYPKRDQSYLGVLVDDLCTHGTTEPYRMFTSRAEYRLSLREDNADLRLTDIARQLG
FT                   LITDNRWRIFCVKQENIEREFQRFRNTYIFPNTTDIIKLNSILKVPLMNKVNGEDLLKR
FT                   PEINYATLSQLSTFKPVISDNQVYEQIEIQIKYAGYLNRQKEEIDRNLRNEDTLLPFDI
FT                   NYNNIVGLSTEVVEKLNYCRPYSVGQASRISGITPVAISILLVWLKKKGLLKKKNNINS
FT                   V"
FT   gene            2407..3231
FT                   /gene="atpB"
FT                   /locus_tag="BVAF_002"
FT   CDS_pept        2407..3231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="BVAF_002"
FT                   /product="ATP synthase subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_002"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33416"
FT                   /db_xref="GOA:E8Q5U7"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5U7"
FT                   /protein_id="ADV33416.1"
FT                   /translation="MLEIKNSTQQYITHHLHHLQFDLRYWHWVGSEVNASSFWILNVDS
FT                   LFFSILLCTSFLMICSYIVQFATYGTPGKMQTFIELIILFIDQHVKDMFHGSKNKLISP
FT                   LSMTIFIWIVLMNSMDLIPIDFFPYIADRVFGFSSLRIVPSADINITCSMALNIFVLML
FT                   FYNIKTSGITGLCAELMYHPFNSVLCIPINFVLEVISLLSKPISLSLRLFGNMYSGELI
FT                   FVLITALLPWWCQWVLSVPWAIFHILIIFLQAFIFMVLTIIYLSITQIHFKS"
FT   gene            3320..3559
FT                   /gene="atpE"
FT                   /locus_tag="BVAF_003"
FT   CDS_pept        3320..3559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="BVAF_003"
FT                   /product="ATP synthase subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_003"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33417"
FT                   /db_xref="GOA:E8Q5U8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5U8"
FT                   /protein_id="ADV33417.1"
FT                   /translation="MENLNFDMLYIAAAIMMGLAAIGAAVGIGILGSKFLEGAARQPDL
FT                   IPILRTQFFIVMGLVDAIPMITVGLGLYVMFAVV"
FT   gene            3649..4134
FT                   /gene="atpF"
FT                   /locus_tag="BVAF_004"
FT   CDS_pept        3649..4134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="BVAF_004"
FT                   /product="ATP synthase subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_004"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33418"
FT                   /db_xref="GOA:E8Q5U9"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5U9"
FT                   /protein_id="ADV33418.1"
FT                   /translation="MNLNATILGQSVSFIFFVWFCMRYVWSPLMLIIEKRRRKISDSLE
FT                   NIKQSEIKCKLMHNEAEICLRKARIKSEEIIKHAYKCKSQILHDAQQEAHQEFSKIVCK
FT                   AKAQIDQERKRVADELRKKIGQFIMEGVEKIVDNRSISNIISDDYIHAVVQTLLNED"
FT   gene            4135..4674
FT                   /gene="atpH"
FT                   /locus_tag="BVAF_005"
FT   CDS_pept        4135..4674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="BVAF_005"
FT                   /product="ATP synthase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_005"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33419"
FT                   /db_xref="GOA:E8Q5V0"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5V0"
FT                   /protein_id="ADV33419.1"
FT                   /translation="MFFEKTIAYVYAKAVFSLATEQNNIIYWKTLLELFSKVSQNFVIK
FT                   SLCYRLLSSQQIFEIFINICECYEKLDFFSKNFVRIVSENNRVLLFPVILEQFNSLNDI
FT                   YMNVIAVKVISATKLHIAQIQKISTCMTNYLSKMVKIECSICPNIIGGIIIRIEDVVID
FT                   GSVKGRILRLRDVLQF"
FT   gene            4718..6259
FT                   /gene="atpA"
FT                   /locus_tag="BVAF_006"
FT   CDS_pept        4718..6259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="BVAF_006"
FT                   /product="ATP synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_006"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33420"
FT                   /db_xref="GOA:E8Q5V1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5V1"
FT                   /protein_id="ADV33420.1"
FT                   /translation="MQLNSNEISELIKRRIKQYNIEVEIRNEGTITTVRDGVIHIYGLS
FT                   NVMQGEMIALPEHKFAVALNLERNSVGAVVLGSYENISEGMLTKCTGDILKVPVGKELL
FT                   GRVVNALGIPIDNKGAVNCSCYYPIESKAPGVIDRQSISEPIQTGYKAIDSMIPIGKGQ
FT                   RELIIGDRQTGKSALAIDTIINQRFSGVKCIYVAIGQKATTVANVVKKLEEHNALGNTI
FT                   VILASASESAVLQYLAPYAGCAMGEYFRNHGEDALIVYDDLSKQAIAYRQISLLLKRPP
FT                   GREAYPGDIFYLHSRLLERSAKVNVNYIEHNTEGRVMGKTGSLTALPIIETQAGDVSAF
FT                   IPTNVISITDGQIFLESYLFNAGIRPAVNPGISVSRVGGAAQTNIMKTLSGGIRTALAQ
FT                   YRELAAFSQFSSELDSSTRKQLHHGQKVTELLKQKQYHPISIACQSLVLFAVIFGYLDD
FT                   IELSKIGRFEFELVSYFMRTESELIKHININGLYDSTIESNFKRILQDFKLNQFN"
FT   gene            6270..7145
FT                   /gene="atpG"
FT                   /locus_tag="BVAF_007"
FT   CDS_pept        6270..7145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="BVAF_007"
FT                   /product="ATP synthase gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_007"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33421"
FT                   /db_xref="GOA:E8Q5V2"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5V2"
FT                   /protein_id="ADV33421.1"
FT                   /translation="MSSLQEVRLKIKSIRNIQKLAKAMEMISASKMYKAQKLILISQPY
FT                   LENIQRVINHIVLGKLEYKHMYLIERKIKSVGYWVVSSDRGLAGGLNINLFRMLLNDIK
FT                   KWNELNITIKLAVIGTKAASFFNSINSNMIVSYVSGIGDVPKISDLIGSVRIMLKLYCN
FT                   NQIDLLYVIYNKFVNTLTYTPQMCQILPILPLPDSNKTEVVNRYWDYLYEPDPKTLLDI
FT                   LLNRYIESKIYQGVVENLASEQSARMMAMKVASDNGETLIQDLKLFYNKIRQSKITQEL
FT                   TEIISGASVV"
FT   gene            7172..8575
FT                   /gene="atpD"
FT                   /locus_tag="BVAF_008"
FT   CDS_pept        7172..8575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="BVAF_008"
FT                   /product="ATP synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_008"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33422"
FT                   /db_xref="GOA:E8Q5V3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5V3"
FT                   /protein_id="ADV33422.1"
FT                   /translation="MSVSVGKIIQIIGAVVDVEFNQNEVPNLYHALEVCVNNNLKNEKK
FT                   IILEVEQQLGGGVVRCIAMGSTDGLCRGLIVGNLKRCIEVPVGKETLGRIMNVLGEPID
FT                   KKGSIKTIERRSIHQFSPLYHELSTNQELLVTGIKVIDLMCPFIKGGKIGLFGGAGVGK
FT                   TVNIMELIRNIAVEHSGYSVFVGVGERTREGNDFYHEMIHSDIINKVALVYGQMNEPPG
FT                   NRFRVALTGLTIAEKFRDDGYNVLLFIDNIYRYTLAGTEVSALLGRVPSAVGYQSTLSE
FT                   EMGMLQERIASTKSGAITSVQAIYVPADDLTDPSPTTTFAHLDATIVLSRQIAALGIYP
FT                   AVDPLDSHSQQLDPFIVGQEHYDVANAVRSILQRYQELKDIIAILGMDELSESDKLIVL
FT                   RSRKIQRFLSQPFFVAEVFTGFSGSYVSLQDTILGFKGIIDGKYDDLPEQSFYMVGSIN
FT                   EAIEKSKKL"
FT   gene            8640..9059
FT                   /gene="atpC"
FT                   /locus_tag="BVAF_009"
FT   CDS_pept        8640..9059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="BVAF_009"
FT                   /product="ATP synthase epsilon chain"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_009"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33423"
FT                   /db_xref="GOA:E8Q5V4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5V4"
FT                   /protein_id="ADV33423.1"
FT                   /translation="MITYNFQLHVVSVEKKLFDGIINKIQVMGVEGEMGIYPGHSPFIT
FT                   FIKPGILKISKLCNSEEYMYLSGGILEVQPNIVIILADMAIRAEDLDEKKAQESKRLAE
FT                   EKIKNMTSRGVDYIKISTEISKAIAQLRLIELLKK"
FT   gene            9252..10649
FT                   /gene="glmU"
FT                   /locus_tag="BVAF_010"
FT   CDS_pept        9252..10649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BVAF_010"
FT                   /product="bifunctional protein glmU (includes
FT                   UDP-N-acetylglucosamine pyrophosphorylase and
FT                   glucosamine-1-phosphate N-acetyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_010"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33424"
FT                   /db_xref="GOA:E8Q5V5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5V5"
FT                   /protein_id="ADV33424.1"
FT                   /translation="MCTVWNKNFNVIILAAGYGERMLSDIPKVMHKIAGKSMLQHLIDS
FT                   VCELDIQLSIYVVYSCKKDMFVNSICINDKNISISWVFQGIPKGTGHAVQKVLPMLYED
FT                   SEILVLYGDVPLISSRTLKKLLSVKLESDIALLTANVNDPTGYGRIIRNEFGQVIDIKE
FT                   DSDIVNDNHRKITEINSGIFISVSKYIKNWVGIVQNNNVKNELYLTDIFKIAYQNKYRI
FT                   NTINPIDEFEIIGINSKLDLIKVERIYQKNQAYNFVKSGVVILDPYRFDLRGTLVCGKD
FT                   VYIDVNVIIEGCVSLGNRVKIGAGCILKNVEIGDDVIICPFSFIENSKISFASKIGPFS
FT                   RLRPNTQLGEKTYIGNFVELKNVQLGKKSKVGHLSYLGDAQIGNQVNIGAGTIICNYDG
FT                   IKKHQTYIEDDVFIGSDSQLIAPIRIGKSAIIGAGTTVTKNVEEGKTVISRIQQFSISN
FT                   KKYTDKK"
FT   gene            complement(10719..12143)
FT                   /gene="mnmE"
FT                   /gene_synonym="trmE"
FT                   /locus_tag="BVAF_011"
FT   CDS_pept        complement(10719..12143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnmE"
FT                   /gene_synonym="trmE"
FT                   /locus_tag="BVAF_011"
FT                   /product="tRNA modification GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_011"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33425"
FT                   /db_xref="GOA:E8Q5V6"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5V6"
FT                   /protein_id="ADV33425.1"
FT                   /translation="MKYYSDTIAAISTPIGRGGIGIIRISGELIPEIALELLGKVPKPR
FT                   TAEYLPFRDKQGSTIEKVITLFFPKPHSFTGENILEIHGHGGYIILNILLSRILEISSK
FT                   IRLANPGEFTERAFLNNKIDLIQAESIADIIDATSYQAAKAAYNSLQGFFSNQIHNILD
FT                   KIIYCRMHVESTIDFSDQDIDTISYNKIKKILKNIITETDKIYKSAYSGSLLRDGIKII
FT                   IAGKPNAGKSSLFNALINLDRAIISSIPGTTRDTLYETIQLNGITFHITDTAGLQEHST
FT                   NEIELIGIKRAKNELKLADHILWVVDSSSCSNKYDDMLLPLQKTLPNINKKTTITIIRN
FT                   KSDLSLEKNGIYIINGYTCITLSALLNSGIDLLKKYLYNNTKHKIQHYTLPHSIEENQN
FT                   NFIARQRHLNIIKNAYQYLLSAQKQLNHYYCGVTIINDRFAEDLRYAHDELNKIFGKST
FT                   PDNLLKKIFSSFCIGK"
FT   gene            complement(12248..14200)
FT                   /gene="yidCD"
FT                   /locus_tag="BVAF_012"
FT                   /note="fusion of yidC and yidD in both Blochmannia vafer
FT                   and Blochmannia pennsylvanicus; yidC and yidD are separate
FT                   CDS in Blochmannia floridanus"
FT   CDS_pept        complement(12248..14200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidCD"
FT                   /locus_tag="BVAF_012"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_012"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33426"
FT                   /db_xref="GOA:E8Q5V7"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5V7"
FT                   /protein_id="ADV33426.1"
FT                   /translation="MEATRILITKLIIWLIRAYQITISPILGHHCRFSITCSQYGINSI
FT                   LQFGILKGIWKICIRILQCHPLNFKKNKNYHSFQHEKTKDIVNMDSQRNFFIGIFLIIS
FT                   FILWQTWEIEHYYQKTHLNNLKDNYTNSYLNSKISSSTPPNNIQKNIVHSENKDIITVQ
FT                   TDVFLLKINKYGGNIEDAYLLKYLDNLNSQQPLRLLNSSKKYQYQTYSELTTNTNLSNE
FT                   ENQCKKFLYTDINNQNKYILKNNKNTLQFTLMHYDPNGIIYTKQYLFHRNNYFITINHT
FT                   IDNTSIHSIYTRILGNLVQSQYYLPIPLKNNKNKIYLSSEYEGSAYSTNKEKYQKYSFN
FT                   DMKHNNLNIHSIGGWVALLQKYFVVAWLPITPVNNVFHTTYIDDHYMSIGFQSDLIQIP
FT                   PGQKKEFQTILWIGPKIQDHIKSTIAPNLNLVIDYGWFWFISQPLFKLLQLIHNYINNW
FT                   GVSIILITIIIRIIMYPLTKAQYTSMAKMRMLQPKLVLIQEKYKHNKYQCHQKTIELYK
FT                   KEKVNPLGGCLPLLIQMPIFLALYYMLSNSVELRHAKFMLWINDLSTQDPYYILPIIMG
FT                   ITMLLIQKLAPTTITDPTQKKIMTIMLTAFTVFFLWFPSGLVLYYIISNVITIIQQHII
FT                   YHGLSKKNNMNIHRS"
FT   gene            complement(14179..14526)
FT                   /gene="rnpA"
FT                   /locus_tag="BVAF_013"
FT   CDS_pept        complement(14179..14526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="BVAF_013"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_013"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33427"
FT                   /db_xref="GOA:E8Q5V8"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5V8"
FT                   /protein_id="ADV33427.1"
FT                   /translation="MNRIRLSKQTKLLNSKEFFSVFKAKKIIKSNGILLFSRPNQLGFP
FT                   RIGLAISKKYINRAHDRNTIKRHARETFRILQHNLLNLDFVLTIYSKKILYLKHNNLNE
FT                   EFKKLWKQHEY"
FT   gene            complement(14578..14718)
FT                   /gene="rpmH"
FT                   /locus_tag="BVAF_014"
FT   CDS_pept        complement(14578..14718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="BVAF_014"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_014"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33428"
FT                   /db_xref="GOA:E8Q5V9"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5V9"
FT                   /protein_id="ADV33428.1"
FT                   /translation="MKRTFQPSILKRNRTHGFRIRMSTKNGRHIISRRRSKGRIRLSTS
FT                   S"
FT   gene            14941..16050
FT                   /gene="dnaN"
FT                   /locus_tag="BVAF_015"
FT   CDS_pept        14941..16050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BVAF_015"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_015"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33429"
FT                   /db_xref="GOA:E8Q5W0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5W0"
FT                   /protein_id="ADV33429.1"
FT                   /translation="MTFCVERQSLYPILQKIISVVSNRPRLPILKHILLEINNNCLILI
FT                   VTNLEVEIIAHVFLEKRYVFRSVTVSGIKLYEIFRNLSACAKIFIKLENNKLLVNSGCS
FT                   SFVLSTLPASDFPNVETLKVDCEFNVIISQLMFKKIIELTQFAMGYRDARHYLNGIFFE
FT                   IEDKVVRVVATDGHRLAMCEITADTLSSSHSIIIPRQGIVEILRLLNYTKNLVKIKIYD
FT                   NRICVKIDNYIVHSKLIDSVFPNYKRVLTNNLKLFFEVDRIILKQALKRVSILSNEKLR
FT                   VVHFNLMHDQLKITANNFKQETSEEILEILYDNENIGISFNVDYILDIINVIDSKTLKF
FT                   FLTDPVSSVKIEGIPKFYEATYVVMPVRA"
FT   gene            16420..18846
FT                   /gene="gyrB"
FT                   /locus_tag="BVAF_016"
FT   CDS_pept        16420..18846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BVAF_016"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_016"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33430"
FT                   /db_xref="GOA:E8Q5W1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5W1"
FT                   /protein_id="ADV33430.1"
FT                   /translation="MLSSYDSSSIKILKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NSIDEAIAGYCQKIVVIIHQDNSVSIQDDGRGIPTGLHEEEGISAAEVIMTVLHAGGKF
FT                   DNNSYKVSGGLHGVGVSVVNALSEKLELIIERDLKIYKQIYFFGKPKSPLSIVGDSNKS
FT                   GTTIRFWPNFQIFTNKIEFQYAVLARRFQELSFLNAGVSIVLCDERNGKEEVFCCNGGI
FT                   KEFIKYLNINKSPIHSNIFYCMGNKGEVNVEVALQWNDSFQERIYSFTNNIPQRDGGTH
FT                   LSGLKSAITRTMHFYIDKEGYNNKKTKIITLGEDAREGLVAVLSVKIQNPKFSSQTKEK
FT                   LVSSEVKPAVESLIYEKLMEFFLENPIDSKNIIGKVISAARARESARKVRDLSRRKGLS
FT                   DFSILPGKLSDCQEKNPRYSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVMTLITALGCGIGQNEYNLNKLRYHSIILMTDADVDGAHIRTLLLTFFYR
FT                   HMPEIIERGHIFIAQPPLYKVQKGIQSKYLKDEEEMYQYQISIAARHARLYLDVNDTFP
FT                   LSEKMLKKLILEYFVIQKIIVRMERQFPKVLLNRLIYHPVLSTEQCLVYSDVEIWIQSL
FT                   VESLSRFQEYGDGNDYSFVIQKNIKEKYFVPILRIRTYGVDRDYLLGLDLIQSYEYGKL
FT                   VSFGKKMNELLLSNGYIEYEDCHKNINSFNQAIEWLMQQSRKGLIIQRYKGLGEMNPDQ
FT                   LWETTMNPQNRCMLRVTVKDAIEADNLFSTLMGDLVEPRRAFIEANALKATNVDY"
FT   gene            19082..19504
FT                   /gene="ibpA"
FT                   /locus_tag="BVAF_017"
FT   CDS_pept        19082..19504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpA"
FT                   /locus_tag="BVAF_017"
FT                   /product="small heat shock protein ibpA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_017"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33431"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5W2"
FT                   /protein_id="ADV33431.1"
FT                   /translation="MHNFDFSPLYGSVIGFDRLVNFLEVGQSNGNYPAYNVELVSEHKY
FT                   CISIVVAGFSSDELDITTHDNMLIVKGIHTRNDSNSNSDSKNYLYQGITDHDFERKFQL
FT                   AEHIQITGAKLDRGILYIHLTRVLPDILKPKHIEIK"
FT   gene            complement(19721..20731)
FT                   /locus_tag="BVAF_018"
FT   CDS_pept        complement(19721..20731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BVAF_018"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_018"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33432"
FT                   /db_xref="GOA:E8Q5W3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5W3"
FT                   /protein_id="ADV33432.1"
FT                   /translation="MFSIKTWITAISYIIMFASILMIIPLGLFPCFFSGFLTYEIIVSL
FT                   STYFERFIGTYRARQLSILIIIIILISTIAISISNCTNFFSENTNKINMLNEINHIFSD
FT                   FKKKLPNFLPKFFPNTTSELKERIFSWIELNIILIRNMGHVILHGCITLLIGLIIGAMI
FT                   AYPQYKKKYIESNTYFTNQLLERIYNLSHAFHNIVFAQLKISSINTLLTSIMIFILIPV
FT                   FGETLPLGKTLIIITFVLGLLPIVGNLISNIMITISALSISLSIGITMLIYLILIHKLE
FT                   YFLNAEIIGNKINSHTWELVLAMIFLESIFGLEGLIAAPIFYAYLKIELQLKNII"
FT   gene            21186..22124
FT                   /gene="glyQ"
FT                   /locus_tag="BVAF_019"
FT   CDS_pept        21186..22124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="BVAF_019"
FT                   /product="glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_019"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33433"
FT                   /db_xref="GOA:E8Q5W4"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5W4"
FT                   /protein_id="ADV33433.1"
FT                   /translation="MQQQYYDVNVKTIQDLIMDLEKFWIHNGCIIVPSLDMEIGAATSH
FT                   PITFFKAIGPEPVAAAYVQASRRPADSRYAKNPSRLQKYYQFQVIIKPSPENMSQLYLN
FT                   SLKAIGISESENDIRFIEDNWENPTLGAYGLGWEVWLNGMEITQLTYFQRMGGLECFPI
FT                   TGEITYGLERLALFLQDMDNIYDLIWGNTITGDITYKDLYYQNELEQSSYNFKYVNVSY
FT                   LFQNFNEYENEINYLLSLDEPLIVPSYELILKLIHIFNLLDARKVISVTERKNYILRIQ
FT                   RLSHMVAEMYYFFRKKIGFPLCANKTNNIIE"
FT   gene            22130..24235
FT                   /gene="glyS"
FT                   /locus_tag="BVAF_020"
FT   CDS_pept        22130..24235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="BVAF_020"
FT                   /product="glycyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_020"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33434"
FT                   /db_xref="GOA:E8Q5W5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5W5"
FT                   /protein_id="ADV33434.1"
FT                   /translation="MKQYTLLVEIGTDELPAKFLKNIGKDFYSHIKNEFKKNNILYNEI
FT                   YWFASPRHLAVKSRISIGKNQSLFKSDVYNRSDIDNCIVDKNLFLKKKNNKFSQNISSH
FT                   VNILEFNRFETEGIRQDKFINVRQFKLLLVQIIKNALGNLINYETMRWGDVLIPFIRPV
FT                   NTVTILLDTNIVSGRIFNKNINRIVYGNRYIKNNKIILNNANDYPNVLFEQGYVIVDYN
FT                   IRKQKIRMDVEHKALKLGGVVDIKNDDFLEKITSSIEWPIILFGKFNKRFLKLPKELII
FT                   HIMQDKQQYFPVYGKNQDILLPYFIFVINIIIDNYNKIINDHENIINMRFLDAEFFLKN
FT                   DNKNRLEDYFPKLSEIVFHSQLGSLKDKVHRITELSGWIANQVNENEFKARRAGYLCKC
FT                   DLVTDVVLEFPEVQGIMGMYYAQRDGEEKEVALAQKEHYQPRYYTDKLPTERISCIVSI
FT                   ADKMDTISGIFSVKEFPTGSRDPFGLKRAAKGILNIVLEKNMPINLLDLISKSIMLYKL
FT                   QLVDDDLINIKNDVYTFMCQRLCLYYRALGYKENIVRSVLNIRFGNIINLGKHIDSVHN
FT                   FYTIQKEKGAMFNLVYKRISNLIRNQNVFCNITEEINKTLLKSLEEIKLFEQITYTKMN
FT                   LNSVLQESRYSDALNIVENLFHRTNFFLDNVFIMSKNQNIKENRLSLIKTVKDLVSRVI
FT                   DISVLLK"
FT   gene            complement(24289..24918)
FT                   /gene="sodA"
FT                   /locus_tag="BVAF_021"
FT   CDS_pept        complement(24289..24918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="BVAF_021"
FT                   /product="manganese superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_021"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33435"
FT                   /db_xref="GOA:E8Q5W6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5W6"
FT                   /protein_id="ADV33435.1"
FT                   /translation="MVFKLPDLSYSYDSLEPFFDAKTMEIHYSKHHQAYINNANSALKN
FT                   LPKFSNLTIENLIKQLDFLPQEKKDILRNNGGGHFNHSLFWKSLKLGTELKGSLKKAIE
FT                   NTFIDYNNFKKEFEQVSMSRFGSGWTWLIIHNNNLKIVSTPNQDNPLMENKLSHTYGFP
FT                   IFGLDLWEHSYYLKYQNRRLDYVKAFWNIINWDEASRRFDESFYLN"
FT   gene            25143..27218
FT                   /gene="prlC"
FT                   /locus_tag="BVAF_022"
FT   CDS_pept        25143..27218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="BVAF_022"
FT                   /product="oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_022"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33436"
FT                   /db_xref="GOA:E8Q5W7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5W7"
FT                   /protein_id="ADV33436.1"
FT                   /translation="MNKKFCNFDLPLFSMIKLNSINDLIKKRIDNCYTEVDRIVSLNKS
FT                   ITYWKDVYEPLRISENKLKKVWSIITHLNSVKHDLKLRVIYQNNLMSILEYRNWVNHHL
FT                   GLYRLYKSLQNNSSYQLLSTIQQVALRKILSRYEISGIHLCGDKRKCYCRMMCMLSQLN
FT                   TIFDNNVLDSIRGWKKIITDQSLLSGIPDDQLHIARLEAQRNQRLGWLFTLQYPVYLSV
FT                   LSYCDNEDFRKELYWAFNTRASDQGPNAGKWDNTLVIDEILSLRYGIAKILGFNSYFEK
FT                   SLQTKMIQNPTSILNFLKNLLNHVHPNAKKDFLKIQSFAKKYYSHKCVNPWDVKYFQEK
FT                   QKSHLFQISEKELRFYFSEEKVLSEMFSIANRMYGIVIRERKDVDVWDSNVRFFDIFNH
FT                   KNEWQGGFYLDLYMRRNKCEGAWMDIYSDTKNEDDMEYQMPIAYLICNFNASEDSGRPS
FT                   LLTHGNIVTLFHEFGHVLHHILTSISISEISGVNGVELDVAEIPSVFMEKFCWDPTVLK
FT                   SISQHYQTKNSLSNNMINDLLRLKTEQATHDLLKQIMCSLFDFKIHHEYSPKEKNPVLN
FT                   IFNEIKQNTIVYPPFGDDRFPHSFAHIFSADDYAAGYYSYLWSDMLASSIWLHCKDLRL
FT                   TDSQMGNLFLDHMVCMGQSIDFKQCFTCIKNKVVTTQAILKYYNIPIQNNLFFKLC"
FT   gene            complement(27432..29054)
FT                   /gene="pit"
FT                   /locus_tag="BVAF_023"
FT   CDS_pept        complement(27432..29054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pit"
FT                   /locus_tag="BVAF_023"
FT                   /product="putative low-affinity inorganic phosphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_023"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33437"
FT                   /db_xref="GOA:E8Q5W8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5W8"
FT                   /protein_id="ADV33437.1"
FT                   /translation="MSYLFYDLDIHIRVLLILALCFVFVYEAINGFHDTANSVVPVIYT
FT                   CALRSSNAVIMSGIFNFLGVMLGGVSVSYTIVHLLPTYFFMNTNANHIFIMIFSMLFAA
FT                   ILWNLGTWYFGLPTSSSHTLIGALIGIGFANAFITHCSVNQELNISQLIHIFLSLIISP
FT                   IIGLILSKIIMSLLLRYRSNFGKYQEIHMTPSKHAQLYGKQHPSLWIRIILIISAAGVS
FT                   FSHGANDGQKGIGFIMLLLVGVAPASFVLNMHANNNDITNTRNAINNFQRYYIQHHDHF
FT                   KNIIPSEIMSMPISVALNQLVIIDPSIQKITTHLIHEHNHQSNCNCRISTVLTTAQIKK
FT                   IFYDFSLTLTIMQNSLCLLENLENYEQLNLNQRLQIRQLLMYITDILDQIIKHPDISNK
FT                   NKKFLKHLKINLLNTIEYAPTWIIVAVALSLSLGTTIGWKRVAITIGEKIGTQKMTYAQ
FT                   GLSAQLTTAISIGTASYIGMPVSTTHILSSSITGSMLTHRWEGVQWKIIKNILMTWSLT
FT                   IPISIILSGGFYLLIFKLFYQNI"
FT   gene            29377..30249
FT                   /gene="ubiA"
FT                   /locus_tag="BVAF_024"
FT   CDS_pept        29377..30249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="BVAF_024"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_024"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33438"
FT                   /db_xref="GOA:E8Q5W9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5W9"
FT                   /protein_id="ADV33438.1"
FT                   /translation="MFNLFNIYNKNYTLVKLMRINQPIGFFLLIWPTLWGLWMSNRGIP
FT                   DFFTLIIFIIGAIIMRSAGCVINDYIDCDIDIYVQRTKHRPLSSRIITKKKALLTFIYL
FT                   IIFAAGLICVFDTSTILLALLALGLLIIYPFLKRYVYLPQLILGILFSWPILMAYTATC
FT                   HVIDSTAWLLFLVNTVWTIIYDTEYSMVDRDDDKKIGIKSSALLFGNMDKLIIGILQII
FT                   TIFMFIFIGYKEKLPIVFYCFSVCGGGLLFVWQQILIHHRIKKRYFKAFLNNNYVGLLV
FT                   FIGIALSFI"
FT   gene            complement(30343..30840)
FT                   /gene="zur"
FT                   /locus_tag="BVAF_025"
FT   CDS_pept        complement(30343..30840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zur"
FT                   /locus_tag="BVAF_025"
FT                   /product="zinc uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_025"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33439"
FT                   /db_xref="GOA:E8Q5X0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5X0"
FT                   /protein_id="ADV33439.1"
FT                   /translation="MHINIQTLLIQIKKICEHRHVKLTAQRLEVLRLISQQYHQSISAY
FT                   DLLNLLRTSSLPHAKPSTIYRALHFLLAQRFIHRIESTNKFMLCKYFLELSHNFVFFIC
FT                   NHCKQVTEQTIKGVEEILHHTAKLRGFVISNNIIESHGLCFNCTNSTHVSITNSSFLSQ
FT                   RK"
FT   gene            31176..32552
FT                   /gene="dnaB"
FT                   /locus_tag="BVAF_026"
FT   CDS_pept        31176..32552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="BVAF_026"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_026"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33440"
FT                   /db_xref="GOA:E8Q5X1"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5X1"
FT                   /protein_id="ADV33440.1"
FT                   /translation="MCMSNRNKHVSDVKILPYSLEAEQSVLGSLMLDNEQWEYISTQIT
FT                   SNDFYNPAHRIIFSEIQRLLEINKPIDLITLSESLEIRGKLELVGGFGYLAELSKNVPS
FT                   VSNIHEYAHIIKERSITRSVITTAHRIADAGYNTKGRNSDELLDFVESLVFEIAHHKHH
FT                   DNKHLKSIDYILSDAVSYIEKSCRNARFGITGISSGYRDLDKKTDGLHQSDLIVIAARP
FT                   SMGKTAFAMNLCEHVAMNEIKPVLIFSLEMPGDQIVMRMLSSLSRVDYMNIRTGKLNHE
FT                   DRIRIVSTIELLLEKRNIYIDDSSYLTPSDVRSRSRRLFKEHDGLSLIMIDYLQLMRVP
FT                   SLSNNRTLEISEVSRSLKSLAKELKVPVIAISQLNRSLEQRVDKHPINSDLRESGAIEQ
FT                   DADLILFIYRDELYHENSDMKGIAEIILGKQRNGPVGTIRLIFNGQWARFDNYIDNNQY
FT                   "
FT   gene            32912..33400
FT                   /gene="ssb"
FT                   /locus_tag="BVAF_027"
FT   CDS_pept        32912..33400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="BVAF_027"
FT                   /product="single-stranded DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_027"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33441"
FT                   /db_xref="GOA:E8Q5X2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5X2"
FT                   /protein_id="ADV33441.1"
FT                   /translation="MVARGINKVILIGCLGKDPEIRYMANGTAVVNISMATTESWKDKQ
FT                   TSELKERTEWHRIVLFGKLAEIASSYLNKGSQVYIEGALRTRKWQGQDGNDRYTTEVVV
FT                   GTRGVMQMLNNRYIKEDHVSSDNETQKLIDDDINIDMSHNEKLADESAENFNDDDIPF"
FT   gene            33830..35473
FT                   /gene="yjcE"
FT                   /locus_tag="BVAF_028"
FT   CDS_pept        33830..35473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcE"
FT                   /locus_tag="BVAF_028"
FT                   /product="sodium hydrogen antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_028"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33442"
FT                   /db_xref="GOA:E8Q5X3"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5X3"
FT                   /protein_id="ADV33442.1"
FT                   /translation="MEIFFTILILILAVSVSGIIKQILPFQIPLPLMQILLGASLAWPK
FT                   FGLHIDFNPELFLLLFIPPLLFSDGWKTPMREFLRHGGEIIILALVLVIITVVGIGYLI
FT                   YWMIPEIPLVASLALAAVLSPTDAVALSGIVGEGRMPKKIMDIVQGEALMNDASGLVSL
FT                   KFAIAVAMGTMIFSISGVSIEFIKVALGGLLAGISVTWSYSKSLRLISRLSGEDPATQT
FT                   MLLLLLPFAVYLIAEHIGVSGILSAVASGMTIGQSGIIRNAPLTMRLRGNSVWTMLEFI
FT                   FNGMVFIILGLQLPDILLTSISQAELDPTVKTWMLFVYVIVIYIALITLRFVWLWLMKY
FT                   ISLYYMCSRPMIFSEYSTHEILIASFAGVRGAITLAGVLSIPLFLKDGTVFPCRYQLVF
FT                   IATGVILLSLLCSVVVLPWLLQGVKVSDKLLQRSEERMARSIAAEVAIDSLYKLEERLI
FT                   HNPEENIDSQLINEVSARIIGNLRKRIDENNDLRSMLVEDLERRMRLNALRAERSEYYH
FT                   LRAQQKISNETLMKLLRDLDFLEALLIDHE"
FT   gene            35918..37213
FT                   /gene="gltP"
FT                   /locus_tag="BVAF_029"
FT   CDS_pept        35918..37213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="BVAF_029"
FT                   /product="proton glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_029"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33443"
FT                   /db_xref="GOA:E8Q5X4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5X4"
FT                   /protein_id="ADV33443.1"
FT                   /translation="MMIKNFKITLAWKIFFALNLGIIVGISLHDQAELKDWIVNTFLFP
FT                   FGEIFIRLIKMIVVPIVMATLVVGIAGIGDVRKLGSIGLKTIIYFEIITTLAIVFGVAL
FT                   ANVFHPGYGIDMSILSKTDISIYEQTTSEIQSNLINTMLSLIPSNIISSMAKGDMLPII
FT                   FFSVIFGLGLAALPEKTKLPLLGVFNSIADTMFEVTNMVMRYAPIGVFALIAVTVATFG
FT                   FSSLFPLTKLVVLVYGAIVFFALVVLGIVARICNLKIWNLICILKEELILSFSTASSET
FT                   VLPRIIKKMEAYGAPSTITGFVVPTGYSFNLDGSTLYQSIAAIFIAQLYKIELSLSQEI
FT                   ILVLTLMITSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVVG
FT                   NALAVLVISKWENQFDTKRALAYELKMLNGDK"
FT   gene            complement(37390..37830)
FT                   /gene="yjgF"
FT                   /locus_tag="BVAF_030"
FT   CDS_pept        complement(37390..37830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjgF"
FT                   /locus_tag="BVAF_030"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_030"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33444"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5X5"
FT                   /protein_id="ADV33444.1"
FT                   /translation="MTKYKNIFQSIYTNNAPKPSGPYSQAVDTGSIIYISGQLPITQET
FT                   KKIPDDVYEQTYQTLKNIQYIVESKNLTMHNIVKTTVFITNIQDLPKINKSYNNFFYIH
FT                   SLKKTTQNQPNLNLPARSCVEVSKLPNNAKIEIEAIAIYSMQ"
FT   gene            complement(37964..38989)
FT                   /gene="argI"
FT                   /locus_tag="BVAF_031"
FT   CDS_pept        complement(37964..38989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argI"
FT                   /locus_tag="BVAF_031"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_031"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33445"
FT                   /db_xref="GOA:E8Q5X6"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5X6"
FT                   /protein_id="ADV33445.1"
FT                   /translation="MNKLYNRSFLRLIDFSVEEIKYILHVSNTLKYQKYNKKEIQQLFG
FT                   KNIVLIFENNSTRTRCAFEVAAFDQGARVTCLTPNISQIGHKESIKDTAKILGRMYHGI
FT                   QYRGYHQDTVKTFAQYSNVPVWNGLTKQFHPTQLLADLMTMKEQIPNKPFHQMKLAYVG
FT                   DTRNNIGNSLLEAAAIMGFDLRLISPKEFWPKKELLLECQKLADQQFNYKNILLTENIA
FT                   QGVKNVDFLYTDVWVSMGENEKVWAHRISLLSPYQVNQAMISQTENPNIKFLHCLPALH
FT                   DTDTVISKKIAQRYNYPNGLEVTNEIFESKQYSVVFEQAENRLHTIKSLMLVTLLSDLC
FT                   I"
FT   gene            complement(39247..42141)
FT                   /gene="valS"
FT                   /locus_tag="BVAF_032"
FT   CDS_pept        complement(39247..42141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="BVAF_032"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_032"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33446"
FT                   /db_xref="GOA:E8Q6K5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6K5"
FT                   /protein_id="ADV33446.1"
FT                   /translation="MIEKIYNPKQIEESIYKFWEESGYFEPDITDFEKPRYCIMMPPPN
FT                   ITGALHLGHAFQQTIMDILARYNRMNGKNVLWRIGLDHAGIAAQILIENKIFNQTKTPK
FT                   NNDLKNSLLKEIWSWKEQTEKLINYQIKRLGNSVSWTNTRFTMDPQMSFAVKEAFIRLY
FT                   QDNLIYKGKRLVNWDYKIQTAISDLEVSYKQVKGLMWYIRYKLEEYSKSNNHTISTNKN
FT                   IYITVATTKPETMFGDVAIAVNPEDSRYKKLIGKYVLIPLINRKIPIISDEHINPNKGT
FT                   GCVKITPAHDFNDYMIGKKHKLCMINIFSTYRKILEKPEIFCSQSQFYDKKNCYIPTIF
FT                   RNLNCDQARTMITSTCNQLNLIEQIQHYDVTIAYNNRTGTIVEPMLTNQWYLKTTYLAK
FT                   QAKNIVEKGSIEFIPEQYKNIYFKWMDNIQDWCISRQIWWGHQIPAWYDNTNKIYVGHC
FT                   EKDIRKNYKLHHDTKLRQDHDVLDTWFSSSLWTFSNLGWPKNNNLLKFYHPTDIIVSGF
FT                   DIIFFWISRMIMMTMYFIKDDKKNCQIPFKKIYITGLVRDKFGQKMSKSKNNVINPIDI
FT                   IDRISIHTLSKNHINNNYDSSQTIKKPPYNKNTPKKNCVNEIITYGADSLRMTLAALSS
FT                   YGRDIHWDINRLIGYHNFCNKLWNVSKFILLHTTNQDCGINYQQDKLLFSLPDRWITSK
FT                   LHQTIQIFYQELHKYRFDKIINLLYEFIWHQFCDWYIEFIKPTLYCSTNTQKLIGTRYT
FT                   LITSFETLLRLSHPIIPFITEKIWQKIKLIIKIKEKTIMLQSFPKYNISDINLNVIIEF
FT                   EWIKDLISEIRTFRTQTGILYKTPLHIALQHISSRIKKYILENNRTLLQVAQLKKIDFL
FT                   KDNDTFSQKSFNIPLHESELIVFIPDVFNKQIAIDKLHKEIKLITQKINYIQKKIDHQN
FT                   EYLKVNCIKEQEKLIFYTKTKNKLHNHLSIIISL"
FT   gene            complement(42138..42620)
FT                   /gene="holC"
FT                   /locus_tag="BVAF_033"
FT   CDS_pept        complement(42138..42620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holC"
FT                   /locus_tag="BVAF_033"
FT                   /product="DNA polymerase III chi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_033"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33447"
FT                   /db_xref="GOA:E8Q6K6"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6K6"
FT                   /protein_id="ADV33447.1"
FT                   /translation="MSNIKKGIFYILPSINSNAELSFKENFACHLSKIMWRSGKSILIA
FT                   CENKNQALKINNSLWNVDNNSFLPNDLLRKNTHYTPITIYWEQCCYHNNLLKDTLINLM
FT                   KINKDFFFNFNEIIDFVPSTNILKKLARIRYKTLQNIGFDLKVSNTSNFKINNINK"
FT   gene            complement(42727..44256)
FT                   /gene="pepA"
FT                   /locus_tag="BVAF_034"
FT   CDS_pept        complement(42727..44256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="BVAF_034"
FT                   /product="cytosol aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_034"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33448"
FT                   /db_xref="GOA:E8Q6K7"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6K7"
FT                   /protein_id="ADV33448.1"
FT                   /translation="MLTIDNTVSFKITDDYLKADEDACILTGVFEEYNLFPATEHINNI
FT                   SQEYIYSLLQRSKFNGSLNQHLLLYDIPYFLNRHILLVGCGKSHKFNSDTYIKILCNSI
FT                   KFCKSSHFNKILLLLSELNISGYESYWKIRHSISIINDIFYTFNKFKSHKHSPKQDLSL
FT                   EVILYINNPNELHICKKAIKDGSAIAYGINIAKNLSNMPPNYCTPNYLSHKVLELPNYY
FT                   TDLNINILDESHLTKIGMNSYLAVGKGSKYSSVMPIIKYKNNPIINHDPIILIGKGVTF
FT                   DSGGISIKPSNNMDEMKYDMCGAAVVYAIMCIVSKLKLPINIIGILAISENMISNKSLK
FT                   PGDVISTLSGKTIEVLNTDAEGRLVLCDVLTFAERYHPSIVIDIATLTGACVVALGKHF
FT                   SGLMTDNHDLAKDLIYASEQTRDYIWRLPLHESFDKQLQSTIADMTNIGDKSGGGAITA
FT                   ACFLKKFTQKYNWAHLDIAGTAWISNEKVKSSTGRPVELLTQFLINSIKQD"
FT   gene            44426..45541
FT                   /gene="yjgP"
FT                   /locus_tag="BVAF_035"
FT   CDS_pept        44426..45541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjgP"
FT                   /locus_tag="BVAF_035"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_035"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33449"
FT                   /db_xref="GOA:E8Q6K8"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6K8"
FT                   /protein_id="ADV33449.1"
FT                   /translation="MILIRYIIKEVFRNQLIILILLFLVCICQKLIKIVGVDNPIPVYL
FT                   IFLHLTLNIPELGKLVIPFSLFLSVFITCYRFHLHNEILAMYSCAINRFFFVKSIFLYS
FT                   IIVFIISLINVMWLSPYCEQLRYVTLSSINKNIYSIKLVEKKFLLMLSKHTVFFIKKIK
FT                   NKNLQYIFIVKKNHHINGSNVCVIITANNGDVYNYSNNLKAITLKSGTYYEIHYDQLIF
FT                   TNIYISDFSRYHTLIDYNMKSPQKGFKIVEHMTISQLICHDSLPEKYIELNWRFTLLVS
FT                   IIIMPIIALLLVINISNGYFLNFVLAISLYILFFMLHILLRFSITLDYRDSMLYMGGVN
FT                   VIYFIIALLMNLGKYQYLRWFELACVYFVKR"
FT   gene            45547..46638
FT                   /gene="yjgQ"
FT                   /locus_tag="BVAF_036"
FT   CDS_pept        45547..46638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjgQ"
FT                   /locus_tag="BVAF_036"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_036"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33450"
FT                   /db_xref="GOA:E8Q6K9"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6K9"
FT                   /protein_id="ADV33450.1"
FT                   /translation="MHKILDMYIKKSILSSISIVFLILISLSSIIRLIDGLRNFEKKTY
FT                   SIIEIFFCTFLSLPKDFELFLPISILLGGLLGLGVLEIRNELVIMKVFGLSYFQITFSV
FT                   VKVSVFILILHIMLNEWLLPGSQYMLYIYQGHKEYNSYFFPEKNKNLWIIDNNGFVCIE
FT                   YMPTTNNVFGVNLYYLTKDKKIEKIIYFKDATYINKSWFVSSAIELNFSDKTHIVNRTV
FT                   FHYKWNTILTPDLLSIITTNPRVLSVSKLFSCIKYFNGINQNSQYYELIFWNKILSPLT
FT                   GMIMLIISLLYSFGPFSKKKIGFRLFFGSIIGFLFYVLHQFFDVFCVMHNIYPLVGSII
FT                   PVLLFIVINIVIVFYKISNFRFI"
FT   gene            complement(46635..47552)
FT                   /gene="yidZ"
FT                   /locus_tag="BVAF_037"
FT   CDS_pept        complement(46635..47552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidZ"
FT                   /locus_tag="BVAF_037"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_037"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33451"
FT                   /db_xref="GOA:E8Q6L0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6L0"
FT                   /protein_id="ADV33451.1"
FT                   /translation="MNNFDFNLLIVLNALLENNSVNLASKKLNVTAPAISKSLNKIRIL
FT                   FNDQILVRSGTKLTPTPKAIALKQNIKTLVDQIETIINTHIIFEPKITNISFTIASNSS
FT                   IFFALSTLLFQDIYTNAPNVFMNLVNDSDYEDDFLRNNSIDLYLGEMRPLNPEITIRTI
FT                   YISKCCIICRNHHPILPKNKNIDNLLKYSFIQTKHEHLTNSDETNKLFWTERNILGITP
FT                   EYITTINSVIHSNALAIIPNFILILIHALHIPVKFFDVDFDLGQRNIIQAWHSKHNQST
FT                   AHKWLRDRTKNMLLKYIHEHIILH"
FT   gene            47892..47975
FT                   /locus_tag="BVAF_038"
FT   tRNA            47892..47975
FT                   /locus_tag="BVAF_038"
FT                   /product="tRNA-Leu"
FT   gene            48230..48367
FT                   /locus_tag="BVAF_039"
FT   CDS_pept        48230..48367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BVAF_039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_039"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33452"
FT                   /db_xref="GOA:E8Q6L1"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6L1"
FT                   /protein_id="ADV33452.1"
FT                   /translation="MKCKKNLSIEMKILTTSGLIRVLVVLMVLSCLWLVIIWTSISCIE
FT                   "
FT   gene            48379..49041
FT                   /locus_tag="BVAF_040"
FT   CDS_pept        48379..49041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BVAF_040"
FT                   /product="ABC transporter (putative manganese transport
FT                   system)"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_040"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33453"
FT                   /db_xref="GOA:E8Q6L2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6L2"
FT                   /protein_id="ADV33453.1"
FT                   /translation="MMVIHNLIAGYFNRNVTPMINGYIKRGSILTVVGSNGVGKSTFLK
FT                   TLAGLLPPNSGNLEFLKVEKPRIIGYLPQKKNIDCYFPVTVFDVVAMGCWPRINFLKRI
FT                   NDEQKYLIWKALKKVKLLNLMHRCVHSLSGGEFQRMLFARILVQQAQFILLDEPLQGID
FT                   QETCEIFLSSINQMSQYGCTIVIVLHDNQFASKYLVYDTLLLTQSNSIWIKSKTNRC"
FT   gene            49142..50011
FT                   /locus_tag="BVAF_041"
FT   CDS_pept        49142..50011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BVAF_041"
FT                   /product="ABC transporter membrane protein (putative
FT                   manganese transport system)"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_041"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33454"
FT                   /db_xref="GOA:E8Q6L3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6L3"
FT                   /protein_id="ADV33454.1"
FT                   /translation="MILHILFDPFIYFEFMRKGIVACCALSISITPIGSFLLLKRMSLI
FT                   GDALSHSILPGVAIGYFFSGVSLVMMNIGGLISGLIVSILSIWVSEKTTLQQDASFSGF
FT                   CIGFLALGVVLVSLQTSNMDLLNLLVGSILSVSMLHIKCIGVVSTITLISLALFYRALI
FT                   MESFDPDFFKTNNVVVFKSIQIFFLFIVMLNLIASFQITGTLMSVGLMILPNLSAQYWV
FT                   HSLIQRLLLSVCIALLCSWIGLLIAFYIVLPAGPTIILCISVFFLFSVLFGRNHSVLFS
FT                   MYWKEKQE"
FT   gene            complement(50519..51244)
FT                   /gene="yhbG"
FT                   /locus_tag="BVAF_042"
FT   CDS_pept        complement(50519..51244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbG"
FT                   /locus_tag="BVAF_042"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_042"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33455"
FT                   /db_xref="GOA:E8Q6L4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6L4"
FT                   /protein_id="ADV33455.1"
FT                   /translation="MEFLIIQKLSKMYKQKRIVNNTDLYLHSGEIVGLLGPNGSGKTTT
FT                   FQMILGIVLHDSGKIFLNETDISQLPTYARARLGIGFLPQDNSIFRKLTVFDNLMAIAQ
FT                   MNFYSNKNARYEHIINLMKNFNIQHLSNNIGESLSGGERKRVEIARALVAKPKFLLLDE
FT                   PFAGVDPISIKEIQKIIKQLKHYKLGILITDHNVQATLSICERAYVMNQGTLIAHGTSQ
FT                   EILNNKHVQKTYLGNLFPL"
FT   gene            complement(51319..51834)
FT                   /gene="lptA"
FT                   /locus_tag="BVAF_043"
FT   CDS_pept        complement(51319..51834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptA"
FT                   /locus_tag="BVAF_043"
FT                   /product="lipopolysaccharide transport periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_043"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33456"
FT                   /db_xref="GOA:E8Q6L5"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6L5"
FT                   /protein_id="ADV33456.1"
FT                   /translation="MNINKFKPYQIILFILINILLSTLEKIANSNNQSIEIHSTSQLIN
FT                   TPENIIIFKDHVVLKYKNIRLCADKIIINHNTNNYKLIKCIKAYGHPVIFQNTQKKTSD
FT                   IITSAQANTICYDIENNSIIFNGNVYIKQLGNSIHSDNIVYSINEKKIQATSNTNGNTT
FT                   AILVIHPS"
FT   gene            complement(51821..52423)
FT                   /gene="lptC"
FT                   /locus_tag="BVAF_044"
FT   CDS_pept        complement(51821..52423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptC"
FT                   /locus_tag="BVAF_044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_044"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33457"
FT                   /db_xref="GOA:E8Q6L6"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6L6"
FT                   /protein_id="ADV33457.1"
FT                   /translation="MVFFKVKNKKNLGNDLKCILLKNLLILICICYFYLNTSQSTIQRN
FT                   ISSLNYATNAHHSNEIILYSYNAIGNLKFKLTATYIQCYPNTQIIEFTQPNITIFNKKN
FT                   IIIWTIKCNKAQLNYKKILNLTGYVSINKIMQNTRDTQSIITNQISINLIKQNMLSNNK
FT                   TIVHGSCFYSIGTKMSAKLNTKQIKLFDSTYTQYEYK"
FT   gene            52844..53104
FT                   /gene="yrbA"
FT                   /locus_tag="BVAF_045"
FT   CDS_pept        52844..53104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbA"
FT                   /locus_tag="BVAF_045"
FT                   /product="bolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_045"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33458"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6L7"
FT                   /protein_id="ADV33458.1"
FT                   /translation="MNADKIKEILLSCLNLSEVYVAFDYHGHCQIIAIGSMFIEKNKLE
FT                   RHKIVYAPLKQYITYNKIHSLSIYAFSLNEWDINKKFYNVK"
FT   gene            53181..54446
FT                   /gene="murA"
FT                   /locus_tag="BVAF_046"
FT   CDS_pept        53181..54446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BVAF_046"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_046"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33459"
FT                   /db_xref="GOA:E8Q6L8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6L8"
FT                   /protein_id="ADV33459.1"
FT                   /translation="MDKFYIQGPTTLSGEVVISGAKNSALPILFATLLTEEPVEIFNVP
FT                   RLKDIDSAIELLNYLGAQVEHQDVIVFSDTSKVHTYYCAPYDLVKSIRASIWILGPLVA
FT                   RFGHGEIWLPGGCSIGKRLIDLHIDGLEKLGAKIIIEKEYVIASVNGRLRGAHIIMNKI
FT                   SVGATVTVMSAAALAEGITVIDNAAREPEVVDTANFLIMLGTKIIGAGSSRIIIEGVQK
FT                   LKGGKYHIIPDRIETGTFLVAAAISRSHVICLKSNPNFLKLVLQKLRESGAEINTGKDW
FT                   ISLNMHGRRPKAIGVYTSPYPGFPTDMQAQFTLLNIVSKGIGKITETIFENRFMHVPEL
FT                   IRMGAKVQVLNNTIICYGVDSLVGTQVISTDLRSAASLILAGCIAQGVTVIDCISHVDR
FT                   GYDRIEKKLKSMGACIQRITDT"
FT   gene            complement(54586..55980)
FT                   /gene="degQ"
FT                   /locus_tag="BVAF_047"
FT   CDS_pept        complement(54586..55980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="BVAF_047"
FT                   /product="protease"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_047"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33460"
FT                   /db_xref="GOA:E8Q6L9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6L9"
FT                   /protein_id="ADV33460.1"
FT                   /translation="MKIIQNSIITLGIILGLEIITNFTPCTYHYNILFSDTSHSSMPTS
FT                   LAPMLDKVLPTVVSIHVEGTQPVKRLTLPKEFRYFFGPDLPPGGNFGTKPFEGLGSGVI
FT                   INANKGYIITNNHVVNEADKITIQLNDGKEYKAKIIGHDEQTDLALLQILKFNKNLSEI
FT                   KIADSDTLKVGDVAVAIGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGN
FT                   SGGALVNLNGELIGINTAILAPGGGNVGIGFAIPSNIVKTLSQQLIEFGEVKRGQLGIK
FT                   GTELTADIAKAFNIDIQRGAFVSEVLPGSAAAKARIKAGDIIVSIEGKPIKNFAELRVK
FT                   VGTTTPGKTIKIGLLRDGKTHIVSVLLDDSTCVSTSEEILTPALQGASLSNGYLKDGTK
FT                   GVKVEDVMKDSPASSIGLQKGDIIIGLNRTRIHNLSQLRKLLKEKPTVMALNIIRRDTS
FT                   IFLLLR"
FT   gene            complement(56194..56595)
FT                   /gene="yhcB"
FT                   /locus_tag="BVAF_048"
FT   CDS_pept        complement(56194..56595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcB"
FT                   /locus_tag="BVAF_048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_048"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33461"
FT                   /db_xref="GOA:E8Q6M0"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6M0"
FT                   /protein_id="ADV33461.1"
FT                   /translation="MIWIIVILLSFLIGNITGIIFMYYRDRNLLNNQKTLYNELQNNKM
FT                   KLNTYQNKLKTHFEYNIKLLNKISENYQNLYQNITKNANFFLPNVYNQENVYSDHAQNI
FT                   NIQHKKHLTTEAPRDYSDDVNAQNEQEKI"
FT   gene            57069..57488
FT                   /gene="rplM"
FT                   /locus_tag="BVAF_049"
FT   CDS_pept        57069..57488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BVAF_049"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_049"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33462"
FT                   /db_xref="GOA:E8Q6M1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6M1"
FT                   /protein_id="ADV33462.1"
FT                   /translation="MRQSKIIKREWYVVDATDKVLGRLSSKVAMYLIGKHKIEYAPYFD
FT                   VGDYIIIINSKKIYVSGRKYENKIYYRHTGYVGGIKSLKFKELISINSNKVIENSVKGM
FT                   LPKNKLGRVMFRRLKVYTSTVHNHEAQSPKFLQIS"
FT   gene            57512..57910
FT                   /gene="rpsI"
FT                   /locus_tag="BVAF_050"
FT   CDS_pept        57512..57910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BVAF_050"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_050"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33463"
FT                   /db_xref="GOA:E8Q6M2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6M2"
FT                   /protein_id="ADV33463.1"
FT                   /translation="MNIICNQFYGTGRRKSASARVFLKLGVGKIIINNRSLDNYFPKIS
FT                   EQVMIKKPLEVTKLLDSLDVYITVTGGGVSGQSGAICHGVTRALLKYDEKLKVLLRSSG
FT                   LLTRDSRIVERKKIGFRKSRRRPQFSKR"
FT   gene            complement(58065..58646)
FT                   /gene="yraP"
FT                   /locus_tag="BVAF_051"
FT   CDS_pept        complement(58065..58646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yraP"
FT                   /locus_tag="BVAF_051"
FT                   /product="putative phospholipid-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_051"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33464"
FT                   /db_xref="GOA:E8Q6M3"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6M3"
FT                   /protein_id="ADV33464.1"
FT                   /translation="MKNHIIFLTLTLVFYSTLLIGCTSMLTIGTATIVANTWYDSRTIG
FT                   SQIDDSILKINIYHALNKHTQIKKFTRIINTVYQGNVLLTGQSPSSELSKEAINIVMHI
FT                   NGTKNIYNAIRKNSPISLQNILFDSIISNQIRFHLFTKKNTHISKIKVVTENREVFLLG
FT                   MVTCKEGQYAEKIARKTKGVKNVFSAFTYI"
FT   gene            59153..60010
FT                   /gene="yraL"
FT                   /locus_tag="BVAF_052"
FT   CDS_pept        59153..60010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yraL"
FT                   /locus_tag="BVAF_052"
FT                   /product="tetrapyrrole methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_052"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33465"
FT                   /db_xref="GOA:E8Q6M4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6M4"
FT                   /protein_id="ADV33465.1"
FT                   /translation="MNSNRTLYIVPTPIGNLHDITYRALSTLRQVDGIIAESTRRVQIL
FT                   LSFFSIKLPVYIMNRYNENRKVPILLSKLQDGRNIALISDAGSPLISDPGYRLVRACHE
FT                   KKIKVISLPGPCAAIAALCGSGLPVNRFCFEGFLPSKRIFRISRLKELLEESRTLIFYD
FT                   VKYRIIDSLKDIVSVFGETRYVVLVRELSKIWEFIYGAPASKLLFWVQQDKTRVKGEIV
FT                   LVVSGYNFKNRGNDEIPPKAWSIMKLLALEVSVKKAASLVGNIYGIKKNVLYHKYVFEK
FT                   LNRK"
FT   gene            60058..60492
FT                   /gene="rnpB"
FT                   /locus_tag="BVAF_053"
FT   ncRNA           60058..60492
FT                   /gene="rnpB"
FT                   /locus_tag="BVAF_053"
FT                   /product="RNAseP_bact_a"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            60847..61398
FT                   /gene="yqjA"
FT                   /locus_tag="BVAF_054"
FT   CDS_pept        60847..61398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjA"
FT                   /locus_tag="BVAF_054"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_054"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33466"
FT                   /db_xref="GOA:E8Q6M5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6M5"
FT                   /protein_id="ADV33466.1"
FT                   /translation="MNILKELFNLVPQNGALLSFNIKINLVFYLTIFIIVFLENAIIPA
FT                   FFLPGDSLLIVLGILIKKGILNFFLTLSILTIAASLGSWVSYLQGKFLLKNKKTLKGWM
FT                   SYLPSRSYQRASNMFNKHGLLALFISRFVVFMRTALPVIAGVSGLDSLKFQLFNWISSF
FT                   IWVLILIILGGCLGHIECFF"
FT   gene            complement(61465..61538)
FT                   /locus_tag="BVAF_055"
FT   tRNA            complement(61465..61538)
FT                   /locus_tag="BVAF_055"
FT                   /product="tRNA-Met"
FT   gene            complement(61752..63614)
FT                   /gene="rpoD"
FT                   /locus_tag="BVAF_056"
FT   CDS_pept        complement(61752..63614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="BVAF_056"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_056"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33467"
FT                   /db_xref="GOA:E8Q6M6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6M6"
FT                   /protein_id="ADV33467.1"
FT                   /translation="MEHNPQSQLKLLVTRGKEQGYLTFSEVNDHLSEDIIDSDQLHNII
FT                   QMMNDMGIQVMEEAPDSDEFLLTKNCDTVVNNDEEDATEAAVQALSNTDPDLGRTTDPV
FT                   RMYMKEMGAVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYQRVETGETR
FT                   LSDLITGFVDLDNFNQNVETIPNITQQNIHHLSSNILTVTDDEENTENEDDDNSIDPEL
FT                   ARKKFIALRKQYETTRQTIKYNGRNHDKSSSEILKLSEIFKQFRLVPKQFDYLVNNMRS
FT                   MMDRIRFHERLIMKLCVDISKMPKKKFIDLFSGNETNKAWLIQALSMNAGWAKKLDTVN
FT                   AEVQQNIWQLYQIEKETGLTIEQVKNINRRMSIGEAKARRAKKEMVEANLRLVISIAKK
FT                   YTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRI
FT                   PVHMIETINKLNRISRQILQETGCEPTPEELSKRMLISEDKIRKVLKIAKEPVSMETPI
FT                   GDDEDSHLGDFIEDTNLDLPLDSATSDNLKAATNDVLSGLTPREAKVLRMRFGIDMNTD
FT                   HTLEEVGRQFDVTRERIRQIEAKALRKLRHPSRSEILRSFLDDD"
FT   gene            complement(63779..65556)
FT                   /gene="dnaG"
FT                   /locus_tag="BVAF_057"
FT                   /note="frameshift in poly-A tract; RNA polymerase or
FT                   ribosomal slippage"
FT   CDS_pept        complement(join(63779..65470,65470..65556))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="dnaG"
FT                   /locus_tag="BVAF_057"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_057"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33468"
FT                   /db_xref="GOA:E8Q6M7"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6M7"
FT                   /protein_id="ADV33468.1"
FT                   /translation="MIARIPKTLIETLISRTNIVDLINQRIPLKKKGSNFIACCPFHSE
FT                   KYPSFTVNFKKQFYYCFSCGAHGNIINFLMNYDQYTFIECIKKLSTIHGISIKNFFYHN
FT                   TTSQISHENNLYKFMSDVSNYYQNNLINKKYAYAHKYLQNRGLTTNSIANFNIGFAPMG
FT                   WNNIAQNLNLNTYNSKLITQSGIYVENGKKNKYDRFRERIIFPMKNQEGKIIGFGGRTI
FT                   QHNPKQPKYLNSPDTTIFKKNQYLYGFYETCKKHKNIPYILLVEGYMDVIILTQFGINY
FT                   VVSTLGTSMSVYHIRLIYSVTNQIICCYDGDNAGKKAAWRTLNTVLPYLTDNKEISFMF
FT                   LPNQEDPDTLIRKIGKDSFLKQISKAQSLSNFLFETLSKKINLHTLEGRVKLSSLILPM
FT                   INQIPGQILQLCLQQKLSKIIGILDDSKLQQLLKKPKKNIPLTQYKHNITYNIEHILIG
FT                   LLIQNPKLAKLVPTIQGLETLKHNNIKIFINLVKLCKFYPNFTTEQLLEYFYNKKTTNR
FT                   HYFIILKKLAYWKHIIKDDMIIITFIDTLTKLYNLILEQQQNMLITRERLFGLTNKERR
FT                   ELWMLNQKLSSIHILK"
FT   gene            complement(65692..65907)
FT                   /gene="rpsU"
FT                   /locus_tag="BVAF_058"
FT   CDS_pept        complement(65692..65907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="BVAF_058"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_058"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33469"
FT                   /db_xref="GOA:E8Q6M8"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6M8"
FT                   /protein_id="ADV33469.1"
FT                   /translation="MPIIKIRENEPFDVALRRFKRSCEKAGILSEVRRREFYEKPTTER
FT                   KRAKASAIKRHIKKITRENSKRFKSF"
FT   gene            66112..67182
FT                   /gene="gcp"
FT                   /locus_tag="BVAF_059"
FT   CDS_pept        66112..67182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="BVAF_059"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_059"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33470"
FT                   /db_xref="GOA:E8Q6M9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6M9"
FT                   /protein_id="ADV33470.1"
FT                   /translation="MRVLGIETSCDETGVAVYDQNEGLLINKIYSQSLLHSHYGGVVPE
FT                   LAARDHTLRIIPLIVSALRETGLTSSDINGIAYTAGPGLIGSLLVGSAVACALAYAWNI
FT                   PIIDIHHMEAHLLAPMLNQKNISFDSGFYSNCTDVIKFPFIALLVSGGHTQLVMVKKIG
FT                   EYKILGESIDDAVGEVFDKIAVLLGLQYPGGAALSVMARNGIKGRYIFPKPMIHKPGLN
FT                   FSFSGLKTAVSRVILSLKTNDNQVKADIACGFECAAIETLTIKCYRALKQTQIKNLVIS
FT                   GGVSANLVLRSYLSNMLESMQGTLLYPPKLEFCTDNGAMVACAGLIRLKSGLAHTNLSI
FT                   LVKPRWSLESLPKVEI"
FT   gene            complement(67262..67828)
FT                   /gene="ygiH"
FT                   /locus_tag="BVAF_060"
FT   CDS_pept        complement(67262..67828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygiH"
FT                   /locus_tag="BVAF_060"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_060"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33471"
FT                   /db_xref="GOA:E8Q6N0"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6N0"
FT                   /protein_id="ADV33471.1"
FT                   /translation="MIITTILTIFFAYFLGSMSGAILICKILNLTDPRNQGSQNPGATN
FT                   IFRIFGYKLAIYVTLFDMLKGAVPIWIGSYLEITPLYLHIITIVVCIGHMYPIFFQFKG
FT                   GKGVATELGSLAAINIHLFFVMISSWIIIVLIFKHSALGSIISNLIVPTYAWYIQYSHI
FT                   LLIIILSLLILIRHINNIKQLWNPQ"
FT   gene            67937..68338
FT                   /gene="folB"
FT                   /locus_tag="BVAF_061"
FT   CDS_pept        67937..68338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BVAF_061"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_061"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33472"
FT                   /db_xref="GOA:E8Q6N1"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6N1"
FT                   /protein_id="ADV33472.1"
FT                   /translation="MKFLYIDQLIVMASIGIYNWERQCLQKLVFDLRLVYDSEFCKFIN
FT                   GMNMYVDYVQINQIILNMINSRHFELIEDVAEITAEALINRFPIISWIQVKVNKPNVIR
FT                   NLCNVGFCVERRKSKVHDFKKVRLYTGWK"
FT   gene            complement(69508..70707)
FT                   /gene="cca"
FT                   /locus_tag="BVAF_062"
FT   CDS_pept        complement(69508..70707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="BVAF_062"
FT                   /product="multifunctional CCA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_062"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33473"
FT                   /db_xref="GOA:E8Q6N2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6N2"
FT                   /protein_id="ADV33473.1"
FT                   /translation="MKKYLVGGAVRDSLLNLPIIEKDWVITGSNPQEMLKIGYEQVGKD
FT                   FPVFLHPTSHEEYALARTERKNGKGYTGFICYTNPSVTIEEDLYRRDLTINAMAYDMHG
FT                   NLLDPYNGQRDIKLKLLRHVSDAFYEDPLRILRVARFAAKFKHMGFSIASETLQLMIQM
FT                   SSSELQLLSSERIWTETKKALITNNPQVYFQILKKCGALNILFPEIYTLFTISGSKKWH
FT                   LNFNNLGSHTMTKLSNISRLTKDLAIRFSILCCNLSEQHNSSKQLIISSVNNLCKRLTI
FT                   PNNILKLSKIVAIYYNDLYDVTTLSSEMIIRIFNKFNCWHCPKNIEQIIYINKSHLLDH
FT                   QCYTQLSYYQENFLRTAFKLTKQIKAHDVISSGFQNINIGKELHNRRINILNAWNKNYK
FT                   "
FT   gene            70903..72369
FT                   /gene="hldE"
FT                   /gene_synonym="rfaE"
FT                   /locus_tag="BVAF_063"
FT   CDS_pept        70903..72369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /gene_synonym="rfaE"
FT                   /locus_tag="BVAF_063"
FT                   /product="bifunctional protein hldE"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_063"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33474"
FT                   /db_xref="GOA:E8Q6N3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6N3"
FT                   /protein_id="ADV33474.1"
FT                   /translation="MKDDNFCFVNFLKSNVLIVGDVILDRYWCGFTNKISLESSGPIVK
FT                   INKIVNRPGGASNVAMNIAALGGQVRLIGLVGIDKAARILKKQLLKFKIKWNVVPLHTY
FT                   STILKLRVLSKKQQLIRLDFEKNVENIDTNQLINEVKLHLTKHKILVLSDYAKGALNKI
FT                   EEIIELARLANIPVIIDPKGIQFSRYKGATILTPNMSEFESVAGFCRNDKILISRAKEI
FT                   IYDYNLSALLITRAEKGMVLLRKKLIDHPLYFKAQSKVVYDVTGAGDTVVGVLSAALSY
FT                   GESLEKACFLANSAAGLVIGKFGTATVDMIEMKNIIQKYEYENMPFGILDENTLKRIVS
FT                   VARNRGEKIVMTNGVFDILHYGHVNYLTNARKLGDRLIVAVNSDESTKRLKGKGRPINT
FT                   LKKRMVVLSALSMVDWVVPFYEDTPIRLISEISPDFLVKGGDYDILDIDGNKEVVSKGG
FT                   KVCVLKFQSGFSSSKIINFIQNNRDKLNVR"
FT   gene            complement(72514..72795)
FT                   /gene="yqiC"
FT                   /locus_tag="BVAF_064"
FT   CDS_pept        complement(72514..72795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiC"
FT                   /locus_tag="BVAF_064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_064"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33475"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6N4"
FT                   /protein_id="ADV33475.1"
FT                   /translation="MLDLKTIAKFTRYINEYVHKIISGLTCDLDSKIQQILQNQLDYMD
FT                   FVNREEFDIQSQVLLEIQQKINELEKKVQILESIYQHKLKKNKSNNNT"
FT   gene            73174..73827
FT                   /gene="ribB"
FT                   /locus_tag="BVAF_065"
FT   CDS_pept        73174..73827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="BVAF_065"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_065"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33476"
FT                   /db_xref="GOA:E8Q6N5"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6N5"
FT                   /protein_id="ADV33476.1"
FT                   /translation="MYWQEDILSKFGTSIERVQNALNALRGGRGVLVIDDENRENEGDM
FT                   IFAAENMTVTQMALAIRHGSGIVCLCLTEDRCKQLNLPMMVEENSNNYKTAFTVTIEAS
FT                   KGVTTGVSAKDRLTTIQASIADYAKPSDLNRPGHVFPLRANKGGVLTRLGHTEAAVDLV
FT                   TLAGLKPFGVLCEVTNKDGSMARTLEIIEFSKKYNMPVLTILDLIIYIKIRTNF"
FT   gene            74149..74883
FT                   /gene="plsC"
FT                   /locus_tag="BVAF_066"
FT   CDS_pept        74149..74883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="BVAF_066"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_066"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33477"
FT                   /db_xref="GOA:E8Q6N6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6N6"
FT                   /protein_id="ADV33477.1"
FT                   /translation="MIAIIRVVLILIISINICVFGIIYCLLVPRQLRYIDIFSHLFGCM
FT                   APIFGIQLEIRKSSDILLPKNCVYISNHQNNYDMVTVSSAVQSNTVTIGKKNLLWIPLF
FT                   GQLYWLSGNILIDRTYNSVQKTRSILTKIIKTIRIDGMSVWIFPEGTRNQGRGLLPFKI
FT                   GAFYAAIFSKVPIVPICVSDISNNKIRLNRWSNGLVIIEIMPSLKTCQYKLNQVRIIAA
FT                   HCHKIMKLKIDKLNEEVMLREN"
FT   gene            complement(74920..76095)
FT                   /gene="metC"
FT                   /locus_tag="BVAF_067"
FT   CDS_pept        complement(74920..76095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="BVAF_067"
FT                   /product="cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_067"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33478"
FT                   /db_xref="GOA:E8Q6N7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6N7"
FT                   /protein_id="ADV33478.1"
FT                   /translation="MKDETKLITSGRNKKFTQGTVNPIIQRASSIIFNSVEQKKYAFKN
FT                   RMNGKLFYGRYGTLSHFALQEAMIELENGSGCVLYPCGTAAITHSILAFISEGDHILIT
FT                   GSAYEPTQNFCRVISKKMNIQISWFDPLIGVNIAHLIQDNTKLIVLESPSSITMEIQNI
FT                   PEIIKSARTKKKDIVILLDNTWSAGIFLKPINIGVDISIQSGTKYILGHSDGMLGIAVS
FT                   NLRCWKQLKEHACLMGQTVDADTAYMAIRGLRTLYIRLKQHEENGLNIAHWLTDHPKVY
FT                   KVNHPALPVCRGHEYFLRDFSGSSGLFSFILKQRLTNVQLSNFLNNFKYFKMAYSWGGF
FT                   ESLIITNQIEELNSIRPVGLLDFTGTLVRIHVGLEHYTDLIQDLKNGLDRI"
FT   gene            complement(76488..76560)
FT                   /locus_tag="BVAF_068"
FT   tRNA            complement(76488..76560)
FT                   /locus_tag="BVAF_068"
FT                   /product="tRNA-Phe"
FT   gene            complement(76807..77118)
FT                   /gene="cutA"
FT                   /locus_tag="BVAF_069"
FT   CDS_pept        complement(76807..77118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="BVAF_069"
FT                   /product="divalent cation tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_069"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33479"
FT                   /db_xref="GOA:E8Q6N8"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6N8"
FT                   /protein_id="ADV33479.1"
FT                   /translation="MIIILCTLPNNEKLALKLIHTLLNLKLAACVNLISNIRSYYYWND
FT                   QLQTSNELQLLIKTQDSLQEKIFNTIKKTHPYTIPELLVIPITFGEIQYLNWITKVLS"
FT   gene            77504..77797
FT                   /gene="groES"
FT                   /locus_tag="BVAF_070"
FT   CDS_pept        77504..77797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BVAF_070"
FT                   /product="10 kDa chaperonin groES"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_070"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33480"
FT                   /db_xref="GOA:E8Q6N9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6N9"
FT                   /protein_id="ADV33480.1"
FT                   /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVLAVGH
FT                   GRVLENGEVKALDVRVGDTIIFNDGYGVKVEKIDNEEVLIMSENDILAIVEK"
FT   gene            77847..79487
FT                   /gene="groEL"
FT                   /locus_tag="BVAF_071"
FT   CDS_pept        77847..79487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BVAF_071"
FT                   /product="60 kDa chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_071"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33481"
FT                   /db_xref="GOA:E8Q6P0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6P0"
FT                   /protein_id="ADV33481.1"
FT                   /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   APVITKDGVSVAREIELEDKFENMGAQMVKEVASKANDSAGDGTTTATVLAQSIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVVAAVEELKKLSVPCSDPKAIAQVGTISANSDETVGKLIA
FT                   QAMDKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFVNKPESGTVELEHPFILL
FT                   ADKKISNIREMLPMLESVAKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVTAVKAPGF
FT                   GDRRKAMLQDIAILTAGTVISEEIGLELEKATLGDMGQAKRVVITKDATTIIDGIGNKS
FT                   AIDSRVAQINQQRDEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALIRVANAIRNLCGDNEDQNVGIKVARRAMEAPLRQIMANA
FT                   GEEPSVIANNVRSGEGNTGYNAATEKYGNMIELGILDPTKVTRSALQYAASIAGLMITT
FT                   ECMVTELPKEDKPDLGGGNPGAGGMGGMM"
FT   gene            79656..80231
FT                   /gene="efp"
FT                   /locus_tag="BVAF_072"
FT   CDS_pept        79656..80231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="BVAF_072"
FT                   /product="elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_072"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33482"
FT                   /db_xref="GOA:E8Q6P1"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6P1"
FT                   /protein_id="ADV33482.1"
FT                   /translation="MIQYGINELRVGLKVIQNQEPCVIISNEGVKPGKGLSFNRIRLKN
FT                   IISGKILDRTLKSGDFLELADVVETQLIYLYRDYNLWYFMHDKNFDQVSIHKNIIGKSD
FT                   KWMKEQWIYFVTFWNSMPILVTPPEIMHFKVVKTDLSIKSSSSTSTSSGNKLAILSTGA
FT                   ILKVPFFIKSGELIKVNTNTGTYISRMK"
FT   gene            complement(80301..83693)
FT                   /gene="yjeP"
FT                   /locus_tag="BVAF_073"
FT   CDS_pept        complement(80301..83693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeP"
FT                   /locus_tag="BVAF_073"
FT                   /product="putative membrane protein/mechanosensitive ion
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_073"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33483"
FT                   /db_xref="GOA:E8Q6P2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6P2"
FT                   /protein_id="ADV33483.1"
FT                   /translation="MGLHKYISKFILAIIYINICACCTFITKASSCNFLNEEKIKKDLQ
FT                   QIEKLDHINNNQKTTINLLKSALYFIAEKKTSNEKINEYQHIINNFSYIILKLQKEYNN
FT                   INEQPTNIYQNLTIQELKQKIFQVNNQLINLSEQLVQEEDQLHSIYEALRLLPQQQVTI
FT                   KHILHNLEQQQILFTNSNIEYAQFISFQAERSANRLKLVELELAQLSSNNRKELIKLKI
FT                   TLIKKKYNYTNNLLKILKNQLTHLRHKEADQTIAYTEKILKEQHDTLPKSIKIQLYMNH
FT                   DLSLLITQQTQDMNNIILRQREIETHISQVNQVFSNLIEQSQWINKSPILGETLRSQVT
FT                   NLPKKPKFQQLDNDMAQLKAKRLQYENYINKIPDLILNSKQDNELELTFIQKSILTKQL
FT                   HTQRELITSLLNNYDNQILELTKLKLLYDQLKDSLQAVQQATHRYLFWTADICPITISY
FT                   PRYVYQDICKLLTNHSFHNQIKSAFYMIVTNQSTLIPMIFCFIISLGLHFGARHYYYKF
FT                   LETTSNYVGKVNQDNFLITFYNIWSTIFIALPIPILWISIGYNLNHTCWLYPIIVSIGN
FT                   GMNATAFMLWIFITSGYFASPKGLFIVHFGWSKKRIQQVFSKNYFWSTTIIIILITSCV
FT                   VFNHYNNREFSNTLGRLCFFILCMYLTYITINLKRSGLPLYLNKHDSSNNIINQSLWNI
FT                   MIIAPIISAISCAIGYLSVAQEILIRLEKSLFIWVLLLITYYIIRRWMLIQRRRIAFKR
FT                   SQENQGIQFITKHYKQSHSKHKLITKERPIIINNHKKFLDLDSISAQSLQLIKSIVTLT
FT                   ALILISLLWSELRFAFSFLENITLWDVKSTIKGIENIQPITLNNFLTVIVVIIITTITV
FT                   RKLPAFLELTLLQYLNFTPSTEYAIITLTKYILMVLGGLTGCSLIGIEWVKIQWLIAAL
FT                   GVGLGFGLQEIFANFISGLMILFEKPIRIGDTITMRNFTGNVTRINIRATILTDWDHKE
FT                   IIVPNKEFITKKFINWSLSDTTTRVILRIPTPIQIDTKKMIQVLMEIIKSSPLSLDTPP
FT                   PEVYLVDFQQGLPILEIRIYTSDIKSRVPLRHQINISIIEYYKNNGLKLPCFPIYICKE
FT                   HMTTVDFPSYNQNTHLNEIKPTY"
FT   gene            complement(83848..84744)
FT                   /gene="psd"
FT                   /locus_tag="BVAF_074"
FT   CDS_pept        complement(83848..84744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BVAF_074"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_074"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33484"
FT                   /db_xref="GOA:E8Q6P3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6P3"
FT                   /protein_id="ADV33484.1"
FT                   /translation="MLEKIQVILQYLLPIRWVNYFAGLIASMKGGWATRYAIKLFIKFY
FT                   NIDLKECSNPNIDDYETFNDFFSREFNIHDRPINRDQNTLIVPADGVISQIGKINDTHL
FT                   FNIKGHSYYLDELLAGHDTIINYFKNGNFCIIYIPPQNCHRVYMPCTGTLRELLYIPGE
FT                   LFSVHPKIFRNIPNILSRNEKIICLFDTNFGYMAQILVGAAIVGSIETTWGGTITPPRT
FT                   GVVKHWHYPPLGSASETDNNEVVVLTKGEEMGAFKLGSTVINLFNNDSVLLNSQLQPND
FT                   IIRIGMSLAQGNNRNNN"
FT   gene            85414..85962
FT                   /gene="orn"
FT                   /locus_tag="BVAF_075"
FT   CDS_pept        85414..85962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="BVAF_075"
FT                   /product="oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_075"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33485"
FT                   /db_xref="GOA:E8Q6P4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6P4"
FT                   /protein_id="ADV33485.1"
FT                   /translation="MDKNLIWIDLEMTGLNPEKDRIIEIATLITDSELNILSTGPNLAI
FT                   NQTELKLSEMDSWNVRTHSANGLLTQVRSSKLNECDASNLTIKFLKNWISFQKSPICGS
FT                   SVAQDRRFLIKYMPKLESYFNHRYLDVSTIKELVMRWRSDLIVGLKVHKKTHRALEDIH
FT                   ESILELAYYRQYFINCGNR"
FT   gene            86106..86178
FT                   /locus_tag="BVAF_076"
FT   tRNA            86106..86178
FT                   /locus_tag="BVAF_076"
FT                   /product="tRNA-Gly"
FT   gene            86630..87127
FT                   /gene="yjeE"
FT                   /locus_tag="BVAF_077"
FT   CDS_pept        86630..87127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeE"
FT                   /locus_tag="BVAF_077"
FT                   /product="putative nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_077"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33486"
FT                   /db_xref="GOA:E8Q6P5"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6P5"
FT                   /protein_id="ADV33486.1"
FT                   /translation="MRQYVLILYNESQTLLLGANLAKVCVLGCIFYLHGNIGSGKTTLC
FT                   RGFLKALGYTKYVKSPTYTLVEFYSLSNKHIYHIDLYRLHSKDELINMGIYDCFDNKSI
FT                   LLIEWPKLEVDCLPNPDISISIDYYKHETYRQVVIVTCSNIGQIIVNTALHAGYFEYEV
FT                   KK"
FT   gene            87111..88475
FT                   /gene="amiB"
FT                   /locus_tag="BVAF_078"
FT   CDS_pept        87111..88475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /locus_tag="BVAF_078"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_078"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33487"
FT                   /db_xref="GOA:E8Q6P6"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6P6"
FT                   /protein_id="ADV33487.1"
FT                   /translation="MKLKNKIIFFILILSKCLFFNIIYASTALHSIYIKNNIRQSTVII
FT                   YCNTTVPEYTVFYLHHPERIVIDLLNIPNVQKKNTFPIACNKNNLIKCVRSNTSVNCNG
FT                   TRIVCDLNHPSYIKVVIQKKIKKNYQVILKIVRKTSIASHLNVRNLYNNIIQRQKSCIT
FT                   TIYSKLMVSNGDTDSVKGINNRNSISLSSSKHYFNNNSGVYHSKSQNQFPIIVAIDAGH
FT                   GGQDPGAIGFHGTYEKNITLSIAKKLKKLLDTDLRFKAVMIRNGDNFVSITDRADLARK
FT                   KRANILISIHTDASVNSKVKGASVWVLSNHRAHIETIHWLKCKEKYAELLGGLGQILNN
FT                   YRNDPYFQYLILDLQFGYTQKAGYNIAMHMLHQLKNVGILHKDIPEYSSFGVLRSPDIP
FT                   SILVETGFISNFKEEKLLITDTYQRKIAQALYMGLRAHFLVLLHQHQQKIMSNHI"
FT   gene            88682..89677
FT                   /gene="miaA"
FT                   /locus_tag="BVAF_079"
FT   CDS_pept        88682..89677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="BVAF_079"
FT                   /product="tRNA dimethylallyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_079"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33488"
FT                   /db_xref="GOA:E8Q6P7"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6P7"
FT                   /protein_id="ADV33488.1"
FT                   /translation="MQQDKKNNIIIKQNISFPLIIFIMGPTASGKTSLVIALKKRKLKI
FT                   KIISVDSALVYKGMNIGTSKPSVSELEIAPHKLIDIRDPSDCYSVSDFYCDVIVEIKKI
FT                   IKSGYVPVLVGGSMLYFKVLLQGLLILPKSDEVIRNNLKCIAQKIGWMNVYRKLQYIDP
FT                   DVSRAIHYNDHKRIIRALEIFLISGKTLTELKSKYRSATCFTSQNRILQFAIMPSSREI
FT                   LHNRIERRFYKMLEIGFENEVRVLFSRSDLHNDKSKAAISCVGYRQMWEYLLGKIEYND
FT                   MIYQSISATKRVAKQQLTWLRSWSDLYWVNSDCISCAVDEVLLILSQQIY"
FT   gene            90243..91529
FT                   /gene="hflX"
FT                   /locus_tag="BVAF_080"
FT   CDS_pept        90243..91529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="BVAF_080"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_080"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33489"
FT                   /db_xref="GOA:E8Q6P8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6P8"
FT                   /protein_id="ADV33489.1"
FT                   /translation="MITVNKINKNAILVYVVLSKSEDIPWNIKELLDLAYSSDIQVLDT
FT                   LLVKNLRIVNSKYFISKGKILELESKIKENLASVVLFSCILSPNQERNLVKLFGCKVID
FT                   RNQLILNIFADRARTYEGKLQVQLAQLRYLNSRLTHEWNHLERQKGGIGVRGGPGEMQL
FT                   ENDRRLLSKRIFRVLSDLKKIENQRKQNRRHRVKIGIPTISLVGYTNVGKSTLFNIMTS
FT                   AHVDTAKKLFVTLDPTFRRIGKRKKSSAILVDTVGFIQNLPKDLITSFKSTLQETVEST
FT                   LLLHVVDVSSNKINQHIKTVNDILREINIKNIPVLLIMNKIDLIDKIEPHIDRNFDGRP
FT                   IRVWLSAHNRVGIDLLNKAIDELLPNNMVSYKLMVPINSSLYQKLYKLQAVTRFYHGNE
FT                   NMAKLKVDLSFEDWNYLTKCHGSLHDYIV"
FT   gene            91579..92901
FT                   /gene="hflK"
FT                   /locus_tag="BVAF_081"
FT   CDS_pept        91579..92901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="BVAF_081"
FT                   /product="HflK protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_081"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33490"
FT                   /db_xref="GOA:E8Q6P9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6P9"
FT                   /protein_id="ADV33490.1"
FT                   /translation="MMCNYFCDGCKCIRKFWYNYMHSNLMINFLIKNKKRLKFNIFDIF
FT                   KYLNKMIYTSNEFTTYNNDDKEFPKNISPLVIVSIIVIVIVLWAMSGFYTIKEAERGVI
FT                   LRFGKYHHLVQPGLNWRPSLIDYVIPVNVESVRELAASGMMLTSDENVVRVEMNVQYKV
FT                   TDPKNYLFSVTNADDSLRQATDSALRGVIGKYNMDRILTEGRTVVRSDTRRILEKTIHP
FT                   YNMGISLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEIQPKANGQAQR
FT                   ILEEGRAYKAKTILEAQGEVQRFLKILPEYKAAPEITRERLYINSMERILSNTRKIFID
FT                   TKNTSNVLLFTSDQINLNNHGKKGGSDLEKNFNSIKQSSKNRSSINMKKNCSEFNSEHN
FT                   LPLYFNYIDNNFAEKQLLGKRQLNVAECVNVIRPGAQGVEL"
FT   gene            92903..93916
FT                   /gene="hflC"
FT                   /locus_tag="BVAF_082"
FT   CDS_pept        92903..93916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="BVAF_082"
FT                   /product="HflC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_082"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33491"
FT                   /db_xref="GOA:E8Q6Q0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Q0"
FT                   /protein_id="ADV33491.1"
FT                   /translation="MIRNLLLCIAICTSMILCFSLFTVQEGHRGIILRFGKVLRDEHKN
FT                   PLIYYPGLHIRIPVIEAVKIFDSRIQTMNNQADRFVTMEKKDLIIDSYIKWRISDLGRY
FT                   YLATGGGDVAQAEVLIKRKFSDRLRSELGKLKVQGIVTDSRNRLMTDVRLSLNYGTDGE
FT                   EMSESLSSDELYSGMYNMSQMKYRNNSDEYMNINSMTALGIEIVDVRIKQINLPTEVSD
FT                   AIYQRMRAERDAVARRHRSQGREESEKLRATADYEATRTLAEAKRQALIIRGEADAETA
FT                   KLYARTFNEDPNFYSLVRTLKAYENSFKRNNNDLMILSSDSDFLRLMRSSKNISIR"
FT   gene            94076..95410
FT                   /gene="purA"
FT                   /locus_tag="BVAF_083"
FT   CDS_pept        94076..95410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="BVAF_083"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_083"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33492"
FT                   /db_xref="GOA:E8Q6Q1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Q1"
FT                   /protein_id="ADV33492.1"
FT                   /translation="MAQNIVVLGTQWGDEGKGKIVDLLTPEARYVVRYQGGHNAGHTIM
FT                   INQKTITLHIIPSGILHEDVINVIAGGVVLSPISFIKEIEKLKELNVYVNERIFISESC
FT                   ALVLPYHVAMDLLREKKISSHITTMHTSTIENLIIGTTGCGIGPAYEDKAARRSLRVSD
FT                   LYNSVSFENKLKHVADYYNFQLEKYYQVEPIDYKVVLDEIMSVSDSLINMITDVPELLV
FT                   NARKEGENVIFEGAQGSLLDLNYGTYPYVTSTNTIAGSVTVGVGVGPNYIDNVIGVIKS
FT                   YSTRVGYGPFPTELVDNIGERLCVNGKEFGSTTGRRRRTGWFDAVLVRYAIKISSITFG
FT                   CLTKIDVLDGLEKIKICVAYQYPDGELTYNFPSTLEKIENVTPVYESLSGWANGAVSGI
FT                   KQFDQLPIEAKNYVKRIEEIIGISINIISTGSDRSMNIILKNPWD"
FT   gene            95652..96398
FT                   /gene="rlmB"
FT                   /gene_synonym="yjfH"
FT                   /locus_tag="BVAF_084"
FT   CDS_pept        95652..96398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /gene_synonym="yjfH"
FT                   /locus_tag="BVAF_084"
FT                   /product="23S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_084"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33493"
FT                   /db_xref="GOA:E8Q6Q2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Q2"
FT                   /protein_id="ADV33493.1"
FT                   /translation="MSELVYGIHAVQSILDKNPSNILRIYILDKSRNSKLEFLFNQGVI
FT                   LKIKIQEKTRRWLNIKSSGSLHQGIIAEVNKVMCLKESDLLQLIQCYNKVPFLLILDGI
FT                   TDPHNLGACLRSADAAGVHMVIAPRNRSASINSTVRKVSSGSADHVAFLRVTNLLRILK
FT                   LLQKYDIWIVGTVEKSDREIFDAKLVGPLALVMGSEGYGMRRVTKENCNEIISIPMCGF
FT                   TSSLNVSVATGICLFEALRQRRNYCR"
FT   gene            96637..97005
FT                   /gene="rpsF"
FT                   /locus_tag="BVAF_085"
FT   CDS_pept        96637..97005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="BVAF_085"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_085"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33494"
FT                   /db_xref="GOA:E8Q6Q3"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Q3"
FT                   /protein_id="ADV33494.1"
FT                   /translation="MRHYEIVLIIHPNFGGKIVNIINNYTEIIISSGGKVHRVENWGDR
FT                   QLAYSIKKLSKAYYVLMNIEVSLNVINELSNDFRFNEVILRNIIMKTKDAKIDPSPMMN
FT                   KKEDSNKNCNVDEIYKTN"
FT   gene            97073..97303
FT                   /gene="rpsR"
FT                   /locus_tag="BVAF_086"
FT   CDS_pept        97073..97303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="BVAF_086"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_086"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33495"
FT                   /db_xref="GOA:E8Q6Q4"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Q4"
FT                   /protein_id="ADV33495.1"
FT                   /translation="MILRYIRHRKFCRFTAEKCTEVDYKDLVKIQSSIIENGKIIPSRI
FT                   TGTRSKYQRQLARAIKIARYLSLLPYTDKHQ"
FT   gene            97365..97862
FT                   /gene="rplI"
FT                   /locus_tag="BVAF_087"
FT   CDS_pept        97365..97862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="BVAF_087"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_087"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33496"
FT                   /db_xref="GOA:E8Q6Q5"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Q5"
FT                   /protein_id="ADV33496.1"
FT                   /translation="MKVILLNSIKKLGLAGDEVVVRSGYARNFLIPQSKAILSTKENIE
FT                   CFKKKKLMFENQFLKKKLEAESCAEMISKLGSITITAKSSIQGKLFGSIGPKDIAKVIS
FT                   ELVGVKIYKSQIRLPDRNPLKFIGNYNINIHIYNKISVTLEVKIINLPLCKKDNNEYDD
FT                   KK"
FT   gene            97870..98652
FT                   /gene="cysQ"
FT                   /locus_tag="BVAF_088"
FT   CDS_pept        97870..98652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="BVAF_088"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_088"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33497"
FT                   /db_xref="GOA:E8Q6Q6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Q6"
FT                   /protein_id="ADV33497.1"
FT                   /translation="MIDQISYIARIAGSEIMKVYSITDRMKINVRKKIDQSFVTNADLF
FT                   SNQIIVSFLQKLTPNIPIISEENLPEWEECKKWNCFWLVDPLDGTKEFLSRNGEFTVNI
FT                   AFVEYGEPVMGVVYVPVYNILYAASNNRAWKVNSIGQLKLLNVISNKLKIYKNPIIVMS
FT                   RSKITDYQQKLLDNYVININNYKIINIGSSFKFCLIAEGIAQFYPRFSYTKIWDTAAGH
FT                   AVAKSAGAFINDWNGYPLNYKYINEYFLNPGFQVSLYL"
FT   gene            98984..100755
FT                   /gene="ytfM"
FT                   /locus_tag="BVAF_089"
FT                   /note="frameshift in poly-A tract; RNA polymerase or
FT                   ribosomal slippage"
FT   CDS_pept        join(98984..99768,99768..100755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="ytfM"
FT                   /locus_tag="BVAF_089"
FT                   /product="surface antigen protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_089"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33498"
FT                   /db_xref="GOA:E8Q6Q7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Q7"
FT                   /protein_id="ADV33498.1"
FT                   /translation="MERIIVIKLLCIMLLVLTPIFSKCEIQIELEGLDSKLELEYNIRK
FT                   KIDHYIARDLDYLGVNLKNEIHDIIKLSLRSAGYYNPKISIVLLPKNIENNKKLNTLII
FT                   KISLGMPIKVIQVNISIYGDGKNDFDYQNIIKDSKLFIGKQLNHHDYEQLKNRLYNLAV
FT                   SKGYLDAKFQKSQLIVIPKLNQSIWNINFFSGCRYIIEELKFQGSQIQETYLKNISNIS
FT                   IGEYYDTKSIMELTRRLSSTNWFCSICTSSNLNSCAKKKKLLLNVLLTPNIKNSFEIGS
FT                   GYSNNTGLRVKIIWKKPWINSYGHSLENSFSISATEQFVDINYKIPLFNNPLEEYYLCQ
FT                   GGWVYENNIYNLQSQVVMLNIARYWKCIDDDWQRVINLYWYINHCFCKNNFIKDIMIIC
FT                   PGININRVKKRGDMIPYWGNSQRYSVNISANYWKSDIDFIIFKAQNIWIRNFFSKNRII
FT                   IKSDLNWVEVNNLSYIIPVFRFFFDKSFGIRGYEYKFVSSFYNSFQYTKSIISTFEYQY
FT                   NICSKLWSAIFIDFGGLGNNINWKKDFKAGFGMGVRWQLPIGPVRLDIAIPLIGLVRIN
FT                   HNLLHFYVNLGPEL"
FT   gene            100761..104711
FT                   /gene="ytfN"
FT                   /locus_tag="BVAF_090"
FT   CDS_pept        100761..104711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytfN"
FT                   /locus_tag="BVAF_090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_090"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33499"
FT                   /db_xref="GOA:E8Q6Q8"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Q8"
FT                   /protein_id="ADV33499.1"
FT                   /translation="MRRMFLILLFGIVVLCGVFVFLFGTTIGTNLIFTSITNRISGLTF
FT                   DSVSGFWGNFNIMRMVYHTPELGVIKVDKCNISVNFKYFLVKKIYINNLLLTDVYIDGR
FT                   ESNLEHVSAENIATNKIFRKILKNYSIILKNIVCNNICIMLDEMEFKFQNINTGCILKN
FT                   NLLRVLPSYISEGFVLYNFFLDDSSNKQTNITLYSAHWIKDLFCIKDVLRNLIDDVLIV
FT                   IRKKYKFSINFVFTDIQGKDFNFFYNCKNRYVINRFQIQFSCIKEVINSKFHINSSLGY
FT                   CNGVANIVLGNRYPVYIVVDYYHYAYLKNLNDDQLEQKDLGKIKLMITGSLIDELCVDC
FT                   DILNIISSTVHILMKIKLKNPTTPIRLLVIGRKIPMFSLGSNKLIFENFNFFLIGNTRN
FT                   YSIQMHSNLVCSKIAVRYVSMRAQGNSNSCTISELKIKMLNGYCKMIGTIKWGGDRISW
FT                   NNIYSFNDVNVNQYLKYSTKELSKKIITQDFVNFNVQRLAVLSYPYLQVCRDGSISNDN
FT                   IIIHNKSVLTERINNRCNISTFILESPLGSDKKGGDNILDLQVRGTHQSRIFGVALEVD
FT                   MINCSIFSSGLSGNLSIYFGLHGTINSPFILLHIHAQSLNWRSKNISIEKIQINSNINY
FT                   DALMQSNFFIKLDKVQCRKFALNELLVQGMGDIVRHSLRIILYDKELVGIVNLNGEFDL
FT                   VNPSWNGRLINTIFFTPIGTWKLINDMIFSYQYTSHKFVFKAHCWESNFCQVSITDRLQ
FT                   RSFLKKISVIINNFNFIFLDLKLIKNVNIYNMRLYFKDVYWNFGEVLPQGSIVYSITRL
FT                   DMLFCDKENIDFYHIKVNDLICHTTFTATSFSCVSSAEIENDKSYLKFSITDLYNTPKI
FT                   SGNIRLDDMKVGSFFYLLFQSKEYINGLINMNLNFKGYLNSPKFYGMIQFKNCDFNQSN
FT                   FPFVVQDVFLQINFFGNYAILNGVIQTEHGGQLYLDGKLNSLNSFKNIHLVLNIKGEQI
FT                   NVRISSPSLYAKISTNLICKITTKGIDLTGRIDVPWAKIEFQEFSRNAIEISSEEILLD
FT                   SSCLRPTLVNKSKNFGIFTISSIFIHLGHDVHFNGLGLYTKLQGDLEISYTNNSNDLLV
FT                   LGHVKMLSGYFKAYGINLIIKQGQVLFSGAVNQAYLDIEAVKSASFILNSKDPVTVGIH
FT                   ITGVVDQLKLEFLSNSVLLSQQEIASYLLGEYNTTLSKLNTIGNNTITSLLIGMGIERY
FT                   EKFIGKIGRVLGVQDLTINTQDFIGGGYTKSSVVALSGYIAPGLQIKYGISIVDLLTTV
FT                   TVRYCINHQLYLEATSRGHDQALDLLYKFNFG"
FT   gene            complement(104774..105325)
FT                   /gene="ppa"
FT                   /locus_tag="BVAF_091"
FT   CDS_pept        complement(104774..105325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="BVAF_091"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_091"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33500"
FT                   /db_xref="GOA:E8Q6Q9"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Q9"
FT                   /protein_id="ADV33500.1"
FT                   /translation="MTLQQVLAGNNIPEDIYVIIEIPAHSSPIKYEIDKETGVVFVDRF
FT                   ISTPMFYPCNYGYINNTLSLDGDAIDVLVPTPYPLLIGSVINCKPIGMLDMIDEEGEDY
FT                   KIIAVPNNKISNQYHLIQDIDQCPTFLREQICYFFQHYKDLTANKWVTIREWKNADSAK
FT                   TEILNAYQRSIIKNKRHQLK"
FT   gene            complement(105532..106506)
FT                   /gene="ispB"
FT                   /locus_tag="BVAF_092"
FT   CDS_pept        complement(105532..106506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="BVAF_092"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_092"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33501"
FT                   /db_xref="GOA:E8Q6R0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6R0"
FT                   /protein_id="ADV33501.1"
FT                   /translation="MNINQINKLIQQDIINVNFEIHKRLKSKITLINKLIQYIINSGGK
FT                   KIRSSMVLLIAKSLTYKKNQHVIIATLIEFIHAATLLHDDVVDTSEMRRGKITANIMFG
FT                   NAASVLVGDFIYTRAFQMMTELQSLRILSLMANAVNIIAEGEIMQLIHCHDPTITINHY
FT                   MKIIYNKTARLFEVASQTSAILANADIKQEQALGNYGKYIGIAFQLIDDVLDYDTSNTI
FT                   LFGKHTGNDLNEGKPTLPLLHAIHHSTPKEASIIRQAIKNGNNRHLLNIILNTMQQYGS
FT                   LEYTRKCAETKINQAISCLSILPASPYKKALKNLAYFIIHRYH"
FT   gene            106658..106972
FT                   /gene="rplU"
FT                   /locus_tag="BVAF_093"
FT   CDS_pept        106658..106972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BVAF_093"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_093"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33502"
FT                   /db_xref="GOA:E8Q6R1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6R1"
FT                   /protein_id="ADV33502.1"
FT                   /translation="MYAVFQIGSKQYYVCAGEIIYIDRMIANIGSRIEFNQVLFIKDND
FT                   CIQIGNPFINSGKVVAQIICHDRCKKIKIIKFRRRKHFRKSQGHRQHITKIKILNIQSS
FT                   "
FT   gene            107029..107289
FT                   /gene="rpmA"
FT                   /locus_tag="BVAF_094"
FT   CDS_pept        107029..107289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="BVAF_094"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_094"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33503"
FT                   /db_xref="GOA:E8Q6R2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6R2"
FT                   /protein_id="ADV33503.1"
FT                   /translation="MAHKKAGGSTRNGRDSKGKRLGIKHFSGEFVSSGSIIVRQRGSKF
FT                   HPGQYVGCGRDYTLFALKSGKVLFEKKKKLNRRLVSIIYLS"
FT   gene            107569..108654
FT                   /gene="obgE"
FT                   /gene_synonym="yhbZ"
FT                   /locus_tag="BVAF_095"
FT   CDS_pept        107569..108654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obgE"
FT                   /gene_synonym="yhbZ"
FT                   /locus_tag="BVAF_095"
FT                   /product="GTPase obgE/cgtA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_095"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33504"
FT                   /db_xref="GOA:E8Q6R3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6R3"
FT                   /protein_id="ADV33504.1"
FT                   /translation="MKFVDVVNITVIAGTGGNGCISFIKIGRNKFFRKPNGSNGGDGGN
FT                   VWLLSDSNIKTLSYFSSHRIFKAGNGVSGRSRGRSGKRGKDMIIHVPVGTRVSCLKTNA
FT                   LLGDMINQKNGTLLLVARGGRHGVGNNGVKFLRNKHYKNNSNILCWDRVQGRSGEIQHL
FT                   LLDLFLVADVGVFGLPNSGKSSFVSMVSQAKSKVADYPFTTLTPKLGVVQVEDKSVVNN
FT                   SSFVIEDVPGIIKGASTGSGLGLRFLKHLQRCQMLLHFVDINPADKSDPVKNIIDIEQE
FT                   LKAYDRRLIDKTRWLVFNKIDLLDEFKLEDRINSIIRSVQWNSRYYAISVTHKINISLL
FT                   CWDIVQFINKDGFIESANSKV"
FT   gene            108861..109343
FT                   /gene="greA"
FT                   /locus_tag="BVAF_096"
FT   CDS_pept        108861..109343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="BVAF_096"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_096"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33505"
FT                   /db_xref="GOA:E8Q6R4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6R4"
FT                   /protein_id="ADV33505.1"
FT                   /translation="MKKFPMTLRGVEQLREKLDYLKNVLRPIITKSISEARRHGDLKEN
FT                   AEYHAAREQQGFCEGRIREIEYKLSNVYIVDVTKVISDKKVVFGVTVCIENVITQCKKI
FT                   YRIVGDDESNLKKNMISISSPIAQGLIGHKEGDIVLISTPNGKIEYRIVKIEYLEE"
FT   gene            109664..110317
FT                   /gene="rlmE"
FT                   /gene_synonym="ftsJ"
FT                   /gene_synonym="rrmJ"
FT                   /locus_tag="BVAF_097"
FT   CDS_pept        109664..110317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmE"
FT                   /gene_synonym="ftsJ"
FT                   /gene_synonym="rrmJ"
FT                   /locus_tag="BVAF_097"
FT                   /product="ribosomal RNA large subunit methyltransferase,
FT                   ftsJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_097"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33506"
FT                   /db_xref="GOA:E8Q6R5"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6R5"
FT                   /protein_id="ADV33506.1"
FT                   /translation="MLNKKCFTRTFKWSKKYYIDKYSNEAKVRKLRSRSWFKLQFIDQI
FT                   DVLFKKGTTVIDLGSAPGGWSIYAANKINNTGYIMACDILPMKTIYGVDFVQGNCADLK
FT                   VINKICCWAKDKKVQVILSDMSPKTTGISVIDVYNSIHLGNIALNICKYVLVFEGSFVV
FT                   KIFQGKGFEQYLHNVKSLFFDVKIRKPSSSRCNSREVYIVAKKFKYKYDMINIL"
FT   gene            110378..112315
FT                   /gene="ftsH"
FT                   /gene_synonym="hflB"
FT                   /locus_tag="BVAF_098"
FT   CDS_pept        110378..112315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /gene_synonym="hflB"
FT                   /locus_tag="BVAF_098"
FT                   /product="cell division protease ftsH"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_098"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33507"
FT                   /db_xref="GOA:E8Q6R6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6R6"
FT                   /protein_id="ADV33507.1"
FT                   /translation="MSDMVKNLILWLAIAVVLISLFQNFGDNNSSNRKVDYSTFMYELN
FT                   QDQIKETRINGREIIVIKKDSSRYITYIPVNDPKLLDFLLEKKVKVVGEPPEEPSLIAS
FT                   ILISWFPMLLLIGVWIFFMRQMQGGGKGAMSFGKSKARMLNENQIKTTFADVAGCDEAK
FT                   EEVKELVDYLREPNKFKKLGGKIPKGILMVGPPGTGKTLLAKAIAGESKVPFFTISGSD
FT                   FVEMFVGVGASRVRDMFEQAKKSAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQML
FT                   VEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVIVGLPDIRGREQILKVHIKVV
FT                   PLSPDVNISVIARGTPGFSGADLANLVNEAALFAARETKNSVSMAEFEKAKDKIMMGAE
FT                   RRSMVMTEIQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEVDALS
FT                   MSKQKLESQISTLYGGRLAEEIIYGVNRVSTGSSNDIKVATSIARNMVTQWGFSEKLGP
FT                   LLYAEEEEEIFLGRSVAKAKNVSDETARIIDQEIKLLIEKNYLRARTLLIENIDILHAM
FT                   KDALIKYETINASQIDDLMGRKITQDLLHDADNIKKIKNDKVDNIYPDTPEESKSISKK
FT                   SYNNNPNVVS"
FT   gene            112444..113280
FT                   /gene="folP"
FT                   /locus_tag="BVAF_099"
FT   CDS_pept        112444..113280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BVAF_099"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_099"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33508"
FT                   /db_xref="GOA:E8Q6R7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6R7"
FT                   /protein_id="ADV33508.1"
FT                   /translation="MKLVANERVLDLSYTQIMGILNVTPDSFFDGGLYNTVPKSIDHVD
FT                   KMISNGATLIDIGGESTRPGSKRISDEEELERVLPVIQAIVNRFDIFISVNTSSALVIK
FT                   ESAQLGVHLINDVRSLADVEAMKAAKYSNLPICLMHMQGSPDTMQKLPSYHNVVHEVFD
FT                   YFKDQITRCQLAGINKTRLLLDPGFGFGKSFQHNYQLLSNLKYFHHFNLPLLIGISRKS
FT                   MLHCNNNTYCVKNRLAGSIACAVIASIQKVQIIRVHDVKETMEALRIVKIVQEERL"
FT   gene            113300..114661
FT                   /gene="glmM"
FT                   /locus_tag="BVAF_100"
FT   CDS_pept        113300..114661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BVAF_100"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_100"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33509"
FT                   /db_xref="GOA:E8Q6R8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6R8"
FT                   /protein_id="ADV33509.1"
FT                   /translation="MNQLKYFGTDGIRGRVGFSPITPDFMLKLGWAVGKVLGYRSTKRS
FT                   KQVIIGKDTRISGYMLESALESGLAAAGLSASLTGPMPTPAIAYLTRTFRAEVGIVISA
FT                   SHNPFYDNGIKFFSIKGTKLDDYVERSIEIELKKCLTCAEPQLLGKASRIADAVGRYIE
FT                   FCKSTFPTFLSLKKLKIVVDCANGATYHIAPNVFRELGADVIPIFCQPNGININKKCGT
FT                   MDISQLKTKVLSKKADLGIAYDGDGDRVIMVDHIGNTVNGDQMLYILAREYLYSKKLDG
FT                   GIVGTLMSNMGLVIALKQLNIPFVRANIGDRSVLSMLKKKGWYIGGENSGHIILLNKTT
FT                   TGDGIIVALQILSTMIMNRVSLYELCRNIHLLPQILINVYCFGLSNLLKSHLVKKEVQV
FT                   VKKELLDQGRILLRQSGTEPYIRIMVEGNRYSKILCLAKRIASVIKEEINKVKN"
FT   gene            114731..115027
FT                   /gene="secG"
FT                   /locus_tag="BVAF_101"
FT   CDS_pept        114731..115027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="BVAF_101"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_101"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33510"
FT                   /db_xref="GOA:E8Q6R9"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6R9"
FT                   /protein_id="ADV33510.1"
FT                   /translation="MYQFFLVTFVIIAIILIILIMLQQNNGNSMGGGFDYRSLGDMLNS
FT                   GSFNDNITRVIVILAILFFVFSLVLGNMNSKCNDHVYFQNDSNKHKDENDIHK"
FT   gene            115193..115281
FT                   /locus_tag="BVAF_102"
FT   tRNA            115193..115281
FT                   /locus_tag="BVAF_102"
FT                   /product="tRNA-Leu"
FT   gene            115349..115425
FT                   /locus_tag="BVAF_103"
FT   tRNA            115349..115425
FT                   /locus_tag="BVAF_103"
FT                   /product="tRNA-Met"
FT   gene            115846..117369
FT                   /gene="nusA"
FT                   /locus_tag="BVAF_104"
FT   CDS_pept        115846..117369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="BVAF_104"
FT                   /product="transcription elongation protein nusA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_104"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33511"
FT                   /db_xref="GOA:E8Q6S0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6S0"
FT                   /protein_id="ADV33511.1"
FT                   /translation="MNKEILFVVEAVSNEKSVPKEKIFLALESALITATKKQYQQDIDI
FT                   RVTIDRKSGKICTFRRWIVVDQVVHPTKEITLEAARLENSKISINDYIEDIVESVGFDR
FT                   ITTQTAKQVIIQKLREAERMIIIEQFLNRQGSIITGVIKKINRNAIHVDLGNNAEGIIK
FT                   REDMLPRENFRLGDRIRGILCLVKPESKGHQLFISRTCTEMLIELFRIEVPEIGEEVIT
FT                   VKSAARDPGSRSKIAVKTNDKRIDPIGACVGMRGARVQAVSSELGGERIDVILWDDNPV
FT                   QFVINAMSPADVVSIIVDEDKHSMDISVDESNLAQAIGRNGQNIRLVSQLSGWALNVMT
FT                   THELEKKRQSELYNTINIFVHVLNIDEKSARVLIDSGFSSLEELAYVPITELLSIGGVF
FT                   DIKTVELLRSKAKQALTNFTESGGSIGSMHKSNQDNCDSVNAVSELLKLSGLKYEIALK
FT                   LVEHGIYTLQDLAEQDILSLSEIKELTTKEIGDLIMEARNICWFNRNNK"
FT   gene            117430..120159
FT                   /gene="infB"
FT                   /locus_tag="BVAF_105"
FT   CDS_pept        117430..120159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="BVAF_105"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_105"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33512"
FT                   /db_xref="GOA:E8Q6S1"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6S1"
FT                   /protein_id="ADV33512.1"
FT                   /translation="MTIQTFAIEMQMSVDRLIQQFLDAGITKTAFDFVTKKEREILFKH
FT                   MNCNKIAVFNKLSLQRKIRSTLNVSSMDGKNKKIQIEVRKKRVYMVKCSIQDSYSVAQS
FT                   HILLQNKKKNNNLKHDDSELVVECNLKNSKSMPVYANNIDISVFTPKSVVEEDCSSAMR
FT                   VLCPTEKKLETKICCVVDHKTQKLENIRKQKGPLDSKGNKFNYDQDLNNVLEIKKNISD
FT                   NFHKVIPSNEVIQDNSNKLENDRRSNGNKIRLRYKNLGKVIKHKRYCKSKSYIDIMNES
FT                   EKEEKLCVSTTTYRVNKNKRKKSILLQSFNKPVDMISRDVVIGETISVSELSNKISVKS
FT                   SYMIKVMMKLGLSITINQVLDQETAQLIVEEMGHRAILRRENELEELVMHHGDLNQISD
FT                   SSVSSINKMVYKNRAPIVTIMGHVDHGKTSLLDCIRSTTITSSEVGGITQSIGAYCVNT
FT                   ANGGMITFLDTPGHEAFTRMRAQGVKLTDIVVLVVAADDGVMPQTIESINHIHNANVPV
FT                   IVAINKIDKSKINIDRIKQELNNYNLIPEEWGGHTQFVNISAMLKIGINDLIDSILLQS
FT                   EMLELKTVHYGMAKAVVIDSFLDKSRGPVASVLVREGELKCGNIILCGSEYGRVKAMRN
FT                   SFGRLIESAGPSIPVELLGLSGTPVSGETLVVVSNEKKAKEVALYRKEKKREIKLSSNL
FT                   EQSTLKNIFNNINSTSKVSELNFIVKSDTDGAAEVICESLKKLVVNGILMKIVSVSIGN
FT                   ITETDAVLASASKAIILAFNIKADIAARNIIESHHIDVRYYAVIYDLLNSVQQLICSKL
FT                   TPKHKYEIIGLAKVRNIFKSPKNGIIAGCLVTQGVMKSHKKVKIIRNDVVIHEGELESL
FT                   RHFKNDVNEIRSGVECGVGIKNYNDICAGDVIEVLDIK"
FT   gene            120342..120710
FT                   /gene="rbfA"
FT                   /locus_tag="BVAF_106"
FT   CDS_pept        120342..120710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="BVAF_106"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_106"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33513"
FT                   /db_xref="GOA:E8Q6S2"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6S2"
FT                   /protein_id="ADV33513.1"
FT                   /translation="MYTRRSNRIQRISQEIQRKISVIIQQKVHDPRIGVPTISGVQVSK
FT                   DLRYAKVFITFLDKNSSEEINSAIAILQKASCFIRFLLARSVNFRIIPILSFKYDSSLM
FT                   VGLRVGDLVSQLNKKNYI"
FT   gene            120739..121497
FT                   /gene="truB"
FT                   /locus_tag="BVAF_107"
FT   CDS_pept        120739..121497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="BVAF_107"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_107"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33514"
FT                   /db_xref="GOA:E8Q6S3"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6S3"
FT                   /protein_id="ADV33514.1"
FT                   /translation="MKRYLNLSKRQIHGILFLDKPSGFSCNFVLNKIKSFFYVKKIGYA
FT                   GTLDPLATGMLPICFGKSTKFATYLSNSDKRYLVSAKLGESTDTFDSDGVIIRVSTVQC
FT                   SEKKIENCLSSFVGKSYQIPPMFSAVKYHGVPLYKYARKGICVFRKPREIYVYSLSCIN
FT                   KIDNIIDLDIYCSKGTYIRSIIHDIGECLGCGAHVIRLRRLMISQYVPDFMIKIKTIED
FT                   IFYNTVLNDTEVLNNLDKLLVAQENLDRFK"
FT   gene            121767..122036
FT                   /gene="rpsO"
FT                   /locus_tag="BVAF_108"
FT   CDS_pept        121767..122036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="BVAF_108"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_108"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33515"
FT                   /db_xref="GOA:E8Q6S4"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6S4"
FT                   /protein_id="ADV33515.1"
FT                   /translation="MSYNMKKKSEIILKFGHNIKNTGITEVQVALLTDRINHLKCHFDK
FT                   NRNDHHSRYGLLKLVAQRRKLLKYLRNNSIFRYNNLIKILELRH"
FT   gene            122235..124328
FT                   /gene="pnp"
FT                   /locus_tag="BVAF_109"
FT   CDS_pept        122235..124328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="BVAF_109"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_109"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33516"
FT                   /db_xref="GOA:E8Q6S5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6S5"
FT                   /protein_id="ADV33516.1"
FT                   /translation="MINSTIYKFQYGKHTIILDTGTIARQANASVMVSMDDTTVLVTVV
FT                   GSDQVKIDQDFFPLVVNYQERTYAAGKFPGGFFRREGRPSESEILTARLIDRPIRPLFP
FT                   KGFYNDVQIIATVVSVNPQISPDIVAIIGASAALSLSDIPFLGPIGVARVGYINNQYVL
FT                   NPTISELANSKLDLVISGTESNILMVESESSLLSEKEILNAIIFGHEQQQIVIHNINKL
FT                   VQEIGKSKFIWKRKELDLSLQKYLSDLYESRLNCISIVRDRKGRQIQLNNIKQDVIDFS
FT                   CIKYSNTMNGNEIMYFLNYLEVQLLRQYILKNNLRLDGRSQDMIREIDIKIGVLPRTHG
FT                   SALFTRGETQALVAVTLGTERNAQNLDELTGDRVDRFLMHYNFNPYCVGEIGIVGAPKR
FT                   REIGHGRLAKRGMLAVMPDSNEFPYTIRVVSEITESNGSSSMASICGASLALMDAGVPI
FT                   KESVAGVAMGLIKEENEFVVLSDIISDEDHIGDMDFKVAGGKQGITALQMDIKINGITY
FT                   EIIHVALEKSKLARLKILNFMEQVIKIPRKNISEFAPRIYNIKINPDKIKDVIGKGGSV
FT                   IRALTEETNTIIDIEDDGLIKIVSLNAEKAKQAMSRIQEITANIAIGSVYTGKVTHIVE
FT                   FGAFITIFSGKEGLLHISQISEKRIGKVSDYLKLGQEVLVKVLDIDRQGRIRLSMRGIN
FT                   HMK"
FT   gene            124587..126440
FT                   /gene="deaD"
FT                   /locus_tag="BVAF_110"
FT   CDS_pept        124587..126440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="BVAF_110"
FT                   /product="cold-shock DEAD box protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_110"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33517"
FT                   /db_xref="GOA:E8Q5M0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5M0"
FT                   /protein_id="ADV33517.1"
FT                   /translation="MFQSESSFSNLGLNACLISMLKKVGYKKPLPIQEKCIPLLLKGHD
FT                   ILGIAHTGSGKTAAFLLPLLQSININTASTQGLIITPTRELAIQIGQVCIDFIKYISGI
FT                   SVAILYGGQNYNIQLNDLRKNPHIIVGTPGRLLDHLNRGTANISKLKILIIDEADEMLR
FT                   MGFIEDVKLIVNKVPVDRQTACFSATFPENIKKISYKFMNTPKEVCICNIDIHPPDIKQ
FT                   NFWLVKRGMITKHEALIRFLEIEDYDAAIVFVRTKSETLRISEILENFGYNSAALNGDM
FT                   NQSIRQKTVSRLKYGTLDILISTDVAARGLDIQRISLVINYDVPNNYNSYIHRIGRTGR
FT                   AGRIGKSLLFVERQEYNLLNSIKRGEKFNISEVQCPTSHDLINSRLMKFSNKVAQYLHS
FT                   DDLLIYRSLLTRIKPDKQSVTMENLAAVLLKIAQGNRPLVLPYETAIVKNKVMCVQGQN
FT                   MSNIKNKYNGGNMSVNRSKNFGQKRCYGGGVVGGNNKHDKKNVDTINIVNSIGLYRVSI
FT                   GRNDGVKIKHIIQAILSKINVDYFNIGDVKLFDSYSIIEIYRTNVINKKIINFALSSCI
FT                   EILNKKVQIKYLGNISADRSNKSYFKKLCPMKFNSSKKKFL"
FT   gene            126652..127071
FT                   /gene="holD"
FT                   /locus_tag="BVAF_111"
FT   CDS_pept        126652..127071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holD"
FT                   /locus_tag="BVAF_111"
FT                   /product="DNA polymerase III, psi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_111"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33518"
FT                   /db_xref="GOA:E8Q5M1"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="InterPro:IPR036654"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5M1"
FT                   /protein_id="ADV33518.1"
FT                   /translation="MQTSWSVISRIMGINIWQLRYPVLLTNTEPVYFLLVKLRLLIISD
FT                   VVVCIDDLFIKDVFRAMSIHCSEVYILTVDRLNRLFLPKTFLSYCWWMGVEALCDFRCI
FT                   TFCTTSLEILKNDADSKRVLWDQICRFMYASKYYA"
FT   gene            127759..130209
FT                   /gene="thrA"
FT                   /locus_tag="BVAF_112"
FT   CDS_pept        127759..130209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="BVAF_112"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase 1"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_112"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33519"
FT                   /db_xref="GOA:E8Q5M2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5M2"
FT                   /protein_id="ADV33519.1"
FT                   /translation="MRVLKFGGTSLSNAQQFMCVANIINKNSKKEQIAVVLSAPATITN
FT                   YLVLAIDNTLHGLDVLKSIYSIKNFFITLIKDITQIQSEFNSSVLNSILEKEFDRLKKL
FT                   LYGVSLLNFCPDNINADIICLGEKLSVVLMKEILTTQNLKVIVLDPVKVIVTRGGYSTS
FT                   IVNIEESTQRIQSISIACDEIVLMAGFTGGNKYGELVTLGRNGSDYSAAILSACLRANL
FT                   CEIWTDVDGIYTCDPHQVPDAKLLRTLSYTEAMELSYFGAKILHPRTIVPIAQFHIPCL
FT                   IKNIFNPDGSGTLIGSSDNITTNIVKGITYLKNMVMLNISGPGMKGMIGMAARVFASMS
FT                   RAECSVVLITQSSSEYSISLCVPNQECEKACDALNEEFHLELKNRLLEPIDSVLDLAII
FT                   SVVGDGMRTQLGLAGKLFGALARANVNIIAITQGSSERSISVVVKNNVTAIGVKTVHQV
FT                   LFSTDQVIDAFIIGVGGVGNALIKQIYKQYFWLKNKRIDLRVCGIINSQIMFINMDGID
FT                   LNHWKSLLMQSQELCDLKKLITIIQKYHLLNPVIVDCTSSLQVANCYVDFLLGGCHVIA
FT                   PNKKANTGSMEYYKKLRSAVTASRRKFLYDTNVGAGLPVIENLQNLLSAGDELIRFSGI
FT                   LSGSLSYIFGKIDEGLSLSKAILLAKENGYTEPDPRDDLSGVDVARKLLVLAREVGYEL
FT                   ELKDIYIEPVIPNNILYNNFHSINDFFKRLSSLDNYFICKINEAKKLGRVLRYIGNIQK
FT                   GECCVKIEFVDHNHPLCKVKDGENALAFFTQYYQPLPLILRGYGAGNNVTAAGVFADLL
FT                   RTLS"
FT   gene            130255..131193
FT                   /gene="thrB"
FT                   /locus_tag="BVAF_113"
FT   CDS_pept        130255..131193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="BVAF_113"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_113"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33520"
FT                   /db_xref="GOA:E8Q5M3"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5M3"
FT                   /protein_id="ADV33520.1"
FT                   /translation="MIRVYAPASIGNIGVGFDTLGIAITPINGDLLGDCVSVEKSDNFI
FT                   IKNIGLFYDQLPIELEKNIVFQCWKRFCEYLCKKYPPVMITLEKNVPVSSGLGSSACSI
FT                   VATLIAINHYYGCPLDNEQLFKLMGEIEGKISGSIHLDNIAPCFLGGMRISLVVYDNIN
FT                   QLIPSFDNWIWVIAYPGIKVSTEMSRSVLPDKYSRKDCITHSQYLSGFIHASHTNQESL
FT                   AIKCMKDIIAEPYRDKLLPVNLSVIKKSLREKGAVSCGISGSGPTIFALCNVAHVVNDV
FT                   FDCLSDLYIKNNLGFVKVCVLSKLGARILLE"
FT   gene            131197..132522
FT                   /gene="thrC"
FT                   /locus_tag="BVAF_114"
FT   CDS_pept        131197..132522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="BVAF_114"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_114"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33521"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5M4"
FT                   /protein_id="ADV33521.1"
FT                   /translation="MKLLYNIKHSKEKVSFSEALIRGLGKNQGLFFPINLPKFSSSEID
FT                   TLLKMNFIERSAYILSKYIGAELLYENILTCVKNAFTFPVPLVFIKKNIAILELFHGPT
FT                   LAFKDFGSRLMASMLMNQVKEGYKLIKTKPLVILTATSGDTGAAVAHAFYGLKNIHVFI
FT                   LYPKDKISILQEKSFCTLGGNITTISVDGDFDICQSLVKQSFEDDFLKKKLHLNSANSI
FT                   NISRLLAQVCYYFEALSQISERIRATNKLVISVPSGNFGNLTAGLLAQSSGLPVQCFII
FT                   ATNLNDTVPRFLQSGIWNPLPTLSTLSNAMDVSCPSNWSRIEELFRREKRSFDELKYGC
FT                   VNDELTKDTINKLSKLGYIADPHTAVAYQVLCDQLNCGEFGICLGTAHPAKFKKLIEFV
FT                   LDKKVNVLLPDVLKNQIKLPILSYRISGCFSKLRDLICSIVL"
FT   gene            132855..134795
FT                   /gene="dnaK"
FT                   /locus_tag="BVAF_115"
FT   CDS_pept        132855..134795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="BVAF_115"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_115"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33522"
FT                   /db_xref="GOA:E8Q5M5"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5M5"
FT                   /protein_id="ADV33522.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIIDGNKPRVLENSEGDRTTPSVIAYTQD
FT                   GEILVGQPAKRQSVTNPKNTLFAIKRLIGRRFQDKEVQRDVNIMPYKIISANNGDAWID
FT                   IKGQKIAPPQISAEILKKMKKTAEDYLGSQVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKATKGNRIIAVYDLGGGTFDISIIEIDDVDGEKTFEVLAT
FT                   NGDTHLGGEDFDSLLINYLVDEFKKDQSINLYNDPLAMQRLKESAEKAKIELSTSQQTD
FT                   VNLPYITADNTGPKHMNLRVTRAKLESLVEDLVTRTMDPLKLALKDANLSVADINDVIL
FT                   VGGQTRMPLVQKKVSEFFNKDPRKDVNPDEAVAIGAAVQGGVLSGDVKDVLLLDVTPLS
FT                   LGIETMGGVMTPLISKNTTIPTKHSQVFSTAEDNQAAVTIHVLQGERKRANDNKSLGQF
FT                   NLDGIAPAMRGIPQIEVTFDIDADGILHVSAKDKNSGREQQITIKASSGLNEEEIKKMV
FT                   QEAEVNAEFDRKFEELVQIRNQADHLLHSTRKQLKELGDRLSIDDKTAINNALKELELV
FT                   MKNENKGEIETKVQDLIKVSGKLLEASSQKSKESNATNQSKNTSDNNATTSSDAHGDVV
FT                   DAEFEEIRNKK"
FT   gene            135024..136157
FT                   /gene="dnaJ"
FT                   /locus_tag="BVAF_116"
FT   CDS_pept        135024..136157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="BVAF_116"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_116"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33523"
FT                   /db_xref="GOA:E8Q5M6"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5M6"
FT                   /protein_id="ADV33523.1"
FT                   /translation="MVKSDYYEILGIARNANDREIKKSYKRLAMKFHPDRNPGSASAET
FT                   KFKEIKEAYEVLSNPEKRAAYDQYGHAVFEQSGGMGSGSNSGGSDFGDIFGDVFGDIFG
FT                   GNRRNRSSRGSDLRYDMELTLEEAVRGVIKEIFVPTLLTCAQCRGSGARSSSSIITCMT
FT                   CRGQGQIQMRQGFFSVQQSCPSCRGHGKIVKEICGVCRGNGRVERTKTLSVKIPAGISA
FT                   GDRIRLSGEGESGKYGASAGDLYVQVQIKKHPIFDREEKNLYCEVPISFSMAALGGEIE
FT                   VPTLDGRVKLKIPPETQTGKLFRMRGKGVKSVRSGSCGDLLCKVVVETPVRLNDRQKKL
FT                   LQDLSDSFNAPGGHKNSPRSKNFFEGVRKFFDDLTRS"
FT   gene            complement(136239..136505)
FT                   /gene="rpsT"
FT                   /locus_tag="BVAF_117"
FT   CDS_pept        complement(136239..136505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="BVAF_117"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_117"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33524"
FT                   /db_xref="GOA:E8Q5M7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5M7"
FT                   /protein_id="ADV33524.1"
FT                   /translation="MANIKSSKKSIKKSKNRRTNNISKKSMLRTFIKKVKKAINNKNKA
FT                   LAINQFIIMQKCIDRQSTKGLIHRNKAARYKSKIFKQIKTLTP"
FT   gene            136742..137687
FT                   /gene="ribF"
FT                   /locus_tag="BVAF_118"
FT                   /note="frameshift in poly-A tract; RNA polymerase or
FT                   ribosomal slippage"
FT   CDS_pept        join(136742..136870,136869..137687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="ribF"
FT                   /locus_tag="BVAF_118"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_118"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33525"
FT                   /db_xref="GOA:E8Q5M8"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5M8"
FT                   /protein_id="ADV33525.1"
FT                   /translation="MELIRGLHNIKPYHKGCILAMGNFDGFHRGHQLLINILCEKKKNY
FT                   KLPIMVMIFEPHPREFFSKIVRIRLSKFRDKIQYLFTAGVDIILCIAFNKKFASTEAYN
FT                   FVKKILIYKLGVQFICIGNDFRFGACRKGDYKFLKKIGNQEGFQVACIETCVDKLGQKI
FT                   SSTSIKIALMEDRIMDAEFLMGHAYRVFGKVIHGNKLGRIIGFPTANVFLQGKQLPMNG
FT                   VYAVTVYGVCDLPLPGIANIGIRPTITGSSIQQLEVHIFNISIDLYLRYITVVFLKKIR
FT                   NEQYFRSIRMLKNQIKNDMLIVCEYFKKYPNIMR"
FT   gene            137699..140554
FT                   /gene="ileS"
FT                   /locus_tag="BVAF_119"
FT   CDS_pept        137699..140554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="BVAF_119"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_119"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33526"
FT                   /db_xref="GOA:E8Q5M9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5M9"
FT                   /protein_id="ADV33526.1"
FT                   /translation="MINYKNTLNLPHTEFPMRANLPDSEIKILKDWYENNLYEIIRIKK
FT                   NKKKLFLLHDGPPYANGQIHLGHAINKILKDIILKFKGLSGYNAPYIPGWDCHGLPIEL
FT                   KVEQLIKKTGSYNNIDFKEFCSICRKYALEQIEIQKRDFIRLGVLGDWTHPYLTMDFKI
FT                   EANIIRTLRKIISNGYLYRGIKPVYWCTQCCSVLANSEVEYYHNHCSNAVYVGFVVANN
FT                   TCINKIFNTNVYESKVELIIWTTNLWTLPANQAISVHPDYIYQLIKTIDGKHIIIAAEL
FT                   VNVFMKCVQCISWVILGQILGGALEYLKVKHPFMLFNVPIILSKHITLNSGTGIVHIAP
FT                   NHGIDDYFVFKKYKLKSNINSIVDEKGYYVCNIHPDLNKLNIFESNSIIIQLLRQSRNF
FT                   LHVNFNYQHSYPYCWRHKTPLIFRITSQWFLDMDHMNLREKLLKESQKVVWIPSKGYTN
FT                   MQSMIINRPDWCLSRQRVWGIPIPIFVHKKTEDFHPNTLEFLEKIAKLVENNGIQVWWD
FT                   LKIEEFITDKQEANCYKKLYDVLDVWFDSGSTHDSVILDKFQSLQHKELKIDLYVEGSD
FT                   QYRGWFMSSLITSVAINNKAPYKQVLSHGFTVDSQGNKMSKSLGNIISPKDIIDKFGSD
FT                   VLRLWIASSDYSKDMTVSDRNLKSITEIYRRIRNTIRFCLANLNDFNPNKDLVLFQHMI
FT                   ELDRWAINHALSVQLKIISNYDNYQFHSVIQNIMQFCSIEMGSFYLDIIKDRQYTLKQA
FT                   SLARRSCQTALYHILEAMVRWISPILSFTADDIWKYIPGQRSRYVFTEEWYTGLSRLDN
FT                   NLLIDNELWDIFIHVRSKVNKVIEQARTDGIIKGSLEAKITLYADSRLADKLRIFGDEL
FT                   AFGLITSSVTVVNNDDVGIITQDQKVNVVGLKITLEKAPGQKCLRCWNYTLNLSQNNSD
FT                   VEICSRCVENVFGVGENRKFF"
FT   gene            140564..141058
FT                   /gene="lspA"
FT                   /locus_tag="BVAF_120"
FT   CDS_pept        140564..141058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="BVAF_120"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_120"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33527"
FT                   /db_xref="GOA:E8Q5N0"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5N0"
FT                   /protein_id="ADV33527.1"
FT                   /translation="MQNSVVKNYVWVFLTILLTLLDIGSKYWIKNNFFIGESKSICSGI
FT                   NFYYIQNSGLAFGLFANIAHVIYFKLIFIWLSIFTLIILIIVFYKSIVCHCFYDSLSYS
FT                   MIIGGGLGNLYNRIFCDAVIDFIDIYVSYWHWPVFNIADVEICSGIIILSIRYFLVSQD
FT                   K"
FT   gene            141151..142098
FT                   /gene="ispH"
FT                   /locus_tag="BVAF_121"
FT   CDS_pept        141151..142098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="BVAF_121"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_121"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33528"
FT                   /db_xref="GOA:E8Q5N1"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5N1"
FT                   /protein_id="ADV33528.1"
FT                   /translation="MIRIILANPRGFCAGVIRAINIVKKAISIYGIPIYVKHELVHNDY
FT                   VIKELLNLGVVFVEDLDDVPNGSVLIFSAHGVSRAVKKQSKDKELIVLDATCPLVSKVH
FT                   MKVLRASKKEMEIILIGHAGHPEVSGIIGQYEYINNTDRSIYLVQSKKDAWSIKVNYPD
FT                   NLSYVTQTTLSIDDTVEIIEILKRRFPRILAPKKNDICYATSNRQVALKKLALLTEVIL
FT                   IVGSKQSSNSNRLLELAYKIGKPAYLISDASYIQVDWICNVNTIGITAGASTPEILVEQ
FT                   VIDRLRMISLCDVVVEHMIGKQENMFFDIPQRLQ"
FT   gene            142263..143147
FT                   /gene="dapB"
FT                   /locus_tag="BVAF_122"
FT   CDS_pept        142263..143147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="BVAF_122"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_122"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33529"
FT                   /db_xref="GOA:E8Q5N2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5N2"
FT                   /protein_id="ADV33529.1"
FT                   /translation="MINNIPIRIAVTGITGRMGTEIIKYIIQRTSQEIRKKIVLGAAIS
FT                   STKSEIFGMDVGNFIGSSNIGVYIANDVESVKKDFDVLIDFTSPVSTMKYLKFCILNNK
FT                   NMVIGTTGFNKIDRRVIKDASENIGIVCSANFSLGITVMLKLLKDMSEKVIKNFINIDI
FT                   IETHHNKKKDIPSGTALMIRNMLIKDQLINDLCRKISCYDNIQTNDQLDEQNKFSRHDT
FT                   QEDNIMIHSVRAGDIVGDHSIWFTGIGERLEITHKAFDRVIFARGAVFSAVWLVEQSKI
FT                   GLFDLNDVLELNM"
FT   gene            143328..144494
FT                   /gene="carA"
FT                   /locus_tag="BVAF_123"
FT   CDS_pept        143328..144494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="BVAF_123"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_123"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33530"
FT                   /db_xref="GOA:E8Q5N3"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5N3"
FT                   /protein_id="ADV33530.1"
FT                   /translation="MRIALLVLEDGSRFYGQSIGVHGESVGEIVFSTSITGYQEIITDP
FT                   SYARQIVVFTYPHIGNVGINKFDNESARIQVAGLVIRNLTIISSNFRSVLSLSDYLIQH
FT                   NIVGISNIDTRQLTRLIRKKGIQRACITTFDRLDMQLAVRKTCEYSIDCQSNLAYEVST
FT                   SHKYIWNQGTNYSSMQCKHDTSVIFSRKFFYNVVVYDFGIKYNIMRILVDYGCLLTVVP
FT                   ANTQAQEVIDMDPDGIFLSNGPGNPNEYIEIVSVIKIFLLKTNIPIFGICLGHQLLALA
FT                   LGAKIIKMKFGHHGSNHPVKDLEINKVLITTQNHNFVVDMMTLPNIFQVTHISLFDGTL
FT                   QGIKCLNKPVFGFQGHPEASPGPHDSVFIFNYFIELIKNYLSYNSARE"
FT   gene            144500..147766
FT                   /gene="carB"
FT                   /locus_tag="BVAF_124"
FT   CDS_pept        144500..147766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="BVAF_124"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_124"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33531"
FT                   /db_xref="GOA:E8Q5N4"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5N4"
FT                   /protein_id="ADV33531.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQASEFDYSGTQACKALREEGYRLI
FT                   LVNSNPATIMTDPDMVDSTYIEAIQWEIVYKIIQKERPDALLSTMGGQTALNCTLDLEK
FT                   KGILKKFNVETIGVTIDSIHKAENRQKFQESIKRVKLETPKSDIARNINEAMSILNNIG
FT                   LPCIVRPSFTLGGSGGGIAYTIEEFEHICQRGLFLSPNHELLIDESLIGWKEFEMEVMC
FT                   DLKDNCIVVCSIENIDPMGIHTGDSITVAPAQTLTDKEYQIMRNAAFLVLRAIGIKSGG
FT                   ANVQFAVNPNNGRILVIEMNPRVSRSSALASKATGFPIAKISAKLAIGYTLDELSNDTT
FT                   NGRIPASFEPSIDYVVTKIPRFDFNKFPGQNNRLLTTQMKSVGEVMAIGRNQQESLQKA
FT                   IRALEIEGIFGLNGKVNINDSNAFKIIIRELQYASDDRLWYIADAFRYGMSLDQIFELT
FT                   NIDRWFLSQIQEIIQLENDVKLKGILFLNKENLFFLKQQGFSDVRLGQLTNTSEIKIRE
FT                   LRNLYDIHPSYKHIDACSAEFSTDTAYMYSSYDGECEHDRINNDKETVMILGGGPNRIG
FT                   QGIEFDYCCVHSAITLREEGYNVIIVNCNPETVSTDYDISDILYFEPVTLEDVLEIIRI
FT                   NKLKGVIVQYGGQTPLKLATFIEKYGIPILGTSANIIDQAENRERFKSAIKYLKLKQPN
FT                   SVTVSSIKLALKNAKEIGYPIVVRPSYVLGGRAMQIVYNKKELLYYLKDAIQVSNNAPV
FT                   LLDHFLENAIEVDVDLVCDGIQVFIGGIMEHIEYAGIHSGDSACSLPAYTLDNNIQNII
FT                   RQQVEKIALYFNIKGLMNVQLAIKKNEVYIIEINPRAARTVPFVSKAINVALAKIGTRV
FT                   MLGQSLCDQKVFQEIIPPYFSVKEVVLPFNKFLNIDPKLGPEMRSTGEVMGIGRTFEEA
FT                   FAKATLSSSQFKIKSNNYLGCILLSLSERDLKLAVMDLVVTFLQKGFILEVTPKTADIL
FT                   KKIGIASKMIKIINIINTQYLLDKMKNGKYSYVIDTTNTLCCEMNHDSSILLRSMALKS
FT                   TIHYSTTVQGGSAVAMSITEDPTKYIRSIQDLHIGLINSI"
FT   gene            147879..148388
FT                   /gene="folA"
FT                   /locus_tag="BVAF_125"
FT   CDS_pept        147879..148388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="BVAF_125"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_125"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33532"
FT                   /db_xref="GOA:E8Q5N5"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5N5"
FT                   /protein_id="ADV33532.1"
FT                   /translation="MISLISILTINHVIGRKNIIPWYFSIDMNWFKYHTTNKPIIMGRK
FT                   TFESIGKKSLSNRINIVLSNRLSNNNNEFNNVIFVDDPNKVLSLSLVNKSKEIMVIGGS
FT                   ALYKIFFPKCTRMYLTYINTVYNYGDKWFPSYKKGDWKVICDIYKTCKSSCNKTMYTLN
FT                   FKIFDR"
FT   gene            complement(148412..149239)
FT                   /gene="apaH"
FT                   /locus_tag="BVAF_126"
FT   CDS_pept        complement(148412..149239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="BVAF_126"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_126"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33533"
FT                   /db_xref="GOA:E8Q5N6"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5N6"
FT                   /protein_id="ADV33533.1"
FT                   /translation="MATYFIGDVHGCYKNLRHMLDYINFDPDFDFLCLTGDLVARGPNS
FT                   LEILRLIKSFKKNACTVLGNHDLHLLETFFSIKKKRTNHHFNDILNAPDSDELIDWLRH
FT                   QSILYIDKNKKLLMSHAGLYPKWSINQAQLYAQEIENILISNHPELLFFTNRTSKNKIK
FT                   IHNIDINQLEKIQHNVILFTRMRYIDLNGTLNLQYKHLPQYAPPYIYPWFKFSKLKTTT
FT                   GYSIIFGHWASLKNTQTPPGIYGLDSGCCWGGELTALKWENKTIIRQPCNPPC"
FT   gene            complement(149356..150165)
FT                   /gene="ksgA"
FT                   /locus_tag="BVAF_127"
FT   CDS_pept        complement(149356..150165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BVAF_127"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_127"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33534"
FT                   /db_xref="GOA:E8Q5N7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5N7"
FT                   /protein_id="ADV33534.1"
FT                   /translation="MQKIHYKNHIIKKKWGQIFLTDQNIINSIINIFQPQHKQTIIEIG
FT                   PGLGALTQPILNVVDFLIVIERDPQLTQKLFQNFNTKKLKIFNTDVMKINFFNLIPLKS
FT                   NQKIRLIGNLPYNIATQLIVHLFKYTKIIYDMHFMLQKEVGKRIIAQPNSKEYGRLSIM
FT                   TQYHYQVSSRLEVSKQSFIPIPKVESMIIQFTPYHAHFPYPIVDIRLLSFLTKIAFHQR
FT                   RKIIKNSLSSLFNTKEMQKCGLDTTLRSENLTIQQFCMLAEILHNKC"
FT   gene            complement(150146..151180)
FT                   /gene="pdxA"
FT                   /locus_tag="BVAF_128"
FT   CDS_pept        complement(150146..151180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="BVAF_128"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_128"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33535"
FT                   /db_xref="GOA:E8Q5N8"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5N8"
FT                   /protein_id="ADV33535.1"
FT                   /translation="MIQFNANKPQKIIITPGEPSGVGPDIVIMTVQKKWPIDLIICADS
FT                   NLLLDRAKTLNLPLTLVPYYINNTTLPFKPGKISILDMSLSQPVIPGQLNVANNNYIIN
FT                   TLNRAATGCINGEFSALVTGPINKSILNKGGISFSGHTEFLAKISKTNTSPVMMLSNNK
FT                   LNVALVTTHIPIALVSQFITQQTIHNTITTLVQGLQKYFNISNPTIYVCGLNPHSGESG
FT                   YIGSEEITTIIPALNNLRKTNMNCNIIGPFPADTIFQTQYLRYANVILAMYHDQGLPVL
FT                   KFSGFGKSVNITFGLPFIRTSVDHGSALKLAGLGIANNNSMTLAIKTAINMIKNAYNYA
FT                   KNTL"
FT   gene            complement(151161..152462)
FT                   /gene="surA"
FT                   /locus_tag="BVAF_129"
FT   CDS_pept        complement(151161..152462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="BVAF_129"
FT                   /product="chaperone surA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_129"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33536"
FT                   /db_xref="GOA:E8Q5N9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5N9"
FT                   /protein_id="ADV33536.1"
FT                   /translation="MKYFKFLFLVLLFLKINTTYSILQTTDKTVALVNNAIILHSDLLN
FT                   KINIIKLNPFNSPDHLTKDKYLYKIALEQLITDHLITQVANKKNININYNQIDHIIDHI
FT                   TQSRNMTHTQFLSHLNKYGLNYTQYSSEIYQEILNKVICNHAICQHINISSYEINDIIQ
FT                   QSNFVDFKKKFKLMHIIIELPIYPSSQQINSYNNLSRLLIKKIESKTNAQDLIYTYYSN
FT                   NIFPRITVKKTSWISWQNIPMIFDQSLQSAKPGDVIGPIHSYDGIHILAIQDILDKQHT
FT                   FPIIRVKINSILFKHVSNEQYIKKQLLQLKTELENHRTTFDIVLKEKSKNFYSENYDHL
FT                   EQWIDLDHFDLSVQKSLLALKKNQISDPIYIFNKWGIIKLIDIKKVNYSEIIRERAYLF
FT                   LLSQKYNETLNNWIQKLKSESYIKILNKHDSIQR"
FT   gene            complement(152469..154895)
FT                   /gene="lptD"
FT                   /gene_synonym="imp"
FT                   /locus_tag="BVAF_130"
FT   CDS_pept        complement(152469..154895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptD"
FT                   /gene_synonym="imp"
FT                   /locus_tag="BVAF_130"
FT                   /product="LPS-assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_130"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33537"
FT                   /db_xref="GOA:E8Q5P0"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5P0"
FT                   /protein_id="ADV33537.1"
FT                   /translation="MSPQLYCKIQLINLIWLILYTQISLAHNSPNNSCHLHTSQILQNN
FT                   NSYSNTFTTIHTQSDRIEINYPQNIQFIGNVNIQHNDNIVKSDKLTIFYYRNNHELYHA
FT                   TTLFADGNVHYHNNSIQIEGSSAQFDLNNKKNKFHNSKYHIYQPNIYGKAKYITQIKHN
FT                   HYIILNQGGFTTCTSNTNSWYIRGSKIIYDHYTNNIDIWNAYLTIKNIPIFYSPYLSFS
FT                   LNNKNILESYIPNIKHSAKHGLILKIPYPLIFSKYYSGIISPYYSSNSGIKLQTKIHYF
FT                   FKLGSGSITADIISDNITQHPANYYSYNNILSKLYWKHNGFIYKKWYCNINYVSNNNST
FT                   FSSNNNTIQKKTKLPNDFIDQKIFFYYNNKHYKLNIAYLGNSNFHTNQTIKNNYFTYIA
FT                   SPQLELYIHFNIYKKLFYFQIFNQFSRFIPSHYLNPTSIRIHTEPKINFTINNPWIKFN
FT                   AETKLKITHYQQNNINYYNNQKHKMNHLQNKVSRIIPQLKIQGSMIFQQKTNISKKYKH
FT                   FLEPKLQYLYTPYYCQRNIGIYDTKFIHMTYNNLFHDSIYSGLDRIAPANQIKSTITAR
FT                   CFKKRNELFYISVGNLFNINQQKKVIYHNYDANKTYCHPYTSKFLLLSGIGHWNINNYW
FT                   NIHSETQFHIPINKFSFSNLALEYNNTHHILQINYRYINSKYLKNTPILHNPLLYYQTI
FT                   SQIGTTIYYPLLKNWKISYSQHHNLKFNYIINQTIGIQRITPCWIISILFERKITDWNK
FT                   TLNTHSYDKKIQFYFKINNSKSKFYQNPYKLLQSSMIPYINIYNINYITTLTHDI"
FT   gene            complement(155144..155761)
FT                   /gene="leuD"
FT                   /locus_tag="BVAF_131"
FT   CDS_pept        complement(155144..155761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="BVAF_131"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_131"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33538"
FT                   /db_xref="GOA:E8Q5P1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5P1"
FT                   /protein_id="ADV33538.1"
FT                   /translation="MNKTTSFNQHTGIVLPLDIANVDTDCIIPKQFLQKTTRDNFGKYL
FT                   FFNWRFLENAPNSLNYNFILNNFNYKDANILLTRKNFGCGSSREHAVWALIDYGFRVII
FT                   APSFSDIFYENSFNNRLLLTILSELEVNSLFEEINTCKNKVMNITVNLYNQTIHTKNNK
FT                   YLFQINDFYKNFMINNLDKISLTLLNNSMIQEYEDNQPSFLK"
FT   gene            complement(155783..157186)
FT                   /gene="leuC"
FT                   /locus_tag="BVAF_132"
FT   CDS_pept        complement(155783..157186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="BVAF_132"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_132"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33539"
FT                   /db_xref="GOA:E8Q5P2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5P2"
FT                   /protein_id="ADV33539.1"
FT                   /translation="MGYSLYQKIYNSHIVYEHKNDMPILYIDRHLLHEVTSPQAFESIR
FT                   TKNRTVRRPNKNFATMDHNVPTTIKDLNSISKTAQIQLDQLTKNCKDFKIQLFDLNHPN
FT                   QGIIHVLAPEQGLILPGMTIACGDSHTATHGAFGALSFGIGTSEIEHVLATQTLRQPRY
FT                   KSMKINLFGTIPPKITAKDLILFIIGKVGNGGATNHIVEFSGNIITQLSMEERMTLCNM
FT                   TIEMGASSALIAPDSTTYHYLKNKKFSPTNKNWEKALIYWNSLYSDPDSNFDKIFNIDI
FT                   SYVKPQITWGTNPSQVIAIDQPIPNLESFTNPVERQSAEQALHYMKLKPNTYLTNIPIN
FT                   KVFIGSCTNSRIEDLRLAADVVKGYKISDNVQAIVVPGSKLVKKQAEKEGLDSIFINSG
FT                   FEWRLPGCSMCLAMNNDQLKQGERCASTSNRNFEGRQGRGGLTHLVSPAMAAAAAIAGH
FT                   FVDIRTYFN"
FT   gene            complement(157214..158317)
FT                   /gene="leuB"
FT                   /locus_tag="BVAF_133"
FT   CDS_pept        complement(157214..158317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="BVAF_133"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_133"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33540"
FT                   /db_xref="GOA:E8Q5P3"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5P3"
FT                   /protein_id="ADV33540.1"
FT                   /translation="MKNNYRIAILPGDGIGPEIINQALKIINAIKNKFKINITTTEHII
FT                   GGKAINLEGSPLSKNTIKCCEQSDAILFGSVGGPQWDHLSRIERPEYGALLTLRKHFNL
FT                   FANLRPIYLPNNLIHLSPIKPKIIPNGLNIACVRELTGGIYFGQPHGQSGTGLKEYAFD
FT                   TAIYHRFEIERIAHFAFKLAQKRHKHVTSIDKANVLRTSMLWRKTVSKLATHYYPNIKL
FT                   QHLYVDNAAMQLIKNPSAFDVILCPNLFGDILSDECAMICGSIGILPSASLNENNFGLY
FT                   EPAGGSAPDIAGKNLANPIAQILSAALLFRYSLQLNHIATIIEKSVYEALTLGYRTLDI
FT                   STKSNQPNKIIGTNEMGDIITSLIYKK"
FT   gene            complement(158369..159910)
FT                   /gene="leuA"
FT                   /locus_tag="BVAF_134"
FT   CDS_pept        complement(158369..159910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="BVAF_134"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_134"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33541"
FT                   /db_xref="GOA:E8Q5P4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5P4"
FT                   /protein_id="ADV33541.1"
FT                   /translation="MKQQVIIFDTTLRDGEQSLQTSLQVNEKLQIAFALEKLGVDIIEV
FT                   GFPISSPGDFKSVRTIAQQIKNCIVCGLARCIDKDIDIAAEALKIAQNFRIHIFLPTSN
FT                   IHIRSKLKKNFNQIIEMTVHAIQYARKYTDDIEFSCEDAGRTSIDNLCRIVEIAIQAGA
FT                   KTINIPDTVGYSTPYQFGEIITALYTKIPIIDKAIISVHCHNDLGMAVGNSIAAIQAGA
FT                   RQVEGTINGIGERAGNAALEEIIMAIKIREDLLNSYTNIHHKEIYNTSKTVSQLCNIPI
FT                   PSNKAIVGSNAFSHSSGIHQDGILKNRKNYEIMTPESIGLKKIQLNLTPRSGRAAVKYH
FT                   MKKMGYQDKDYNMDKLYNIFLQLADKKGRVFDYDLEALAFIDNFNEPIDYFKIQSFNIY
FT                   TNSSGISKALIELYCGKQKHICSHSTVGNGPINAIYETLINITKLPINLKKYTLNSKEC
FT                   DHNILGQVNVIIAYKNRQFHGAGLSSDFIEASIKAIIQALNSIWRTRKIIKNKKC"
FT   gene            160245..161237
FT                   /gene="mraW"
FT                   /locus_tag="BVAF_135"
FT   CDS_pept        160245..161237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="BVAF_135"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_135"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33542"
FT                   /db_xref="GOA:E8Q5P5"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5P5"
FT                   /protein_id="ADV33542.1"
FT                   /translation="MHHKSVLLHEAIEALNIDPSGIYIDGTFGSGGHSRLILSKLTKFG
FT                   RLIAFDKDHLSVEIGKTIFNQDSRFSIVHMSFSKAMNYVHNVKLLGSINGILLDLGICE
FT                   NQLFDANRGFSFIKDGPLDMRMDITTGQTAAQWIAMSSQEHITWVLKNLGEERFCKKIA
FT                   KSILFHRRIRPIVRTHELSKIVSDIIVPSRIKKNSWNKHPATRSFLAIRMHINKELEAI
FT                   AKVLKDMYNLLSNKGRLVIISFNSLEDRLVKHFIYKHSRIFPELPKLALTESQIINIFS
FT                   SSCQFKNIGKIIPTKQEIKENIRARSAILRCAEKIDKTYINRYDLSKTI"
FT   gene            161215..161532
FT                   /gene="ftsL"
FT                   /locus_tag="BVAF_136"
FT   CDS_pept        161215..161532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="BVAF_136"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_136"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33543"
FT                   /db_xref="GOA:E8Q5P6"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5P6"
FT                   /protein_id="ADV33543.1"
FT                   /translation="MIYRKQFSLIKIIYTDLYIYGKVKLVLLLFIIISSILVILITHQT
FT                   RCILIDRERLLLEKHTLDTEWNNLILRKTQLSNHVRIEHIAINKLQMRYRDPMLDNKIY
FT                   E"
FT   gene            161630..163330
FT                   /gene="ftsI"
FT                   /locus_tag="BVAF_137"
FT   CDS_pept        161630..163330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="BVAF_137"
FT                   /product="peptidoglycan synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_137"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33544"
FT                   /db_xref="GOA:E8Q5P7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5P7"
FT                   /protein_id="ADV33544.1"
FT                   /translation="MIFFKNRRLYIAYSGVFFMFFILSARLIYLQIISSDHLINESNKR
FT                   VLRIKSVSESRGMITDRMGRVLAVNVPTTSIWVDPKVVHKCSEMNFDIVKWSALSSILG
FT                   LSLKKLLCFINQHNLDRFLYLARRIDSAIAEHISQLKLPGVYIQQESKRYYPAGSAAAH
FT                   LVGVTNVDNQGIEGVEKSFNGWLAGSPKTRLVYQDRLGRVVEDINLLNEGQLSKSIELS
FT                   IDERLQYVAYHELNNAVNIHKAKSGSVVLIDINTGEILAIANSPSYNPNNFSSIKQSMM
FT                   RNRAITDVFEPGSTVKPIVIMTALQHDIIKKDSIINTLPYMINGHRIKDVSFNNQLTIS
FT                   EILKKSSNVGVSKLALAMPVSILLNSYLNFGMGQSTNVGLIGENKGKLYSSNRYDSDIE
FT                   RAALSYGYGLMITPLQLARMYAIIGGLSLSRQISIIKLDKSKSIPLISPSSNQIFSKSL
FT                   MRTVINMMEVTTTSHSGCHQAAIEGYRVAVKTGTIKKVGSQGKYINKYIACTAGIAPVS
FT                   NPRFALVVVIDDPKNGFYYGGMVSAPVFKSIMSSTLKIMNVDPDCFNNI"
FT   gene            163343..164890
FT                   /gene="murE"
FT                   /locus_tag="BVAF_138"
FT   CDS_pept        163343..164890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="BVAF_138"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_138"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33545"
FT                   /db_xref="GOA:E8Q5P8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5P8"
FT                   /protein_id="ADV33545.1"
FT                   /translation="MSDVSNCYYIFPINKLRELVIPWVFNELISSALVITALQLDSRNV
FT                   TVGNLFIAIKGHKTDGRLYIKHAIKNGAVAVLLESTNNDNFLAQNIVNNVSSCVPIINF
FT                   YKLNQAVSSIAGRFYGHPSRNLNLIGVTGTNGKTTISHLLANWVELLGEKSAVMGTIGY
FT                   GMIGSMCVSNCTTFSAIDTQRILNQFIQSGIKFVAMEVSSHGLDQYRVDALYFDVAIFS
FT                   NLTSDHLDYHGDINKYIMAKWRLFSELCVTNYVINVDDYIGYEWLSYLPNSVAVTIQDN
FT                   LPKFWKGEWIKLVKANYFVYGTDVFFHSSWGNGIIRSQLLGECNVSNLLLALGALLVLG
FT                   YPLMVLLSIADQLKPICGRLEKFKSFNKPTIIVDYAHTPDALEKILRFLGAQLCKKGKL
FT                   WCVFGCGGNRDKLKRSRMGIVAERYSDYVVITDDNPRTENSQSIIDDIILKIKHSEKIT
FT                   IIKNRVQAIETAICQADSNDFILIAGKGHESYQIVGNDYLKYSDQDIVRNILENFIT"
FT   gene            164904..166292
FT                   /gene="murF"
FT                   /locus_tag="BVAF_139"
FT   CDS_pept        164904..166292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BVAF_139"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_139"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33546"
FT                   /db_xref="GOA:E8Q5P9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5P9"
FT                   /protein_id="ADV33546.1"
FT                   /translation="MVPFRLHEIACFINAKCVGSDVMINTISIHSDLIEEQCIFIALIG
FT                   NRYDGHDFVEQAVMAGAKALLVNRYVSLDIPQLIVCDTRDALLKIAGWIRRQVSSKIIA
FT                   ITGSSGKTSVKEMTASILKECGTVIATQKNYNNFIGVSITLLKLTYGIDFAVVELGSNK
FT                   LGELKKLGEIVGADVALVNNIFSSHLSGFGSLTTIKKEKEKIFYGMSIDNAQAVINLDS
FT                   YSFVQGNSILLNFKKKWSFSLYKKGIGVNFFASNVILYEHGIRFTLHSPNGSAPIFMPI
FT                   LGIHNISNILAASALSFAVGASLSNIVHGLQKMNALPGRLFPFILNRGKLCLIDDTYNA
FT                   NIGSMIAAINVLSFMPGYRILVVSDMLELGDLKMARYYHCYIGRLILGSNIDYIITIGD
FT                   LSHFILKIFKKGKHFQRKTALIFYINKILSQNRLISILIKGARKFKMEQVVDAVRKTHD
FT                   VVIR"
FT   gene            166297..167382
FT                   /gene="mraY"
FT                   /locus_tag="BVAF_140"
FT   CDS_pept        166297..167382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="BVAF_140"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_140"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33547"
FT                   /db_xref="GOA:E8Q5Q0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Q0"
FT                   /protein_id="ADV33547.1"
FT                   /translation="MGLYKMLCLFMSNHHVIDTVFFKSFASFFSALVVALGIGSVVIIW
FT                   LRHLCVFQTIRVECPDTHRLKRDTPTMGGIIMLISSIVSILMWADLSNLYVWYVLFIFI
FT                   VYGLLGWIDDFLKIKRKNALGMRGLNKYFWQTLSAFLLSIVIFMMRIDCINTDLEGWYY
FT                   LKDIVSKLDIWGVLLSYFVIVGTSNSTNLSDGLDGLAIVLIILITTGLIVIAWISSNVY
FT                   FSNYLQILYIDRVQELIIICAAIIGTGLGFLWFNSYPAQIFMGDTGSLSFGGAIGVITV
FT                   LLQQEYLLLVIGGIFVMESLSVILQVSYFKIFKKRIFKMTPIHHHFELQGCPEPKLVVR
FT                   FWIISLVLLLLGLTIVIFKII"
FT   gene            167385..168725
FT                   /gene="murD"
FT                   /locus_tag="BVAF_141"
FT   CDS_pept        167385..168725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="BVAF_141"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_141"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33548"
FT                   /db_xref="GOA:E8Q5Q1"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Q1"
FT                   /protein_id="ADV33548.1"
FT                   /translation="MNTTKYKKAQVVIIGLGITGLSCLNFFLIRGIIPKVIDTRLRPPA
FT                   INQLPSFIEFCFGRLCDEWILHADLIVVSPGVRLDDPVLIEARRMGIEIIGDIELFVRE
FT                   ITVPIIAITGSNGKSTVTQLVGNMARYAGWKVGIVGNIGIPALTLLNNNYQLYILEISS
FT                   FQLDVTYSLCAAAATILNVSEDHMDRYAAGIVDYSSSKNRIYNNAITCVINFLDPLTYP
FT                   VSCNYGRLVSFGVDSNSADYRIEYCKGKAWIVIYGEYILDCFELHINCHINYYANILSA
FT                   LALSDSVNIPRMASLQSLRYFSGLSHRFQLIYTNRNVKWINDSKATNVAATKIAINAAL
FT                   SILASGDLHLLLGGDGKLANFFELTALITKYEIHLYCFGKDGFFLTKSGSKNIFLTNDI
FT                   IDAMNIICRRVRRKDIVLLSPACSSLDQFLSFKYRGELFTYLSRRLG"
FT   gene            168801..169922
FT                   /gene="ftsW"
FT                   /locus_tag="BVAF_142"
FT   CDS_pept        168801..169922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="BVAF_142"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_142"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33549"
FT                   /db_xref="GOA:E8Q5Q2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Q2"
FT                   /protein_id="ADV33549.1"
FT                   /translation="MILLYDRMLFGLLLGLICIGFIITSSGSIPVGINIAGDPYFFIKR
FT                   AIIYYIITFLISLIVLNIPIVVWKNCSFIMLLCSFCMLVVVLIFNNTINGASRWVIWGS
FT                   LCAQPSELSKLFFIFYFANYLERKLIEVRSTFWGVCKPIIIVFLLSLLLLRQPDFGSII
FT                   ILFIITLYILFLFGAKLNQLALIFILSIFFIILSVALKPYRIQRMLSFWDPWKDPFGNG
FT                   YQLTQSLMAFGRGGYFGRGLGNSIQKLEYLPESHTDFVFSILAEELGLVGSILVLMILF
FT                   GVVFRAMIIGTHALYYNQKFSSVLAYSIGIWLGIQTFINVGVVSGILPIKGLTLPFISY
FT                   GGSSFLITTIIGMLLIRIDFEIRLIKHQAFFEK"
FT   gene            169934..171031
FT                   /gene="murG"
FT                   /locus_tag="BVAF_143"
FT   CDS_pept        169934..171031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="BVAF_143"
FT                   /product="UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_143"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33550"
FT                   /db_xref="GOA:E8Q5Q3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Q3"
FT                   /protein_id="ADV33550.1"
FT                   /translation="MINACKKKIKTILIIAGGSGGHVFPGLSVARYLMNHGYKVVWLGS
FT                   KENIESQLVPRHGIDIKFIYMKGWRGKNIYKKLVTLLFLMFLSIYQALKIIKYWKPDIA
FT                   LSMGGYVAGPSSLAVVLCRIPLIIHEQNRVIGLTNRYLSFFAAKIFQGFPDVIANAITL
FT                   GNPLRHTILSIPKPINRWKYRTGPIRVLVMGGSNGAYIFNKVVPKIFEQLFSKLIIWHQ
FT                   SGEKDFERVLKAYRKTKQKINYKITPFIDDIAQAYSWADVVISRSGALTVSEIIYVGLP
FT                   AIFVPFPYHKDKQQYWNALPLMKLGSAIIVEQEKFTSDYISRVLESWNRKTLLVMAKRA
FT                   RSLITPNATKLVAQTIIQYLKEKKY"
FT   gene            171049..172497
FT                   /gene="murC"
FT                   /locus_tag="BVAF_144"
FT   CDS_pept        171049..172497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="BVAF_144"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_144"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33551"
FT                   /db_xref="GOA:E8Q5Q4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Q4"
FT                   /protein_id="ADV33551.1"
FT                   /translation="MQSFQLTNDILPVINRYYIKQIHFIGIGGAGMSGIAIILAHQGYN
FT                   VTGSDIEESDITQYLLNLGVKIFFGHCSENVNNADLVVISSAINLNNIEFQAAKRLKIP
FT                   IMRRAEVLFELMRYKYGIAIAGTHGKTTTTAMLANIYVEAGLDPTFINGAIIRSEGVQS
FT                   RFGCSCYFIIEADESDKSFLWLYPTVEIITNIDFDHMSAYQNNYEFLKKAFVEFLNHLP
FT                   VYGYAVICIDDPAIRSVLSNVNRKIITYGFSKDADLCILNYHQYREKSKFTVLIKNKKK
FT                   LEIILNIPGYHNVLNATASIGVSIEEGIPDLVILRAMLNFQGTNRRFENLGFYSLKQIN
FT                   GRVGKVMIVDDYGHHPTELHATIATVRSGWPDKRLIMVFQPHRFTRTCELYDSFIHVLS
FT                   TVDVLLILNVYPAGEKPILNINSQTLCDAINKYGKIKPVFVSNEYILLKILLGLLDNGD
FT                   LLLIQGAGTIGNKMRALFLKNQKS"
FT   gene            172615..173424
FT                   /gene="ftsQ"
FT                   /locus_tag="BVAF_145"
FT   CDS_pept        172615..173424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="BVAF_145"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_145"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33552"
FT                   /db_xref="GOA:E8Q5Q5"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Q5"
FT                   /protein_id="ADV33552.1"
FT                   /translation="MLAKFGIGLRYYLNRRLIIGWIFFFVLILSIFWIISRVALIWIHD
FT                   YCCDPISYVIVTGNRYFTTNNDINHLIVQLDKIGSFITQDVNVIQRQIKKLPWIKQISV
FT                   RKQWPDTLKIHIVEYIPVGYWNNELIISTTGIMFKAPKHRIKNGHNNDEIKYLPFLYGP
FT                   DGSEQDVLNNYLIFQAILQSHKFRIMSLKMDKCYAWQLTLQDNIQLRLGSTNLVDRLRY
FT                   FIKVYPMLLQAVHKKNIYIDYVDLRYYSGCAVKWIDNVSLPVCGNNK"
FT   gene            173452..174708
FT                   /gene="ftsA"
FT                   /locus_tag="BVAF_146"
FT   CDS_pept        173452..174708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="BVAF_146"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_146"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33553"
FT                   /db_xref="GOA:E8Q5Q6"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Q6"
FT                   /protein_id="ADV33553.1"
FT                   /translation="MKSLDNRKLIVGLEIGTAKVATLIGEVLPDGIINIIGLGCCSSQG
FT                   MDKGGVNNLESVVKCVEYSINQAELMAGCQIASVYLSLSGKHISCKNEIGMVPIAEEEV
FT                   TQLDVDNVVHIAKSVKIRDEHRILHVIPQDYSIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVEKCGLRVDQLIFSGLASSFAVLTQDERELGVCVVDLGGGTMDIAIYV
FT                   AGALRHIKVIPYAGNVVTSDIAYAFGTPLSDAETIKVRYGCALESLVNKNENIEVPSVG
FT                   GRPSRILQRRMLAEIIEPRYIELMRLVNKEILQLQSQLKQLSIKHHLAAGIVLTGGASL
FT                   MEGVIECAQKVFNTQVRVASAVNVNGAIDEISGPRYSTVIGLLHYGKESHLNNNIDADK
FT                   RVKIKNWLKKINNWLKKEF"
FT   gene            174796..175962
FT                   /gene="ftsZ"
FT                   /locus_tag="BVAF_147"
FT   CDS_pept        174796..175962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="BVAF_147"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_147"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33554"
FT                   /db_xref="GOA:E8Q5Q7"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Q7"
FT                   /protein_id="ADV33554.1"
FT                   /translation="MFEPMELTSDAVIKVVGIGGGGSNAVDHMLRERIEGVDFFAVNTD
FT                   AQALRKMTIGQTIQIGSSITKGLGAGANPEIGRNSAEEDRDVLRATIEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFSFEGKKRMMFAEQGISELSKYVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGAGTGCGDDRAEEASELAISSPLLEDIDLSGARGVLVNITSGLNLRLDEFETVGNT
FT                   IRSFASDNATVVIGTSLDPDINDELRVTVVATGIGIDKRSESILSNTNQEEIKTTQQDN
FT                   CYHHNASIQKTSAFFNESRCALDNSVTQDNTLSDTETEYLDIPAFLRK"
FT   gene            176051..176926
FT                   /gene="lpxC"
FT                   /locus_tag="BVAF_148"
FT   CDS_pept        176051..176926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="BVAF_148"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_148"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33555"
FT                   /db_xref="GOA:E8Q5Q8"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Q8"
FT                   /protein_id="ADV33555.1"
FT                   /translation="MLKQRTLKKITRIAGVGLHTGRLVTATLYPALANTGVIYRRIDLK
FT                   PSVDFNVNIESVGNTTLCTCLRDEYGIHQVCTIEHLNAALSGLGIDNIIVELDASEVPI
FT                   MDGSANPFVSLLMNAGVQELNVSKKFFKLKQIVRVEEKDKWAELKPHDGFTLDFTIEYK
FT                   YSMMEPICQHYFFNFSTQSFIAEISAARTFGFINRVKDLKNRGFILGGDLNSVVVIGNN
FT                   SKVLNIGGLRFDNELVRHKVLDAIGDLFVCGYNMLGSFSAFKSGHSLHNKLLRTVLSCQ
FT                   ESWEIISCIE"
FT   gene            177470..180055
FT                   /gene="secA"
FT                   /locus_tag="BVAF_149"
FT   CDS_pept        177470..180055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="BVAF_149"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_149"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33556"
FT                   /db_xref="GOA:E8Q5Q9"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Q9"
FT                   /protein_id="ADV33556.1"
FT                   /translation="MAISFQFLKNLFKNRNERMLLRMQKTVDVINLLEQDMERLSDVQL
FT                   SNKTNEFRNLIKSGVSIDQLLPQAFAVVREAIKRIFNIRLFDVQLLGGIVLNNRCVAEM
FT                   RTGEGKTLTATLPAYLNALSGKGVHIVTVNNYLANRDATYNRLLFEFLGLSVGINLPEQ
FT                   SASLKRLAYNADITYGTNNEYGFDYLRDNMVFSIKDRVQRTLHYALIDEVDSILIDEAR
FT                   TPLVISGPSDNSSSLYLKINELVCEVIKKNKNNIISDSKKEYFTVDEKIKQVILTETGL
FT                   VLIEKLLIESRLMQSGESLYSSDNIILMYHVNSALRAHILFTREVDYIVKKGEVLIIDE
FT                   HTGRVMPGRRWSDGLHQAIEAKEHVTIQDENQTLASITFQNYFRLYAKLAGMTGTAYTE
FT                   SFEFRSIYKLDTVVIPTNRPMIRNDFPDVIYMAEHEKIDAIIKDIRNCIKRNQPVLVGT
FT                   ISIDKSEIISRALKKLDIPHKVLNAKFHAAEAEIIAQAGQPGAVTIATNMAGRGTDIVL
FT                   GGNWQAEIAKLNTDDANKICIIKSDWLNRHDLVLKAGGLHVIGTERHESRRIDNQLRGR
FT                   SGRQGDVGSSRFYLSMEDSLIRIFASDKLVSLMKKLGMQSGESIEHPWITKAIAHAQKR
FT                   VENRNFDIRKQLLEYDDVANDQRKVIYEQRNKLLSMSNISDVIENIRFDVVDQLLNIYM
FT                   PLGILESKINLIKLEERLKIDFHLIIPLVKWVEEDSRLYEEIEKIRDRILTELVKQYLY
FT                   TQKFIGIEFLSTFEKNIMLKTFDTLWKEHLSSMDYLRQGIHLRGYAQKDPKQEYKKESF
FT                   AMFKKMLDHLKYEVISEISKLYSTTISLNELKNPLIIKENRFSGLKIRN"
FT   gene            180646..181107
FT                   /gene="dksA"
FT                   /locus_tag="BVAF_150"
FT   CDS_pept        180646..181107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="BVAF_150"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_150"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33557"
FT                   /db_xref="GOA:E8Q5R0"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5R0"
FT                   /protein_id="ADV33557.1"
FT                   /translation="MLKKSSKKKCSSLNVLIIAGVKPYIRKLDEEYMSVNQLLHFKSIL
FT                   KAWKNQLTTDIQCSILRMKDEVSINFPDPVDRAVQEEEFNIELRNRDRERKLIEKIEKT
FT                   LKKIEIKEFGFCILCDIEIGIRRLEANPIADLCIDCKTLEELKEKQMIG"
FT   gene            181199..181696
FT                   /gene="folK"
FT                   /locus_tag="BVAF_151"
FT   CDS_pept        181199..181696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BVAF_151"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_151"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33558"
FT                   /db_xref="GOA:E8Q5R1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5R1"
FT                   /protein_id="ADV33558.1"
FT                   /translation="MERVWIGVGSNLLDPKKQVDRAIWALANKIPKTKLVFCSKYYCSL
FT                   PLGRINQPNFLNMVVVLDTDLNPEILLIYMQKIEKEQGRVRSTCFCHFWQPRTLDLDIL
FT                   LFGKHVIRTTDLIIPHYNMIEREFFIYPLFEIDQCLIFPDGIRIIDIIKKLPKNGLTFW
FT                   KS"
FT   gene            complement(182545..183978)
FT                   /gene="lpdA"
FT                   /locus_tag="BVAF_152"
FT   CDS_pept        complement(182545..183978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="BVAF_152"
FT                   /product="dihydrolipoyl dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_152"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33559"
FT                   /db_xref="GOA:E8Q5R2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5R2"
FT                   /protein_id="ADV33559.1"
FT                   /translation="MNIKIERTTILVIGAGPGGYSAAFRCSDLGMKTMIVERYKNLGGV
FT                   CLNVGCIPSKSLLHIAKLINDNKNLSKYGILQQNPQIQLDLNKISLWKNNIINQLSRNL
FT                   YSLAKAHNVNIVHGLGKFIDNHTLQIFNDQQEETLQVIFDYAIIAAGSHTLSFSSLPND
FT                   KRIWHSTDALQLQSIPETLLIVGAGAIGLEMATIYHALGSKVEILESQNKIIPILDQDI
FT                   IKILSKNLYNKNIDCIINTKINSIYTQTDGIYVVMENNSDTTIKNTNKYDAILIAIGRA
FT                   PNSNILNLQNAGINVNKYGFISVDKQMRTNVPNIFAIGDIIGHPMLAHKSIHEGYVAAE
FT                   VISGKNYYFDAKIIPSIIYTNPEIAWVGYTEQTAQQTEEQIQYKSVALPWTALGKAITS
FT                   NCTEGITKLVFDKTTHKIIGGSVIGTNASEIIGEIALAIEMGCDVEDITLTIHAHPTLH
FT                   ESIELAASIYYKSIKDFSL"
FT   gene            complement(184065..185405)
FT                   /gene="aceF"
FT                   /locus_tag="BVAF_153"
FT   CDS_pept        complement(184065..185405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="BVAF_153"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase
FT                   component of pyruvate dehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_153"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33560"
FT                   /db_xref="GOA:E8Q5R3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5R3"
FT                   /protein_id="ADV33560.1"
FT                   /translation="MVIDIHVPNIGEDALEVTEILIKIGDNININQPLAIIEGDKSSME
FT                   IPSPYSGLVTKIYINIGEKVHTGSLILSVDVKNEPKNLQSLHKEKDISLDSAINQQNNL
FT                   NNTITKNNNNSHYDDTKKTTSLLSTPTENPIMYATPVIRHMARKFRINLSQIKGSGRKG
FT                   RILKEDLQNYLNNIKNNIHNHYPSQSSKKENKSFDLTQKKSTINTNNTTNYISTIQLTK
FT                   IQQSSGRNLQKNWIEIPHVTQFDIIDITDLELFRKQQNLEIQNKKTDYKITILAFVIKA
FT                   VSKVLKELPQFNSSLSRNGDKLILKKNINIGIAVNTKQGLLVPVLHNTNKKNIMTLAQE
FT                   LSEIAKKARIENQLIPSDMQGGTFTISNLGNIGGMFFTPIINAPEVAILGVSKSMIYPI
FT                   WTGKKFLPKLVLPISLSYDHRVIDGVDGSKFIRHINKILSDIRLLSM"
FT   gene            complement(185423..188101)
FT                   /gene="aceE"
FT                   /locus_tag="BVAF_154"
FT   CDS_pept        complement(185423..188101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="BVAF_154"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_154"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33561"
FT                   /db_xref="GOA:E8Q5R4"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5R4"
FT                   /protein_id="ADV33561.1"
FT                   /translation="MSSCLNHDIDSIETQEWIQSIASVIQKDGISRAHFLINQIINKAR
FT                   ADGLIIPNNNNSLLNSDYINTIPVQDEPEYPGNLKIEQRICSTIRWNAMMMVLHASKKK
FT                   LDLGGHIASFQSSATLYEVCFNHFFRARNSIDEGDLIYFQGHISPGIYARAFLEGRLKK
FT                   EHIDNFRQEVNNIGLSSYPHPKLMPEFWQFPTVSMGLTAINAIYQAKFLKYLYNRNLKN
FT                   TSQQTVYAFLGDGEMDEPESKGALNIASRDKLNNLIFIINCNLQRLDGPVTGNGKIIND
FT                   LENIFIGSGWEVIKVIWGSKWDKLFNKDKTGKLIQLMNETVDGDYQTFKSKDGKYIRKY
FT                   FFGKYAETKALVKDMSDSEIWELNRGGHDPKKIFAALKKAKNNIKKPVVILAHTIKGYG
FT                   MGSEIEGVNIAHQIKKINIKTIQYFRDRFELNSIIKDHQIESLPYLTFKKDSEESLYLH
FT                   KRRQALFGYLPTRLTNSTHTLELPKLEYFDSLLQQQNKNISTTLAFIRILNILLQYPSL
FT                   KNRLVPIIADEARTFGMEDLFRKIGIYNPLGQQYTPQDHNLLSYYREDKQGQILEEGIS
FT                   ELGAAASWLAAATSYSTNNFPMVPFYIYYSIFGFQRIGDFLWASADQQARGFLIGATSG
FT                   RTTLNGEGLQHADGHSHIQSLTIPNCISYDPAYLYEITVIIHNGLIRMYGKNPENIYFY
FT                   ITTLNERYHMPSMPPGIEEGIIKGIYKLESLPGKNGKVQLMGSGSILRMVRDAAQILSR
FT                   EYNVSSDVYSVTSFTELARNGQDCERWNMLHPSSTPKVPYITSILNDFPTIAATDYMKL
FT                   FAEQVRSFVPNNNFFVLGTDGFGRSDSRENLRHYFEVNSGYIVVAALFNLTKQGYIHID
FT                   IVSKAIKMFNIDPEKINPRLM"
FT   gene            189421..191862
FT                   /gene="mrcB"
FT                   /locus_tag="BVAF_155"
FT   CDS_pept        189421..191862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="BVAF_155"
FT                   /product="penicillin-binding protein 1B"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_155"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33562"
FT                   /db_xref="GOA:E8Q5R5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5R5"
FT                   /protein_id="ADV33562.1"
FT                   /translation="MHKINLIFGCLKLVSIFFKKIVFINYFFLKNCLKIIINIFFFTHY
FT                   GIYVLLCVVILLCFYGIFLDKKIQNHINDQVWQLPTVIYSKIVNIEPNISCNKNDMIKL
FT                   LQSLQYRQVSKIIRSGEFVVFNDNIELLRRSFDFPNREEQESHVRLFFDKEKLLRIYNQ
FT                   DTQNNFALFRIDPKIISIQYVFQGQQRLFVPRSKFPDTLIDMLLAVEDKNFYNHDGIQI
FT                   PSVIRAFLINIVSGHTVQGGSTITQQLVKNLFLNNTRSLWRKFNEMYMALIFEVRYSKD
FT                   RILELYLNEIFFGQNGNDQIRGFPLASFHYFGRPVDELSLDQQAMLVGMIKGASLYSPR
FT                   KNPKKTLERRNFILNLLRNIDMIDADLYSILKSRPLGVQLKDEVLTNQPAFIQMVYEEV
FT                   SRINKIHNLAGLRIFTTLDPIAQQAAERSMKLGIPKLRCSSNISDLEGAIIIVDRFNGS
FT                   VRAMVGGSEPNFSGFNRAMRARRPIGSLIKPAIYLTALNQPHKYRLNTWIADTPINLKQ
FT                   PDGSVWSPKNYDRQFRGKVMLIDAFVKSLNIPAVNLGLTMGINTITDILMKLGISENLI
FT                   PSFPSILLGSINLTPINVAQEYQTIASGGRYSKLSCIEHIVNSDNMTVYQYFPKTKRMV
FT                   SPQSVYLVLFAMQQVVTRGTSYDLSVKFADFHLAAKTGTTNDSRDSWFVGIDGKEVVVI
FT                   WVGRDDNGKMNLTGASGALKLYSLYLGLGHPTPLQLTIPSNIIQVPINSSGSVLLYNNC
FT                   NKNIYTYVLPIWKNDHFNGIECNMLNSSDEVIAYSGNVLDFSENQDFRKMEKWINEILK
FT                   E"
FT   gene            192028..192378
FT                   /gene="erpA"
FT                   /gene_synonym="yadR"
FT                   /locus_tag="BVAF_156"
FT   CDS_pept        192028..192378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="erpA"
FT                   /gene_synonym="yadR"
FT                   /locus_tag="BVAF_156"
FT                   /product="iron sulfur cluster insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_156"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33563"
FT                   /db_xref="GOA:E8Q5R6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5R6"
FT                   /protein_id="ADV33563.1"
FT                   /translation="MKNSVFSIQLTPFAADRIRYCMKEHKYINKSNLKFRIYIIGGGCG
FT                   GFQYKFILDDQISDDDYVIKSNGVTLIVDSMSFQYLVGGVVDYREELSGSKFVMINPNA
FT                   KITCSCGSSFSI"
FT   gene            192784..194430
FT                   /gene="pyrG"
FT                   /locus_tag="BVAF_157"
FT   CDS_pept        192784..194430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="BVAF_157"
FT                   /product="CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_157"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33564"
FT                   /db_xref="GOA:E8Q5R7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5R7"
FT                   /protein_id="ADV33564.1"
FT                   /translation="MGINYIFVTGGVVSSLGKGIMTASLASVLEARGLSVTIIKLDPYI
FT                   NIDPGTISPVQHGEVFITEDGAETDLDLGHYERFIRTKMTRYNNFTAGRIYADVLQKER
FT                   RGDYLGATVQIIPHVTCMIKRWLVRNSKDYDILLVEIGGTVGDIESLPFLEAIRQMAIE
FT                   VKRKHTLYIHLTLVPFVSVSGELKTKPTQHSVKELLSIGIQPDILICRSDRIIGDSERQ
FT                   KISLFCNVPKQAIISLQDVSSIYKIPLLLQNQKLDDYICKYFQLHCPKADLSDWKRVIY
FT                   YQNNPIGKVTIGIIGKYTELTDAYKSVTEALYHAGFKNRFFIQIRFINSQDIDNLGIES
FT                   MLKDLDGILIPGGFGYRGVEGKILSARYAREHKIPYFGICLGMQVALIEFARNVVGMTG
FT                   ANSTEFVDNCEYPVISKINEFQNHNEYLEKCNNNVNLGGTMRLGNQVCYLVEGSLVQKM
FT                   YGKKVILERHRHRYEVNPVLFKKIEHAGLDCVGFSKDENLIEIIEYKYHPWFIGSQFHP
FT                   EFNSTPREGHPLFIGFIGAAIQYKDCHNKLI"
FT   gene            194524..195846
FT                   /gene="eno"
FT                   /locus_tag="BVAF_158"
FT   CDS_pept        194524..195846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="BVAF_158"
FT                   /product="enolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_158"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33565"
FT                   /db_xref="GOA:E8Q5R8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5R8"
FT                   /protein_id="ADV33565.1"
FT                   /translation="MSKILNIIGREIIDSRGNPTVEAEVHIKNGFFGLASVPSGSSVGS
FT                   QEALELRDHDESRFFGKGVKKSVDIINGPIRSALLNVDVTKQCFIDQIMIDLDGTDNKS
FT                   KLGSNSILSVSLAVAKAAADVIGIPFYEYISNLYGAPNIYSMPIPMMNVINGGKHADNN
FT                   LDIQEFMIIPVGAKTIKEAIQIGSEISCNLKIILRNQGIFPALGDEGGYAPNLISHVGT
FT                   LELIKQSVEQSNYIFGKDVVLSMDCAASELFDKSSNQYNIKSENLCCSSKEFIDYLSLL
FT                   AQKYPIVSIEDAQSEHDWNGFSYLTKVLGSTIQLVGDDLFVTNPNLLNKGIQQNIANSI
FT                   LIKPNQIGSLTETLYVIKLAKKHGYTTIISHRSGETEDTSIADIAVGTSAGQIKTGPVR
FT                   CVDRTSKYNRLIRIEEKLGDAAKFNGIKEIKNFFDRKSVIF"
FT   gene            196251..198095
FT                   /gene="cysJ"
FT                   /locus_tag="BVAF_159"
FT   CDS_pept        196251..198095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="BVAF_159"
FT                   /product="sulfite reductase [NADPH] flavoprotein,
FT                   alpha-component"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_159"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33566"
FT                   /db_xref="GOA:E8Q5R9"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5R9"
FT                   /protein_id="ADV33566.1"
FT                   /translation="MITLTPDQLSRLQSILNTLSRDQLIWVSGYLWGLINVNRFTDTTV
FT                   SISTQNQVSSTKQRLSQLSDKIIIISASQTGNASQIAQKLYNDCIKSGLNATLFNARDY
FT                   TCKNISEIKLLVLIISTYGEGDPPEEAIPLHKYLFSQKAMRMEDTSFVVLGLGDRSYEY
FT                   FAKAGKDFDRRFEELGAIRLYNRVDLDIDFEDAANIWRKEIIEVLQNRISSDVTIFNSF
FT                   SDKTIQKSAVVSSENCGDYSVYCKEFPFIACLSNRQKITSRNSMKDIHHLEFDISGSNL
FT                   LYQPGDALGVWYENDYDLINELLELLKLTGDEWVNVKGQSMILCEALKDHYELTQNTSI
FT                   FVEKIATITKNKMLLDLMTDRKKLKIYVLETPIIEMIRNISPDITLTAQNLLLALRSMR
FT                   PRFYSISSAQLEVGEEIHITVSAVRYRVNGRLRSGGASSYLVDRLKENDKLRIFVEPNH
FT                   NFRLPSDFSASIVMIGAGTGIAPFRAFMQHRVLNQATGRNWLFFGNLRFIDDFLYQTEW
FT                   QRYVKEGVLSNIRTAWSRDQDHKVYIQNKILEDGSELWDWIEEGAYIYVCGDAKGMAHD
FT                   VEKALISLTSKYGNMSTNQANDFWDTMRTQHRYQRDVY"
FT   gene            198095..199807
FT                   /gene="cysI"
FT                   /locus_tag="BVAF_160"
FT   CDS_pept        198095..199807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="BVAF_160"
FT                   /product="sulfite reductase (NADPH) hemoprotein,
FT                   beta-component"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_160"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33567"
FT                   /db_xref="GOA:E8Q5S0"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5S0"
FT                   /protein_id="ADV33567.1"
FT                   /translation="MTILKHTKKVSLSDNERIKKDSNFLRGTINEDLDNNLTGGFNPDN
FT                   IQLIKFHGMYQQDDRDVRLERTYQKLEPLINIMLRCRLPGGVITSKQWLAIHNFSEKYT
FT                   LYGTIRLTNRQTFQLHGLLKPQLKIAHQLLNKLGLDSIATAGDVNRNVICTVNPMESTI
FT                   HYQVWKLSKRISEYLLPRSKAYAEIWLNEQKTEFVESEPILGDCYLPRKFKIAIAVPPF
FT                   NDVDVYANDIGLVAIADNIGNLIGFNVLIGGGLAMTYGDKTTYPRRASEFGYIDAVNIL
FT                   KIIESVITIQRDWGDRSNRKHAKTKYTLVRVGIDTFKQEIENRSGLMFAPVRSYMFTDR
FT                   GDRFGWSKGINKDYWNLTLFIENGRIFNSSHKLLKHGLAEISKVHSGGFIITTNQNLVI
FT                   SNIHKDKKDIIEALSKEYKLLDDSITLQRKASMACVALPTCPLAMAEAERFLPDFVTKI
FT                   EHIMCKYNLEKDSIILRVTGCANGCARAMLSEIGLTGRGIGRYNLYLGGDKIGTRIPRL
FT                   YKENISESEILDILEYTIKLWVKDRNIQESYGDYVVRSGIVKPVLNSEKDFYL"
FT   gene            199804..200577
FT                   /gene="cysH"
FT                   /locus_tag="BVAF_161"
FT   CDS_pept        199804..200577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="BVAF_161"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_161"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33568"
FT                   /db_xref="GOA:E8Q5S1"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5S1"
FT                   /protein_id="ADV33568.1"
FT                   /translation="MIYRKLAKFDKRFWSIKEFNALSLNEQNTILYELNQYLESLETED
FT                   RIKWAIRHLSDKCILSSSFGVYSSVSVHMMTRYFPDIPIILIDTGYLFPETYRFIDHLK
FT                   EKMRLNLHVFRSNRSAAWQEARYGKLWEQGAQGVQRYNFINKVKPMKYALKTLQVEVWF
FT                   AGLRRIQSDSRRGLTIINVQNNVFKFLPIIDWNDTQMHRYITQYELEYNPLWKQGYVSI
FT                   GDVHTTVKKKSGMKDEETRFFGLQRECGLHCFDKN"
FT   gene            200715..202112
FT                   /gene="cysG"
FT                   /locus_tag="BVAF_162"
FT   CDS_pept        200715..202112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="BVAF_162"
FT                   /product="siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_162"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33569"
FT                   /db_xref="GOA:E8Q5S2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5S2"
FT                   /protein_id="ADV33569.1"
FT                   /translation="MKYLPLFINFNKKSILVVGGGIVAFRKIQILRKSGAIINIVARVL
FT                   CPNLKKILFLEKIIWIGKTFQPSMLDGIFLIIISTNNIFLNNVIFKHAEKRRILINTVD
FT                   NKSTCSCIFPAIIDRSPIIIGISSFGTAPVLIRILREKLESLIPASIGYLAELAGTWRD
FT                   RVKRYIKNISCRRQFWENLFYSGRILFLIEQGKIDQANKIIQNTIKLNKLNIKKKGSVA
FT                   LVGAGPGDKELLTIRGLQLMQQADIILYDNLVNPDILDLARRDADKIYVGKSANKHSIS
FT                   QDRLNNFMIQLAQKGNDIVRLKGGDSFIFGRGGEELLAISKAGIEFQVVPGITAAIGVA
FT                   AYSGIPLTHRKYAHSVVFITGHEQCNNDYYQINWKSLSDKYQTIVIYMGKLNILNISKN
FT                   LICNGRHINTPVAIISRGTYKDQKILIGTLIELEKLVLTAKQPVLLIVGEVVSLHDKIS
FT                   WFGSNKN"
FT   gene            202181..203098
FT                   /gene="cysD"
FT                   /locus_tag="BVAF_163"
FT   CDS_pept        202181..203098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="BVAF_163"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_163"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33570"
FT                   /db_xref="GOA:E8Q5S3"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5S3"
FT                   /protein_id="ADV33570.1"
FT                   /translation="MLQNQKCITYLNQLESESVYIIREVASEFRNPVMLYSIGKDSSVM
FT                   LHLARKAFYPCSRLPFPLLHIDTGWKFRDMYIFRDNIAKSSDVDLLIYKNQEGISMGID
FT                   PFVHGSSKYTSIMKTESLKKALNKYGFDAAFGGARRDEEKIRSKERIFSFRDKFHVWNP
FT                   KNQRPELWSKYNGRINSGESIRVFPLSNWTELDVWQYIFFEKIDVVPLYLAKSRPVLHR
FT                   NGNLIMVDDNRIELKSEEIIKNRMIRFRTLGCWPLTGAIESEAETLPKVIKEMLLSTKS
FT                   ERSGRVIDFDQVGSMETKKRQGYF"
FT   gene            203112..204542
FT                   /gene="cysN"
FT                   /locus_tag="BVAF_164"
FT   CDS_pept        203112..204542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="BVAF_164"
FT                   /product="sulfate adenylyltransferase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_164"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33571"
FT                   /db_xref="GOA:E8Q5S4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5S4"
FT                   /protein_id="ADV33571.1"
FT                   /translation="MLNILEQEIIDCGGIESYLYTQQNKTLLRFLTCGSVDDGKSTLIG
FT                   RLLHDTQHVYDDQLCNLYSDNDQFGVHKDKIDLSLLVDGLQLERMQGITIDVSYRYFSS
FT                   KKRKFIIVDTPGHEEYTRNMVTGASNSNLAVLLVDACKGIRKQTKRHLFISFLMGIRTI
FT                   IVVVNKMDLVNYDEKIFQDITIKCLKINSYLSESINMKFIPISALDGDNVIQLSKNMSW
FT                   YDGPTLFNILDDIKINFVTDINDQKLRLPIQYIIRDHFNFRGYSGTIASGSLHKGQQIR
FT                   VFPSNITSYIKQILNCDKNQTNALTGEAVTITLTDDIDVSKGDILIDSKEKINFVESVV
FT                   IDVIWMKKDALKKGQYFDVKITTKFYRVQIKDIYYQIDMHTFIHQQSDEIPYNGIGVIE
FT                   LLFEEPVILDEYLKYPVTGSMIFIDILSNDTVGAGMVKNSKIHQVDELNNKKYSEFELA
FT                   LHELIQFHFPHWNVPDLT"
FT   gene            204570..205187
FT                   /gene="cysC"
FT                   /locus_tag="BVAF_165"
FT   CDS_pept        204570..205187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="BVAF_165"
FT                   /product="adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_165"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33572"
FT                   /db_xref="GOA:E8Q5S5"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5S5"
FT                   /protein_id="ADV33572.1"
FT                   /translation="MMIKNNNGFRGRNISWSSYCINRKNREKLHKHRAIVLWFTGLSGS
FT                   GKTTLASFLEERLYHEGISTYVLDGDNIRYGLCSNLSFSHQDRYENIRRAGEVAWLMFD
FT                   AGLVVLVAFISPCSSDRKMVRNMFFKNCFLEIYIDTPIEVCKSRDSKNLYKQVQEGKIK
FT                   NFTGIDSPYESPENPDIYLDGTKTIQELINQLFDAVILKIFV"
FT   gene            205354..205635
FT                   /gene="ftsB"
FT                   /gene_synonym="ygbQ"
FT                   /locus_tag="BVAF_166"
FT   CDS_pept        205354..205635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsB"
FT                   /gene_synonym="ygbQ"
FT                   /locus_tag="BVAF_166"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_166"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33573"
FT                   /db_xref="GOA:E8Q5S6"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5S6"
FT                   /protein_id="ADV33573.1"
FT                   /translation="MGKSGYLLLVILVWIQYSLWLGKNGILVCINIYNERKLYKCMNNI
FT                   DQMKIRNSQLLLEIHDLLYGYELIEEHARYNLGMIKKDEIFYCIKFND"
FT   gene            205702..206430
FT                   /gene="ispD"
FT                   /gene_synonym="ygbP"
FT                   /locus_tag="BVAF_167"
FT   CDS_pept        205702..206430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /gene_synonym="ygbP"
FT                   /locus_tag="BVAF_167"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_167"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33574"
FT                   /db_xref="GOA:E8Q5S7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5S7"
FT                   /protein_id="ADV33574.1"
FT                   /translation="MYLDHNNFPDMTAILPAAGIGGRMHSFPPKQYCIIGNKTLIEYSI
FT                   NVLLQQSNIKHCIVVINCNDNWFSKLSVSYDPRVSVVIGGKTRADSVMAGLKHVKKSMW
FT                   VIIHDAVRPCLHYQDLLRLFKITQFSKIGGILATPVVNTVKKAYVGSNFISHTVSRNDL
FT                   WHSLTPQLFNYNLLKKCLEKALINQIIISDEASAIEYCGYTSILVRGRSDNIKITYKDD
FT                   LRLAKFYLSEIYRNKNIFKI"
FT   gene            206427..206900
FT                   /gene="ispF"
FT                   /locus_tag="BVAF_168"
FT   CDS_pept        206427..206900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BVAF_168"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_168"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33575"
FT                   /db_xref="GOA:E8Q5S8"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5S8"
FT                   /protein_id="ADV33575.1"
FT                   /translation="MIRIGHGFDVHRFGGCRPLIIGGVLVPFEKKVVAHSDGDVVIHSI
FT                   IDALLGASSNRDIGTLFSDTDSRYNNINSRILLRTVWNKISDQGYSIGNIDVTVILQQP
FT                   TIQKYISQMIYYLSQDLNCVLSAINIKATTTEDLGYIGRSEGIACTAIVLLKK"
FT   gene            207508..208398
FT                   /gene="nlpD"
FT                   /locus_tag="BVAF_169"
FT   CDS_pept        207508..208398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD"
FT                   /locus_tag="BVAF_169"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_169"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33576"
FT                   /db_xref="GOA:E8Q5S9"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5S9"
FT                   /protein_id="ADV33576.1"
FT                   /translation="MLDEILVVYKMVIFTFLEILLYFGIYLNLDFYMPYRMYFNTVKCI
FT                   SCIEQWRFCYAPEKHNFFHEYNNLNYNVYKDSVYVVKAGDTLFYIAWITGNNYLDLSKK
FT                   NNISDINMLKVGQVIKVKQNIIIWSLYCIRNKIKEKYILLRKTYIKLYKINFFNNITSC
FT                   FNKSDKIIFTYYWARPTLGKIINTFSDCEGGNKGIDISGLFNQPIFAAYSGKVIYVGDV
FT                   LKGYGNLIIIKHDNDYLSAYAHNNKILVTERQQVKTGEQIATMGNSGTNEVKLHFEIRH
FT                   KGKSVNPLFLISFTY"
FT   gene            208601..211255
FT                   /gene="alaS"
FT                   /locus_tag="BVAF_170"
FT   CDS_pept        208601..211255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="BVAF_170"
FT                   /product="alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_170"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33577"
FT                   /db_xref="GOA:E8Q5T0"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5T0"
FT                   /protein_id="ADV33577.1"
FT                   /translation="MYKSIVDVRQEFLNFFHKKEHQIISSSSLIPENDQTLLFTNSGMN
FT                   QFKNIFLGIEKVLFKRVVTAQRCMRAGGKHNDLNNVGYTERHLTFFEMLGNFSFGDYFK
FT                   DSAIEFAWELLTDSNWFALSKDKIWITTHICDNESYDIWTKHIGISKKRVIKIGSKNGH
FT                   YSDSDNFWKMGNIGPCGPCSEIFYDLGDKFPGVPPNNDMTASSERYVEIWNLVFMQFNQ
FT                   RSNGNLESLPMLSVDTGMGLERITAILQGMCSNYLIDVFKNLIISISEVMNVKKSIADR
FT                   SLYVIADHIRACAFLIKDGIIPDNEGRGYVLRRIIRRAVCHGRKLGVNGIFFYKLVTPL
FT                   ISSMSYITEILCDQVDLIEKILFNEEKLFENTLNKGLKLLRKSLIELKNNKILSGRVAF
FT                   QLYSTYGFPLDLTQDICHEYNIKIDQLEFDQIMLKEKKQSKQLNRFCRVSGDITIPIDI
FT                   SSIFVGYKHVTYRAKIIALFQNNEAVKIVKSNTESMVILDFTPFYGESGGQIGDCGYLR
FT                   AESGGVFEVRNTKKYGNITVQIGILKSGKINVGEEVFAQVNPLKRKLICLNHSATHLLH
FT                   AALLEILGSHVTQKGSLINDRCLRFDFSHYDAMTEKQINSVENFINQQIWSNWVITEDL
FT                   MPIESAYNNTDIIMLSKKQYNQEVRVVRIGNFSSELCTGTHSKNTGKIGLFVIVKELGI
FT                   GAGIRRIEATTKDLALSIIQRKRTLIQNIIQIMHTDDDHLLNKIHALKLFSNKLEKEIR
FT                   VLKNKQETQKILSSAHEVYYIKNVPILVKQIENIELETVFYMVGCIKRHLKSGLIVLIN
FT                   TRINNSIHLIVSVTEDLIERNHINSLDVVHYIMHNVGGKGGGKSDFAQAKIDNVINKSE
FT                   FVANVKLLLRNFL"
FT   gene            211401..211571
FT                   /gene="csrA"
FT                   /locus_tag="BVAF_171"
FT   CDS_pept        211401..211571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="BVAF_171"
FT                   /product="carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_171"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33578"
FT                   /db_xref="GOA:E8Q5T1"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5T1"
FT                   /protein_id="ADV33578.1"
FT                   /translation="MLILTRRVGETLIIGDEITVTVLGVKGNQIRIGVNAPKKISIHRE
FT                   EIYRKIQDEKN"
FT   gene            211777..211866
FT                   /locus_tag="BVAF_172"
FT   tRNA            211777..211866
FT                   /locus_tag="BVAF_172"
FT                   /product="tRNA-Ser"
FT   gene            211937..212010
FT                   /locus_tag="BVAF_173"
FT   tRNA            211937..212010
FT                   /locus_tag="BVAF_173"
FT                   /product="tRNA-Arg"
FT   gene            213038..213292
FT                   /gene="rpsP"
FT                   /locus_tag="BVAF_174"
FT   CDS_pept        213038..213292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BVAF_174"
FT                   /product="30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_174"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33579"
FT                   /db_xref="GOA:E8Q5T2"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5T2"
FT                   /protein_id="ADV33579.1"
FT                   /translation="MVRIRLARGGMKRNPFYYIVVTDSRNSRDGSFMERVGFFNPLGLN
FT                   VSKRVFIKLDRIQYWINQGANPSNRVCELIKKSKRLLST"
FT   gene            213330..213899
FT                   /gene="rimM"
FT                   /locus_tag="BVAF_175"
FT   CDS_pept        213330..213899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="BVAF_175"
FT                   /product="ribosome maturation factor rimM"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_175"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33580"
FT                   /db_xref="GOA:E8Q5T3"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5T3"
FT                   /protein_id="ADV33580.1"
FT                   /translation="MDFFLENTEPLDPVIIGKIGGAYGVQGWLKIISFTDKIEDIFKYC
FT                   PWFILLRSQWKLMILENWRVINKHYIAKISDISSREIAMSLAQCNLIIDSKSLPILKKE
FT                   GEYYWKDIIGCEVINIDGDYLGYVINIIETQAHDVLVIKLNSHDDVKIKSCLIPFVQKK
FT                   IIKYVSIINRTIIVDWGIYDRSRDKK"
FT   gene            213923..214681
FT                   /gene="trmD"
FT                   /locus_tag="BVAF_176"
FT   CDS_pept        213923..214681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="BVAF_176"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_176"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33581"
FT                   /db_xref="GOA:E8Q5T4"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5T4"
FT                   /protein_id="ADV33581.1"
FT                   /translation="MLFGIITLFPEMFNAVTHYGVVGKSVRNGIISVKLWNPREFSRNS
FT                   YKKVDDYPYGGGAGMLMSSQPLKEAITAAQNTLGEGSKVIYLSPQGKRLNHKYVCKLAQ
FT                   NEKNLILVCGRYQGIDERIIQMKINEEWSIGDYVLSGGELAAMVFIDTIARVLPGTLNN
FT                   QESKRSNSFFKNRLNYPHYTRPEVFEGMRVPAILLSGNHGQISRWRLKQSLGRTWLKRP
FT                   DLLKKLNLSKEEKILLTEFKNEYLVSLSNE"
FT   gene            214696..215040
FT                   /gene="rplS"
FT                   /locus_tag="BVAF_177"
FT   CDS_pept        214696..215040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="BVAF_177"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_177"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33582"
FT                   /db_xref="GOA:E8Q5T5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5T5"
FT                   /protein_id="ADV33582.1"
FT                   /translation="MYEVIKKFELQQIKKNIPRLHPGDIIAVKLWVVEDGNKKRFQIFE
FT                   GMVISIKNKGLHSTFTVRKIASGEGVERVFQMHSPVIKDIKIKKLGIVRKAKLYYLRDL
FT                   QGKSARIKTR"
FT   gene            215526..216626
FT                   /gene="aroF"
FT                   /locus_tag="BVAF_178"
FT   CDS_pept        215526..216626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="BVAF_178"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   Tyr-sensitive"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_178"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33583"
FT                   /db_xref="GOA:E8Q5T6"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5T6"
FT                   /protein_id="ADV33583.1"
FT                   /translation="MQKNNQKILQNCNMQSIIAPEQLKLKFPLIKINQRSVEYSQNVIN
FT                   NIIHKKDPRLLVICGPCSINDINAAFDYAKKLKCLSTELEDQLYIVMRVYLEKPRTITG
FT                   WKGLINDPYMDGSGDIESGLQISRRLLLQLIEIGLPLATEILNPIFPQYIGELFSWVSI
FT                   GARTTESQIHREVASGLQSAVGFKNSTDGNINHAINAIQASMIPHHCISIDQTGQICVL
FT                   NTEGNINSHIILRGGMHPNYYPENIIYCEQRIMEVGLNPVLIIDCSHGNSKKDYTQQVD
FT                   VAKSIVDQIKLGNRSIVGFMLESYLYSGNQILDFNNLSSMKYGVSVTDACINWEKTQEL
FT                   LYYVYRELKSILTTRLVGGPKRNDRK"
FT   gene            216613..217737
FT                   /gene="tyrA"
FT                   /locus_tag="BVAF_179"
FT   CDS_pept        216613..217737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="BVAF_179"
FT                   /product="T-protein (includes chorismate mutase and
FT                   prephenate dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_179"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33584"
FT                   /db_xref="GOA:E8Q5T7"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008244"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011277"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5T7"
FT                   /protein_id="ADV33584.1"
FT                   /translation="MIENKLNVLRNEIDKIDKNLIELLSRRLSLVSQIGKIKSRFGLFI
FT                   YSPEREEQLMSCRKKEAIKLGISPDLVEDVLRRIMRESYYKESKKGFKRLYSDCRPVVI
FT                   IGGKGRMGQFFAKMLTLSGYQVKILDQDDWINAKSILINVGVVFISVPIHLMTKVVNTL
FT                   PPLPDDCVIIDLSSIKTISLKTILNIHSGPVLGLHPMFSPDNENMIKQAIICCEGRYPE
FT                   SYQWVLKQLQLWGAKLYYCTSMEHDKYMSFIQSLCHLITFADGYHLFKENVDLDKMISF
FT                   SSPIFKLKLITIGRLFHQDPQLYANIIMESHDNLILIKRYYKRLGTMLMWLERNDKIEF
FT                   IVRFNKIKNWLGVHADAFFKDSCKLLQLITDMKK"
FT   gene            complement(217908..218495)
FT                   /gene="pheA"
FT                   /locus_tag="BVAF_180"
FT   CDS_pept        complement(217908..218495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="BVAF_180"
FT                   /product="prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_180"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33585"
FT                   /db_xref="GOA:E8Q5T8"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5T8"
FT                   /protein_id="ADV33585.1"
FT                   /translation="MTQNKATIHIAFLGPKGSYSHIAAMKYAHYYFGKFIECSCQNFQD
FT                   IFFLVETQKAEYGILPIENSNSGFIEEVCNLLSKTHLMLIGNITIPIQHHILVKNNQIS
FT                   LNKIKIIYSHPQPVQQCSKFLKKNSNLKILLCASSAVAIKKVAFLNQPNIAALGSIQGG
FT                   EYYGLQPLLLPQIISNHPYNSTRFVIVKNTNF"
FT   gene            complement(218653..219438)
FT                   /gene="yfiO"
FT                   /locus_tag="BVAF_181"
FT   CDS_pept        complement(218653..219438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiO"
FT                   /locus_tag="BVAF_181"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_181"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33586"
FT                   /db_xref="GOA:E8Q5T9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5T9"
FT                   /protein_id="ADV33586.1"
FT                   /translation="MMKINNKNNQKIKFIKPYILLSSILIINIFSTSFLMAKSHHKIKH
FT                   QNSSDLYKSAHDKLLHNNYTESIQKLLRLNNLHPFEPYPQQIYLDLIYAYYKLHDFQSA
FT                   NNFIQRFLSSYPNHKNLDYVLYMQGLINMNLDKNNSYFAHKYWHKSWFKHNPSYANIAF
FT                   HSFSKIIQNHPNSQYYIDAYKRLIILKNRIANYELAIIKFYDQRNSYISVILRSERMLR
FT                   YFPNTPATYEALYYMKRAYQKVSLLDQSNIVNKIISENK"
FT   gene            219494..220495
FT                   /gene="rluD"
FT                   /locus_tag="BVAF_182"
FT   CDS_pept        219494..220495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="BVAF_182"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_182"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33587"
FT                   /db_xref="GOA:E8Q5U0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5U0"
FT                   /protein_id="ADV33587.1"
FT                   /translation="MLEKIYDNITIKPIVVQIAYSGKRLDWVLSELLPQFSRSQIKRWI
FT                   INKKVVINNQISVLPKKKVISGEIIEINDINNDSTSDCNNNILIPQNISLNIVYEDNDI
FT                   LVINKPSNMVVHPGVKNNKDTVLNALLYRYPSIMQISKQAGIVQRLDKDTTGLMIIAKT
FT                   YLAYTNLLQSFKMKQVIKEYDAVVCGTFSYNAGIISQPIRRHSINRTCMTVHPHGKPAV
FT                   TRYSVVESFGRTYSRIRVYLETGRTHQIRVHMAYINHPVVGDVKYGIKFKNSTTGKLSI
FT                   SDDVSICLSSFNRQALHACKLQLVHPITRLKMHWIVPLPEDMLKLVTVLKKM"
FT   gene            220731..223319
FT                   /gene="clpB"
FT                   /locus_tag="BVAF_183"
FT   CDS_pept        220731..223319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="BVAF_183"
FT                   /product="chaperone protein ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_183"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33588"
FT                   /db_xref="GOA:E8Q5U1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5U1"
FT                   /protein_id="ADV33588.1"
FT                   /translation="MRLDRFTYDFQLALSDAQSIALGRDNQFVEPIHLMYAFLKEENES
FT                   IYVLLNESGVNINKLTKLVIQACDALPTVEGIGGDIQFSSNLITVLNLCDKLSQKYKET
FT                   VISSTIFVLASIKSAGVLSDILKESGMTEIHLEKSIQLLRENNFMHGNSSKNNVKQILK
FT                   KFTVDITKFAEQGNLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGNPGVGKTAIVEGLAQ
FT                   RIINGEVPDGLKNSRILSLDIAALLAGTKYRGEFEERFKKVLNSLVSKDSNIILFIDEL
FT                   HVMVGAGKTDGAMDASNMIKPKLARGELHCVGATTFDEYSKYIEKDAALERRFQKIFII
FT                   EPNIKDTIAILRGLKERYELHHNVHITDPAIVAAATLSKRYISDRQLPDKAIDLIDEAA
FT                   SSIRIQIDSKPEDLDRLDRRIIQLKLEKQALKKESDKASKKRLEILKKELMEQESAYLV
FT                   LESEWKREKSSLSDIQNIKSDLEKAKIALEQARRFGDLDKMSELQYGSIPSLEKKLLNA
FT                   TQSNNKKMRLLRNYVSETEIAEVLSKWTGIPISRILTNEKCKLLNMEKILHQLVIGQDD
FT                   AVQSVSNAIRRSRSGLSDPKRPIGSFMFLGPTGVGKTELCKSLSYFLFDTDSAMVRIDM
FT                   SEFMEKHSVSKLLGAPPGYIGYETGGYLTEAVRRRPYSIVLLDEIEKAHSDIFNVLLQV
FT                   LDDGRLTDNQGRTINFSNTVMIMTSNLGSDLIQKKFKSLDYFEMKTMVLNVVNQYFKPE
FT                   FINRIDEIVVFHPLNIEHLIKIANIQLKELCHRLEEKGYPCTHITKEALLFLSKIGYDS
FT                   VYGARPLKRVIQQYVENPLSQKILAEHFLPGKKIILDVKNNEIIFSQNEI"
FT   gene            223579..224619
FT                   /gene="murB"
FT                   /locus_tag="BVAF_184"
FT   CDS_pept        223579..224619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="BVAF_184"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_184"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33589"
FT                   /db_xref="GOA:E8Q5U2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5U2"
FT                   /protein_id="ADV33589.1"
FT                   /translation="MKHCVQLKLLNTFSVSAYADQLVEVYDECSLLHYWEKSQRDGRGV
FT                   LILGAGSNILFLGDYRGTVLLNRIKGIFITESKVEWRLHVGAGERWNKLVAYTINNNIP
FT                   GLENLACIPGCVGAAPIQNIGAYGLEFSQVCEYVDVLDLEQRKKIRFYCHECCFKYRES
FT                   IFKVNLHKYAILFIGLKLHKHWKPILHYLQLYYPNLSLSTTPHTVLNAIILIRQKKLPD
FT                   PMIHGNAGSFFKNPVVSTNTALSLLNKYPNMPYYIHQNDKIKLLAGWLIENCKLKGYVL
FT                   GEASVYYKNALILINNRQKATGMEIAKLAYYVYNKVAIKFNIYLQPEVRLMGQIGEINL
FT                   VKMFSN"
FT   gene            224803..225573
FT                   /gene="birA"
FT                   /locus_tag="BVAF_185"
FT   CDS_pept        224803..225573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="BVAF_185"
FT                   /product="biotin-(acetyl-CoA-carboxylase) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_185"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33590"
FT                   /db_xref="GOA:E8Q5U3"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5U3"
FT                   /protein_id="ADV33590.1"
FT                   /translation="MSEVEISAQLSEGRVVVLDIIHSTSQYIIDNLKYVKPGDVFVTEN
FT                   QTQGRGRRGNLWISPDKQSICLSMYWRLSRKLFTTIELSLIISFAVSEVLKRIGIFQVK
FT                   IKWPNDLYVNGKKLAGILIEIITKNKNISHLIIGIGINVSICLNTKLNLKMSESWIDLK
FT                   DINIYTDRNMLVVDLVNELRRTLKHFEHNRCVLFKYYKRIFDYLYNKSVALLIDGNVKY
FT                   GVVVGINSDGSLLVMDRFGIISAYLKENISIQLL"
FT   gene            226282..226354
FT                   /locus_tag="BVAF_186"
FT   tRNA            226282..226354
FT                   /locus_tag="BVAF_186"
FT                   /product="tRNA-Thr"
FT   gene            226384..226465
FT                   /locus_tag="BVAF_187"
FT   tRNA            226384..226465
FT                   /locus_tag="BVAF_187"
FT                   /product="tRNA-Tyr"
FT   gene            226581..226652
FT                   /locus_tag="BVAF_188"
FT   tRNA            226581..226652
FT                   /locus_tag="BVAF_188"
FT                   /product="tRNA-Gly"
FT   gene            226711..226782
FT                   /locus_tag="BVAF_189"
FT   tRNA            226711..226782
FT                   /locus_tag="BVAF_189"
FT                   /product="tRNA-Thr"
FT   gene            226981..227451
FT                   /gene="bfr"
FT                   /locus_tag="BVAF_190"
FT   CDS_pept        226981..227451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="BVAF_190"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_190"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33591"
FT                   /db_xref="GOA:E8Q5U4"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5U4"
FT                   /protein_id="ADV33591.1"
FT                   /translation="MKGDKSIISNLNRLLSNELIAVNQYFLHSKIFKNWGLKRLNDIEH
FT                   TEFMDELKHADLYIERILFLEGSPIIRSINEFSICKNVEDILRMDLQIEYNGINDLKES
FT                   IKNADLAQDYVSKKIMTKVLCDEEKHVGFLETELALINQIGVSNYMQSQMNG"
FT   gene            227669..227980
FT                   /gene="rpsJ"
FT                   /locus_tag="BVAF_191"
FT   CDS_pept        227669..227980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BVAF_191"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_191"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33592"
FT                   /db_xref="GOA:E8Q5U5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5U5"
FT                   /protein_id="ADV33592.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDKSTLEIVETAKRTGAQVHGPVPLPTR
FT                   KERFTILVSPHVNKDARDQYEIRTHKRLIDIVDPTDKTVDALMKLDLAAGVDVQISLG"
FT   gene            228082..228735
FT                   /gene="rplC"
FT                   /locus_tag="BVAF_192"
FT   CDS_pept        228082..228735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BVAF_192"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_192"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33593"
FT                   /db_xref="GOA:E8Q5X7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5X7"
FT                   /protein_id="ADV33593.1"
FT                   /translation="MNGLIGRKLGMTRLFGEDGVSIPVTMVEVLPNHVIQIKNLKRDGY
FT                   CAVQVTTGHSKVNCLNKPQLGHLKKAGVKPGKGLWEFRVNSDSTISLGDVITIEIFKNA
FT                   KEVDVTGISKGKGFSGTIKRWNFHTQDASHGNSLSHRAPGSIGQNQTPGKVFKGKKMAG
FT                   QLGNSRVTVQNLKIINVNLNDNVLLIKGAIPGTIGEHVIVKKSIKVKFGNAGVI"
FT   gene            228732..229373
FT                   /gene="rplD"
FT                   /locus_tag="BVAF_193"
FT   CDS_pept        228732..229373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BVAF_193"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_193"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33594"
FT                   /db_xref="GOA:E8Q5X8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5X8"
FT                   /protein_id="ADV33594.1"
FT                   /translation="MSLELQCFIIGDQNRLNSSVMLPVSEKIFKYPFNMSLIHQVVSSY
FT                   LINSRQGSRSQKSRAEVSGSNKKPWRQKGTGRARSGSLKSPIWRSGGVTFAAKPKKYNQ
FT                   KINKKMYKGAIKSILSKLVSENRLLLIENLFLEKPKTKLFLEKLNCLIALNKSMLFITD
FT                   MIESNVLLATRNLYKVEVRDLYHMDPVSLVKFDIVIFTKKVLNKIETALI"
FT   gene            229370..229672
FT                   /gene="rplW"
FT                   /locus_tag="BVAF_194"
FT   CDS_pept        229370..229672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BVAF_194"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_194"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33595"
FT                   /db_xref="GOA:E8Q5X9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5X9"
FT                   /protein_id="ADV33595.1"
FT                   /translation="MIYIERLLKVIKVPHISEKASIVLEKNNVVILKVSKNSTKMDIQD
FT                   AVCMLFSVTVKKINILMVAGKTKGSKGNIGRRCDWKKAYVILNSGCKIDLFDKIR"
FT   gene            229704..230540
FT                   /gene="rplB"
FT                   /locus_tag="BVAF_195"
FT   CDS_pept        229704..230540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BVAF_195"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_195"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33596"
FT                   /db_xref="GOA:E8Q5Y0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Y0"
FT                   /protein_id="ADV33596.1"
FT                   /translation="MAIIKCNPTSPGRRHLIKLVNTELYKGRPYSELLSKITTKKSGGR
FT                   NNYGRITTRHIGGGHKRRYRIIDFKRNKDNINAIVERIEYDPNRSANIALLLYKDGERR
FT                   YILAPKDLRIGDVVVSGSGIDITIKSGNSLPMINIPVGSIVHNIEMKLGKGGQLARSAG
FT                   TYAQIISKDKGYINLRLRSGEIRKVRCECRATIGEVGNSEHMLRALGKAGANRWRGVRP
FT                   TVRGTAMNPIDHPHGGGEGKNFGKHPVSPWGMQSKGKKTRRNKRTNKFILYNRHNK"
FT   gene            230568..230852
FT                   /gene="rpsS"
FT                   /locus_tag="BVAF_196"
FT   CDS_pept        230568..230852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BVAF_196"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_196"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33597"
FT                   /db_xref="GOA:E8Q5Y1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Y1"
FT                   /protein_id="ADV33597.1"
FT                   /translation="MSRSLKKGPFIDLHLLKKVEKVVKTGDKKPIKTWSRRSTIFPKMI
FT                   GLTILVHNGKQHIPIFISDEMVGHKLGEFSPTRTYRGHHSIDKRIKKRY"
FT   gene            230910..231245
FT                   /gene="rplV"
FT                   /locus_tag="BVAF_197"
FT   CDS_pept        230910..231245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BVAF_197"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_197"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33598"
FT                   /db_xref="GOA:E8Q5Y2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Y2"
FT                   /protein_id="ADV33598.1"
FT                   /translation="MESMAKYRYIRSSAQKVRLVVNMIRGKYVSRALDILNYTNKKSAY
FT                   VVKKTLESAIANAEHNDGMNIDNLKIIKIFVDNGPSIKRIMPRAKGRSDRILKRTSHLT
FT                   VVVSEEK"
FT   gene            231298..232005
FT                   /gene="rpsC"
FT                   /locus_tag="BVAF_198"
FT   CDS_pept        231298..232005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BVAF_198"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_198"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33599"
FT                   /db_xref="GOA:E8Q5Y3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Y3"
FT                   /protein_id="ADV33599.1"
FT                   /translation="MGQKVHPNGMRLGIIKFWYSTWYANNKDFSKNLNNDFEVRRFLTK
FT                   ELSKALISRIIIERPAKSMRVTIYTARPGIVIGKKGGDVEKLREKVAKISGVPTQLNIS
FT                   EVRKPELDAKLLADNIASQLERRVIFRRAIKRAAQSAIRLGAEGIKIEISGRLSGAEIA
FT                   RTEWHREGRVPLHTLRANIDYSLSEAYTTYGVLGVKVWIFKGEILDTKLFDEFKTSAQL
FT                   ISSFSKHRNKTRL"
FT   gene            232040..232453
FT                   /gene="rplP"
FT                   /locus_tag="BVAF_199"
FT   CDS_pept        232040..232453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BVAF_199"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_199"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33600"
FT                   /db_xref="GOA:E8Q5Y4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Y4"
FT                   /protein_id="ADV33600.1"
FT                   /translation="MLYPKRTKYRKMHKGRNRGIVVNDKIHFGTFALKAVDRGRLKSCQ
FT                   IESARRAITRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALVQPGRILYE
FT                   MSGISQDLATYAFKLGASKLPIKTIIIGLQHSE"
FT   gene            232446..232646
FT                   /gene="rpmC"
FT                   /locus_tag="BVAF_200"
FT   CDS_pept        232446..232646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BVAF_200"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_200"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33601"
FT                   /db_xref="GOA:E8Q5Y5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Y5"
FT                   /protein_id="ADV33601.1"
FT                   /translation="MNKFFKILNSNNKTNQSERLKLLHALHKHFNLHIQLKIGQFRKSH
FT                   LLKQSRHDIARLKFFENKKCI"
FT   gene            232673..232930
FT                   /gene="rpsQ"
FT                   /locus_tag="BVAF_201"
FT   CDS_pept        232673..232930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BVAF_201"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_201"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33602"
FT                   /db_xref="GOA:E8Q5Y6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Y6"
FT                   /protein_id="ADV33602.1"
FT                   /translation="MVNKIRVLRGFVISNKMQKSIVVTVDRLVKHPIYRKFIKRTTKFY
FT                   VHDVNNESSVGDLVEFRECRPISKMKSWMMTAIIKRANVS"
FT   gene            233059..233430
FT                   /gene="rplN"
FT                   /locus_tag="BVAF_202"
FT   CDS_pept        233059..233430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BVAF_202"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_202"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33603"
FT                   /db_xref="GOA:E8Q5Y7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Y7"
FT                   /protein_id="ADV33603.1"
FT                   /translation="MIQERTVLNVADNSGARFAMCIKVLGGSKRRYARIGDVIKITVKE
FT                   AIPRAKVKKGDVLKAVVVRTKQGVRRSDGSMIRFDSNSCVLLNDVNLQPVGTRIFGPVT
FT                   RELRNKKFMKIISLAPEVL"
FT   gene            233474..233794
FT                   /gene="rplX"
FT                   /locus_tag="BVAF_203"
FT   CDS_pept        233474..233794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BVAF_203"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_203"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33604"
FT                   /db_xref="GOA:E8Q5Y8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Y8"
FT                   /protein_id="ADV33604.1"
FT                   /translation="MAAKKIRCGDEVIMLNGKDKGKIGKVQCIFSLKNRAMISGINLMK
FT                   KHKKPVPDKNQPGGIFKKEASVDLSNIAIFNPDCKKADKVVFKIKDGKKIRVFKSSGNV
FT                   IK"
FT   gene            233816..234358
FT                   /gene="rplE"
FT                   /locus_tag="BVAF_204"
FT   CDS_pept        233816..234358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BVAF_204"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_204"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33605"
FT                   /db_xref="GOA:E8Q5Y9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Y9"
FT                   /protein_id="ADV33605.1"
FT                   /translation="MANNFYSYYKDNVVFNLMEQFKYKSIMQVPKISKITINMGLGQVV
FT                   LNKKFLEKSISDLTMISGQKPIVTKARKSIASFKIRQGQPIGCKVTLRRMRMWEFLERL
FT                   IVIAIPRIRDFRGLSTKSFDGYGNYSMGIREQIIFPEINYDTVDGIRGMDITITTSASS
FT                   DKEAFALLTAFRFPLKN"
FT   gene            234415..234720
FT                   /gene="rpsN"
FT                   /locus_tag="BVAF_205"
FT   CDS_pept        234415..234720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BVAF_205"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_205"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33606"
FT                   /db_xref="GOA:E8Q5Z0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Z0"
FT                   /protein_id="ADV33606.1"
FT                   /translation="MPKESVKARDKKRLKLINKYYARRLFLKKIIVSHNATNEDKWNAM
FT                   LKLQTLPRDSSPSRLRNRCKQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLRKSSW"
FT   gene            234785..235180
FT                   /gene="rpsH"
FT                   /locus_tag="BVAF_206"
FT   CDS_pept        234785..235180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BVAF_206"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_206"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33607"
FT                   /db_xref="GOA:E8Q5Z1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Z1"
FT                   /protein_id="ADV33607.1"
FT                   /translation="MSTQDPISEMLTAIRNAQISKKDKVCLPSSSIKVAIIKVLTEEGF
FT                   IKQYFVHDGIKPILEICLKYYQYNNPVIESIKRVSRPGLRVYRNKRKIPKVMSGMGVVI
FT                   ISTAKGVMTDKKAKRLNIGGEIICYVS"
FT   gene            235212..235754
FT                   /gene="rplF"
FT                   /locus_tag="BVAF_207"
FT   CDS_pept        235212..235754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BVAF_207"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_207"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33608"
FT                   /db_xref="GOA:E8Q5Z2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Z2"
FT                   /protein_id="ADV33608.1"
FT                   /translation="MTTNYSRTIPIPDSIFVSLVDHCLIVKGKLGKLHCQLNKYICVRF
FT                   DNSNNIIVYTTKFKHVNHKALVGTISSLINGMFIGVRLGFFKKLQLVGIGYRAAIKKGN
FT                   VISLIVGLSHPVNYIIPVGVNAQCVNQTEIILNSANKQLIGQVAADLRAIKPPEPFKGK
FT                   GIRFSNEIVRHKDAKKR"
FT   gene            235793..236152
FT                   /gene="rplR"
FT                   /locus_tag="BVAF_208"
FT   CDS_pept        235793..236152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BVAF_208"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_208"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33609"
FT                   /db_xref="GOA:E8Q5Z3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Z3"
FT                   /protein_id="ADV33609.1"
FT                   /translation="MKNNKKIARVRRAMKMRKKLIELRVLRLAVYKSSKHIYAQIFSTD
FT                   NTEVLVSASTVEKEISTKLDMTGNKKAASLVGQVIAERALKKGIMNVAFDRSGFKYHGR
FT                   VQVLADCARQFGLKF"
FT   gene            236175..236714
FT                   /gene="rpsE"
FT                   /locus_tag="BVAF_209"
FT   CDS_pept        236175..236714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BVAF_209"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_209"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33610"
FT                   /db_xref="GOA:E8Q5Z4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Z4"
FT                   /protein_id="ADV33610.1"
FT                   /translation="MIRYINKQNSNLSEFREKLITVNRVSKTVKGGRVFSFAALTVVGN
FT                   SNGKVGFGYGKAREVPSAIQKAMEKARHNLIDVPFLRTGRTLQHAIVGVYTGARIYMQP
FT                   ASEGTGIIAGGAMRAILEVVGVHNVLAKAYGSTNPINIVRATVNALKTMKSPEMIAKKR
FT                   GKSVEYICGYCNENKK"
FT   gene            236717..236890
FT                   /gene="rpmD"
FT                   /locus_tag="BVAF_210"
FT   CDS_pept        236717..236890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BVAF_210"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_210"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33611"
FT                   /db_xref="GOA:E8Q5Z5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Z5"
FT                   /protein_id="ADV33611.1"
FT                   /translation="MIKITQIKSSIGCVLKHKATLRGLGLRRIGSTVSKMDTPSVRGMI
FT                   NTIAYMVKVEDE"
FT   gene            236901..237356
FT                   /gene="rplO"
FT                   /locus_tag="BVAF_211"
FT   CDS_pept        236901..237356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BVAF_211"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_211"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33612"
FT                   /db_xref="GOA:E8Q5Z6"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Z6"
FT                   /protein_id="ADV33612.1"
FT                   /translation="MSLQLNNISSSQGSRCLKKRVGRGIGSGLGKTGGRGHKGQKSRSG
FT                   CKIGVTFEGGQTALHRRLPKFGFTSKKKMMTKAITLLDLSRISENLIDLNVLRKNNIIG
FT                   NKIRFVKIIMSGKINRAVVIRNIRISKGAKTLIQVAGGRIEREENSK"
FT   gene            237365..238708
FT                   /gene="secY"
FT                   /locus_tag="BVAF_212"
FT   CDS_pept        237365..238708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BVAF_212"
FT                   /product="preprotein translocase subunit secY"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_212"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33613"
FT                   /db_xref="GOA:E8Q5Z7"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Z7"
FT                   /protein_id="ADV33613.1"
FT                   /translation="MGMIDKNRAIFDFQSIKGGFYDLKRRVLFLIGALIIFRIGSFIPI
FT                   PGVDLIVLSQILQEQQGTIIEMLNMFSGGSLSRASIFSLGIMPYISASIIIQLLTAVHP
FT                   VLMEIKKEGESGRRVINQYIRYGTLILSTFQAVGIVIGLPNISGLVLNPGFTFYFIAVI
FT                   SLVSGTIFLMWLGDQITNRGVGNGISIIIFSGIVAGLPSAIGHTIEQVRQNELHFFILI
FT                   LIMCLIFSITFFVVFMEKGQRRILVHYAKPKRQQGRRIYAAQNSTHLPFKVNMAGVIPA
FT                   IFASSVILFPSTIVSWFCSGSSNCYWLTMMSMYLQPGQLLYILIYSSAIIFFCFFYTSL
FT                   VFNPRETADNLKKSGAFVPGIRPGEQTSKYIDKIIVRLTCIGAVYVTFICLVPEFMRIA
FT                   IKVPFYFGGTSLLIVVVVIMDFMAQIQTLLMSSQYESVLKKANLKYYS"
FT   gene            238777..238893
FT                   /gene="rpmJ"
FT                   /locus_tag="BVAF_213"
FT   CDS_pept        238777..238893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BVAF_213"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_213"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33614"
FT                   /db_xref="GOA:E8Q5Z8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Z8"
FT                   /protein_id="ADV33614.1"
FT                   /translation="MKVRASVRKLCRHCVVVKRRNVVRVICRVIPKHKQRQG"
FT   gene            238949..239308
FT                   /gene="rpsM"
FT                   /locus_tag="BVAF_214"
FT   CDS_pept        238949..239308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BVAF_214"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_214"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33615"
FT                   /db_xref="GOA:E8Q5Z9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q5Z9"
FT                   /protein_id="ADV33615.1"
FT                   /translation="MVRIVGVNVPDRKHAVIALMSIYGIGKSLAKEICLNVGIDLHVRI
FT                   NQLSEENIDKLRDEISKYVIEGDLRREINLNIKRLIDLGTYRGLRHRRSLPVRGQRTRT
FT                   NARTRKGPKKFTNKQ"
FT   gene            239361..239753
FT                   /gene="rpsK"
FT                   /locus_tag="BVAF_215"
FT   CDS_pept        239361..239753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BVAF_215"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_215"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33616"
FT                   /db_xref="GOA:E8Q600"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q600"
FT                   /protein_id="ADV33616.1"
FT                   /translation="MIKSSSLRSRKRVKKQITDGIAHIHASFNNTIVTISDRQGNTLGW
FT                   ATSGGSGFRGSRKSTPFAAQIAAERCADIVQEYGVKNLEVMVKGPGPGRESAVRALNAS
FT                   GFNIISITDVTPIPHNGCRPSKKRRV"
FT   gene            239797..240420
FT                   /gene="rpsD"
FT                   /locus_tag="BVAF_216"
FT   CDS_pept        239797..240420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="BVAF_216"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_216"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33617"
FT                   /db_xref="GOA:E8Q601"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q601"
FT                   /protein_id="ADV33617.1"
FT                   /translation="MAKYLGPKLKLSRRENTDLFLKSGIRSIDSKCRFEHSPGQHNIRK
FT                   ARYSDYGMQLREKQKVKRIYGILERQFVNYYKKAARIKGNTGEILLQLLESRLDNVVYR
FT                   MGFGSTRAESRQLVSHKSVVVNGRVVNIPSYQVMSDTVIQISTRSKHQTRIHAALEIAE
FT                   QQRERVLWIEVDSIKLKGFFKRRPERSELSANIDEHLIVELYSK"
FT   gene            240461..241465
FT                   /gene="rpoA"
FT                   /locus_tag="BVAF_217"
FT   CDS_pept        240461..241465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BVAF_217"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_217"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33618"
FT                   /db_xref="GOA:E8Q602"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q602"
FT                   /protein_id="ADV33618.1"
FT                   /translation="MQSPEKEFLKPRLINIEKISEVHAKITLEPLERGFGHTLGNALRR
FT                   VLLSSMPGCAVTEVEIDGVLHEYGIKEGIREDVLEILLNLKTLAIAIEGKDSMILSLKK
FT                   SGVGPVVASDILYDSSIVKIVNPAHVICVITDDHAILSMRIKVQRGRGYVPAFSKFNSI
FT                   LDEQQTAIPIGRLVLDACYSPVERVSYTVEAARVEKRTDLDKLIIDMETNGTIDPEEAI
FT                   RRAATILSDQLSTFIDLNNVYQPEIKEDKPEFDPALLHLVDDLELTVRSANCLKAESIH
FT                   YIGDLVQKTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMCLEKWPPKSFTDR"
FT   gene            241518..241892
FT                   /gene="rplQ"
FT                   /locus_tag="BVAF_218"
FT   CDS_pept        241518..241892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BVAF_218"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_218"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33619"
FT                   /db_xref="GOA:E8Q603"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q603"
FT                   /protein_id="ADV33619.1"
FT                   /translation="MKHRKKIFKLNKNSSHRKAIFKNMVISLITHTIIKTTLSKAKVLR
FT                   QIVEPIITRGKLDTVSNRRLVFSKIRNDDVVSKLFTKVSPHFLNRSGGYTRILKCGFRK
FT                   GDNAPMAYIELIDRNKISQS"
FT   gene            complement(241908..242942)
FT                   /gene="fmt"
FT                   /locus_tag="BVAF_219"
FT   CDS_pept        complement(241908..242942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BVAF_219"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_219"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33620"
FT                   /db_xref="GOA:E8Q604"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q604"
FT                   /protein_id="ADV33620.1"
FT                   /translation="MKFQLQQILRIVFFGTGEFAAYHLYTLINCSAHTIIAIFTQEPQI
FT                   LNKKTQHYFSIYHIIRTYNLPLFQSNTLSMFQILQIIKHRNIDIIIVVSYGLILSKEIL
FT                   SIPKLGCINVHGSLLPRWRGPAPIQRALEHGDIITGISIIQIDSGIDTGNILYTQSCKI
FT                   LPKETSYSLCKKLAYIGSVALLQTMHHITMGTCKNIPQNPLYATYAPKVSKLEARINWK
FT                   NSAEELERRIRAFNPWPISYFQLKTKRIKVWGAEINNNSSITTTKPHPSHPFHSLLRND
FT                   NLHSYSFLTPGTILKINSKGIYVATGNGTIILTILQIPGKKKTPVKCLLNSYSLWFPIN
FT                   AVLK"
FT   gene            complement(242983..243489)
FT                   /gene="def"
FT                   /locus_tag="BVAF_220"
FT   CDS_pept        complement(242983..243489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="BVAF_220"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_220"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33621"
FT                   /db_xref="GOA:E8Q605"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q605"
FT                   /protein_id="ADV33621.1"
FT                   /translation="MSILKILHYPDKRLRKTAKFVSKISKHTKRIIFDMFDTMYAQQGI
FT                   GLAATQVDIDQQIIVIDLYQNITQRLVFINPIIIKKIGIIHTVEGCLSIPKIKESIPRS
FT                   KQIIVRSLNQDGNIFEITATDLLSVCIQHEIDHLLGKLFIDYLSPLKIKRINKKIQKWT
FT                   KLLNK"
FT   gene            243835..244410
FT                   /gene="yrdC"
FT                   /locus_tag="BVAF_221"
FT   CDS_pept        243835..244410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdC"
FT                   /locus_tag="BVAF_221"
FT                   /product="putative ribosome maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_221"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33622"
FT                   /db_xref="GOA:E8Q606"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q606"
FT                   /protein_id="ADV33622.1"
FT                   /translation="MIINSITEYSIKNLSMQLKKNRVIIYPTESVFGLGCNPDSESAIR
FT                   TLLKIKRRSWKKGLILVAANYSQLLKYVDDRLLSDNQRLLVFSTWPGPVTWVFPARVGT
FT                   PYWLTGQFSSIAVRVSDFKPIRYLCLDFGKPLVSTSANLSGYPPARTVIEVHNQFRYYN
FT                   LPIMHHNVLGLPCPSEIRDVVSGRIIRK"
FT   gene            244437..245339
FT                   /gene="aroE"
FT                   /locus_tag="BVAF_222"
FT   CDS_pept        244437..245339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="BVAF_222"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_222"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33623"
FT                   /db_xref="GOA:E8Q607"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q607"
FT                   /protein_id="ADV33623.1"
FT                   /translation="MSAFAVFGNPIKHSKSAEIYSLFAKEIGISSKYDLRLVSKIEDFD
FT                   IVVRNFFDTGGLGANFTVPFKERAFFLCNQLTDRALMANAVNTIKKRSDNSLLGDNTDG
FT                   IGLMNDLKRLCWLDFDDSIIEMNENKNLSSRKSDTHILLIGAGGAARGIIPMLLNIKGC
FT                   YINVVNRTLLNAQKLVYYYHSIGCQNISYIDINKLKFHHGYNIKKYDLIINASSSSMSH
FT                   VIPMIPSFLVSCFTKCYDVFYQNQDTVFITWCKKHGSNYCSDGLGMLVEQAAYAFYLWH
FT                   NIFPSVKSVIDFLKSKNYV"
FT   gene            245501..245615
FT                   /gene="rrf"
FT                   /locus_tag="BVAF_223"
FT   rRNA            245501..245615
FT                   /gene="rrf"
FT                   /locus_tag="BVAF_223"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(245830..246600)
FT                   /gene="gloB"
FT                   /locus_tag="BVAF_224"
FT   CDS_pept        complement(245830..246600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="BVAF_224"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_224"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33624"
FT                   /db_xref="GOA:E8Q608"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q608"
FT                   /protein_id="ADV33624.1"
FT                   /translation="MKIITILTLKTNYIWVIYNQLNECIIVDPGEFVQVLKILNKLKLI
FT                   LKAILLTHNHHDHINGIYELIKHFPNVQIYGPIDILNTGTKLVTVSDKDEFFLLNKKVM
FT                   VIGLPGHTLNHIGFYYNSWLFTGDTLFSAGCGKVQTGLIRHMYQSFLKIQCFPENTELY
FT                   PGHEYTLSNLNFALSILPEDPEIVKYNKKITTLHRRQQRIFAPMTLALELKINLFFRCN
FT                   NNNKNLKYALNCFPKTGKEWKIFRNLRNKKDLYP"
FT   gene            complement(246803..247297)
FT                   /gene="rnhA"
FT                   /locus_tag="BVAF_225"
FT   CDS_pept        complement(246803..247297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="BVAF_225"
FT                   /product="ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_225"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33625"
FT                   /db_xref="GOA:E8Q609"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q609"
FT                   /protein_id="ADV33625.1"
FT                   /translation="MHKQIEIFTDGSCLGNPGPGGCAAILRYKQYKKEFSAGYYLTTNN
FT                   RMELMAAIIALESLKNPCQVTLYSDSQYLLIGITQWIHIWKKHHWKTAEEKLIKNIDLW
FT                   RRLNSAIHSHSIKNWHWLKSHTGHPSNERCDQLARKAAKHPLNKDYDNSPIILYDNNII
FT                   T"
FT   gene            247354..248109
FT                   /gene="dnaQ"
FT                   /locus_tag="BVAF_226"
FT   CDS_pept        247354..248109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="BVAF_226"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_226"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33626"
FT                   /db_xref="GOA:E8Q610"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q610"
FT                   /protein_id="ADV33626.1"
FT                   /translation="MNINTTRYVILDTETTGMNKFGIHYEGHKIIEIGAVEIINRSLTK
FT                   NKFHVYLNPNRPVDSEAFKIHGISDRFLKDKPVFSDISNKFLSFICGSNLVIHNASFDV
FT                   GFLNFELRETNLKYKTLETYCSIIDSLKLARNLFPGQRNSLDALCERYFIDISQRNLHN
FT                   ALIDAQILAYVFLAMTGGQTEMQLTNDIINLDKNTSVLSDMQRSYNVDTQEIKSLNIIY
FT                   ATVEEKTNHNRYLELIEKQSGKCLWKKCN"
FT   gene            248252..248842
FT                   /gene="gmhA"
FT                   /locus_tag="BVAF_227"
FT   CDS_pept        248252..248842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="BVAF_227"
FT                   /product="phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_227"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33627"
FT                   /db_xref="GOA:E8Q611"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q611"
FT                   /protein_id="ADV33627.1"
FT                   /translation="MYGNLIFNEFNKIIGMMKIFLKNSNGVDEILISAKLISDAFKLGG
FT                   KVLSCGNGGSLCHAMHFAEELTGRYRENRIGYPAIAISDPSYLSCVSNDFGYENVFSRY
FT                   VKSIGNKKDVLLAISSSGESVNILNAIEEAHNIGMKVIFLTRESKLKNKFSSYVDVEIC
FT                   APFSRHLDHIQEMHMKIIHVLVLIIEKEMLSTV"
FT   gene            248950..249023
FT                   /locus_tag="BVAF_228"
FT   tRNA            248950..249023
FT                   /locus_tag="BVAF_228"
FT                   /product="tRNA-Thr"
FT   gene            complement(249212..249811)
FT                   /gene="ahpC"
FT                   /locus_tag="BVAF_229"
FT   CDS_pept        complement(249212..249811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="BVAF_229"
FT                   /product="peroxiredoxin, AhpC-TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_229"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33628"
FT                   /db_xref="GOA:E8Q612"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q612"
FT                   /protein_id="ADV33628.1"
FT                   /translation="MLVSYSAPDFTAPAVLNDGKIIDNFNLFQHIKNKKSVVFFWPMDF
FT                   TFVCPSELIACDKRYFEFQNREVEVIGVSIDSVFVHNAWRQLPVNKGGIGFVQYPMVSD
FT                   VKREIIKKYRIEHSSKGVGLRASFLIDKSGIIRHQVVNDLPFGRNFDEMIRMVDAIQFH
FT                   ETHGLLCPAQWNKNKSGLHASQKSVEEYLSNNLSQL"
FT   gene            250077..251157
FT                   /pseudo
FT                   /gene="queA"
FT                   /locus_tag="BVAF_230"
FT   gene            251268..252374
FT                   /gene="tgt"
FT                   /locus_tag="BVAF_231"
FT   CDS_pept        251268..252374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="BVAF_231"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_231"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33629"
FT                   /db_xref="GOA:E8Q613"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q613"
FT                   /protein_id="ADV33629.1"
FT                   /translation="MIFQLLQTDGSARFGKLICNHGIINTPTFIPVGTYGVIKTVTPQE
FT                   IKESGAQIILSNTFHLWLRLGQNIIKIHNNLHNFMNWNGPIITDSGGFQVFSLRKLRKI
FT                   TTAGVHFKNPVNGLSVCLTPEKSIEVQTDLGSDIVLVLDECVSYPNTWNYIKNSINLSL
FT                   NWAERSRLYFDKLHNSNMLFAIVQGGIYRKLREESAIKLTDMNFDGYAIGGLAVGEPRQ
FT                   KMYDLISHICQILPVNKPRYLMGVGKPKDLVEAVLRGIDMFDCVIPTRNARNGYLFVYG
FT                   GVVRIRNAKYKTDTGPIEKNCDCYTCKYYSRSYLHYLDKCREVLGMRLNTIHNLRFFQR
FT                   LMENLRQAIKNKELSKFVNLFYRQIDII"
FT   gene            252442..252789
FT                   /gene="yajC"
FT                   /locus_tag="BVAF_232"
FT   CDS_pept        252442..252789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="BVAF_232"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_232"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33630"
FT                   /db_xref="GOA:E8Q614"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q614"
FT                   /protein_id="ADV33630.1"
FT                   /translation="MSWLINKVWANSNTVDQGNPYSLIIMLLLFAIIFYFVIFRPQQKR
FT                   NKEHKELLNSITKGDEIITSGGLVGRVLRITETGYIFITLNFKDTDINNEVLIKKDCVT
FT                   AILPKGTVKAL"
FT   gene            252824..254677
FT                   /gene="secD"
FT                   /locus_tag="BVAF_233"
FT   CDS_pept        252824..254677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="BVAF_233"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_233"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33631"
FT                   /db_xref="GOA:E8Q615"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q615"
FT                   /protein_id="ADV33631.1"
FT                   /translation="MINSYPIWKYVIVFLVLIIGCIYMLPNLYQENYAISIVKNDLSNC
FT                   NIYSISKSNILNILKKEKIISKSIFFHDDKIQICFFSELDQKRAYGVLFSIFSENFSVS
FT                   CLKIPDMPNWLYLIGAKPIQLGLDLKGGLYLIIRVDIQTMLNKLQDYYFNNFKSILNEN
FT                   NIFYLRLNKINDYDLKIVFENADIRNKSILYLSKIYPELIFYTKEECIVCISFSKEYIH
FT                   TMCEYAIQQNSNILRHRINQLQITEPLIHRYGSDCIVIELPGIQDSSKIKTIFNNAASL
FT                   EFRLVNTKINEFQINNNFIPEDSEIKLDSNGNIIALYKKVILTGDHIIGANLNFDEYHR
FT                   PRVNILLDNLGSLIISKFTQDNIGKVMATLFVEYKDTGEKDKQGYSILYRYDKVINIAT
FT                   IQSKLSHNFCIIGINNVKEARYLSSLLSMGSLIAPIYIEEERVIGPTLGKKNIAQGITA
FT                   CVLGILISIFFMITWYRFFGLIAGVALIVNLILMVSLMSLIPGVILTMPSIAGVILTLA
FT                   VSIDSNVLINERIKEEIKQGKPMQYSIYVGYRKAFTSIIDANITTIIVSIILYIISTGP
FT                   IQGFAMVTIIGVGTSMFTSIIGTRAFVNLIYGKRYIKKLSI"
FT   gene            254706..255623
FT                   /gene="secF"
FT                   /locus_tag="BVAF_234"
FT   CDS_pept        254706..255623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="BVAF_234"
FT                   /product="protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_234"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33632"
FT                   /db_xref="GOA:E8Q616"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q616"
FT                   /protein_id="ADV33632.1"
FT                   /translation="MPKIKDFTPHNKVYDFIFYGRDVFFVFIFLCAISFIVMKLYNFNW
FT                   GLDFTGGLLIEVVSDKDLDIDKIRNSFIKFGFKTPVIQYLNNTNGGVIIRVPLMKGVSC
FT                   FSQQIEKEILNILDHGINHQFVMQQINWIGPNSSKNLIKTTIIAFFMTFLCIFLYITYR
FT                   FELTLSIATFISLIYDIIITLGFLSVFYIEINSTTITALISSMGYSLNDKIVIFDRIRE
FT                   NFSCMSKLSCYAVFNRSLTQVLNRTIITSVTTIMVLLILLIFGGAMLYEFSITLLFGVI
FT                   IGTISSIYVASFLAFRLKDINISS"
FT   gene            255806..256957
FT                   /gene="ribD"
FT                   /locus_tag="BVAF_235"
FT   CDS_pept        255806..256957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="BVAF_235"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_235"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33633"
FT                   /db_xref="GOA:E8Q617"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q617"
FT                   /protein_id="ADV33633.1"
FT                   /translation="MIKNVIPEDIGYLSRAFQLARKGRFTTMPNPNVGCVIVKDNHVIG
FT                   EGYHMRAGENHAEINALSVAGNFAKGATAYVTLEPCSHYGRTPPCTTALIKSGIKRVVV
FT                   SMLDPHPDLTGRGIQLLKQSGILVSHSIMLSEAESINKGFIKRIRTGMPWIKLKLASSL
FT                   DGRVAMSSGESKWITSVQSRQDVQCFRAESDVILSTASTVLMDNPRLNVRWSCFSKEMK
FT                   NIYINGNQIRHPLRVIIDSTNRILPTHRFIQNEGGVILVRIKKDNLNWPKSVEQLLVSP
FT                   IVNKSGLNQINLKKLMQYLACYLKINSVWVESGPTLSGALLDIGLVDEVILYQAIKFLG
FT                   SNAKPLCLLPNLNKLSDIKTFKLIDITSIGPDIRLILQPNTVV"
FT   gene            257066..257569
FT                   /gene="ribH"
FT                   /locus_tag="BVAF_236"
FT   CDS_pept        257066..257569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="BVAF_236"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_236"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33634"
FT                   /db_xref="GOA:E8Q618"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q618"
FT                   /protein_id="ADV33634.1"
FT                   /translation="MNVIESNNVVTNAVKIAIVVARFNRFINNNLLDGAIDVLRRIGCV
FT                   KDQNITVVWVPGAYELSLAIKALAITNSIRNNNKNKNNYDALIALGTIIRGETEHFHFI
FT                   SRSCSAQLTKISIDNILPIGLGLLVTNNVKQAVERAGIKDKNKGAEAALAVLEMINILK
FT                   LLNY"
FT   gene            257616..258038
FT                   /gene="nusB"
FT                   /locus_tag="BVAF_237"
FT   CDS_pept        257616..258038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="BVAF_237"
FT                   /product="N utilization substance protein B-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_237"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33635"
FT                   /db_xref="GOA:E8Q619"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q619"
FT                   /protein_id="ADV33635.1"
FT                   /translation="MKFITRRLARLCALQALYSWQFSKNDLIEIENYIVSIQNIQNFDI
FT                   SYFRELYIGVINCISDLDKLMIPYLFRDLKTIGYVEYSVLLIALFELTQCYDIPYKVVM
FT                   NEAIELAKIFGSEKSYKFINGVLNKIVTEKLFIPIK"
FT   gene            258144..258608
FT                   /gene="pgpA"
FT                   /locus_tag="BVAF_238"
FT   CDS_pept        258144..258608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="BVAF_238"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_238"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33636"
FT                   /db_xref="GOA:E8Q620"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q620"
FT                   /protein_id="ADV33636.1"
FT                   /translation="MKIMYFFATGFGIGKISIMMPVVGTIASLLAIPMWWGLVYFFSYQ
FT                   TYFIFLILGIIFGIYLCGKVTKFIGIHDHQSIVWDEFVGMWITLIVVPLYSWMWIVVAF
FT                   LLFRVFDVIKPWPISWCDRVIKGGFGIIIDDILAGFISIHIILFFMQIFP"
FT   gene            complement(258697..260582)
FT                   /gene="dxs"
FT                   /locus_tag="BVAF_239"
FT                   /note="frameshift in poly-A tract; RNA polymerase or
FT                   ribosomal slippage"
FT   CDS_pept        complement(join(258697..259973,259973..260582))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="dxs"
FT                   /locus_tag="BVAF_239"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_239"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33637"
FT                   /db_xref="GOA:E8Q621"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q621"
FT                   /protein_id="ADV33637.1"
FT                   /translation="MHMINDDSNIYSILEFINTPEELRQLPENKLNKLCNELRQFLLNS
FT                   VSKSSGHFASGLGVVELTVALHYVYNTPFDYLIWDVGHQSYPHKILTGRKKRIYSIRQR
FT                   NGLHPFPCRDESKYDVLSVGHSSTSISAGLGLAIAAEREMLNRHTVCIIGDGALTAGMA
FT                   FEAINHAGTVKSTNLLIILNDNDMSISENVGALHTSSCKTKKKKYLNITSNIKKLCRNI
FT                   FINHEENNFTIAMELFKNLGFNCIGPIDGHNVYKLIHNLRNIRNTKKGPQFLHIITKKG
FT                   YGYKPAEKDPIKWHAVPKFNLNSGIIPTNQHNIKKNITYSEVFGEWLCQIATQDNKIIG
FT                   ITPAMREGSGMSKFSKKYPKQYFDVAIAEQHAVTFAAGLAIAGYKPVVAIYSTFLQRAY
FT                   DQFIHDIAIQKLPVLFAIDRGGIVGADGQTHQGAFDLSYLRCIPNTIIMTPSDAYECKL
FT                   MLNTGYLYQKGPSIVRYPKEYTTNNNIPNDNNIKQLYSIPLNKGIIRHHGQHIAILNFG
FT                   ALLKAAYNVALQLNATLVDMRFVKPLDETLIKNLAKNHQALITLEENAITGGAGSGVNE
FT                   ILMRNNKLLIPILNIGLPDFFIQQGSRTEILSELGLDSSGIYKKIMDWIIMQ"
FT   gene            261256..262755
FT                   /gene="thiI"
FT                   /locus_tag="BVAF_240"
FT   CDS_pept        261256..262755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="BVAF_240"
FT                   /product="tRNA sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_240"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33638"
FT                   /db_xref="GOA:E8Q622"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q622"
FT                   /protein_id="ADV33638.1"
FT                   /translation="MKIIIKFSPEIIIKSRSVRVFFINVLVKNIKKVLKQYNTLALLRV
FT                   HWDNIEIQSECGSYLEISKILVNVPGIHSVLWVHDSIINSLEDIYNQVIRTKYYTQLLG
FT                   KTFCVRVKRRGNHIVTSQDVERYIGSRLHESINDTSVNLVNPEVTIYLNIRDSFLFIVL
FT                   ERFKGLGGFPVGTQQESLSLISGGFDSTVASYMLIRRGCKVHYCFFNLIGNITHTIEVY
FT                   KIISYLWNKFSGSHKVKLISVDFSIVVKELFMKIKNNYIGIILKRMMIRAASTLASHYK
FT                   IKSLVTGESLGQVSSQTLDNLILINNVVSSSDCIVFRPLIVHDKESIIKLARQIGTEEL
FT                   SRTIPEYCGLISKRSCAKAKKKAIELEEGNFNFSILDKAISQAHIINVNNILQYIEDIR
FT                   AIKIETQTELNSQDIIVDIRSEYEQQRNPINIPLDIKIKKIPFYKLKDQFPKLDQNKIY
FT                   LLYCDQGIMSRLQAIHLLQQGFHNVKVYRSNLLLVNTKINR"
FT   gene            complement(262917..264098)
FT                   /gene="yajR"
FT                   /locus_tag="BVAF_241"
FT   CDS_pept        complement(262917..264098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="BVAF_241"
FT                   /product="membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_241"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33639"
FT                   /db_xref="GOA:E8Q623"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q623"
FT                   /protein_id="ADV33639.1"
FT                   /translation="MLHNIQITSTELRLTCILSMIFALRMSGIFMVLPILPIYAISLNG
FT                   SYEYLVGISIGIYGIMQIIFQLPFGLMSDQIGRKPMIIIGLIIAAVGSEIAAITNEIWG
FT                   LIIGRALQGIGAIGSVIITLLLESIQEHNRTQAMAILGISFGITFTGSIIIGPCIANTI
FT                   GLHGLFQIITLITGFTIILAFCLIPKKDSSSNNLDHNINLRDILNNIKIILTNSELLKL
FT                   NFHIFSLHTVLILNFVIWPKIMTALGCIPNTYHRTYAIIILISILILLPYLFYMHTRIN
FT                   KSKILTISIHILALSEFIMLIAIKSLWLLLVGILLFFIAFNLIESILPDLISKKSPSKY
FT                   QGTSISIYSIGQFLGVGLGGVTGGLLLEVYGIQSILFTTFIITLLNIIIHYKL"
FT   gene            complement(264279..265163)
FT                   /gene="cyoE"
FT                   /locus_tag="BVAF_242"
FT   CDS_pept        complement(264279..265163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="BVAF_242"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_242"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33640"
FT                   /db_xref="GOA:E8Q624"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q624"
FT                   /protein_id="ADV33640.1"
FT                   /translation="MIIQYYFSLIKPGIVIGNIMSSIGGFLMASQEQHINYMILINMII
FT                   GLALVIASSCVLNNIIDRDIDAIMMRTNTRILAQQKKILSIKNSIFYALILNISGFLLL
FT                   YNIKNFYTIFLSAIGFIIYVVLYSLYMKRKSSYGMIAGSLSGAMPPVIGYCTVTNTFDC
FT                   GALILLMIFSFWQIPHSYSITIFRHIDYKNALIPTFFIKKGMHITRIHILTGILGFCLS
FT                   TILLTVKGYTSYIFLCIISIFNLFWLYTGWYKYKYINNDSVWAKKMFILSIIIIILLNL
FT                   MLSLDVKICRSIW"
FT   gene            complement(265200..265502)
FT                   /gene="cyoD"
FT                   /locus_tag="BVAF_243"
FT   CDS_pept        complement(265200..265502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="BVAF_243"
FT                   /product="cytochrome o ubiquinol oxidase, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_243"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33641"
FT                   /db_xref="GOA:E8Q625"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q625"
FT                   /protein_id="ADV33641.1"
FT                   /translation="MNNNNSNTSYFIGFVLSLILTIIPFYTIQYNIFDKKILLIITISC
FT                   ALIQIYIHLVYFLHLIHISDRKWIITSLIFTIFIVFILVLGSVWIMTHLHHNLMM"
FT   gene            complement(265507..266103)
FT                   /gene="cyoC"
FT                   /locus_tag="BVAF_244"
FT   CDS_pept        complement(265507..266103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="BVAF_244"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_244"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33642"
FT                   /db_xref="GOA:E8Q626"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q626"
FT                   /protein_id="ADV33642.1"
FT                   /translation="MHTINTTLQFDINKRVIFGFWLYIMSDCILFASLFAMHIVLSKHL
FT                   NITVFDDHNNSIFNLNFIFSETVLLLLSSLACCKSMFYINKTWAQKFMQWICITELLGL
FT                   CFIILEIYEFFHLIHHGYTPCYNAFFSSFFILIGTHGIHVIVGLIWIIIMIIQLTLNGL
FT                   TQTNLIRLQCLSLFWHFLDIVWICVFTIVYLIGIL"
FT   gene            complement(266072..268057)
FT                   /gene="cyoB"
FT                   /locus_tag="BVAF_245"
FT   CDS_pept        complement(266072..268057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="BVAF_245"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_245"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33643"
FT                   /db_xref="GOA:E8Q627"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q627"
FT                   /protein_id="ADV33643.1"
FT                   /translation="MLGKLTIHSIPYHDPIIMSTIAVVFIFSTLVIGTVTYYKKWTYLW
FT                   NEWLTSVDHKKIGIMYVMVSCIMFLRGFADAIMMRTQQALSSLGLSEFLSVHHYDQVVT
FT                   AHGVIMIIFMATPFVIGLMNIIVPLQIGARDVAFPFLNSLSFWLFMVGVILINLSLGIG
FT                   EFAQTGWAAYPPLSSKEYSPDVGVDYWIWSIQISGIGTTLTGINFFTTILYMRAPGMSM
FT                   MKIPVFTWTALCTNALIIVAFPILTVTIALLTFDRYLGTHFFTNDLGGNMMMYINLFWA
FT                   WGHPEVYILALPAFGIFSEIVSTFSQKKIFGYTTLIWATIAITALSFCVWLHHFFTMGA
FT                   GSNVNAFFGIMTMIIAIPTGVKVFNWLFTMYQGKIIFKTPMLWAIGFIITFSIGGMTGV
FT                   LLAIPGIDFLLHNSLFLVAHFHNVIIGGVLFGCFAGMSYWFPKAFGYTLHENWGKCAFW
FT                   LWIIGFYIAFMPLYILGFMGMTRRLSQNIDTIFSPMLITAAIGTFLIGLGILCQCIQII
FT                   ISVFNRDKYNNYHDNSDPWNGSTLEWATSSPPPFYNFAHIPIINNNRNVFWYIENRKNV
FT                   TLCKNKTYEPIHMPKNTHDGILIAFFSLLFGFSMIWYIWWLSILSLFGIIGIWIAHTFN
FT                   NNTEYYVPSNIIKEIEHAHNKHNSSV"
FT   gene            complement(268144..269016)
FT                   /gene="cyoA"
FT                   /locus_tag="BVAF_246"
FT   CDS_pept        complement(268144..269016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="BVAF_246"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_246"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33644"
FT                   /db_xref="GOA:E8Q628"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q628"
FT                   /protein_id="ADV33644.1"
FT                   /translation="MNILTNKYIKKCTFFFIYSSIILLNGCDHLVLMHPKGSIGLEERS
FT                   LIIIAFGMMLIIVIPVIIMTLLFTIKYRATNNTHTKYNPNWIESKKIEYATWIIPIIII
FT                   IILSILTWHSTHKLDPKNPIYLDSKIVDPIIVNVIALNWKWLFIYPQHNIAIINELVFP
FT                   ANVPIRFNITSNSVMNSFFIPQLGSQIYAMAGMQTQLNLIANKPGKYKGISSNFSGQGF
FT                   SGMKFIVIATNNKKEFTQWVQKAQRSIHHLNNMNAYEKLAKPSMFDSITYFSNIQPNLF
FT                   DSVINKFKH"
FT   gene            270104..270751
FT                   /gene="clpP"
FT                   /locus_tag="BVAF_247"
FT   CDS_pept        270104..270751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="BVAF_247"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_247"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33645"
FT                   /db_xref="GOA:E8Q629"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q629"
FT                   /protein_id="ADV33645.1"
FT                   /translation="MKEIRWIYGGNTTLQNLNYNMGIIPIVIEQTARGERAYDIFSLLL
FT                   KERIIFITDTIENHTANSIVAQMMFLESENPTKDIHLYINSPGGLITAGMSIYDTIQFI
FT                   KPDVSTYCMGQAASMGAFLLAAGAKGKRFCLPNARVMIHQPLGSFQGQATDIAIHTKEI
FT                   LQVKNNINKLIAKHTGKSIDIVIKDMERDCFLSADEAMDYGLVDCVLSKRIP"
FT   gene            270933..272228
FT                   /gene="clpX"
FT                   /locus_tag="BVAF_248"
FT   CDS_pept        270933..272228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="BVAF_248"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_248"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33646"
FT                   /db_xref="GOA:E8Q630"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q630"
FT                   /protein_id="ADV33646.1"
FT                   /translation="MHDNHDHHSKEALYCSFCGKNQLQVLRLISGVSASICNTCIDLCN
FT                   NIISRELQSNSVVVHNENIEKFFTPRDIGNYLDSYIIGQECAKKILSVAIYNHYKRLKY
FT                   QNQKFDKNANKINDNYGGDIELFKSNILLVGPTGSGKTLLAETLARFLEVPFAISDATT
FT                   LTEAGYVGEDVENVIQKLLHRCDYNINKAQRGIIYIDEIDKIAKKSENISITRDVSGEG
FT                   VQQALLKLIEGTIASIPPKGGRKHPQQEFIKLDTTNILFICGGSFFGLNKIIEQRISEK
FT                   RTIGFHTFPRMKVNKDFEYALLDKVEPEDLIKFGLIPEFIGRFPIISVLDELKEYELIK
FT                   ILTDPKNALIKQYKTLFNLDKIELEFSEASLNAIAKYAINKQSGARGLRTILENILLDT
FT                   MYNLPSQNKVRKVVINSQVVTGQSKPVLLYYE"
FT   gene            complement(272399..272635)
FT                   /gene="yggX"
FT                   /locus_tag="BVAF_249"
FT   CDS_pept        complement(272399..272635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggX"
FT                   /locus_tag="BVAF_249"
FT                   /product="putative Fe(2+)-trafficking protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_249"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33647"
FT                   /db_xref="GOA:E8Q631"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q631"
FT                   /protein_id="ADV33647.1"
FT                   /translation="MTRTIYCVFLKKYSVGLDSFYFPGELGKRIYDNISKEAWKQWQDQ
FT                   QTILINENKLNMLYAKDRLFLIQKMKEFLFTKS"
FT   gene            complement(272672..273760)
FT                   /gene="mutY"
FT                   /locus_tag="BVAF_250"
FT   CDS_pept        complement(272672..273760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BVAF_250"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_250"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33648"
FT                   /db_xref="GOA:E8Q632"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q632"
FT                   /protein_id="ADV33648.1"
FT                   /translation="MTYIAQNNSVFSKRILLWHYNTKISYLPWQLNKTIYKIWISEIML
FT                   QQTQVITVIPYFEKFINTFPTISKLAKADSNSILYIWSGLGYYKRAINVHKTAQIIMSQ
FT                   YNGEFPQNFSTILSLPGIGKSTAGAILSLALNKRYPILDGNIKRILMRYYALEYHKNIS
FT                   QSKKDANLWHLISMLMPFNEDVSHFNQAMMNLGRLICTYKNPKCSICPLNDNCQSFLKN
FT                   KIHSYQQDKKQITKKHKKNIWWIVLLLKNTYIVRLIKRSKSNIWNKLFCFPEFYNIDEL
FT                   NEWLYKYNLHNTACNSMDILQHHISNIKLQIQPILIDINKIITFNKEEGIWYNIYKPVT
FT                   VGLPKPVTIILKKLIKDKTNLQ"
FT   gene            complement(273956..274669)
FT                   /gene="yggS"
FT                   /locus_tag="BVAF_251"
FT   CDS_pept        complement(273956..274669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggS"
FT                   /locus_tag="BVAF_251"
FT                   /product="pyridoxal phosphate enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_251"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33649"
FT                   /db_xref="GOA:E8Q633"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q633"
FT                   /protein_id="ADV33649.1"
FT                   /translation="MIFIQKQLNHIHNQIHIAAHNVNRNPQNIQLIAVTKNQSINTIKK
FT                   SIFYGQRNFGENYVQEALKKICWFRTHIPDKISWHFIGSIQSNKIRIIAENFDWCHTIS
FT                   NEKSIYHLNKHRPKKLSQLNTLIQINISGNHNKSGIITIEQMLKLATTIYQCSKLKLRG
FT                   IMSMSIPKSEFKQQMIQFKKVYTFFKRLQNICPHVDTLSLGMSNDILPAIYSGSNLLRI
FT                   GTSIFETKSNKHDNT"
FT   gene            complement(274757..275197)
FT                   /gene="yqgF"
FT                   /locus_tag="BVAF_252"
FT   CDS_pept        complement(274757..275197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgF"
FT                   /locus_tag="BVAF_252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_252"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33650"
FT                   /db_xref="GOA:E8Q634"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q634"
FT                   /protein_id="ADV33650.1"
FT                   /translation="MSNIEIIMAFDFGTKNIGVAVGQKLTCTTTSLNVLHSIAGTPDWK
FT                   NIELMYNEWKPKTLIVGLPLQIDGSEQYITILSKKFAIQLKNKFNTTVEMYDERFTTLE
FT                   ARSNFYNQYCSKFSEKIKKNKIDSIAAEIILKSWLNTNYKLI"
FT   gene            complement(275197..275781)
FT                   /gene="yqgE"
FT                   /locus_tag="BVAF_253"
FT   CDS_pept        complement(275197..275781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgE"
FT                   /locus_tag="BVAF_253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_253"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33651"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q635"
FT                   /protein_id="ADV33651.1"
FT                   /translation="MLDNKITNLQNYFLVAMPTLKDPLFKKSVIYICEHNNTGAMGIVI
FT                   NKPLGKCTIETILNKLKITSTQRDPSIQLNHPIFLGGPLLDDRGFILHTPKLGFNSSIN
FT                   ISEKAMITTSKDILETLGTPDQPENILVALGYSGWGKGQLEQELIENSWITVPANETIL
FT                   FHTPIINRWNDAAKILGINMHNIIAHQTGHA"
FT   gene            complement(276119..277276)
FT                   /gene="metK"
FT                   /locus_tag="BVAF_254"
FT   CDS_pept        complement(276119..277276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="BVAF_254"
FT                   /product="S-adenosylmethionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_254"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33652"
FT                   /db_xref="GOA:E8Q636"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q636"
FT                   /protein_id="ADV33652.1"
FT                   /translation="MNQYFFTSESVSPGHPDKIADQISDAILDSILTQDSNAHVACETY
FT                   VKTNIVVIGGEITTTASINIEEIIKTTIREIGYVNLDMGLDANSCSIFSIINQQSPEIK
FT                   NSINLNNNKIKQGAGDQGSIFGYATNETDVLMPAPITYAHRLINRQSIVRKNKTLPWLG
FT                   LDAKSQITFSYNNNKIIGITAVVLSTQHHHDVKLIDLKEAVMEEIIKPVLPKKWISKHT
FT                   KFFINPGGNFTIGGPIIDCGLTGRKIIVDTYGGMARHGGGSFSGKDPSKVDRSAAYAAR
FT                   YVAKNIVASGLAERCELQISYAIGVENPIAINIETFGTEKVLHSTLITLINDLFDFSPY
FT                   GIITMLNLLQPIYKDTAVYGHFGREKFPWEKTDKTNILKDASGIK"
FT   gene            277516..278430
FT                   /gene="speB"
FT                   /locus_tag="BVAF_255"
FT   CDS_pept        277516..278430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB"
FT                   /locus_tag="BVAF_255"
FT                   /product="agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_255"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33653"
FT                   /db_xref="GOA:E8Q637"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q637"
FT                   /protein_id="ADV33653.1"
FT                   /translation="MNNFSCNNDHSLFSNAFGFLRLPLEFDPYTQCSDWVITGVPFDMA
FT                   TSGRPGSRFGPTAIRQASINLVWEQCRWPWNFNIREKLKIIDCGDLVYKIGSIQNFTDN
FT                   LQIHIEHLLNSRKKVFLLGGDHYITLPALRAYSKIFGKIAIIHFDAHTDCYSNCSQYDH
FT                   GAVMLYALNEGLINPNLSIQIGIRTEYDTKFGFTILDSEFVNSVDTSIIVNKIISVIQN
FT                   APVYLTFDIDCLDPSIAPGTGTPVIGGLTSSCVLKLIRSLKKINIIGMDIVEVSPEYDC
FT                   SQITALTAATLGLEMLYTQAVIC"
FT   gene            278856..280034
FT                   /gene="pgk"
FT                   /locus_tag="BVAF_256"
FT   CDS_pept        278856..280034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="BVAF_256"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_256"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33654"
FT                   /db_xref="GOA:E8Q638"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q638"
FT                   /protein_id="ADV33654.1"
FT                   /translation="MISINDLDLFDKQILIRSDLNVPVKNGVITSNRRIHASLPTIQLA
FT                   LSKSKRVMVTSHLGRPVEGEYDPNFSLQPVVDYLKYYLSDQIRGVRLVKDYLDGIQWVS
FT                   DELLILENVRFNKGEKKDDEVLSKKYAALCDVFVMDAFGSAHRMQASTHSISKFVKVAC
FT                   SGLLLEQELKALHQALSNPVRPMVAVVGGSKVSTKLTVLESLSKIADYLIVGGGIANTF
FT                   LAALGKKVGKSLYETELIPTARNLLKNCDIPILTDVRVSSEFSETAQSIMKNVIDIKDD
FT                   EQILDLGDNSIDRILQILDCAKTILWNGPLGVFEFPSFRKGTEMVSRSIAASNAFSIVG
FT                   GGDTLMAVDLFGISNQISYISTGGGAFLEFIEGKILPSIQALEDHQRIRNII"
FT   gene            280157..281233
FT                   /gene="fbaA"
FT                   /locus_tag="BVAF_257"
FT   CDS_pept        280157..281233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="BVAF_257"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_257"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33655"
FT                   /db_xref="GOA:E8Q639"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q639"
FT                   /protein_id="ADV33655.1"
FT                   /translation="MTGIFKFIKPGVIFGNDIQKLFSLAKKNNFALPAVNCIGIDSINA
FT                   ALEAASNMKSPIILQFSNKGSAFMAGYGLDNENYSASILGAIAGGLYVHHISIHYGIPV
FT                   ILHTDHCPKKFLPWIDALLDFSEKHFASTGNPLFSSHMIDLSAESLEENIEISSQYLSR
FT                   MAKLNMILEIELGCTGGEEDGINNDCLDQSCLYTTPEDVAYAYEKLHVISPRFMIAASF
FT                   GNVHGVYQPGNVRLDPKILDKSQKYISNKFGLSKNFLNLVFHGGSGSSSEEIKKAITYG
FT                   VVKINFDTDIQWASWEGVLKYYKKNKNFLQAQLGNPHDNNFPNKKFYDPREWLRESQKS
FT                   MIKYLEKIFFILNATNIL"
FT   gene            281491..282162
FT                   /gene="rpiA"
FT                   /locus_tag="BVAF_258"
FT   CDS_pept        281491..282162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="BVAF_258"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_258"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33656"
FT                   /db_xref="GOA:E8Q640"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q640"
FT                   /protein_id="ADV33656.1"
FT                   /translation="MKQDELKKAVGWAALKYIKFNTIIGIGTGSTVSYFINALGSIKEK
FT                   IIGVVSSSKNSSIQLKKVGIPIYNFNNIDNLDVYIDSADEIDKYMQMIKGGGGALTQEK
FT                   ILAFAAKQFICIIDSSKQVDILGRGPLPVEVIPMARSLVAKELIRLGGLPEYRYGVVTD
FT                   NGNSILDVHNMNIINASLLEERINNIPGVVSVGIFAHRKADVVLISTKNGIKVLNNNNL
FT                   K"
FT   gene            complement(282292..282897)
FT                   /gene="ygfA"
FT                   /locus_tag="BVAF_259"
FT   CDS_pept        complement(282292..282897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygfA"
FT                   /locus_tag="BVAF_259"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_259"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33657"
FT                   /db_xref="GOA:E8Q641"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q641"
FT                   /protein_id="ADV33657.1"
FT                   /translation="MRHVTNKKKIRKYIRSLRQSLTFSEQYVAAQLITNKIINLHYVDQ
FT                   AKNIAIFISTDGEVSTNLLIKTLLLMNKSIYLPILPNIYTQSIQYLSFVKYTLSTPLVR
FT                   NRFNIYEPKYNNNNIHIIPMELLDILFIPLVAFDQNKNRLGMGGGFYDKTLQHWEKKIK
FT                   NCICIGLAYNFQKIPNHLLPIEQWDIKLSNIITPSCLY"
FT   gene            complement(283006..283350)
FT                   /gene="zapA"
FT                   /gene_synonym="ygfE"
FT                   /locus_tag="BVAF_260"
FT   CDS_pept        complement(283006..283350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zapA"
FT                   /gene_synonym="ygfE"
FT                   /locus_tag="BVAF_260"
FT                   /product="cell division protein ZapA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_260"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33658"
FT                   /db_xref="GOA:E8Q642"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q642"
FT                   /protein_id="ADV33658.1"
FT                   /translation="MPEKPIDIQIFGRTLRINCPPHQKDALNKAVQDLTKRLHDLKIKT
FT                   KVTNSDQLIFITALNICHELAQEKLKTVEYILHVKKCLLEVQQTVEKALTTHDNLTERS
FT                   NLTLEYSKHT"
FT   gene            283931..285121
FT                   /gene="ubiH"
FT                   /locus_tag="BVAF_261"
FT   CDS_pept        283931..285121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="BVAF_261"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_261"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33659"
FT                   /db_xref="GOA:E8Q643"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q643"
FT                   /protein_id="ADV33659.1"
FT                   /translation="MSVVISGGGMIGLILALKLSKLTQGRLEISLIEQNSIDICKDKFF
FT                   LGNPGVIALSRGAYFELSKIDIISSILSHYSSIVDTLEISEYSKFSEVFIDAQDYHVSE
FT                   LGYIMPLFPIRRELYDVLYRQPGVTIYCSVKIQHIIRKKSHNIIFLNTGKKIISKLIIA
FT                   ADGSGSNLINYYGIQQFKWNYHQTAVVTEVTTAVSHCGRAFERFTPFGPLVFLPMSNRN
FT                   VSFMIWCIFKKRNQEIFKYGSSNFSKILQKMFGWKLGKILHIKNRYFHNLWLIYSYNHI
FT                   AYRLALVGNSAQKLHPIAGQGFNLGIRDVVVLSEIIYQALRDNVDIGDYSVLSAYQKRR
FT                   RLDQFKTIAATDGLINLFENHYLPLIIARNLGLFCIEHNSFLKDFFVKKALFWSLM"
FT   gene            285178..286417
FT                   /gene="visC"
FT                   /locus_tag="BVAF_262"
FT                   /note="frameshift in poly-A tract; RNA polymerase or
FT                   ribosomal slippage"
FT   CDS_pept        join(285178..285466,285468..286417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="visC"
FT                   /locus_tag="BVAF_262"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_262"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33660"
FT                   /db_xref="GOA:E8Q644"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q644"
FT                   /protein_id="ADV33660.1"
FT                   /translation="MKKFDLIIVNKGLPGLILACGLSRYFSIAIIEQNEIIDISQTRSC
FT                   NVKEISFFNIISIKILKYLQAWDTDISYLLNSVYKLEILEKDNVIGILKKKIEFGYLGY
FT                   PELGYIIDNVKLLDVLTNYAKTLKTIHFFYFTNSFEIIFHNYNEVLINLDNEFICSAKL
FT                   IIAADGINSYIRNRVNIPLIFKDIRYYRLSALVHTKKEHQCTFRCIVHDHGIIIFLPLQ
FT                   NLHLSYVFWILSSYEIKKYLNTKNMNQHIFNVELIRFYDVLGKTILCQDDEVIQVFPIR
FT                   IQYACDIIKHRLILLGQSAYVACPFVFWNINIELMDVILLFNYLREGQKTNKDIGCYSY
FT                   LQLYSNYRKHSRNKFIVHIAHILSNSCYDKGWIRYVLCAFDYLTKIIPNSDEYILKYIM
FT                   GLNDVPNCLFRKK"
FT   gene            complement(286479..287474)
FT                   /gene="ygfZ"
FT                   /locus_tag="BVAF_263"
FT   CDS_pept        complement(286479..287474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygfZ"
FT                   /locus_tag="BVAF_263"
FT                   /product="tRNA-modifying protein ygfZ"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_263"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33661"
FT                   /db_xref="GOA:E8Q645"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q645"
FT                   /protein_id="ADV33661.1"
FT                   /translation="MLPNTIFIEKPATPSLNLPLTLISLKNWILIKLTGKDSIPYLHNQ
FT                   FTCDIKNLNINKYTFSSHCNVQGKMITNMYVFYFNKYELAFICPTNVYKKQIEILKKYS
FT                   IFSKVNIIPDYNVTLLGVAGSNAKQYLSIFFKTLPNQINTIVHHQGISVLYFHLPKERF
FT                   LLIVHDNSLFYSLLKEAQFLSAQYNNHSQWISLDIESGYPYIDILTSEMFFPQAANIDL
FT                   LGGISFNKGCYLGQELIARIQHYKLNKQSLHKLTGTIDTNKHNQIPISGNYLMQIQNKT
FT                   YKKVGTVLQSCQIKGNKLWIQAILLKSIPNNSQLYIQMPQCPDFIFLKKQ"
FT   gene            287988..288785
FT                   /gene="prfB"
FT                   /locus_tag="BVAF_264"
FT   CDS_pept        287988..288785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="BVAF_264"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_264"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33662"
FT                   /db_xref="GOA:E8Q646"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q646"
FT                   /protein_id="ADV33662.1"
FT                   /translation="MLAYIFDKLEMYRMFFQEHDNCNCYVDIQSGSGGIEAQDWANMLL
FT                   RMYLKWLDSKKGFYVKKTTETSGEFLGIKSATIKIIGPYAYGWLKTESGVHRLVRKSPF
FT                   DSGGRRHTSFASIFVYPELDDNITINIRPEDLRVDVYRASGAGGQHVNRTESAVRVTHI
FT                   PTNVVTQCQSDRSQHKNKNQAIKQLKAKLYNLELQKKQYEKKIRENKKLDITWGSQIRS
FT                   YILDDSRIKDLRTGLEKRNVKAVLNGDLDDFVTMSIKQLNNTI"
FT   gene            288785..290332
FT                   /gene="lysS"
FT                   /locus_tag="BVAF_265"
FT   CDS_pept        288785..290332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BVAF_265"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_265"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33663"
FT                   /db_xref="GOA:E8Q647"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q647"
FT                   /protein_id="ADV33663.1"
FT                   /translation="MSKYIDLKKSLNREELNINYDELKIRQKKLLKIRKLGIAFPNKFR
FT                   RNYTSSQLHKEFSYKTHEDLVALNIQVNISGRIMTRRIMGKASFIVLKDGEGSIQLYIT
FT                   INSLLSKQIYVNHLKQLDLGDIIGAQGILFKTRTGELSIRCYNVMLLSKSLRPLPSKFY
FT                   GLNNSEKKYRQRYLDLIVNDKSSKIFKKRSLIIYKIRQFMKKYDFIEVETPIMHTIPGG
FT                   AIARPFVTYHNKLGMHMYLRIAPELYLKKLIIGGFERIFEINRNFRNESISPYHNPEFT
FT                   MMEVYIAYSDYKDMISFTQKLLSKLAEQIFKSNTIQYGEYCLNFKEPFTKMSVKEAIIY
FT                   YLPEVKLNNINDMSIIVDILKKFEIQFNKKWSLEKLHMLLFEEIITKKIIQPTFITHYP
FT                   TELSPLARCNDNDSKLADRFELFIAGFEIGNGFSELNDPDDQRDRFLKQIQEKRMNSKN
FT                   TDNTDIVHCYDEDYLTALEYGLPPTSGIGIGIDRLVMLLTNQHNIRDVILFPTLRPK"
FT   gene            290441..291727
FT                   /gene="lysA"
FT                   /locus_tag="BVAF_266"
FT   CDS_pept        290441..291727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="BVAF_266"
FT                   /product="diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_266"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33664"
FT                   /db_xref="GOA:E8Q648"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q648"
FT                   /protein_id="ADV33664.1"
FT                   /translation="MSPHIINELLRIHNYDNLKKLYHTYKGPVWIYDSSIIINRITQLR
FT                   QFDIIRFAQKSCSNIHILKLMYNNGVKIDAVSLGEIERALLAGFKFGKEKSEIIFTADI
FT                   LEEETLLKILELKIPVNIGSIDMIIQLGSCSPGHEVWMRINPGFGYGHNNKTNTGGENS
FT                   KHGIWYEDVPIALFYMRRYNLKLTGLHMHIGSGVHYSHLSKVSTVMVEQILKYKIDLKV
FT                   ISCGGGLTIPYKFTDQVVNVNRYFNIWDHARKSISKYLKHSIQLEIEPGRFLVAESGIL
FT                   VTQIRAIKTTGSRRFVLIDAGYNDLMRPVMYGSYHHISIVFGERNSNDKDICLGEELSD
FT                   VVVGGPLCEAGDVFTQGANGEILSRKLPDSVKVGDYLIFHDTGAYGASMSSNYNTRPLL
FT                   PEVLLEDGKIREIRRKQKLEDLFALELPR"
FT   gene            291964..292437
FT                   /gene="rppH"
FT                   /gene_synonym="ygdP"
FT                   /locus_tag="BVAF_267"
FT   CDS_pept        291964..292437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rppH"
FT                   /gene_synonym="ygdP"
FT                   /locus_tag="BVAF_267"
FT                   /product="RNA pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_267"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33665"
FT                   /db_xref="GOA:E8Q649"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q649"
FT                   /protein_id="ADV33665.1"
FT                   /translation="MIDSNGYRLNVGIVLCNARGQVFWGKRHKQHSWQFPQGGIDIGET
FT                   PVQAMYRELFEEIGLNYYDVCILSATHRWISYKLPSSLIRWEMKPLCFGQKQKWFLLKL
FT                   LSKDTKINMQQGESYTFDSWKWVSLWYPVRRVVFFKRHVYRKVIKEFVNLILS"
FT   gene            292574..293461
FT                   /gene="lgt"
FT                   /locus_tag="BVAF_268"
FT   CDS_pept        292574..293461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="BVAF_268"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_268"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33666"
FT                   /db_xref="GOA:E8Q650"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q650"
FT                   /protein_id="ADV33666.1"
FT                   /translation="MQYFYTPNFNPIIFKIGLVSLHWYGMMYILGFLFAIWLLTHPRYP
FT                   LNIFFNDRKDIEYLLFLNFLGVIIGGRVGYALFYQWPFFYCQDILWILKIWEGGMSFHG
FT                   GLLGVIISIKWFSYRKNQSFLKVSDFVVPAVPFGLGLGRLGNFINGELWGRVTFDVPWA
FT                   MLFYNSFYQDLLVLETYPELEPLFNYYGALPRHPSQLYEMILEGIVLFILIYLFIYKPK
FT                   PVGSISGLFLVLYGLFRLIAEFFRQPDNHIGLINHFFTLGQILSLPMIVSGGIIILCAY
FT                   KKKLLSKITLFKKM"
FT   gene            293543..297007
FT                   /gene="recC"
FT                   /locus_tag="BVAF_269"
FT   CDS_pept        293543..297007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="BVAF_269"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_269"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33667"
FT                   /db_xref="GOA:E8Q651"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q651"
FT                   /protein_id="ADV33667.1"
FT                   /translation="MFMVYRSNCIELFMKFVMDIMSRYQLSNPLKPEVMLIENKIIAQW
FT                   IETELTSYFGVAANITFMNVTAFIQKIAIDFLSDKSKVVINSFCDDSMYWKFMEVLMTS
FT                   DLNKKCSIIQKYLDFDINQRKLSQFSEQLANLFSEYLIYRPDWLNMWQSNKFIDNLDGK
FT                   EHQIWQAEIWRMFLNNIEHKSQKFNSVYRCVCFLEKNIKKINWNQLPNRIFIYGITSIP
FT                   LIYLKILKLLSYHIDIYLCFISPFENNWNWYQHKYDNDLLLERNTYQCHCDILSEFSKN
FT                   NDMNYHKQYDKNSICMLQLEHPLLNSWGKVGKGALCSLSQLHPLFEIKAFKYPQTDSIL
FT                   HILQRNILEFSNIHLNPEKKSLVFPVEKKFSQKKHILKLLDQSITFHECYSIQREIEVL
FT                   HDNLLLMLSDDPNLLPGDIIVMAPNIDFYIAEIKTVFNNVFNRKLPFSISANHNNSIHP
FT                   IISSILSILDISNSRFTAEEILSLLSVSSISSKFHINNEEIELLRLWVIKSGIRWGLDE
FT                   ETMKTLNMPITDQNTWYFGLKRMLLGYAMKSTDSGLWENISPYDCGCINDKYVHIISGL
FT                   VEFLKILQKWRNRLSYSYTLKTWLLYFKEIINDFFYCNDFNIEENQALLILKTYWINII
FT                   ESGMKLGYSNTIHISILRDKLIHKLNKKNIYYRFVPNVINFCNINPICLIPCKILCLIG
FT                   MNVDAYPRSQSIYDFNLIAKKLRCGDNNIRKENDYYAFLLLFLLPKARIYFSFINESII
FT                   RSNISNNSSILINELLEYIAQNFCLIGDQNLDIQYNIKRVQKYLFYTHSHMPFNLINFT
FT                   LNSKTPSFFYEWLHIADTNINSDKSLIDFNFITTLPYITVSTVLLDELYNFYKHPVRVW
FT                   FQKRLQIYFYQCKYNSILNDEVFSVNSLYKFKINTKLLNYLICEKNTDVLYDELYASGM
FT                   LPRESFSKLYWINQCNQMNILANNIKEYYLPNKIFTLNICLKYSNITLTGKLSSVQVNG
FT                   LIRWKPSKLSMKDCFLLWLEHLVYCASGGNGDSRLFGINSIWHFPFFTQKKAKELLQPL
FT                   ILGYCSGINAPLILLYKSGGMWMNNMFDWNNKVIYSNQTAHEKACQKLIQVWQGNIITN
FT                   EYFSDMKESHDFYLRKLIPFNLNKKHIQIIVDTAKYYFLNMMRYRIL"
FT   gene            complement(297099..299036)
FT                   /gene="recD"
FT                   /locus_tag="BVAF_270"
FT   CDS_pept        complement(297099..299036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="BVAF_270"
FT                   /product="exodeoxyribonuclease V, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_270"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33668"
FT                   /db_xref="GOA:E8Q652"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q652"
FT                   /protein_id="ADV33668.1"
FT                   /translation="MKNLSKQKSPVKLWNPLDLQFAKILITSVFNSKTHHINNITNIEK
FT                   TVLLLASTYLSAYVRLGHTCLPIHILTSDKLHQHYYPPLLLSNFKILQEIKKLSIDDWQ
FT                   EILLSLSAVGNGSYTSPLVLDNNHLYLYRIWQDECTIAKFFNSSYNHFNRYPSTKIIHI
FT                   IQQLFPETSSKQVNWHKIATILSFIHSRVLISGGPGTGKTSTIAKIITALLLYDHNLRI
FT                   KMIAPTGKSASILTYSCNNKLNNFNQLNGFFKYKLELKATTVHSVIEHFFIQQKTLTNY
FT                   SNTLDIDYLIIDESSMLSVSMLSQLIKILPIHVTVIFSGDHHQLYSIEPGSIFRDVCQF
FT                   SNFQYSIKRQKELIQLTQYPDNIFSNANLNSAKNCFYNNISDGICILNQNYRFNKNSGI
FT                   GQLSSAINLGDYTRTLSILNSKKYTDLSYIHLKNEKDYITMIKRCSNKYYHYLKNLQYK
FT                   KIFSINTLKIFDQYRILCAFKHGIFGVIKLNYFIEQTLTQCGLITLNKSNNYIGRPIII
FT                   LHNEPSLELCNGDTGILLPDAQNHLSAYFLLPNNEIKIIKINQLPAHETCFAMTIHKAQ
FT                   GSSFLNTDIILPNEHSTILTRELLYTAVTRAQLKLTLYATDNVLIRTVSAATQRYSGLF
FT                   NRIKKACIHY"
FT   gene            complement(299266..302880)
FT                   /gene="recB"
FT                   /locus_tag="BVAF_271"
FT   CDS_pept        complement(299266..302880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="BVAF_271"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_271"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33669"
FT                   /db_xref="GOA:E8Q653"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q653"
FT                   /protein_id="ADV33669.1"
FT                   /translation="MQDLNIFHLPLNKIRLIEASAGTGKTYSLIILYLRLLLNLHSNQS
FT                   IYSTPLTVKEILVVTFTNSAAYDLRKRIKESIQQFRWDCMNKYSNNYIFSKLLLQIRNI
FT                   DLAITLLFKAEKEIYEASIFTIHGFCQKILTENTLELNIPFHTSIIEDELTLYRQICFD
FT                   FWRRHFYELPLNITSFIQEFWNNPEELLQNLRPYIGYHNNSKIQNPKFFNQLNKYISEF
FT                   YNQILFDINNIKKQWVKTTNNLTKIINNMPNFNRKIYNKKNLAQWINIINQWCEQPTLN
FT                   HVTPNALKRFRLSILNSSNNLNEVNVFSLFNSIDQLFQKFTSFKFIILNSALKDIQNNL
FT                   NVLIYSKSQITFNNIITILLKNGIENTQNNLTKKILKYYPITIIDEFQDTDFSQYKIFH
FT                   KLYSHSLKNGLILLGDPKQAIYGFRGADIFTYMKIRQNLSYKYHLNINWRSSPGMVNAI
FT                   NHLFQSTTNPFKFKDISFIPTQAAYKNNRHKLMIHNIPQSAMCFWLYLDKCVTKNSYKT
FT                   IMAQECAITLKKLIQNINDKKIWLKTNTDKKTLQTSDITILVRNHLEASLIRLELLKIN
FT                   ISTIFLSNRNNIFNTIEAYELLLLLRAILFPKQETIYPALATIFFGLNAMQIVNVYNNT
FT                   LKWDQIINEFSKYYFIWKNNSILSMIQKIIFYYKIPKKLLSTPSGKYNLINILHLGELL
FT                   NNISTQFNNEYELIIWLELKINQPLNQYKKESMDYMVRSNRDDHNCIKISTIHKSKGLE
FT                   FPLTFLPFAATSFNAKAQNTYITHFKYQLNLKQHNLLHSDFDLLNEEHLSENLRLLYVA
FT                   ITRSIYHCSIGIAPIVRNRSQNSFNELTDFHRSALGYLIQNNTPNTLKSIKQYLQQLSI
FT                   RSNKDITFRIISKKNQQYTSNTTTKFVKKPQLHLLSKIWQPSCMQIRNNSRQITSYSNL
FT                   KFINNKVAVNVSKLSNFNLEELYQINLNSKFTKESSKLNLLTTHTFPKGQIYGTFFHNL
FT                   LKVIIFKQTIDMQWLKIQMERYNVHLNWKTLIHQWIYTIKHTPINHHNLTLSKIRSSNI
FT                   QTEMKFSLSIKNCLTAQKLDSLCKFYDELSSKTACITFPDILGMLQGFIDVVFYWNKKY
FT                   YLLDYKTNWLGSNNFYYNYSSMQAAMIKYRYELQYQLYTIAIHRFLKHKIVSYNYEKDF
FT                   GGIYYLFIRGMNGISHKNGIFFHRPSWDFIHKLNNLIS"
FT   gene            complement(302986..303822)
FT                   /gene="dapD"
FT                   /locus_tag="BVAF_272"
FT   CDS_pept        complement(302986..303822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="BVAF_272"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_272"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33670"
FT                   /db_xref="GOA:E8Q654"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q654"
FT                   /protein_id="ADV33670.1"
FT                   /translation="MNTKNISNLKKIIENAFLKKEDILQHNIDSILNNAIQEIIHNLDN
FT                   GIFRISEKLNNKWITHQWLKKAIILFFKITGNKLMTWGNAHFFDKCPTKFETWNETDFQ
FT                   KNKIRIVPPATVRYGAYISHNTIIMPSYINIGAYIDTGTMIDTWATIGSCAQIGKYTHI
FT                   SGGAGIGGVLEPIQNNPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYDR
FT                   NTEQIYYGRVPAGSVVIPGSIPSLDNKINTYCAIIIKQVDSKTKNKTQINDLLREL"
FT   gene            complement(303846..304655)
FT                   /gene="map"
FT                   /locus_tag="BVAF_273"
FT   CDS_pept        complement(303846..304655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BVAF_273"
FT                   /product="methionine aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_273"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33671"
FT                   /db_xref="GOA:E8Q655"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q655"
FT                   /protein_id="ADV33671.1"
FT                   /translation="MNIAVNTPKDIEKMRVAGRLAAEVLEMIEPYVLPGISTEKLNNIC
FT                   HDYITKVQKAIAAPLGYHGFPKSICTSINDVVCHGIPHCSQKLKDGDIINIDVTIIKQG
FT                   FHADTSKMFTVGTSTQLGNCLCQVTQTSLYKAINIIRPGIRLKMIGKTIQNIVNKKNFS
FT                   IVREYCGHGIGKLFHEPPHVLNYDADDGGVILKSGMIFTIEPMVNAGKRHVYTESDGWT
FT                   VKTQDHSLSAQYEHTILITKTGCEILTKRTNETLPNYLFSTHSEHAQ"
FT   gene            305016..305720
FT                   /gene="rpsB"
FT                   /locus_tag="BVAF_274"
FT   CDS_pept        305016..305720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="BVAF_274"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_274"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33672"
FT                   /db_xref="GOA:E8Q656"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q656"
FT                   /protein_id="ADV33672.1"
FT                   /translation="MMKKLSIREMLQAGVHFGHQTRYWNPKMKPFIFGVQNKIHIIDLD
FT                   KTILMFNKALVELKKITTLKGKILFVGTKRAARESIKSTALICGQFFVNHRWLGGMLTN
FT                   WKTVRQSIKRLKELENQSQDGTFQKLTKKEVLILKHELRGLENSLGGIKNMGGLPDAIF
FT                   TVGAIHEHIAIKEANSLGIPVFAIVDTDSNPDGVDFIIPGNDDATRAINLYLNIVSNVI
FT                   YPDNFNKELVEN"
FT   gene            305812..306624
FT                   /gene="tsf"
FT                   /locus_tag="BVAF_275"
FT   CDS_pept        305812..306624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="BVAF_275"
FT                   /product="translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_275"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33673"
FT                   /db_xref="GOA:E8Q6S6"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6S6"
FT                   /protein_id="ADV33673.1"
FT                   /translation="MNIINSDLIKELRRRTNVSIMKCKQALEESNGDVELAIDNIKKSG
FT                   LKIDSIKSNRLTVSGLIVSKISSNKQIGLMIEINCETDFVARNSLFQEFTNTVINTALS
FT                   ESIININILKTRFENQRCVLMNTVGENIEINKFIVLTGDFLCSYVHNAKIGVIVDIIFE
FT                   KTINILVAKNIAMHIAASSPKYIYENDVPEEIMLKEYRTQMNLAIKSGKSLKIAEKITQ
FT                   GRINKFMNQIVLTKQNFIMEMNRTVGSILDENHIKIKNFIRFEIGYDN"
FT   gene            306756..307484
FT                   /gene="pyrH"
FT                   /locus_tag="BVAF_276"
FT   CDS_pept        306756..307484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="BVAF_276"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_276"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33674"
FT                   /db_xref="GOA:E8Q6S7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6S7"
FT                   /protein_id="ADV33674.1"
FT                   /translation="MISHMSPVYRRIMIKISGEALQGTKNFGIDFIILNRMALEIKELI
FT                   NIGVQIGIVIGGGNFFRGINLVKSGIHKVISDHIGMLSTIINGLAIHNSLNSVYVDSQL
FT                   MSAIPLQGVCDHYNWMKAINLLSNNRVVIFGAGTGNPFFTTDSAACLRGIEIEADAILK
FT                   ATKVDGVFSDDPEQHPNNAILYKQLSYQDVLKRELKIMDLTAFTLARDHNLPIHIFNIN
FT                   KVGALKRIVMGCREGTLITE"
FT   gene            307579..308145
FT                   /gene="frr"
FT                   /locus_tag="BVAF_277"
FT   CDS_pept        307579..308145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="BVAF_277"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_277"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33675"
FT                   /db_xref="GOA:E8Q6S8"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6S8"
FT                   /protein_id="ADV33675.1"
FT                   /translation="MINEICEIQADLKEQMKKCIDSFKINVNKIHVGHVSPNMLNFITV
FT                   EYYGSVIPLSQLTNSVVEKPRTLAITVFDASMIKTIEKAILTANLGFTPIAHGNVIRIT
FT                   LPILTEDRRRTLIKMMRIESEKSKISLRNIRRIANDKIKVFLKKKEINVDDEYHRQNEI
FT                   QNLTNFWVNQINMILKEKELELMMF"
FT   gene            308228..309454
FT                   /gene="dxr"
FT                   /locus_tag="BVAF_278"
FT   CDS_pept        308228..309454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="BVAF_278"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_278"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33676"
FT                   /db_xref="GOA:E8Q6S9"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6S9"
FT                   /protein_id="ADV33676.1"
FT                   /translation="MEYLTILGSTGSIGQKTVAVIQQHKDKFAARALIANNNVTIMTEQ
FT                   CLMLSPQYVCMICENSAKSLKNNLRIAGKSNIQVLSGMKEACALAELNDVDMVMSAIVG
FT                   IAGLTPTFSAIRAGKKILLANKETLVVSGQFFMQEVCKYNARIIPVDSEHNAVFQSLPE
FT                   ICQKKIGQLSSLSEYGISRIVLTASGGAFLGMSTEQLSMITPEQACVHPNWVMGRKISV
FT                   DSATMMNKGLEYIEARYLFNANPNEIQILLHPQSIIHSMVHYIDGSILAHLSLPDMTIP
FT                   ISYAMAYPNRIALHHLSSKEFNNDAYNTCFYNKLYCDELNSLNYPCIKLAIDASNHSQS
FT                   AMIILNAANEIAVESFLKKMISFTDIPNIIDHILNILHLNEPNAIDDVLYIDQRAKEIT
FT                   IQYIMNNIL"
FT   gene            309647..310399
FT                   /gene="uppS"
FT                   /locus_tag="BVAF_279"
FT   CDS_pept        309647..310399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="BVAF_279"
FT                   /product="undecaprenyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_279"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33677"
FT                   /db_xref="GOA:E8Q6T0"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6T0"
FT                   /protein_id="ADV33677.1"
FT                   /translation="MISYQHKDNLKYFSYNLLPKHVAIIMDGNGRWARIRGRLRIIGHQ
FT                   AGFQAARQAVRFAVNYQFDALTLYAFSSENWKRPDSEIDSLMQLFAYALDNEIYNLHKN
FT                   NIKLKIIGDISRFNKALQNSIFNAERLTADNDGLNLNIAVNYGGRWDILQGVKKIAVQV
FT                   KKGILDPNLINEDLLCQYICMNDMVPVDLVIRTGGERRISNFLLWQIAYAELFFTDILW
FT                   PDFNDVVFKSALHAFMQRDRRFGKSTFM"
FT   gene            310461..311342
FT                   /gene="cdsA"
FT                   /locus_tag="BVAF_280"
FT   CDS_pept        310461..311342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="BVAF_280"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_280"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33678"
FT                   /db_xref="GOA:E8Q6T1"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6T1"
FT                   /protein_id="ADV33678.1"
FT                   /translation="MLRSRIISTFVLIPVVIYLLFFSSKIQFSLLLFTMCAISAWEWGK
FT                   LMNFSFKIYCIWMCMMCSLLYITMTVIISNYSYLDHYWFILFIFFSFIMVWWMFMFCIV
FT                   VFYPYFSIYWDKFNILRFLFGIFMILPFFLGVLILYGFDFFHHNINGKWWLLYILVLVW
FT                   INDSSAYIIGRTIGKYKLLQCVSPNKTWEGCVGGILTSTGIAWLLCHYIMENIDYNCLY
FT                   IIFICFIGTIFFSIIGDLTESMFKRASGIKDVSNLVPGHGGMLDRIDSLLAAVPSFIVF
FT                   LLLFTHINIIST"
FT   gene            311360..312769
FT                   /gene="rseP"
FT                   /gene_synonym="ecfE"
FT                   /gene_synonym="yaeL"
FT                   /locus_tag="BVAF_281"
FT   CDS_pept        311360..312769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /gene_synonym="ecfE"
FT                   /gene_synonym="yaeL"
FT                   /locus_tag="BVAF_281"
FT                   /product="RIP metalloprotease RseP"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_281"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33679"
FT                   /db_xref="GOA:E8Q6T2"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6T2"
FT                   /protein_id="ADV33679.1"
FT                   /translation="MINLTHFFWNTVAFVITIGILITVHEFGHFLAARFFQVKVERLSI
FT                   GFGPVLWSWTCSNGTEYTISAIPLGGYIKLLDTPSNSIFEKSRNLVAQKITNEGNSFHS
FT                   QHIWKRSIIIAAGPIFNFIFAILIYTITYSIGIPINKPIINYILPNSIFDQSGIPVKSE
FT                   IKSVNNIKVSDWESARFEILNNINKKKILFTIQVTSDKKEHLNTYTIYLPTNWFSQSLI
FT                   DSNDPLIALGIFPDILHITSDDLDSQLYCFNSQNLLEINDKILLINKQPIYNWEFLTQT
FT                   IQNNAEKLFQIVVERNERLLYLDAILGNKNLVDSNVFKTNNYFFLRNNYLANTQNPEIQ
FT                   KYELHNAILKAFNKTKNLFFFTVNSLRQLISGDIKITNLHGPIAIAQGARQSMYSGLHH
FT                   YLMFLAIISINLGIINFLPFPVLDGGQLCLLLIEKITGAPLSKKVQNFSYMLSLIILIC
FT                   ITIIALYNDIV"
FT   gene            312834..315266
FT                   /gene="yaeT"
FT                   /locus_tag="BVAF_282"
FT   CDS_pept        312834..315266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="BVAF_282"
FT                   /product="outer membrane protein assembly factor YaeT"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_282"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33680"
FT                   /db_xref="GOA:E8Q6T3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6T3"
FT                   /protein_id="ADV33680.1"
FT                   /translation="MAVLLLFVSDVTYSTDFLVNKICFIGLQRVSLNTALHKLSFKIGD
FT                   VIQSSDIANSIKMLFFTGCFKEICISRDDGVITITVTENPIINKITFHGNKVIKPEMIQ
FT                   HVLDMKKIKVGQPLNNSFICEALKEFKDIYHSIGKFNAIVKINPIILPKNCVDLKVVFY
FT                   EGNTAKINSITILGNQSFSQKKLFEQCNLYKKTWWNNTLYNNEYDQQKIFYGLEKLRTF
FT                   YLNHGYAKFYIDEPLANLSMNKEKVEINLRIFEGSRYFFDSVILHGNVLKYFPSIKRYL
FT                   QISSEKLYSNSAIEQMGQNIRYLLGKHGYIQPDILIDQDFNEKNKTVKLHLYIDVGKRF
FT                   YVREICCEGNNLTEDSVIRREVRQAELSPLNYIHVLKDQEQLRRLGYFKEVNARIEPVP
FT                   DTINQIDLIYNIEERNTGNLNISIGLGKESGLNIQSEIHQDNFLGTGNAISVTITKNYC
FT                   QSYIDMLMLKRYSKIRGDNISGKVFYNNLFSDKMNLSNYNMKNYGVNVDYLYPLNKRTS
FT                   CNIGLNYISNHLNKIVPQVAVWRYLDSIGKNPAILTDQVNPLTNINSINFYANDFLIIL
FT                   GQSFNNLNHIFFPEFGSNTTITCKLTLPGSDNKYYKLMINSSYYYPLDDRAHWVLMSAI
FT                   CTGYSGSLYNQKTESPFFDNFCIGGIGTVRGFRLNSIGPKAAYYQCNNSNTNYSQCSIR
FT                   NSYDTIGGNAVVFIKNELIMPILWMNNTKYDNVARISLFIDSGTVWDTYWENTQKTQYA
FT                   GILDYSIFGHIRISSGISLKWISPIGPIIFSYSKLIQKYPGDMEEVFQFTIGKTGNL"
FT   gene            315348..315848
FT                   /gene="skp"
FT                   /gene_synonym="hlpA"
FT                   /locus_tag="BVAF_283"
FT   CDS_pept        315348..315848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skp"
FT                   /gene_synonym="hlpA"
FT                   /locus_tag="BVAF_283"
FT                   /product="chaperone protein skp"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_283"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33681"
FT                   /db_xref="GOA:E8Q6T4"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6T4"
FT                   /protein_id="ADV33681.1"
FT                   /translation="MKNQMYILGIMIWLIQINYVDASNKIAVVNIAHIFQQSSQRSESI
FT                   KKLECEFKDRASELEMMEHDLQIKMQTLQRDGATMKEIDRNKLEKLLIAQRELFSNKAK
FT                   VFQQDNHSRQTEERDKILDIIFTVVKNMAKRENYDIVIDTSSVVYFNSRIKDITNPVAK
FT                   QVG"
FT   gene            315865..316995
FT                   /gene="lpxD"
FT                   /locus_tag="BVAF_284"
FT   CDS_pept        315865..316995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="BVAF_284"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_284"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33682"
FT                   /db_xref="GOA:E8Q6T5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6T5"
FT                   /protein_id="ADV33682.1"
FT                   /translation="MCLNKIRLFELAKKIGAELHGNGNIYITQVSSIKKAQSGHITFLN
FT                   DLRYKNQLRFCSASAIIVSKENLKFCRSITALVVQDPILTYIKIFNFFHTQSNDKFNSH
FT                   ISAGSVIDKRAVLSKNVKIGNNVIIRSGAVVEDKVKIGSGCFIGKNVKIGEGTCLCSNV
FT                   VVHSESEIGKYCRIQSGSVIGSDGFGYIKRNNIWIKIPQLGRVNIENYVEIGSCTTIDR
FT                   GALDDTHIKNGVIIDNQCQIAHNVVIGEHTAIAGGVIIAGSVIIGNHCMIGGASVINGH
FT                   ISICDNAVVTGMSMVIRSISQPRVYSSGLPVQPNFSWKRTTALVMKIREINKRIKKVEK
FT                   KTHYSYYYRILGIIYFFTILSSTSLILLINFLFNQE"
FT   gene            317001..317468
FT                   /gene="fabZ"
FT                   /locus_tag="BVAF_285"
FT   CDS_pept        317001..317468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="BVAF_285"
FT                   /product="(3R)-hydroxymyristoyl-(acyl-carrier-protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_285"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33683"
FT                   /db_xref="GOA:E8Q6T6"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6T6"
FT                   /protein_id="ADV33683.1"
FT                   /translation="MVIDASMLSIEEVLRLLPHRFPFLLVDRVLNFEKGKFLKALKNVS
FT                   FNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSTGKLEPGELYYFAAIDEARFKKP
FT                   VQPGDQMILNVEFIKERCGIARFKGVATVNEEMACEALMMCARRKEIKIDD"
FT   gene            317461..318249
FT                   /gene="lpxA"
FT                   /locus_tag="BVAF_286"
FT   CDS_pept        317461..318249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="BVAF_286"
FT                   /product="acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_286"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33684"
FT                   /db_xref="GOA:E8Q6T7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6T7"
FT                   /protein_id="ADV33684.1"
FT                   /translation="MINPSAIIHPSSIIEKGAKIHANVHIGPFCFVGAQVEIGARTILK
FT                   SHIVINGVTQIGEDNKIYQFASLGEINQDLKYAKEPTKIEIGNFNQIRESVTIHRGTTQ
FT                   GGEITKIGNSNLFMINVHIAHDCVIGNHCIMANNVTLGGHVKVDDHVVIGGMTAIHQFC
FT                   LIGSHVMIGGCSGVVQDIPPFIIAQGNHATPFGLNIEGLKRKGFSRGSMHAIRNAYKVL
FT                   YRSNKTIEEAKIALKLLAMEYPVINTFISFLIRSQRGIIR"
FT   gene            318257..319408
FT                   /gene="lpxB"
FT                   /locus_tag="BVAF_287"
FT   CDS_pept        318257..319408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="BVAF_287"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_287"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33685"
FT                   /db_xref="GOA:E8Q6T8"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6T8"
FT                   /protein_id="ADV33685.1"
FT                   /translation="MVNCRPILIGMVAGENSGDILGVGLIKSLKKYLKNVYFFGVGGMR
FT                   MRSENMECWYNIEELSVMGITEVIFKLPSLIRIRRNLISQFLKLKLDIFIGIDFPDFNI
FT                   SLEYNLKKKGIRTIHYVSPSVWAWRRNRILYLKKAVHSVLLLFPFEKPIYSYFNVPHKF
FT                   IGHVLADEIPLYPNKIKIREKLGISDKKICLAVLPGSRMEEIKMLAQDFLTCIELLNNN
FT                   IPNLEVLVPLHHQKLIDQFVKLSSSISVKVKVLHTQKAWKIMVAADIALLTAGTATLEC
FT                   MLAKCPMVVAYRTNLLTFTLVKNFIKIPWISLPNLIAKKSIVQEFIQKECNPKNLSIAL
FT                   LNLLNYNDDQLLTLKRIFYQLHQSIKLNANEKAAYEILKFIKS"
FT   gene            319427..320053
FT                   /gene="rnhB"
FT                   /locus_tag="BVAF_288"
FT   CDS_pept        319427..320053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="BVAF_288"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_288"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33686"
FT                   /db_xref="GOA:E8Q6T9"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6T9"
FT                   /protein_id="ADV33686.1"
FT                   /translation="MYKKKLIIITNNKPILIAGVDEVGCGALMGPIIASAVIFPPFNNQ
FT                   KKINVAGLVDSKTLNSKKRVKLYKDIQKYSLSWSIGVVSVSEIDKLNVLKARLLAMKRA
FT                   VLNLSIIPDLILVDGNKAPFFKNIFYQCFIKGDVYIPIISAASIIAKVIRDRAMIILNT
FT                   QYPQYGLNHNKGYPTNFHIQQLYFYGPTIYHRKTFSPVKHMIGKI"
FT   gene            320135..323644
FT                   /gene="dnaE"
FT                   /locus_tag="BVAF_289"
FT   CDS_pept        320135..323644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="BVAF_289"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_289"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33687"
FT                   /db_xref="GOA:E8Q6U0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6U0"
FT                   /protein_id="ADV33687.1"
FT                   /translation="MVHPNFIHLHTRSDYSMIDSIAKVNELLEKAKLFNMPALALTDFT
FT                   NLFGLIKFHNYSYELGIKPITGSDFCIQDSSSDNIDFHEITCLVINSQGYQNLIQLISK
FT                   AYKYKSNTSFPVIKMSWLQEYNKGLILLSGGRNGDIGQYLLKDKKNKIDERLSFYNNYF
FT                   PNRYYIELIRTGREYEELYLQLAIELSKIKGLPVVATNDIRFINEKDFLAHEIRVAIHD
FT                   GVVVDKIQQLNKYSKQQFMKNAQDMCLLFKDVPESLTNTVEIAQRCNCIINLNGSFLPK
FT                   FPTGSISIENFLIKFAQKGLEKRLLHLFPDDKKRYINRKPYDERLSHELHVIIQMGFPG
FT                   YFLIVMEFIQWAKNNKIPVGPGRGSGASSLVAYVLTITELDPIKFDLLFERFLNPERIS
FT                   MPDLDIDFCMEHRDLVIDHVVKTYGSCAVAQIITFGTMAAKAVIRDVGRALGYPYTFIN
FT                   SIAKLIPSKIGITLSQSYATDSQLKLMYDNNEEIKKLIDLSLQLEGLIRNVSKHAGGVV
FT                   IAPSKITDFSPLYYDSDHTHPMTQFDKNDIERIGLIKFDFLGLRTLTVIDRSLKMINNL
FT                   RLKSCLSIIDINQISLNDQESFDVLQTSKTTGIFQLESRGIKALIKRLKPDCFEDLIAL
FT                   IALFRPGPLQSGMVDNFINRKHGYEAIYYPDSQWEHKSLRPVLKSTYGIILYQEQVMQI
FT                   AQVLAGYTPGKADILRRAIGKKKPEDMAKQRSIFIDGAVRNGIDKILSKKIFDLMEKFA
FT                   GYGFNKSHSVAYALLSYQTLWLKTHYPAEFMASTLNSDMDNLNRTINLLNECKRIGLKI
FT                   HPPDINNSQYYFCVNKKKEIVYGIGAIKGIGKTSIDEIVKSRNCHGEFKGLFDFCVRIE
FT                   NLKINFRMVEKLIFSGAFDSFKTHRSKLLSTLKDTINNATQYINKKNSKQTDMFETYIN
FT                   TQVTEYNVLNMSCMTSTKWNNQILLEKEKETVGLYLTNHPVDQYIDEIEQYILNINKIK
FT                   DVFRKKNNEMVCIFGLLSSVRIKLSKKGNYILFGILEDKDDQVEIVVFSKLLKKYHYCL
FT                   KENNLIFIEGILNYDEILDIYKIIVHEIQDINDLRKRHVCNLSVLLHNKYCNKKLLHDI
FT                   YNVFKKNQLTGGIPVYFLYQVDGIQVKLRCHKKWNVILTDQLLTDLRDLVGYDQIVLEL
FT                   NSD"
FT   gene            323666..324625
FT                   /gene="accA"
FT                   /locus_tag="BVAF_290"
FT   CDS_pept        323666..324625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="BVAF_290"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_290"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33688"
FT                   /db_xref="GOA:E8Q6U1"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6U1"
FT                   /protein_id="ADV33688.1"
FT                   /translation="MNLNFLDFEKPILDIESKINFLSKSIYRDENLSDNVDKEINNLKK
FT                   KHVETIQRIFSNLNSWQITQLARHSCRPHTLDYIEYIFNDFDELSGDRVYGDDKAIVGG
FT                   IARLDSRPVMIIGHQKGRKTQEKIDRNFGMPAPEGYRKALRLMKMAEKFNMPLITFIDT
FT                   PGAYPGIGAEKRGQARAIAKNLCTMITLKIPIVCTVIGEGGSGGALAISVGDKINMLEY
FT                   STYSVISPEGCASILWKNSTKAPIAAEAMGITAHKLKRLKLIDNIISEPLGGAHRDILS
FT                   TSLSIKKQLLLDLIELDCLTEKDLLNNRYQKWMSFGYC"
FT   gene            324840..326447
FT                   /gene="tilS"
FT                   /gene_synonym="mesJ"
FT                   /locus_tag="BVAF_291"
FT   CDS_pept        324840..326447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /gene_synonym="mesJ"
FT                   /locus_tag="BVAF_291"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_291"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33689"
FT                   /db_xref="GOA:E8Q6U2"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6U2"
FT                   /protein_id="ADV33689.1"
FT                   /translation="MLIDIDTLILSTNLSLQDKYLYNQVACCILNYRNLLLSYSGGLDS
FT                   TVLLDILTTLTKNSQIWMKSRKFPLFLKAVYVHHGLNEKADDWANHCAHQCQIRDVPFN
FT                   ILYIQYFNFCKKRSNVESLARKLRYQVLYDYLNVNVEEILLTAHHMDDQLETVLLALKR
FT                   GSGPAGLSGISREVWLNYDYRYRVLRPLLGCSRGQLEEYAHRRKLIWINDDTNVNIRFD
FT                   RNFLRIQVIPLLNKRWPAFNKVVTRTAQLCRNQENLLRELLLETLNTLVDVNGALFFLP
FT                   LLKYSHSKRQALLRFWLRNFFKDMPSYRLLQCIWTEVALSKVDSKPVLNLGKNHICCRF
FT                   RKKLYILPITMKSPLNTFNLSWNPFNKIMMLPDKLGLLISRSCMINECFCHKTKQFYNN
FT                   KNILLPDFLLNYSTNNGRVVTNCFIRNPKVDEKIFIRFGNVSGLLYLMNRNRGRLLKKI
FT                   WQEYSIPPWLRSRIPLLFYNEILISAIGVFITKDGSITRLTDEKIINDDIIAVRQISWV
FT                   QNDLIYNLFKGVICNVLK"
FT   gene            complement(326555..328342)
FT                   /gene="proS"
FT                   /locus_tag="BVAF_292"
FT   CDS_pept        complement(326555..328342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="BVAF_292"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_292"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33690"
FT                   /db_xref="GOA:E8Q6U3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6U3"
FT                   /protein_id="ADV33690.1"
FT                   /translation="MRATQYLLTTLKEIPKNCETISHQLMLRSGMIRQISTGLYTWLPI
FT                   GLRVLRKVENIVRDEMNNISFIEISMPIIQPANLWKQSGRWSEYGPELLRFKNRVNQEF
FT                   VLGPTHEEMISNLICKEIISYKQFPIKLYQMNTKYRDEIRPRFGLIRAKEFTMKDGYSF
FT                   HTNNKCLQNTYNNIYHQYHTIFNRIGLNFHVVQADTGNTGGTLSHEFQAYPENNNNYTD
FT                   NANQTAMMIHHNQSKNLSIKHNNTTNQTQFTPTLPNEIMRLITIPPKHNNSIQSILELL
FT                   NKFKLPINKTIKITIVKTNNINQKYPYNFLGLVLRADHQLDNEKLLMIPEIFFPTSILN
FT                   KQEVEKIIKVKPILLNFIHLSIPIIIDRNVAIMNDFIIESNIDGKYIFGVNWNRDLPMP
FT                   KIADLYKSKCNNNYKQNNKNKKNIAFIQNKIEIGHIFQLGDKYSRSIYSCIQKYNKFNI
FT                   KIIMGCYGIGITRIIPTIIEQNYDQYGIIWPDSIAPFKLAIIPINMHVSVNVRNTTEEL
FT                   YTQFKSIIGSDVFIYDRKENPGIMFADIDLIGIPHILVISDRNLNNQEVEYKHRKTRTT
FT                   TKIKLDVILQFLINKLIRC"
FT   gene            328522..329105
FT                   /gene="gmhB"
FT                   /gene_synonym="yaeD"
FT                   /locus_tag="BVAF_293"
FT                   /note="frameshift in poly-T tract; RNA polymerase or
FT                   ribosomal slippage"
FT   CDS_pept        join(328522..328610,328610..329105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="gmhB"
FT                   /gene_synonym="yaeD"
FT                   /locus_tag="BVAF_293"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_293"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33691"
FT                   /db_xref="GOA:E8Q6U4"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6U4"
FT                   /protein_id="ADV33691.1"
FT                   /translation="MNAKSAIFLDRDGTININNNYISQINNFFFIDNVIKTLLELQDMG
FT                   FILIIVTNQSGIARGFFTEEQFLYLTKWMISYLKSYFIYIDAVYYCPHHVKGKVKKFKQ
FT                   FCCCRKPNPGMLINAKKYFNINMSKSYIIGDSKYDMFAGKSAQVGTTVLIHNKYNTKII
FT                   QELEWGSNPDYVIESLEFLPEIIKYHDNNVI"
FT   gene            complement(329299..330660)
FT                   /gene="accC"
FT                   /locus_tag="BVAF_294"
FT   CDS_pept        complement(329299..330660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="BVAF_294"
FT                   /product="biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_294"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33692"
FT                   /db_xref="GOA:E8Q6U5"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6U5"
FT                   /protein_id="ADV33692.1"
FT                   /translation="MLNKIVIANRGEIALRILRSCKELGIKTVAVHSTIDRDLKHVLLS
FT                   DETVCIGLPSIVDSYLNIPAIISAAEITGATGIHPGYGFLSENADFAEQVERSGFIFIG
FT                   PNSETMRLMSNKISAISIMKKVGIKSVPGQDLKINEKINNIPYMNSNHININYPVIIKS
FT                   AYGAGGLGMCVVRKKNDLQNAIKLAKSESKKIFNNDSIYIERYLENPRHIEVQILSDGK
FT                   GNAIYLTERDCSIQRRHQKVIEETPASGITPEMRMFLGERCVQVCCEIGYRGVGTFEFL
FT                   YENDDFYFIEMNTRIQVEHPITEMITGIDLVQKQLEISSGYPLNITQNEINTMGHSIEC
FT                   RINAEDSQTYTPSSGRITRFHPPGGLGIRWESHIYSGYLVPSYYDSLIGKLISFGKTRE
FT                   IAIIRMKNALLELIIEGIKTNIELHLKIITDESFIKGKNINVHYLEKKINMYKM"
FT   gene            complement(330683..331147)
FT                   /gene="accB"
FT                   /locus_tag="BVAF_295"
FT   CDS_pept        complement(330683..331147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="BVAF_295"
FT                   /product="biotin carboxyl carrier protein of acetyl coA
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_295"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33693"
FT                   /db_xref="GOA:E8Q6U6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6U6"
FT                   /protein_id="ADV33693.1"
FT                   /translation="MDIRKIKKLVELVEESSISKLEIIEGKKTIRIIRSEYKISSQSSL
FT                   VPITTKRKTEALSSTTINKDHQHELLDTIDTYIVRSPMVGIFYTASYPHDKPFVFIGKS
FT                   VEIGETLCIIEAMKVMNQIQSEKSGIIQSILIDDGKPVEFGEPLFIIKIT"
FT   gene            complement(331189..331629)
FT                   /gene="aroQ"
FT                   /locus_tag="BVAF_296"
FT   CDS_pept        complement(331189..331629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="BVAF_296"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_296"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33694"
FT                   /db_xref="GOA:E8Q6U7"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6U7"
FT                   /protein_id="ADV33694.1"
FT                   /translation="MFKLLLINGPNLNLLGIRETNLYGHNRLSTIISDLNKTADSLGII
FT                   LNHFQSNAEHKLINRIHESYNNTDFIIINPAAFTHTSIALRDALLSVKIAFIEIHFSNI
FT                   YKREKFRSHSYLSDIAIGVICGFGELGYHVSLRMAHQYLSKN"
FT   gene            332056..333099
FT                   /gene="mreB"
FT                   /locus_tag="BVAF_297"
FT   CDS_pept        332056..333099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="BVAF_297"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_297"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33695"
FT                   /db_xref="GOA:E8Q6U8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6U8"
FT                   /protein_id="ADV33695.1"
FT                   /translation="MFKKFRGIFSSDLSIDLGTANTLIYLKGQGIVLNEPSVVAIRQDR
FT                   GGIPKSVAAVGYAAKQMLGRTPGNIVAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFM
FT                   RPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGSMV
FT                   VDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDESIISYVRRHYGSLIGEVTSERIKHTI
FT                   GSAYLDKELREMEVRGRNLAEGIPRSFTLNNHEILEALQEPLTGIVSAVMAALEQCPPE
FT                   LASDISEYGMVLTGGGALLKNIDRLLIKETSIPVVIAEDPLTCVARGGGKALDMIDLHG
FT                   KDLFSEE"
FT   gene            333210..334040
FT                   /gene="mreC"
FT                   /locus_tag="BVAF_298"
FT   CDS_pept        333210..334040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="BVAF_298"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_298"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33696"
FT                   /db_xref="GOA:E8Q6U9"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6U9"
FT                   /protein_id="ADV33696.1"
FT                   /translation="MLYSRIVKRIPYLELRLIIAVIVSIVMVFADNKFHMFSSFKNCIA
FT                   NYIYLFYYLCDKPNYIFNYVAKVLVTYKELIAENDALRKELFLKNSELLLMDQYKHENL
FT                   KLYELLNSPVYQEKRKLITKIIFIHVEPNNQQAIINQGKNKNIYVGQPVFAASGVIGQV
FT                   ISVNDFNSRVLLISDFEHALSVQLNRNDANNVYLILMGRGFNLDLYAEYSGNSTDICIN
FT                   DILITSGLDGRFPAGCPVAKISHIEVNSEQDYTIVRAKPIVNLKYLRYAMLILE"
FT   gene            334178..334663
FT                   /gene="mreD"
FT                   /locus_tag="BVAF_299"
FT   CDS_pept        334178..334663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="BVAF_299"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_299"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33697"
FT                   /db_xref="GOA:E8Q6V0"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6V0"
FT                   /protein_id="ADV33697.1"
FT                   /translation="MRHYRIVKYKIGIVCCSFIIAMVLQGVMSLVTTWYFQPSWILMVL
FT                   IYWINMHPNKINIGAGFVLGLLTDCICFSTIGVHALSFSILSYVVVRKVYIFRYTSIWQ
FT                   QSFFVLFFSLINQSIKFLIKFFIIKNSCSPEIFWNCILDFSIWPFLVFLMSKHFTYK"
FT   gene            335023..336501
FT                   /gene="tldD"
FT                   /locus_tag="BVAF_300"
FT   CDS_pept        335023..336501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="BVAF_300"
FT                   /product="putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_300"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33698"
FT                   /db_xref="GOA:E8Q6V1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6V1"
FT                   /protein_id="ADV33698.1"
FT                   /translation="MSIEFVSQQILVPNKLQISDLSYLLGMAESFNIDYSDLYFQSRFY
FT                   ENWILEDKIIKSGSYHVNQGVGIRVIVGEKTGFSYTNKLVLDSLVHSMNDAIGIVNSNN
FT                   FKNAMKCDNREVELLFSKREKEKNAYLNVNPLSAMSNEEKIDLLIRIDKIARHEHSYVK
FT                   TVQATLSGMYEQILVAATDGTLSADIRPLIRLSILVQVEHNGRREQGFSGGGGRSGYDY
FT                   FLNNIIHGESCIDHWTKNAVKMGVTNLKSISAPIGTMPVVLGPGWPGILIHEAVGHGLE
FT                   SDFNRKGSSVFSKEIGKKVASELCTIVDDATFKLSRGSLIIDDEGIPGQYNILIKDGVL
FT                   QGYMQDKLNSKFMGVCSTGNGRRESYSDLPMPRMTNTYMLPGKSTPEEIINSIEYGVYA
FT                   TNFGGGQVDITSGKFVFSTSEAFLIEKGNITNSIKGATLIGSGIEIMQNISMIGNDLLL
FT                   DSGIGTCVKNGQKIPVSVGQPTIKLNKITIGGVT"
FT   gene            336806..338146
FT                   /gene="pmbA"
FT                   /locus_tag="BVAF_301"
FT   CDS_pept        336806..338146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="BVAF_301"
FT                   /product="putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_301"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33699"
FT                   /db_xref="GOA:E8Q6V2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6V2"
FT                   /protein_id="ADV33699.1"
FT                   /translation="MDLMSDAKQNDLFLKKITNRTLQLTSQCSQESEVSIIKTTGINVS
FT                   TRYGNVENIEFDNNEILKITVFFQHKKGIVFLNNLSEQSIIDAVHYAVDIARYASIDLY
FT                   SGIADKELLAFNPVYLDLCHPIELDIKSSIQLASRAENTALNYDRRIICTEGGRFSSHI
FT                   TTVIFGNSHGMLSSYSSSQYFLSCNVIAESNGVMEQDYSYTLSRVFKKLRSPEWVGKEC
FT                   ARRVLMHLNSRKINTIESPVLFTSETAVSLLQHLANAIHGDNIYKQSTFLLNDLGKKIF
FT                   PSWFCIKEIPHVSQELGSAPFDDEGVQTLNKSIVKNGILNSWLLNTYSANKIGLKSTGN
FT                   AGGIHNWYVSCQNISFMELIKIMNRGLIITNLMGQGVNIVTGDYSRGASGFWVNHGEIQ
FT                   YPVHEITVSGNLRQMFLNVNSISNDIETRSNIHCGSILINAMQIAGT"
FT   gene            338491..340818
FT                   /gene="lon"
FT                   /locus_tag="BVAF_302"
FT   CDS_pept        338491..340818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="BVAF_302"
FT                   /product="ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_302"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33700"
FT                   /db_xref="GOA:E8Q6V3"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6V3"
FT                   /protein_id="ADV33700.1"
FT                   /translation="MNTKQSERIDIPVLPLRDVVVYPHMVIPLFVGREKSIKCLEYAMS
FT                   GDKKIMLVAQKEASNDEPSINDLFSVGTVSIILQMLKLPDGTVKVLVEGLIRARIIELT
FT                   DSGNYFKADADYFDIKELNEKEKEVLMRTVIHQFEGYIKLNKKIPPEVLVSLNNINDAD
FT                   RLADTIAAHIPLKLHDKQSILEMSNITERLEYLISVMESEIELLKVEKRIRNRVKKQME
FT                   KSQREYYLNEQIKAIQKELGEMDNIVDENESIKRRIESSKMPKEARNKIESEFQKLKMM
FT                   PPMSSEATVVRGYIDWVLSVPWHSKSKMKKDLVKAQESLDRDHYGLKRVKDRILEYLAV
FT                   QNRINKIRGPILCLVGPPGVGKTSLGKSIAKATGRKYIRMALGGMRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMSKIGVKNPLFLLDEIDKMSFDMRGDPASALLEVLDPEQNIAFNDHYLE
FT                   VDYDLSDVMFVATSNSMNIPSPLLDRMEVIKLSGYTEEEKFNIARQHLLSKQIERNALK
FT                   PGELLIQDDALTSIIRYYTREAGVRNLEREISKLCRKTVKNLLLNKKITCITINEENLK
FT                   DFLGVQRYDCALAEQENRIGQATGLAWTEVGGDLLTIETVCVPGKGKLTYTGSLGEIMQ
FT                   ESIQAALTVVRARADKLGIKTDFYEKKDIHVHVPEGATPKDGPSAGIAMCTALVSCLTG
FT                   NSVKAHVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPYENKRDLEDMPDVVIN
FT                   NLNIYPVKQIDEVLTLALQNAP"
FT   gene            341283..341834
FT                   /gene="apt"
FT                   /locus_tag="BVAF_303"
FT   CDS_pept        341283..341834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="BVAF_303"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_303"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33701"
FT                   /db_xref="GOA:E8Q6V4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6V4"
FT                   /protein_id="ADV33701.1"
FT                   /translation="MVNTKNQQLMLIKNNIKFIPNYPKKGIIFRDISTLLANPNAYSTS
FT                   ITLLASHYQHYQLTKIIGVEARGFLFGAPLALILKVGFIPVRKAGKLPCNTINETYILE
FT                   YGTGCLEIHKDSIVPGDKVLIVDDLLATGGTIEATVKLIRRLGGKVNDAAFIINLEYLG
FT                   GNLLLKNIGVNTYSLVVFSE"
FT   gene            341898..344067
FT                   /gene="dnaX"
FT                   /locus_tag="BVAF_304"
FT                   /note="frameshift in poly-A tract; RNA polymerase or
FT                   ribosomal slippage"
FT   CDS_pept        join(341898..343550,343552..344067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="dnaX"
FT                   /locus_tag="BVAF_304"
FT                   /product="DNA polymerase III subunit gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_304"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33702"
FT                   /db_xref="GOA:E8Q6V5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6V5"
FT                   /protein_id="ADV33702.1"
FT                   /translation="MTYQILALKWRPKKFSEIVGQAHIIKAMIRSFILNRIHHAYILSG
FT                   TRGSGKTTIARLFAKGLNCEIQFASNNDVCGQCKNCLDIESGCFIDLIEIDAASRSKVE
FT                   ETREFLDNMQYAPSQSQFKIYLIDEAHMLSRHSFNALLKTLEEPPHHVKFILITTDHQK
FT                   LPETILSRCLQFYLKPLSTSQITTQLQYICNQENININDIHLLELLANSAKGSMRDALN
FT                   LLEQAIILGDSNHITSDVINNMLGILDVDDSISLIEDLMNGNINNIMHKIDHYSNIGID
FT                   WDHFFSEILTILQKIAINQFTSFSTIQQHNTNNKSKNINHRIHNLRTKISPETIQLYYQ
FT                   IFLLGRQELSYAPSYRIGTEMTILRALAFSPINIQSKKNSNKNDINKFNDNLKYCKNSL
FT                   PQSTTHLNMLTIPKSKTLIKKPLISNKIHTNTNTIELQKIQHQHNLSVVDRNLPQNIIP
FT                   NDNSSNHQLHLGDVTKIFNTHLVSNKIPSNTVSEILKARSKLINYHDNYNKTIKMKAKS
FT                   DKNIEFQKKLANILKRFSDINMTAIPHDSKNIKKNDKNLLIKINSHKSNINTHRVDYYI
FT                   YLDSKKPLHVIMKDIFQEAVQFDPWIFQIYQLSLLKPAKQLLLSSWKQIVDDNKLYLNL
FT                   LTCFQHLYSKDLHNAIQLEISNNLKMPIKLYIIKNDNFVEKTPIEYLYILYTNKIVQLK
FT                   QKILIDPNTKIIQSLFNAKFYEEDIQIF"
FT   gene            344291..344959
FT                   /gene="adk"
FT                   /locus_tag="BVAF_305"
FT   CDS_pept        344291..344959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BVAF_305"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_305"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33703"
FT                   /db_xref="GOA:E8Q6V6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6V6"
FT                   /protein_id="ADV33703.1"
FT                   /translation="MIRIIFLGPPGSGKGTQAHLIADLYNIPNISSGEILRHSYNTFKL
FT                   NLPSTNAINLINSGKLVNDELIIKLIINRIRKTDCQHGFIIDGFPRTINQAIAIKKNKI
FT                   SIDFVIEFYMKDAEIIDRIIGRQIHLSSGRIYHKKYNPPKFHGIDDITGENLIVRKDDT
FT                   EEVIQQRLDQYYKYTAPLSNYYKKQAKKNNMHFYVINSNQEIMKIHTELVDIINLYAST
FT                   "
FT   gene            complement(345025..345774)
FT                   /gene="lpxH"
FT                   /gene_synonym="ybbF"
FT                   /locus_tag="BVAF_306"
FT   CDS_pept        complement(345025..345774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /gene_synonym="ybbF"
FT                   /locus_tag="BVAF_306"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_306"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33704"
FT                   /db_xref="GOA:E8Q6V7"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6V7"
FT                   /protein_id="ADV33704.1"
FT                   /translation="MSILFISDVHLHNNKPKIIKGFLNFLRIQATQAKALYILGDLFEI
FT                   WLGDDNDNSMCINIAKGLKSLNKKKIPCYFIRGNRDFLLGEKYANACGMILLPDNPVLK
FT                   LPSGKNIVILHGDTLCIYDKPYQRLRVFLRCRIIQKLFLSLPLSVRFCIYNFMNSYVTR
FT                   YNQSKSKNKLNISTKKAIDILMKNQSQIMIHGHTHQPAIHNIYFYKEKKILLKRIVLGC
FT                   WNRCGSVVRLDDKNDNIALVNFPLDYS"
FT   gene            346066..347472
FT                   /gene="cysS"
FT                   /locus_tag="BVAF_307"
FT   CDS_pept        346066..347472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BVAF_307"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_307"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33705"
FT                   /db_xref="GOA:E8Q6V8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6V8"
FT                   /protein_id="ADV33705.1"
FT                   /translation="MLKIFNTLTQKKEILKPINFNTIKLYVCGVTVYDLCHLGHARTFS
FT                   IFDTIIRYLNYCGYQVEYTRNITDIDDKIIQRAFSHHETIVQFTNRMIQEMYIDLDNLN
FT                   ILRPKHEPKVTNYIDTIINCIHLLLKKKHAYITRNGDVMFSINTANKYGILSRNKKLIQ
FT                   SISKYTNHNTIKKNSADFVLWKSAKFNEPYWMSPWSKGRPGWHIECSAISHNILGKNID
FT                   IHGGGSDLMFPHHENEIAQSACAYSIDPNVYVNIWMHVGMLLLNNEKMSKSLNNFFTIR
FT                   EILKKYDPETIRYFLLSAHYRNQLKYNDNNMKSAQLALKRLYIALYGINPIVHSANDEE
FT                   RYFTLKFIEKMNDDFNTPEAYSVLFEMAHELNRLKSKHYYIRAQRLATQLKLLANILGI
FT                   LYQNPENYLQCQVSKNKNPFEIEKIQKLIQIREDARKNKNWELADKIRTQLTTLGVILE
FT                   DEPEGKTRWR"
FT   gene            complement(347576..348427)
FT                   /gene="folD"
FT                   /locus_tag="BVAF_308"
FT   CDS_pept        complement(347576..348427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="BVAF_308"
FT                   /product="bifunctional protein folD"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_308"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33706"
FT                   /db_xref="GOA:E8Q6V9"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6V9"
FT                   /protein_id="ADV33706.1"
FT                   /translation="MNAKLINGKYFAEKIKQDIAKQVYKNTNMGKRAPGLAMLLIGDDP
FT                   ISKIYVTHKKKACKQVGFISFLYTLPITVTEKEVLQLIKTLNNDCRIDGILIQLPLPNK
FT                   LNDIKILEHIIPDKDVDGFHPYNIGRLCQRSPVLRPCTSKGIMTLLKGCNINMFILDAV
FT                   IVGASNIVGRPMMMELLLAGCTVSITHKFTQNLKLYIKNADLLIVAIGKANFIPGNWIK
FT                   KGAIVIDVGINRLDNGSLVGDVHFPSAYERAAYITPVPGGVGPMTVATLIQNTLQAYYN
FT                   HV"
FT   gene            348624..348697
FT                   /locus_tag="BVAF_309"
FT   tRNA            348624..348697
FT                   /locus_tag="BVAF_309"
FT                   /product="tRNA-Arg"
FT   gene            348908..349879
FT                   /gene="ytfF"
FT                   /locus_tag="BVAF_310"
FT   CDS_pept        348908..349879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytfF"
FT                   /locus_tag="BVAF_310"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_310"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33707"
FT                   /db_xref="GOA:E8Q6W0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6W0"
FT                   /protein_id="ADV33707.1"
FT                   /translation="MILGIVCAIISCLLWGVIFIGPLLVPEYPGMLQASGRYIVFGLIS
FT                   LPLSWIDRKHLCKLSLQDWIEAIKLVISGHLIYYACLASAIQRIGAPISTAIIGTLPIM
FT                   IMIIAHIIMKNNNQKKNNKKFFKCSIIMPIVLIGIGLLCINISELKSENLIEYNSLEYI
FT                   VGIILAVISVISWSWYALRNAHWLKTHPNNKPITWTNAQGIVTLPLSCFTYFIICLYSY
FT                   YVKDEFILPLGPRPFFFILLMISIGLCCSWLGTFFWNKASQRLPTTLMGSLIVFETIAG
FT                   LIYAFIHRWLWPSSLILIGIILLISGVLCILYIENVYKHNYQ"
FT   gene            complement(350073..351188)
FT                   /gene="mrdB"
FT                   /locus_tag="BVAF_311"
FT   CDS_pept        complement(350073..351188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="BVAF_311"
FT                   /product="rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_311"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33708"
FT                   /db_xref="GOA:E8Q6W1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6W1"
FT                   /protein_id="ADV33708.1"
FT                   /translation="MNQIIYKKNIFHNILHIDLILFLPILCILLFSIFITWSASGQSVE
FT                   IIQQKIIQIIIGFIIMILLAQIPPKKYEMYALHTYNICLILLILVNITGHISKGAQRWL
FT                   DLGLLKFQPSEIVKFSILLITAYYLNKGQYPPSIKRVCIVLLLTTIPAVFILLQPDLGT
FT                   TILTMSTGLFVLFLSGISWKLIIIILSMIISLIPIFWFFFMYPYQKIRISILWNPEIDP
FT                   LGSGYHIIQSKIAIGSGGLIGKGWLHGTQSQLEFLPERHTDFIFSVIGEEFGFLGISML
FT                   FILYLIIILRGFFIAINVQHMFGRLVTGGSILIFFMTIFMNIGMVTGILPVVGMPLPLV
FT                   SYGGSSLLVLMAEFGCIMSMHSHRKMISKVL"
FT   gene            complement(351241..353091)
FT                   /gene="mrdA"
FT                   /locus_tag="BVAF_312"
FT   CDS_pept        complement(351241..353091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="BVAF_312"
FT                   /product="penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_312"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33709"
FT                   /db_xref="GOA:E8Q6W2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6W2"
FT                   /protein_id="ADV33709.1"
FT                   /translation="MKFHKFQIFPDYSTASLLFIQRVMISFFIIILMLSALFIYLYNIQ
FT                   IIQFQIYTIRSNENCIKIIPISPKRGIIYDRNGIALALNRAVYHLEIIPEYSLNLTETI
FT                   QELQSLLQLDADDINKFEKERKRHPRFTPIPIKIGLTEEQRARFAVNQFRFHGVTIKRY
FT                   QCRYYPYGPILTHVVGYVSKINKLDIQQLNKNGIYAKYVATQNIGKLGIERYYENILHG
FT                   TPGYGAVEVNNRGKIIRKLYEKPPIPGKDIFLTLDVHLQQYITKLLVGSRSSVIVIDPR
FT                   TGGIQALVSYPSYDPNLFVNGISQSEYCLLLKNHDCPLLNRATQGIYPPASTVKPYISV
FT                   SALILGIINKNFSFFDPGWWKLPGSEKRFRDWKRWGHGELNITKALEESSDTFFYQIAY
FT                   KMGIDNLSEWMSKFGYGKYTGIDLREELTGVMPNRAWKVKKFKIPWYQGDTISVGIGQG
FT                   YWTATPVQMSKALITLINDGNVRIPHLLHSVLLNKNYSISYNQVENKQVGDPKSNVWQI
FT                   AKDGMFGAANRPNGTVKNSFSNTTYKAAAKSGTAQLFRLKNQQNYDPSKISKYLQDHKL
FT                   MTAFAPYEKPTVAIVVILENGGVNMSIGTITRKILDYILL"
FT   gene            complement(353197..353526)
FT                   /gene="ybeB"
FT                   /locus_tag="BVAF_313"
FT   CDS_pept        complement(353197..353526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /locus_tag="BVAF_313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_313"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33710"
FT                   /db_xref="GOA:E8Q6W3"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6W3"
FT                   /protein_id="ADV33710.1"
FT                   /translation="MKFDILKQLILNCIEDLKGQNIVCLNINTDKYKYSITNLMIFCTG
FT                   QSSRHVVSIAQNILKKLRQTSFHKFYGIEGVECGEWVLVDLGDIIIHIMKSEIRKLYEL
FT                   EKLWN"
FT   gene            complement(353747..354769)
FT                   /gene="holA"
FT                   /locus_tag="BVAF_314"
FT   CDS_pept        complement(353747..354769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="BVAF_314"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_314"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33711"
FT                   /db_xref="GOA:E8Q6W4"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6W4"
FT                   /protein_id="ADV33711.1"
FT                   /translation="MIWIYPEQLSKKLNKKNKFIYILFGNDLSLLQDSHEDIINTIKKS
FT                   YDCEHFRIQLDKNYDWDQIFTLCKETNLFSKLQILSIHFSQDYPISSLKKNVSTLLSLT
FT                   KDNLVFILIIYKLNQFIQQNNWIHHLYKQNILLINCITPEYSRLTMWIQNQAKRMQLVI
FT                   ENLACQLLCSYYEGNTIRLKQILEHLFLIYPDGNLTFDRVKTIIVDSSCFNYNHWIESI
FT                   LMGRKQRANRILNQLDYMRLNLKILLHKIQHEILIIIRIKYDLIAKKNVLSVLFDKYKI
FT                   YTQYRRIMLSKAMHRLSLMQLHKAIFLLTQMELQYYQNYMEVSKIHFELLAEILCYKSA
FT                   "
FT   gene            complement(354832..355413)
FT                   /gene="rlpB"
FT                   /locus_tag="BVAF_315"
FT   CDS_pept        complement(354832..355413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpB"
FT                   /locus_tag="BVAF_315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_315"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33712"
FT                   /db_xref="GOA:E8Q6W5"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6W5"
FT                   /protein_id="ADV33712.1"
FT                   /translation="MFLEKKNYYIIFNKSICISLLLFSGCNYELATTSYLSTGCNANNC
FT                   DTEKNKQLTIELNSFYPYNSITRYMKHELCINNINVIENIYDTTIMHKNCESHKFSLNI
FT                   THMSKKYITISVFPNGIKSEYQIILKIRAIFCTPPQINCYPVIVQTYRNFINNPEKALS
FT                   NLIQENEILEEMYQDVARKLTRQFLNAIKK"
FT   gene            complement(355421..358024)
FT                   /gene="leuS"
FT                   /locus_tag="BVAF_316"
FT   CDS_pept        complement(355421..358024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="BVAF_316"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_316"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33713"
FT                   /db_xref="GOA:E8Q6W6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6W6"
FT                   /protein_id="ADV33713.1"
FT                   /translation="MQKIYSPIHIERIVQKYWHIHQTFSVQEDKSKQKYYCLSMIPYPS
FT                   GKLHMGHVRNYTIGDVISRYQRMLGKNVLQPMGWDAFGLPAEQAAITNNTNPSDWTYAN
FT                   IDYMKNQLKSLGFAYDWSREIITCQPQYYKWEQWFFNFLYKKGLVYKKTTIVNWCSYHE
FT                   TVLANEQVVNNSCWRCQNQIQYKKMPQWFIKITDYAKELLDKLDELKYWPNQVKAMQRN
FT                   WIGQSQGINIIFKIMNSNDIITIHSTRLDIFMGITYVVLSIDHPISLKIAKINLKINEF
FT                   IKKNSIDLTRFYNINAHDDKKGIFTDIYAVHPLNNSILPIWIANFVVPVEINGIGAIAA
FT                   CPAHNQQDWEFAHQYNLPIKPVIKNINDKFINIKTKAMTSVGILFNSGDFNGLISKVAS
FT                   DIITKVLINKKLAFFKVLYRLKDWSVSRQRYWGVPIPMVTLKNGVIKPVPMNELPVIFP
FT                   KQLYSVESNIKKTLKEKMSNWIRTTYKNKSATRDLDTFDTFIESSWYYARYTCPNYHNG
FT                   MLDSNAANYWLPIDQYIGGIEHATMHLIYFRFYHKLMRDAGLVNSHEPAIRLLCQGMIL
FT                   TDSFYYISNDGQKIWVSPKNVVVTRNNTGHIVKAIDTDGNNLIYDGMCKMSKSKNNGID
FT                   PNVIIKKYGADAVRFFIMFAAPAHATLEWRESGIKGAYRFLQRLWNITYQHIKSGLIND
FT                   ELYFHQLSDKNKTIRHLVHKTIIKVTDDIDRRQSFNTALSTIMKLVNNLQNAPKISIQD
FT                   RIVLQEALSVTIRLLYPFTPHISFILWKSLGNLKNIDDTKWPIVDEQAIQNKNVLIIVQ
FT                   INGKKKASIFVSKNSDKNTIYEMSKKSINLYINYKKNQIYKTIYIPNKVINFLVK"
FT   gene            complement(358171..359721)
FT                   /gene="lnt"
FT                   /locus_tag="BVAF_317"
FT   CDS_pept        complement(358171..359721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="BVAF_317"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_317"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33714"
FT                   /db_xref="GOA:E8Q6W7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6W7"
FT                   /protein_id="ADV33714.1"
FT                   /translation="MSILNFQYKHIQLVLALILGMFGILAFSPYDFWPASIISLTGLFT
FT                   IILDVSWTKAVRNTFLWGLGFFGSGLYWVYIGISQYFNVNTVISFLLIFILIIYLTLFP
FT                   MLFSILFVILQTITTKWISLVIATATLWSIIERLRGYICTGFPWLQFGYTQIDGPMKGI
FT                   APILGVEGITFILVFISALLALSIKTIQLFPFFLFLMTLMFLYPLTWIQWYHLDPKRIT
FT                   TISLVQGNIDQHLEYNAHNIALVLQTYLKHTLPLIGKSKIIIWPESAILGHELFHNKFL
FT                   TLLDHQLKKSNTCLITGIINRKFDTKKNKYYHYNSIIVLGDTIPYTYENHNRYNKHHLV
FT                   LCAEKFPLQTFFEPLFQYLKIPIVFMKSGCYLQPQLNAINVKITAAICYEIILGNQIRD
FT                   NFKFNSDFLLVIANDAWFGCSIGPWQHFQMIRMRAIELGRPILCCTNNGVTAIILADGS
FT                   IEAQVSQFISTTLTEKVIPTTGLTPYARFGTWWLFIIIVIIYTTYSILFIKNMFFKKF"
FT   gene            complement(359748..360626)
FT                   /gene="ybeX"
FT                   /locus_tag="BVAF_318"
FT   CDS_pept        complement(359748..360626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeX"
FT                   /locus_tag="BVAF_318"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_318"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33715"
FT                   /db_xref="GOA:E8Q6W8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6W8"
FT                   /protein_id="ADV33715.1"
FT                   /translation="MNNNTNMEESVNSIRKKNFFAVLLRHLFRDNFKNRNDLLNLIRDF
FT                   EENSLIDSDTKNMLEGVMEIVEQKVRDIMVPRSQIVFLKDTQSWDEQLSIIIKSTHSRF
FT                   PVLNGNLEQIKGILIAKDLLPFILNKSQACDINQILRPAMVVPENKGVDRMLKEFRAKR
FT                   CHMAIIIDEFGSMSGIITIENILELIVGEIEDEYDHKNDRDIYQINEHTFLVKALTTVD
FT                   DFNKIFNSCFYNDEIDTIGGFVMQSFGHLPANGEIINISGYTFKVTVTDNHRITQLLVQ
FT                   IPKNTLYLSNK"
FT   gene            complement(360680..361147)
FT                   /gene="ybeY"
FT                   /locus_tag="BVAF_319"
FT   CDS_pept        complement(360680..361147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /locus_tag="BVAF_319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_319"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33716"
FT                   /db_xref="GOA:E8Q6W9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6W9"
FT                   /protein_id="ADV33716.1"
FT                   /translation="MANKITLNLQIACTNLYGIPNKKIFQKWIKKIFFLYNKKIELTIR
FT                   IVDIQEMLYLNWYYAGKKHPTNVLSFPFKTPLKGILSSLLGDIVICKQIIEYESKQYNI
FT                   SSIMHWAHMIIHGSLHLLGYDHILNKDAELMHQMELNIMQKFGYHNYYFFN"
FT   gene            complement(361187..362176)
FT                   /gene="ybeZ"
FT                   /locus_tag="BVAF_320"
FT   CDS_pept        complement(361187..362176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="BVAF_320"
FT                   /product="phoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_320"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33717"
FT                   /db_xref="GOA:E8Q6X0"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6X0"
FT                   /protein_id="ADV33717.1"
FT                   /translation="MNIKIIDIVLKPTNNKRLNSLCGPCDDNLKQFEHQLSITISRQNN
FT                   IFKLQGLSLSVDIAIKTLILLYENTISIHGAINDINPDQVSFAIQYIQALTQQPNYLTN
FT                   IKNNFISIQMQITLKHRIIKPRTLNQARYIANIFNHDITFGIGPSGTGKTYLAIAIAID
FT                   LLERKKNQHIILSRPAIEAGEKLGFLPGDFNQKTDPYIRPLYDALGDVLGYKEMDQLIQ
FT                   KNTIEVIPLAYMRGRTLNNAIVILDESQNTTITQMKMFLTRIGFNSKAIITGDITQVDL
FT                   PSYQESGLAHAIKILSVIKDISFNFFNKSDSVRHAIVTKIIDAYESCD"
FT   gene            362560..363756
FT                   /gene="ubiF"
FT                   /locus_tag="BVAF_321"
FT   CDS_pept        362560..363756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiF"
FT                   /locus_tag="BVAF_321"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_321"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33718"
FT                   /db_xref="GOA:E8Q6X1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6X1"
FT                   /protein_id="ADV33718.1"
FT                   /translation="MNKLFYDVLICGAGIIGSALALRLAQSGLLIAIVDHNNLILKKNK
FT                   NTIPDSRVSAINYASVNFFKKINIWKDIPSEFLASYHYLKVWECPISVVTFNSNSIGLS
FT                   EMGFTIENNRLKSILWKAMINSLRITLYCPSILVDFQYNGTYWQCTLNNNIIVNSWLLI
FT                   GADGTYSKIRERLGIGVTGHIYNQYCMLLTIKTEYSKQGTIWQIFTPRGPIGFLPLYDR
FT                   WGSLMWFDTGKYIRRLQCLPKLILEKKIKTNFYKQLGECSLHNILIIPLLTQQPHYCVF
FT                   SGGVLIGDSAHTIHPLAGQGINLGIRDVMQLSKLLIDIGNFKKDVLILQEILQSYQNKR
FT                   KFDVSLMQNSINWLHTIFHNNFLPLKITRNLTFMMIERLPYIKRQILRYAVGVSSFIK"
FT   gene            complement(363992..364063)
FT                   /locus_tag="BVAF_322"
FT   tRNA            complement(363992..364063)
FT                   /locus_tag="BVAF_322"
FT                   /product="tRNA-Gln"
FT   gene            complement(364166..364247)
FT                   /locus_tag="BVAF_323"
FT   tRNA            complement(364166..364247)
FT                   /locus_tag="BVAF_323"
FT                   /product="tRNA-Leu"
FT   gene            complement(364390..364463)
FT                   /locus_tag="BVAF_324"
FT   tRNA            complement(364390..364463)
FT                   /locus_tag="BVAF_324"
FT                   /product="tRNA-Met"
FT   gene            complement(364788..365942)
FT                   /gene="nagA"
FT                   /locus_tag="BVAF_325"
FT   CDS_pept        complement(364788..365942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="BVAF_325"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_325"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33719"
FT                   /db_xref="GOA:E8Q6X2"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6X2"
FT                   /protein_id="ADV33719.1"
FT                   /translation="MYALVNGKIYTGYHILDDHALIISDGYIKEICPTAHLPININTHN
FT                   LLGLIVSPGFIDLQLNGCGGVQFNDNSQSISSQTLEIMKITNRRFGCTSFLPTLITSND
FT                   SLMKQAIKVVRIFSNQNKSQVLGLHLEGPFLNAKKKGIHNSNLIRSPTKKILDYLCSNS
FT                   DIIKKITLAPEQLDCVVIEKLQRSGICISIGHSNATYYETKLSFLSGVSFGTHLFNAMP
FT                   PIYAREPGVIGAIFDTTQIYCSIIADGIHVHWNNIKYAKQIKKDHLILVTDGTSPSGAE
FT                   YITNFIFSGETILHHKNICTNSHGVLSGSSLTMIQAIQNSVKYANIPLDEALRMATLYP
FT                   ARAIGIDNYLGSLEKNKIANLTVFDKKYQIKKTVVDGKIYVISN"
FT   gene            complement(365954..366757)
FT                   /gene="nagB"
FT                   /locus_tag="BVAF_326"
FT   CDS_pept        complement(365954..366757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="BVAF_326"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_326"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33720"
FT                   /db_xref="GOA:E8Q6X3"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6X3"
FT                   /protein_id="ADV33720.1"
FT                   /translation="MRVIFLNNSDQVAQWVSDYIVWKINYFKPTKINPFILGLPTGNTP
FT                   IKTYKKLIKIHQNGQVSFKHVIIFTMDEYLGLSREDQRSYCKFIHNTFADHIDILKENV
FT                   NFLNGNAEDLHLECERYEKKIKSYGSVHLFVGGVGKDGHLAFNEPGSSFSSRTRIKNLS
FT                   KDTRISNAQFFNNNIDCVPKLALTIGLATLLESQEILIIATGQDKAIAVQAAIEGNINH
FT                   MWPISCLQLHQKSILVCDDSSSIELKLKTIKYFQELEMNNSVIVD"
FT   gene            367165..368811
FT                   /gene="glnS"
FT                   /locus_tag="BVAF_327"
FT   CDS_pept        367165..368811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="BVAF_327"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_327"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33721"
FT                   /db_xref="GOA:E8Q6X4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6X4"
FT                   /protein_id="ADV33721.1"
FT                   /translation="MYYKSNFIYKIVDQDFKLKKCTKIHTRFPPEPNGYLHIGHAKSIC
FT                   LNFNIAQKYNGKCNLRFDDTNPTKEHKEYVKSIKYDIQWLGFMWDNTARYTSDYFEKLY
FT                   AYAIELIKKGLAYVDELSMYDIKKYRGTLTKIGIDSPYRYRSIKENLIYFTKMRDGGFL
FT                   EGKACLRAKINMADASVIMRDPVLYRIKYTSHHRVGKNWCIYPTYDFSHCISDAIEGIT
FT                   HSLCTLEFQENRRLYNWILKNTSITQYPVQYEFARLNLTYVITSKRQINVLIKNKIVDG
FT                   WDDPRLLTISGLRRRGYTAASIREFCQRIGVSRQDSQIELSVLESCIRNDLNKTAPRLM
FT                   AVIHPIKVIISNFPEGYEEKIIVPNHPSNYNLGTRFVIFTKEIFIDRFDFYEKLDSNFP
FT                   KLTIGTEIRLRYAYIIRANHVIKDVNGNILAIYCNYNPHTLNKNPINDKKVYKVIHWVS
FT                   AQKNIPAKFHFYDKLFTHPNPSTVRNLLNIVNPTSLISLKGYIESGISFFKHPGPYQFE
FT                   REGYFILDHQYSKPTDLVFNRIVTLKKSSVR"
FT   gene            complement(368890..369405)
FT                   /gene="fldA"
FT                   /locus_tag="BVAF_328"
FT   CDS_pept        complement(368890..369405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldA"
FT                   /locus_tag="BVAF_328"
FT                   /product="flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_328"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33722"
FT                   /db_xref="GOA:E8Q6X5"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6X5"
FT                   /protein_id="ADV33722.1"
FT                   /translation="MKKSVGIFFGSDTGNTEKLAKMIQTKIGKNLSDIFDIAESSKEDI
FT                   ETYDKLIFGIPTWYYGEPQCDWDSFLPIFKNINFYDKKVAIFGCGDQEDYSEYFCDAMS
FT                   ILYKIVLKNGAKVIGLWPSSGYYFDMSKSIINNDQFVGLAIDEDRQPDMTELRVKNWVN
FT                   KICVEMNI"
FT   gene            371572..371958
FT                   /gene="sdhC"
FT                   /locus_tag="BVAF_329"
FT   CDS_pept        371572..371958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="BVAF_329"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_329"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33723"
FT                   /db_xref="GOA:E8Q6X6"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6X6"
FT                   /protein_id="ADV33723.1"
FT                   /translation="MLNNNLKFIQLDIKTIKFPITAIASILHRISGIFLFIMIGPILWV
FT                   LRKSLHSEDNFYKISNLLLINNYLFLFVKWSVTIALSYHIIFGIRQMLMDFGFLKQTLL
FT                   VGKISAIIVFILVISLFIYIELFL"
FT   gene            371958..372311
FT                   /gene="sdhD"
FT                   /locus_tag="BVAF_330"
FT   CDS_pept        371958..372311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="BVAF_330"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_330"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33724"
FT                   /db_xref="GOA:E8Q6X7"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6X7"
FT                   /protein_id="ADV33724.1"
FT                   /translation="MVFIKKLNLLKKHGVYEWLIVRFSAMLMILYILYILNFMCFNHNV
FT                   SYEQWRSFFYSNKIRLFSIIILFFVLQHTWIGIRHVLEDYIKSVQFKRLGMKLIGIVIY
FT                   TYLLSGIVIIWGV"
FT   gene            372314..374119
FT                   /gene="sdhA"
FT                   /locus_tag="BVAF_331"
FT   CDS_pept        372314..374119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="BVAF_331"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_331"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33725"
FT                   /db_xref="GOA:E8Q6X8"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6X8"
FT                   /protein_id="ADV33725.1"
FT                   /translation="MVNYNNLPVKEFFSVIIGAGGAGMRVALYISQLGFSCALISKVFP
FT                   TRSHTVSAQGGITVALGNQHEDNWEWHMYDTVKGSDYIGDQNAIEYMCKTGPQAIIELE
FT                   RMGLPFSRLKNGRIYQRPFGGQTLFYGKKQAARTASSADRTGHALLHTLYQQNLKNKTI
FT                   IFSEWYALDLVKNQDGRVLGCVAFSIETGELIYFKARATVIATGGAGRIYQSTTNAYIN
FT                   TGDGIGMALRAEIPVQDMEMWQFHPTGIAGIGILVSEGCRGEGGYLLNINGEKFMERYA
FT                   PNAKDLAGRDVVSRAIIIEIREGRGYSDIYYGPHVKLKLDHLGKELLELRLPGILELVR
FT                   TFANIDPVKELIPVFPTCHYMMGGIPTTIHGQVITINNEKEKYDRIVPGLFAVGETACV
FT                   SVHGANRLGGNSLLDLIVFGHATGLCIHKYILEEEWPPARNATASDIEKSLSRYIKWNS
FT                   DTQLGSNKESPEKIRKDLQWCMQNNFSVFREEKTMLRGLEELKEMKERLSNVTLQDKTQ
FT                   QFNTQRIECLELENLLEIAYATAISALFRKESRGAHSRYDFPFRDDKNWLCHTLFLPKN
FT                   NIMIRRNVNMQPKFRPAFLPKARLY"
FT   gene            374131..374856
FT                   /gene="sdhB"
FT                   /locus_tag="BVAF_332"
FT   CDS_pept        374131..374856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="BVAF_332"
FT                   /product="succinate dehydrogenase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_332"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33726"
FT                   /db_xref="GOA:E8Q6X9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6X9"
FT                   /protein_id="ADV33726.1"
FT                   /translation="MKIKFSIYRFCPELNKVPYMQEFQINLINIYRMTLLDALIQLKEH
FT                   DPTLTFRRSCREGVCGSDGMNINGTNNLACITSLTELINRNPQKKIIIRPLPGFPVIRD
FT                   LVVDMSQFYLQYQKINPYLINKDINKPSHEYLQSPEDRAKLDGSYECILCACCSSSCPS
FT                   FWWNSDKFIGPAGLLTLYRFLVDTRDTHSKERLKELQDSFSVFRCHNIMNCVSVCPKKL
FT                   NPAQAIGKIKRMLVKNIIK"
FT   gene            374983..377886
FT                   /gene="sucA"
FT                   /locus_tag="BVAF_333"
FT   CDS_pept        374983..377886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="BVAF_333"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_333"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33727"
FT                   /db_xref="GOA:E8Q6Y0"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Y0"
FT                   /protein_id="ADV33727.1"
FT                   /translation="MYRDILEKQMNSSFLTRNNQSYINQIYEIFLKDPSSVDSDWRNVF
FT                   QKWIFETQYEQDQRSSDVKLNKIPGEYTKYKKNQISKSTKSNNNIIVVVEKILKLINSF
FT                   RIYGHQYAKLDPLGLSVNKNKSNFLELEYYKFENEDLYRLYDTNLLGISKGFMTIEDIH
FT                   QFFKKIYCRTIGFEYMHILDSTIVFWIQKQIESITNISEDLNNADQQQFLKEIIAADKL
FT                   EHYLGIKFPGAKRFSLEGGDVLIPMLKEIIRYSAFKHEIKEIFLGMAHRGRLNVLVNVL
FT                   GKTLQDLIDEFYGKNLSNNQSGDVKYHQGLYSDIVINKHNVSLFLLFNPSHLEIVTPVV
FT                   MGAARSRIDQLNYRTISQSIKNINLKLQNNTVLPIVIHGDAAISAQGVVQESFNMANTR
FT                   AYGIGGTVHIVINNQIGFTTSNIYDLRSTSYCTDIAKMIQAPIVHINADDVNAVIFVTR
FT                   FALNFRKKFNKDIVIDLVCYRRHGHNEADEPSVTQPVMYQKIHNHLKVVDIYAQFLHKN
FT                   KIIDMDKIQDMIQVYRSKLEHKQHCMIENWNPTNVRSTYHPNDHNDLNQKTDYFVLKQI
FT                   SKKYLQDLAYCISNIPPNFLLHERVKKIYAERIEMALGKRLFDWGGAEILAYAVLLKEG
FT                   YSIRLSGEDVARGTFFHRHAIIYDQTHGSKYIPLMNIQKKQGSFLIWDSVLSEESALAF
FT                   EYGYSIISSKNTLVIWEAQFGDFSNGAQVVIDQFISSGKQKWNQSCGLVMLLPHGYEGQ
FT                   GPEHSSCRIERYLQLCAENNIRLCVPSTPAQIYHVLHQQMKNSIQIPLIIISPKSLLRN
FT                   AMATSSIEDLTYGSFNTIFKETNNCCILNQINKVIMCTGKVYYDLLSSRDKERLYTIAI
FT                   IRIEQLYPFPYSDIIKIINQSYSHVKNFIWCQEEPENQGAWYYIQRCFCKCITKLNMNI
FT                   TLHYVGRDASASPASGYFAIHQAQQKKIINTAIRSII"
FT   gene            377906..379225
FT                   /gene="sucB"
FT                   /locus_tag="BVAF_334"
FT   CDS_pept        377906..379225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="BVAF_334"
FT                   /product="dihydrolipoyllysine-residue succinyltransferase
FT                   component of 2-oxoglutarate dehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_334"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33728"
FT                   /db_xref="GOA:E8Q6Y1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Y1"
FT                   /protein_id="ADV33728.1"
FT                   /translation="MIDSSNSLEILVPNLPESVEDATVAVWHKKEGDKIQQDEILLEIE
FT                   TDKIMLEIPASQNGTLEMILEKEGSIVRAGQILARLKLNKNIVAMKESKLNPLISNKDY
FT                   NNQNIALNFNYTSSDQKCAQIKQENNSTTFLLKNLSPSIKKLITEYNLNIKEIKGTGIK
FT                   GRITRQDIETYIKTKLAQSNNITDPDANININIQDNNISDVSGNRKDTRISMNRLRKKI
FT                   AERLLYVTNSTAMLTTFNEVNMQSIISLRNKYNKLFIERHGTKLGFMSFFIKSVLEGLR
FT                   RFPEINACIDGDDIVYHTYFDISIAVSTERGLVTPVLRNVNKLSISNIEKQIKFLSEKS
FT                   RKGKLTLEELTGGNFTITNGGIFGSLMSTPIINPPQSAILGMHTITERPMAINGQVIIL
FT                   PMMYLALSYDHRLIDGKDSVSFLKTIKELIEDPTRLLLDI"
FT   gene            379360..380547
FT                   /gene="sucC"
FT                   /locus_tag="BVAF_335"
FT   CDS_pept        379360..380547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="BVAF_335"
FT                   /product="succinyl-CoA ligase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_335"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33729"
FT                   /db_xref="GOA:E8Q6Y2"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Y2"
FT                   /protein_id="ADV33729.1"
FT                   /translation="MTNLYEYQAKKLFRKFKIPILKNWIFSDISEIKHCTSSVIMDGPP
FT                   WIVKCQIHSGGRGKAGGVKVANSLEDIYSFATHWLGNRLITDQTSKKGDVVNYILVEPA
FT                   IKFINEFYFSLFIDRDSSQILCIVSVKGGIDIENTINKSPDLIFKISIDPMVGAYPYQG
FT                   RILADKLNLKGIEINKFVQIYIDIVRMFLENDLTLVEINPFIIDNNHNLLCLDAKVSVD
FT                   SNSFFRQPNLLSLCLNKHSTNNLNNKLVPLSQDLSINYVSLHGNIGCMVNGAGLAMATM
FT                   DLIKSLGGEPANFLDIGGDTDMDSLMSAFTMILKKTSVKAVFVNIFGGIVCCDLVADGI
FT                   IAVLTKNINNHVPVVIRLEGNNAILGHKKLINSKLNIFVVNNLLDAVHHTIELVK"
FT   gene            380550..381443
FT                   /gene="sucD"
FT                   /locus_tag="BVAF_336"
FT   CDS_pept        380550..381443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="BVAF_336"
FT                   /product="succinyl-CoA ligase [ADP-forming] subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_336"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33730"
FT                   /db_xref="GOA:E8Q6Y3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Y3"
FT                   /protein_id="ADV33730.1"
FT                   /translation="MSILINRNTKVICQGFTGKKASFHSKQALSYGTKIVGGVTPGKGG
FT                   SIHLGLPVFNTVYEAIQQTHATASVIYVPAPFCKDAILEAIYSKIHLIVCITEGIPILD
FT                   MLIIKQQLQRQNTCIMIGPNCPGVITPKQCKIGIMPDYIHNPGNVGVISRSGTLTYEVV
FT                   KQITDSGLGQSTCVGIGGDPILGSNFTDILKLFEQDTQTKLIIMIGEIGGKSEEQAATY
FT                   IKKYMTKPIIAYIAGSTAPKGKRMGHAGAIISGKGTNVYEKYTALSEAGVYIAENFVNI
FT                   GKMAKEILIKYQVIKD"
FT   gene            381546..382316
FT                   /gene="tolQ"
FT                   /locus_tag="BVAF_337"
FT   CDS_pept        381546..382316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="BVAF_337"
FT                   /product="protein TolQ"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_337"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33731"
FT                   /db_xref="GOA:E8Q6Y4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Y4"
FT                   /protein_id="ADV33731.1"
FT                   /translation="MNIFDLFFKTNMLVQFTTLLLIIFSIISWSIIFNRIFILKKEQRK
FT                   LKLFEDRFWAGIELSNLYKEISNRRNRLNSSERIFFVGFKEFSKLYHIKNHLPEVVTNR
FT                   TLCVMHNIMNIELEMLEKNVPLIGIIGSISPYIGLFGTVLGIIHVFLELGKITTEHTGG
FT                   THIQLIAPGVAEALISTAIGLFVAIPAVMAFNYLTIQINTLSQSYNNFIEEFIAILYRQ
FT                   VLFSTNSTSTTVNKDNKYVVISATKKEPKISDSI"
FT   gene            382264..382704
FT                   /gene="tolR"
FT                   /locus_tag="BVAF_338"
FT   CDS_pept        382264..382704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="BVAF_338"
FT                   /product="protein TolR"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_338"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33732"
FT                   /db_xref="GOA:E8Q6Y5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Y5"
FT                   /protein_id="ADV33732.1"
FT                   /translation="MLLYQQQKKNQRFQIQSEINIVPFLDILLILLIIFMMIPFQLIQG
FT                   FQVNLPHSTKAVSITEDNKYAITIEILKEGLYNFIYNNKHINNINASKLSSEINNIVQT
FT                   KPDVICLIAAASIINYSEIIHIFNLLSTSGIYSIGMMTNPIN"
FT   gene            382727..383899
FT                   /gene="tolA"
FT                   /locus_tag="BVAF_339"
FT   CDS_pept        382727..383899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="BVAF_339"
FT                   /product="tolA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_339"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33733"
FT                   /db_xref="GOA:E8Q6Y6"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Y6"
FT                   /protein_id="ADV33733.1"
FT                   /translation="MIIHNSNLTKKYYTNIKYAIFISIIMHIIICLVLFNWVSFFKKKD
FT                   TPSFIFKIFSDKENDNQVINHHPRQRSEQSDRFKITNTSSNIASSEKQSLHPTPALKKQ
FT                   RSEQSDRFKITNTSSNIASSEKQSLHPTPALKKQRSEQSDRFKITNTSSNIASSEKQSL
FT                   HPTPALKKQRSEQSDRFKITNTSSNIASSEKQSLHPTPALKKQRSEQSDRFKITNTSSN
FT                   IASSEKQSLHPTPALKKQRSTTAKKLLAHPPLHNTNIHSSDSNKLEILLNNILISNDKY
FT                   IQNNKNFQSLFIKKNNAVEIRNNEINLYKNLIIQSIQQKFYNVTDYSGKKCDLKIQLDP
FT                   NGKVISVTSISGDWMLSKAATIAVQLANFPKPPNVYVYNVFKNIILSFTP"
FT   gene            384049..385431
FT                   /gene="tolB"
FT                   /locus_tag="BVAF_340"
FT   CDS_pept        384049..385431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="BVAF_340"
FT                   /product="protein TolB"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_340"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33734"
FT                   /db_xref="GOA:E8Q6Y7"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Y7"
FT                   /protein_id="ADV33734.1"
FT                   /translation="MYQKFFLLSILLSTSFSAISDMKIEITHGVNTAYPIAVVPFSTTY
FT                   MKHNNILNNNNNIENIGSIIAADLRNSGKFNTLPISFLPHQPSKLSDIVPMFWKKLGIN
FT                   TIVLGSINIDCNDNYLITYQLIDTSSNPALIILENQYLIKKKYTRCAAHTISNEIFEKL
FT                   TGIKGAFCTRIAYVSYIHNTKYPYELYVADYDGYNQISICRSAEPLMSPAWTPDGKKIA
FT                   YVAFSSGHSELVVQTLGTGLINHIIKFPNHNGAPAFSPDGEKLAFSSSKTGSLNLYVMY
FT                   LSSGKICQITSNRHNNTEPSWFPDNTNLAYTSDQGGIPQIYKININNIIDNQRISWLPG
FT                   SNQKPNISSDGNFIIMVNRYKGQQNISKLDLLTEKEEILTKRSFLADTPSIAPNEIMII
FT                   YSSILKKSTSVSIIHDNDENNEKSVLELISVDGHFKANLKGASGSLRFPVWSSSSWTCP
FT                   KK"
FT   gene            385547..386074
FT                   /gene="pal"
FT                   /locus_tag="BVAF_341"
FT   CDS_pept        385547..386074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pal"
FT                   /locus_tag="BVAF_341"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_341"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33735"
FT                   /db_xref="GOA:E8Q6Y8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Y8"
FT                   /protein_id="ADV33735.1"
FT                   /translation="MKISQSTFITYIYRLGISIIMFLYTSCTHISKDYEKHVDNIDYLN
FT                   KLDTNSIDNIINQPNKLNRQHLQSKNIIYFPLDQYNIPSVFFDILDVHAIFLRKNPLHH
FT                   IIIEGHTDERGTPEYNIGLGERRAYSIKKYLQSKGVLSNQISTISYGKEKPVSFGHTEE
FT                   SYSQNRRGVLLY"
FT   gene            386118..386849
FT                   /gene="ygbF"
FT                   /locus_tag="BVAF_342"
FT   CDS_pept        386118..386849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygbF"
FT                   /locus_tag="BVAF_342"
FT                   /product="tol-pal system protein YbgF"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_342"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33736"
FT                   /db_xref="GOA:E8Q6Y9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Y9"
FT                   /protein_id="ADV33736.1"
FT                   /translation="MIFYAISTGVISNTTSLDNYIHVAHAKKICSKINLDQKIKELNRV
FT                   LDAHSQCLIQLQQQLLENQQDIDTLRSCIQDTQHCIQSMRNTNNTIENYEKICEKSRSN
FT                   TNVINKKQQFLNNIEDADYKLAVSLVLEKKQYDRAIQTFQDFIKNYPQSNYQPNAHYWL
FT                   GQLYYNQNDKNNASYHFALVVKNYPKSSKAPDALLKIGIIMQETNQIDKSKTIYKQLGK
FT                   LYPNSNAAKHAQKQLTYLKNK"
FT   gene            complement(387127..388158)
FT                   /gene="pgl"
FT                   /gene_synonym="ybhE"
FT                   /locus_tag="BVAF_343"
FT   CDS_pept        complement(387127..388158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /gene_synonym="ybhE"
FT                   /locus_tag="BVAF_343"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_343"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33737"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Z0"
FT                   /protein_id="ADV33737.1"
FT                   /translation="MKSKITQIVYVASPESQQIYVWKLDEFKELLELMQIVSTCGQAQP
FT                   MAINPTQRFLYVGIRPNFSIYTYCINREGLLNKIKIVNIASSPTHITMNAQSTFLYYAS
FT                   YNYNAISVIALDDSGMPNDNNSIVQTIENLLGCHSVNIDRTERLLWVPCLKENVVRLFN
FT                   INKHNGKLIPYHLNYIKTKIDSGPRHMIFHRSADYAYVINEFNGTINVLSYNIKEKYLC
FT                   IIQTINILPITYGVNINKLWAADIHITPDSRWVYCSDRLTNTISYFEILSDTKKLRFIG
FT                   YKHTEKQPRGFAIDKTGNFLIVAGQKSHCISLYRINLKNGKLNFLSRYQSGKGPMWINI
FT                   VFI"
FT   gene            388397..389104
FT                   /gene="gpmA"
FT                   /locus_tag="BVAF_344"
FT   CDS_pept        388397..389104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="BVAF_344"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_344"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33738"
FT                   /db_xref="GOA:E8Q6Z1"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Z1"
FT                   /protein_id="ADV33738.1"
FT                   /translation="MNINKIQVVFVRHGESEWNKNNRFTGWVDIDLSNRGHLEAKQAGQ
FT                   LLKKNNFIFTYGYTSVLKRAIHTLWIILDQLNQAWLPIKKSWKLNERHYGALQGLNKDE
FT                   AIKKYGYETIQKWRRNFKDIPPGRVKNKNLITEIDDIHYNIMGIHNLPNGESLELTANR
FT                   VIPYWKNVIIPDINNNNHTIIIVTHGNSIRAMIKFLNCLSETEISKVEVPTGTPLIYEF
FT                   NRDFQPIKHYYLS"
FT   gene            389289..389999
FT                   /gene="ybhL"
FT                   /locus_tag="BVAF_345"
FT   CDS_pept        389289..389999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhL"
FT                   /locus_tag="BVAF_345"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_345"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33739"
FT                   /db_xref="GOA:E8Q6Z2"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Z2"
FT                   /protein_id="ADV33739.1"
FT                   /translation="MDRFSRFQGILSDRDNTIIQPFISQVFGWMSCGLLLTAFVAWYTS
FT                   KSPVVLQLLFSNQIIFFGLVISQLALVFVLSGMVIKLNGSLATTLFMLYSVLTGLTLSS
FT                   VFILYTTSSISSTFLVTSGMFGAMTLYGYTTKRDLSSFGNLLLMALIGIMLASLVNLWV
FT                   KNTAIMWIITYVGVLVFVGLTAYDMQKIKSIGASLSIEDQDQFRKYSIIGALTLYLDFI
FT                   NLFLMMVRIFGNRR"
FT   gene            complement(390126..391196)
FT                   /gene="engD"
FT                   /gene_synonym="ychF"
FT                   /locus_tag="BVAF_346"
FT   CDS_pept        complement(390126..391196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engD"
FT                   /gene_synonym="ychF"
FT                   /locus_tag="BVAF_346"
FT                   /product="GTP-dependent nucleic acid-binding protein engD"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_346"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33740"
FT                   /db_xref="GOA:E8Q6Z3"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Z3"
FT                   /protein_id="ADV33740.1"
FT                   /translation="MKISCGIIGLPNVGKSTLFKVLTKIPVKIANFPFCTIQPNIAVVK
FT                   IPEFRLYELNRIVHTHKIVHEIIEFTDVAGLIEGAAHGIGLGPNILNHVQFIKIFCHVI
FT                   RCFDDDNICHIKNNIDPCRDINIINTELILFDIDKCEKYISFIKKNYKTQYTSINHDQQ
FT                   LYILKKCLDQLYEGILLRSIQWSLIEKQNIQKFNFLTFKPVIYIANINKQSESNIYLQQ
FT                   LQKLTSNQNYAPIVSYCLENSNTKLVLECKNTYSILFNSIIEHVISLLQLNTFFTVNSK
FT                   MIRAWTCVKGDTAFNVSDKVHSDFKKGFIRVQVIKFSDFIENKGEIGGKKHGKVRNESK
FT                   IYSVEDGDILKFLFRI"
FT   gene            complement(391326..391909)
FT                   /gene="pth"
FT                   /locus_tag="BVAF_347"
FT                   /note="frameshift in poly-A tract; RNA polymerase or
FT                   ribosomal slippage"
FT   CDS_pept        complement(join(391326..391431,391431..391909))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /gene="pth"
FT                   /locus_tag="BVAF_347"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_347"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33741"
FT                   /db_xref="GOA:E8Q6Z4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Z4"
FT                   /protein_id="ADV33741.1"
FT                   /translation="MTIKLIVGIGNIGAEYINTRHSIGHRYIHMLTKKYKVNLKLDKIL
FT                   SGFIGSLTICKSMTVQLLIPNSYINESGLAVYKYMKLYRLDLKELLVVHDELDLSPGMI
FT                   RIKLGNKLYESHRGIQNIINNLSNQYGFYRLRIGIGRPKNKNEIVNFVLSSPSIHEKKK
FT                   IDFIMNQAILCIEDIIFDKFVKVMNQLHPKI"
FT   gene            complement(392040..392984)
FT                   /gene="prs"
FT                   /locus_tag="BVAF_348"
FT   CDS_pept        complement(392040..392984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BVAF_348"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_348"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33742"
FT                   /db_xref="GOA:E8Q6Z5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Z5"
FT                   /protein_id="ADV33742.1"
FT                   /translation="MKLFTGNAIPELAQLIADRLYTTLGKASVGRFSDGEVSVQINENV
FT                   RGGDIFIIQSTCAPTNDNLMELIVMVDALRRASAARITAVIPYFGYARQDRRVRSARVP
FT                   ITSRVVANFLSSVGVDRILTVDLHAEQIQGFFDVPVDNVFGSPILLEDMFRQNFNNPII
FT                   VSPDIGGVIRARAIAKLLNDTDMAIIDKRRPRANISQIMHIIGDVCNRDCILVDDMIDT
FT                   GGTLCKAADVLKERGAGRIFAYATHPIFSGNAYENIQKSMIDEIIVCDTIPLKIVIQKL
FT                   PNIRTLTLSGMLAETIRRISNEESISAMFEYRI"
FT   gene            complement(393098..393961)
FT                   /gene="ispE"
FT                   /gene_synonym="ipk"
FT                   /locus_tag="BVAF_349"
FT   CDS_pept        complement(393098..393961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /gene_synonym="ipk"
FT                   /locus_tag="BVAF_349"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_349"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33743"
FT                   /db_xref="GOA:E8Q6Z6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Z6"
FT                   /protein_id="ADV33743.1"
FT                   /translation="MHQWVVSPGKLNLFLYVTGRRSDGYHYLQTLFRLLDYGDNMKFFV
FT                   TKNGCIRLFNTNNNIISNNNLVIQAAKLLRKFCFRSCQKKPGVDIILHKKLPIGSGLGG
FT                   GSSNAATTLMILNQEWRCFLEKKVLMRLGLMLGADIPVFINGYSAFSEGIGEKLVSIFL
FT                   PERWYLIIIPPIYINTTWVFDVYRSAFNYYSPYRSVEKLLNTPFSNDLEPIVKNMFPEI
FT                   KKYFFYLSNYASARLTGTGACIFFEFYNRYLACQSQKYLPNWIKSIVVRGIYISPVHQI
FT                   LSKIKI"
FT   gene            complement(393964..394581)
FT                   /gene="lolB"
FT                   /locus_tag="BVAF_350"
FT   CDS_pept        complement(393964..394581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolB"
FT                   /locus_tag="BVAF_350"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_350"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33744"
FT                   /db_xref="GOA:E8Q6Z7"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Z7"
FT                   /protein_id="ADV33744.1"
FT                   /translation="MYQNIYFFQLLNIAVLICTACVHNYDSVFEKKRLMNSWSMHQQLI
FT                   SKIFYYHIQGNIVYKVNSKQKMYLNFIWTQNDNNNCNIKLFNIFGLTIISISLKNGIIY
FT                   VTSNLMFQDEEFKNNVRVWLTNTNFFKEQLQSWILGLPGYHSKYYLNSMGTLSKVNCLY
FT                   DNKNICIFYRLYFTNNKPMLPKILEIHYEKYFIKLHINNWSM"
FT   gene            395097..396179
FT                   /gene="prfA"
FT                   /locus_tag="BVAF_351"
FT   CDS_pept        395097..396179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="BVAF_351"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_351"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33745"
FT                   /db_xref="GOA:E8Q6Z8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Z8"
FT                   /protein_id="ADV33745.1"
FT                   /translation="MLHDIIINKLTILQERFYKLKQLIEHPNHIQNNKDFHSISKEYAH
FT                   LAHIVTYFEQWLNIQKEILHTKEILTDIDLHDLALDELKKLNIIENNLEKKIKILLLPT
FT                   DPNDKYGCFIELRAGTGGKEAAIFSGELFRMYTRYAETQRWNIEIIHATYGEYGGYKEI
FT                   IAKISCNGAYNQLKFESGGHRVQRVPYTESQGRIHTSTCTVAVIPKIPDIKLPNINPND
FT                   LRIDTFRSSGAGGQHVNTTDSAIRITHIPSGLSVECQDERSQHKNKSKALSILRSRLYA
FT                   MNIKRRKIEESNFRRNLIGSGDRSDRIRTYNFQQGRVTDHRIDFTSYKLSDVMDGALGI
FT                   LIKPIICKYRSKLIDQLTQL"
FT   gene            396179..397024
FT                   /gene="hemK"
FT                   /locus_tag="BVAF_352"
FT   CDS_pept        396179..397024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="BVAF_352"
FT                   /product="protein methyltransferase HemK"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_352"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33746"
FT                   /db_xref="GOA:E8Q6Z9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6Z9"
FT                   /protein_id="ADV33746.1"
FT                   /translation="MITWNKWLNLACLKLKHSLSPKLDAELLLQKVTRKSKIQLLTFGE
FT                   TNLSFKQIQTLQLLINRRSQGEPIAHIIGVKEFWSLNFKVSPGVFIPRPDTECLIEQIL
FT                   NLNFNSDNVEILDLGTGVGTIALTLASERPSWNITGIEQQKQALSLAHKNKLLLDCKNV
FT                   NFIYGNWFKYLKNSKKFDLIVSNPPYINKKDLHWLSKDVYFEPRNALISKNSGLSDLMI
FT                   ICQYSKYYLCPSGWIFLEHGWNQGKQVRNLLSKQQFINICTKFDYNNCERITCGQWKPT
FT                   "
FT   gene            397085..397921
FT                   /gene="kdsA"
FT                   /locus_tag="BVAF_353"
FT   CDS_pept        397085..397921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="BVAF_353"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_353"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33747"
FT                   /db_xref="GOA:E8Q700"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q700"
FT                   /protein_id="ADV33747.1"
FT                   /translation="MNDIMINIGDIQISNDLPFVLFGGMNVLEEHDTVMKICEHYTSVT
FT                   SKLNIPYIFKASFDKSNRTSIHSYRGPGLESGLHLFQILKKTFNIKLMTDVHEISQVKA
FT                   VSEVVDVIQLPAFLARQTDLIKAIAQTGSVINIKKPQYMHPTQIQYIIQKCHSFNNYNT
FT                   ILCERGTCFGYDNLVVDILGLNIMRNISGGYPILVDVTHSLQTRTPLSSISGGKGNQVF
FT                   DLAKASIAVGIAGIFLEAHPCPDIAKCDGQSALPLTKLEHFLKQIKAIDKLVKSFK"
FT   gene            398714..399949
FT                   /gene="thrS"
FT                   /locus_tag="BVAF_354"
FT   CDS_pept        398714..399949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="BVAF_354"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_354"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33748"
FT                   /db_xref="GOA:E8Q701"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q701"
FT                   /protein_id="ADV33748.1"
FT                   /translation="MDNHFQQYKKKDHRTLSNQLDLFHTQDDAPGMIFWHKNGWIIFQE
FT                   LKKFIRKKLQQYQYQEVKSPIMIDQELWKKTGHWDNYYEHIFITASENRTYCIKPMNCP
FT                   GHIQIFNYGIKSYKDLPLRIAEFGHCHRNEPSGSLHGLMRIREFTQDDAHIFCSIEQIP
FT                   TELNYCIKMMYDVYHTFGFKKIIVKLSTRPIKRIGEDSIWDITEQCLVHILQKKNIEFT
FT                   YQPQDGAFYGPKIEFILLDSLKRAWQCGTVQLDFSLPKLLKAKYIDNNNKYQIPVMIHR
FT                   AILGSIERFIGLITEEYSGFLPTWLAPTQIVLMNVTDAQSLYVTNIANRLKFENFRVQI
FT                   DLRNEKIGCKIRLHTMHRVPYMIICGNSEVDHGTISIRTFRGRKINNYNIDTFIQKLKQ
FT                   EINTYNFNQLEE"
FT   gene            399973..400554
FT                   /gene="infC"
FT                   /locus_tag="BVAF_355"
FT   CDS_pept        399973..400554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="BVAF_355"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_355"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33749"
FT                   /db_xref="GOA:E8Q702"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q702"
FT                   /protein_id="ADV33749.1"
FT                   /translation="MQSFRLHRINREITLHKTRLTGVDGKQIGIVDFNEAIKQAESVGL
FT                   DLVEISPNSDPPVCKIMDYGKFLYEKSKSTKEQKKKQKIIHVKEIKFRPSTDEGDYQTK
FT                   LRNIIKFLSEGCKIKITLRFRGGELIHHQIGMKVLYRIRNELHELATIEFFPKKIEGRQ
FT                   MTMILIPKKIINKTNYSKNYNNDTNHDIIN"
FT   gene            400597..400794
FT                   /gene="rpmI"
FT                   /locus_tag="BVAF_356"
FT   CDS_pept        400597..400794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="BVAF_356"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_356"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33750"
FT                   /db_xref="GOA:E8Q703"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q703"
FT                   /protein_id="ADV33750.1"
FT                   /translation="MPKIKTLKSAKKRFTKTSSGKYKYKHAYTRHILTKKSSKLKRHLR
FT                   HRSVLSNMYISKITKILPYI"
FT   gene            400886..401242
FT                   /gene="rplT"
FT                   /locus_tag="BVAF_357"
FT   CDS_pept        400886..401242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="BVAF_357"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_357"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33751"
FT                   /db_xref="GOA:E8Q657"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q657"
FT                   /protein_id="ADV33751.1"
FT                   /translation="MMTRVKNSIIARARHKKILKQASGYYGARSRTYRVAYQSILKSGQ
FT                   YSYRDRRQKKRLFRKLWINQINAASRQYGITYNILINALRKSSININRKILAKLAQSDK
FT                   VSFFSIIKNSVKTI"
FT   gene            401325..402338
FT                   /gene="pheS"
FT                   /locus_tag="BVAF_358"
FT   CDS_pept        401325..402338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="BVAF_358"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_358"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33752"
FT                   /db_xref="GOA:E8Q658"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q658"
FT                   /protein_id="ADV33752.1"
FT                   /translation="MLKNLLDNLVNQAKKKLIASNNIGDLESIRVAFLGKNGYINQQLK
FT                   LLNPTKLNMNPELGASINQAKKDIYNLFLKQKKTIQSQIIKHSLHTQISDITLPGRQSE
FT                   IGAFHPITSVIEQTKIFFNHLGFSEVDGPEIENDYFNFDALNIPKNHPSRNQHDTFWFD
FT                   TNLLLRTHTSGIQIRCMLYETPPMRIMSIGKVYRKDYDNKHTPMFHQIEGFMVDSNLNL
FT                   MNLKKILYDFLHNFFKKDITLRFRPSYFPFTEPSAEIDILYTTNTIQSKQPEDKWIELL
FT                   GCGMIHPKVLSNVGIDTKKFSGFAFGIGIERLAMLLYHITDMRVLFENDIQFLNQF"
FT   gene            402383..404794
FT                   /gene="pheT"
FT                   /locus_tag="BVAF_359"
FT   CDS_pept        402383..404794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="BVAF_359"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_359"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33753"
FT                   /db_xref="GOA:E8Q659"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q659"
FT                   /protein_id="ADV33753.1"
FT                   /translation="MKYSELWLRKWTNPPVTHNELINQLTMAGFNVNETQSIILNKFYG
FT                   VVIAEIINFKIHPNVDNTWIITINNGTNKLISIISDNHINYRKKMKVVVANIGALLPDG
FT                   QVVTSKIIQGIKSEGILCTFSTLGLHNNRKDIIELPDNAPIGYDFYDYLDLNDKIIDVD
FT                   ITPNRGDCLSIIGLAREIASINKLQLKKLIINTIIPTTHETIPIRIEEPKFCPKFLGKI
FT                   IKNININVPTPLKIQEKLRRCGIRSTNIVEDITNYVVLELGHPIHIYDYEKINKNEIII
FT                   RLSKPGEKLIFDEKNINIKLFENTLIISDRNKPLAIAGLEIENKSNISLKTSNIFIQVS
FT                   FLDPTVIIKQSKLYNFHHFYTMQYERGVDCNISELTLNYFTELLIKNCNGHVGPTIKII
FT                   NKKFIPKIKKIKLQRAKLNSILGFHVETQDISNILKSLGFKINVKDNLWIVSIPTWRFD
FT                   INIEENLISEIIRIYGYNKIPQDSIKTVLIPNSLHTQLSNETVTLSKSKIILIDRGYQE
FT                   IITYSFINPNIQKLMKFQDITPFTLINPINQEMSVMRLSLWPGLIKTMLYNQNRQQKDI
FT                   RLFESGMCFIPNKNNNDQVSHQFMLSGIRSEFKNNEHWDSKISSIDFYDIKGDVESVLN
FT                   MIYRHNQIIFKSCIHPALHPGQRAEIYCNNILIGYIGMIHPKIQHLLGLRANILMFELF
FT                   WDAIPKFTLSQITSVSKFPKNHRDISFVLPIYISASAVIDELKKLNINQLICIKLIDLY
FT                   TGKKIPIGFKSFTIKLTFQSNTHTFQEQEIKEILNTCIITLQKRFHIILR"
FT   gene            405000..406016
FT                   /gene="lplA"
FT                   /locus_tag="BVAF_360"
FT   CDS_pept        405000..406016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="BVAF_360"
FT                   /product="lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_360"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33754"
FT                   /db_xref="GOA:E8Q660"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="InterPro:IPR023741"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q660"
FT                   /protein_id="ADV33754.1"
FT                   /translation="MTSLRLLVSNSYNPWFNLSLEEHTFQNMEKNQSILFLWRNQNTVV
FT                   IGRAQNAWKECNTRRMTRDGIKLARRYSGGGAVFHDLGNTCFTFMSTQPKYNKNISLNI
FT                   ILNGLNTLGIKAIISGRNDIVVDTTQGQRKISGSAYRKTTDRQLHHGTLLLNVNLNKLT
FT                   YYLNPDFKKLESKGISSIKSRIINLNKLKPDIDHEEVCHTIQQAFFKYHQASEQQPELI
FT                   SINDLNHVIEFSKQFNKQRSWDWNFGNTPSFTHLLDKRFDWGGVELHFDIEHGIINRSQ
FT                   IFTDSLDPAPLEELSKKLIGIPYNSSSIQNCCIKWMENWPKLKELEEVKLWLVKSII"
FT   gene            406340..406729
FT                   /gene="sufA"
FT                   /locus_tag="BVAF_361"
FT   CDS_pept        406340..406729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufA"
FT                   /locus_tag="BVAF_361"
FT                   /product="FeS cluster assembly protein sufA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_361"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33755"
FT                   /db_xref="GOA:E8Q661"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q661"
FT                   /protein_id="ADV33755.1"
FT                   /translation="MQNTIVHSNTFLKSNKNIPWKGVTLTDSAAQHILQLINRESKILG
FT                   LKITIKKSGCAGLTYQLSKVFYPEQNTVVYEHNRAKLFVPINIMPIIDGTELDYIQDGL
FT                   NYSFKFNNPKAQFHCGCGESFRIYK"
FT   gene            406741..408240
FT                   /gene="sufB"
FT                   /locus_tag="BVAF_362"
FT   CDS_pept        406741..408240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="BVAF_362"
FT                   /product="FeS cluster assembly protein sufB"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_362"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33756"
FT                   /db_xref="GOA:E8Q662"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q662"
FT                   /protein_id="ADV33756.1"
FT                   /translation="MLNKISNMDDIDPKFKHKNTINYKEGFFTTLQSEEFNKGINENVI
FT                   RAISKKRLEPAWMLKFRLSGYHAWKNMKEPHWLKGHYDKLDYNAYSYYSAPICTANNQN
FT                   NKQKNDPVNTSDKSKFLNKEVEKTFNKLGIPLNDEGQVAIDAIFDSVSVSTTYRQTLLK
FT                   KGIIFCSLNDAIHDYPHLVQKYLGTVVSFNDNFFAALNAAVMSDGTFIYIPKNVRCPME
FT                   LSTYFRINSKITGQFERTILIADIGSYVSYIEGCSAPAHNNYQLHAAVVEVIVLKNAQV
FT                   KYSTVQNWFSGNTKNSKNGILNFVTKRALCAEENSKMSWTQSESGSAITWKYPSIILKG
FT                   NNAVGEFFSVAITNGFQQADTGTKMIHLGENTRSTIISKGISVGNSQNTYRGLVKIMPT
FT                   AFHARNFTQCDSMLIGNKCGAHTFPYIESHNNTAQLEHEATTSKINDDQLFYCRQRGIT
FT                   EDNAISMIVNGFCKEILSELPLEFSVEARKLLEITLEHSVG"
FT   gene            408314..409054
FT                   /gene="sufC"
FT                   /locus_tag="BVAF_363"
FT   CDS_pept        408314..409054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="BVAF_363"
FT                   /product="FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_363"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33757"
FT                   /db_xref="GOA:E8Q663"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q663"
FT                   /protein_id="ADV33757.1"
FT                   /translation="MLLSIQNLNVNIQETSILKKFNLEINFGEIHIIMGPNGSGKSTLS
FT                   SVISGQQNYIVTNGKILFKGKDLLSLKPEERAGEGIFVALQYPVEIPGISNQLFLYSAV
FT                   NALRKYRKQPPIDRFTFLNSVQEKMKLLKMPEDLLSRSVNVGFSGGEKKRNDILQMMML
FT                   EPILCILDETDSGLDIDAIKIVYNGLNFLRNKTRAFIIITHYERILEYIKPDYVHILYK
FT                   GHIRKSGDLTLVTKLEEKGYGWIC"
FT   gene            409038..410330
FT                   /gene="sufD"
FT                   /locus_tag="BVAF_364"
FT   CDS_pept        409038..410330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="BVAF_364"
FT                   /product="FeS cluster assembly protein sufD"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_364"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33758"
FT                   /db_xref="GOA:E8Q664"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q664"
FT                   /protein_id="ADV33758.1"
FT                   /translation="MVGYVKDSKTQILRQWYLLFKQQHNNCLSNADIKHWEFVKKYKAT
FT                   DNTYNLNNFNFFENLSKYHFIINSNLNIDICLYNSIKLPIDCYRVVFINGQFSFKFSDK
FT                   IIDPWILTIHQGSKRYNIFNPPICPTMFSYLTECLSDTTIHIKLPKSIETKKPLYLLHI
FT                   NSGTKIPNQLSLSNSHYYLETEQYTNTSIIEHFVGINENSYLFNTRSSILIGKQSKLNH
FT                   ISLIYENQSSYHISNQDININSCAHANSNVFIISGSKFTSHQINSKINHSQSFLSLNSL
FT                   TILLNKEIGKIQTYVEHNNQNHATSEQLHKIIANDHSTGVFQGLIKVNKNSIKTDSKMT
FT                   NNNLLLNKSASVYSKPKLEIYSDSVQCGHGATVGCIDMNHVFYLNTRGIVKKDAINMLI
FT                   YAFTIEITKNITHPFLQDVTTQKINHILSGM"
FT   gene            410332..411567
FT                   /gene="sufS"
FT                   /locus_tag="BVAF_365"
FT   CDS_pept        410332..411567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufS"
FT                   /locus_tag="BVAF_365"
FT                   /product="cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_365"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33759"
FT                   /db_xref="GOA:E8Q665"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q665"
FT                   /protein_id="ADV33759.1"
FT                   /translation="MTVDYPIKKIRSNFPILNKMINKYPLTYLDNAATTQKPDVVIESQ
FT                   AYYYRNECSSAHRSVHSLSTLSTDYMEKTRLYVANFINASKSEEIVFVKGTTDAINLIA
FT                   NSWGRNFINYGDNILISEMEHHSNILPWQILAKEKNIKLNYIPLLYDGSLNLTKLSTLI
FT                   DHRTRLVSITHMSNVVGIINPLIEIINIVHTKSNAIILIDGAQGIAHQLVDVQKLNCDF
FT                   YVFSGHKIYAPSGIGIMYGKSELLKKMKPWIVGGGIVKDVSLTQNATFIDSPWKFESGS
FT                   SNVSGIVALRNAIKYVNSIGIENIFRHETQLMSYTRHMLLKKNLNLMLYNKNNKSSSMI
FT                   AFNFKLHNSYDIGTLLNQYGIAIRTGHHCAIPLMNHFKVSGMCRASFAMYTNTEDIDRF
FT                   IDGLIRIQNLFI"
FT   gene            411617..412093
FT                   /gene="sufE"
FT                   /gene_synonym="ynhA"
FT                   /locus_tag="BVAF_366"
FT   CDS_pept        411617..412093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufE"
FT                   /gene_synonym="ynhA"
FT                   /locus_tag="BVAF_366"
FT                   /product="cysteine desulfuration protein sufE"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_366"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33760"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q666"
FT                   /protein_id="ADV33760.1"
FT                   /translation="MLPTKNQLLKNFYSCANWEEKYLYIIDLGKLLPIFPERFRTTKYL
FT                   IKNCQSNTWIALIPILNKKPDQHLNKNQNTSFVKFYGDSDSVIIKGIITIIFIVYQNLS
FT                   IESIINFDIRHFLTQLALNQHLTISRSQGVYSILDDIQTQSNNLLLSSSKTHLT"
FT   gene            complement(412171..412407)
FT                   /gene="lpp"
FT                   /locus_tag="BVAF_367"
FT   CDS_pept        complement(412171..412407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpp"
FT                   /locus_tag="BVAF_367"
FT                   /product="major outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_367"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33761"
FT                   /db_xref="GOA:E8Q667"
FT                   /db_xref="InterPro:IPR006817"
FT                   /db_xref="InterPro:IPR016367"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q667"
FT                   /protein_id="ADV33761.1"
FT                   /translation="MNNKILMYFVTVFSTLILVSCASTTKITELSAEVQELSTRLDQLN
FT                   SNVDILKPEIEQAKNEAHRANKRLDNQISLYRK"
FT   gene            complement(412595..412668)
FT                   /locus_tag="BVAF_368"
FT   tRNA            complement(412595..412668)
FT                   /locus_tag="BVAF_368"
FT                   /product="tRNA-Val"
FT   gene            412934..413566
FT                   /gene="ribE"
FT                   /locus_tag="BVAF_369"
FT   CDS_pept        412934..413566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="BVAF_369"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_369"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33762"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q668"
FT                   /protein_id="ADV33762.1"
FT                   /translation="MFSGIIQAVVPVHQIYKETTHFIKYTIKFPPHLLIKLTIGSSISN
FT                   NGCCLTVVSINQNLVSFHIIHETLKLTNMNKLKIGDLINIEKSIRYNSRIGGHLMNGHV
FT                   DCTGEIKKVINFKKNKIIWIKINNNYFQKYIIQQGSIGIDGVSLTINKILNNYIRICLI
FT                   PHTTNNTTLGIKKTGNIVNIEIDFITKIITNTTEKILYNANYTLIRK"
FT   gene            413617..413949
FT                   /gene="grxD"
FT                   /gene_synonym="ydhD"
FT                   /locus_tag="BVAF_370"
FT   CDS_pept        413617..413949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxD"
FT                   /gene_synonym="ydhD"
FT                   /locus_tag="BVAF_370"
FT                   /product="glutaredoxin-4"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_370"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33763"
FT                   /db_xref="GOA:E8Q669"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q669"
FT                   /protein_id="ADV33763.1"
FT                   /translation="MNNTIKTIKQQIKTHPILLYMKGTPNIFKCGFSSKASQILSEYIK
FT                   SFVYIDVLVHTDIRSALPSFSNWPTFPQLWVEGKLIGGFDILSDMHQDGSLKKLIDPIK
FT                   IKYNLD"
FT   gene            complement(414014..414679)
FT                   /gene="rnt"
FT                   /locus_tag="BVAF_371"
FT   CDS_pept        complement(414014..414679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnt"
FT                   /locus_tag="BVAF_371"
FT                   /product="ribonuclease T"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_371"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33764"
FT                   /db_xref="GOA:E8Q670"
FT                   /db_xref="InterPro:IPR005987"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q670"
FT                   /protein_id="ADV33764.1"
FT                   /translation="MTNKYKKNNTLKSRFRGFYPVVIDVETAGLNANTDALLEIATITL
FT                   KMDSDGWLCMDNVLHFNIKSFPGANLHPSALALNKIDPNNPLRFAVTEQEALNEIFKMV
FT                   NMGIKIHECHKAIIVAHNASFDHSFIMAAIERISDTNNNMNVNPFHPFVTFDTAALSGL
FT                   VFGQTVLATACKHAGIVFDKSKAHSALYDTEKTAILFCELVNIWKRLGGWPPSSSINN"
FT   gene            415162..415596
FT                   /gene="slyA"
FT                   /locus_tag="BVAF_372"
FT   CDS_pept        415162..415596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyA"
FT                   /locus_tag="BVAF_372"
FT                   /product="transcriptional regulator slyA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_372"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33765"
FT                   /db_xref="GOA:E8Q671"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q671"
FT                   /protein_id="ADV33765.1"
FT                   /translation="MESSLGSNLARLVKMWRTLIDYRLKPLKLTQTHWITLYNIYQLPP
FT                   DQSQIQLAKAIGIEQPSLVRTLDQLELKGLIVRNTCPNDRRAKRITLTPKAKPIIIKVN
FT                   QVINMTRVEVFNGFTCKEVHEFNSTLFKLEKNITTLYNNS"
FT   gene            415848..416498
FT                   /gene="pdxH"
FT                   /locus_tag="BVAF_373"
FT   CDS_pept        415848..416498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="BVAF_373"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_373"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33766"
FT                   /db_xref="GOA:E8Q672"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q672"
FT                   /protein_id="ADV33766.1"
FT                   /translation="MIINSFEIFNTRREYNLGTLRRSNLTTNPMDLFSKWLQEAYLKKI
FT                   PDPNAMCISTVDRTGQPFQRLVLLKYFNDETMMFFTNLKSRKSIHLIDNPKISLCFPWS
FT                   IIDRQVIVTGNVNKLSQKEVSQYFYTRPKNNQISTWASRQSSIVSSRNIFENKFLKFKT
FT                   KYLNKNIPFPKFWGGYKIYINSIEFWQGGMYRLHDRFIYRKNKKKWSVDRLSP"
FT   gene            416609..417907
FT                   /gene="tyrS"
FT                   /locus_tag="BVAF_374"
FT   CDS_pept        416609..417907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="BVAF_374"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_374"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33767"
FT                   /db_xref="GOA:E8Q673"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q673"
FT                   /protein_id="ADV33767.1"
FT                   /translation="MKTYNSITNVDVINYLYERGFIAQITNKNILNSILQSKSITLYCG
FT                   FDPTSDSLHIGHLVPLLCLKKFQKFGHKPIILLGGATGLIGDPSFKDSERQLNPMNTIQ
FT                   QWIEKIKSQISSFIDLNSKNHPHNIHIVNNYTWFSSTNILTFLRDIGKFFSINKMINKD
FT                   FIKKRLKEDNCGISYTEFSYNLMQSYDFFYLYKNYGVILQIGGSDQWGNIISGIDLIRR
FT                   IYNKKTYGITVPLLTTINNIKFGKTEKNTIWIDPNKTSPYKFYQYWLNIDDKQVCSFLK
FT                   IFTDMNIEQINFLEKKMNNNYFIPITKTTLAEKITKLIHGKQGLKSAQRITKNIFYDHP
FT                   LDLTLEDFNQLAKDGIPSIILKKDITLQQALVESKLATSKSQARYFIESHAITINKIKQ
FT                   LNKQYIFNNTDRLFNSYTLLKKGKKHSCLIQWK"
FT   gene            complement(417975..418625)
FT                   /gene="nth"
FT                   /locus_tag="BVAF_375"
FT   CDS_pept        complement(417975..418625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="BVAF_375"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_375"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33768"
FT                   /db_xref="GOA:E8Q674"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q674"
FT                   /protein_id="ADV33768.1"
FT                   /translation="MNRIKRYQILCKLRDYNANITTYDTELIYHSPFELLIAVLLSARA
FT                   RDVQVNKVTESLFQVANTPQDMLFLGINRIRYYIRSIGLFNSKAVNIIKICQLLIEKFN
FT                   GFLPENREELESLPGVGRKTASIILNVIFGWPTIAVDTHVFRFCNRSKFAIGNNVAAVE
FT                   QKLISVVPREFKKNCHLWLIRHGRNTCHAKKPSCNSCVINSLCEFDMKKFFGF"
FT   gene            complement(418728..420131)
FT                   /gene="fumC"
FT                   /locus_tag="BVAF_376"
FT   CDS_pept        complement(418728..420131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="BVAF_376"
FT                   /product="fumarate hydratase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_376"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33769"
FT                   /db_xref="GOA:E8Q675"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q675"
FT                   /protein_id="ADV33769.1"
FT                   /translation="MTKYTKLIHKSLDLSHNLWGPQTELSLKYFNISYEKMPLELIKSL
FT                   AFIKRAAAQVNFDLKLLDFNRSEAIIKAADEVLSGIHESEFPLSVWQTGSGTQSNMNIN
FT                   EVLSNRANELLKKKLGNKKKLLVHPNDHVNKSQSSNDVFPSAMHIAIIISLKEQLIPTV
FT                   KILQKTLLKKSIQFRDIIKIGRTHLQDAIPLTLGQEISGWDFMLRKDIDHIKLHIPYLS
FT                   TLALGGTAVGTGFGAHPEYDERVVLELSRLINHTFVSAPNKFESLSTCNALVHSHGALK
FT                   GLATSMMKIANDIRLLASGPRCGIGEIIIPANEPGSSMMPGKVNPTQCESMTMLCCQVM
FT                   GNDVSIGIGGASGNLELNVYRPLIIYNFLQSVRLLSDGIRNFHDYCVVGLQPNIKRIKE
FT                   LLDKSIMLVTALSLHIGYEKSAQIAKEAELTGVTLKTAAEKLGYISEDQFDEWVNPDNM
FT                   IHPTETKLL"
FT   gene            420295..422511
FT                   /locus_tag="BVAF_377"
FT   CDS_pept        420295..422511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BVAF_377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_377"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33770"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q676"
FT                   /protein_id="ADV33770.1"
FT                   /translation="MLPMMKICNANNVNAHNAFINSLIPISINSDIDHLYKNEILSNKF
FT                   IRLINNNKEDINLNNAHKFYLYRMYKNNITNTLQYNYKVLPFFYHYKNDNQFRIQLKND
FT                   SINILRVMHKYLWNHIYGTTLSFVQAGIKKTVSKEKIAILGIGKRHVHNNKHVIGCNSF
FT                   IYFPIFNRQTHPYFLNLGGEYWYNNLVCLFKSYYTINSTPNFYKPFCFYTSYIYPKTGY
FT                   QICIENKLPYISELKSQIKIEKFIYRKKNNNIFDCINKHHNHCLYINLIYTPIPLLDIK
FT                   IDNLFIQKKYYDTTCSISLNYQYNIPFQQHINNKQYLYNQSKSIISNNLNAILEPFIPS
FT                   SKLCMINSTNNYGIIDLSKSNQEITGYPGEIKLIKIIGNNHESNLTWDMQNFYNQGGQM
FT                   LHVKHDMYAISFPKIPLEKEVYILFSKNENHNCTNNSINHIKQKIKILVNNYAQTTLTS
FT                   QLNNTLLFNNDNISNNQSTLLSDSTNNLVKSDENHEIYTNTITTHDNNKVINYYYPITE
FT                   QQKNQDTNDVDVLHDNHNTTTSENSLNKTIDGIQEKSNSNSISLSPPPPPPMPLQLYST
FT                   QIETKLLPKKIYNDDSELFLISKSTQPSQLDEKLEKNTDNSTITITNINIPTTSRNNSC
FT                   IKNDDNYHQLKTNNSNNNLSYLIPMHKQFKFSSINSDEYIKKLENSILERKKLRCTSEM
FT                   EKILSKLHLSSSFSSIEDSVETNDSSDNFSTSSTNTQNINTKKN"
FT   gene            complement(422557..423165)
FT                   /gene="ubiX"
FT                   /locus_tag="BVAF_378"
FT   CDS_pept        complement(422557..423165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="BVAF_378"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_378"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33771"
FT                   /db_xref="GOA:E8Q677"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q677"
FT                   /protein_id="ADV33771.1"
FT                   /translation="MNQKLRLVVGISGASGGIYGIKALYMLKQCNVESHLILTRNALIT
FT                   LRYEMNITRQDIQKLADFVYFSQDIGAAISSGSYQTLGMLIAPCSIKTMSEIQSGITSS
FT                   LISRAADVILKEKRKLVLIVRETPLHLGHLRTMVQLSEIGAIIMPPVPAYYTYPKTIDD
FT                   IVSYNVKRAINLFGICSKKCKTNNDEWLGIKNNFLSREK"
FT   gene            complement(423280..424077)
FT                   /gene="kdsB"
FT                   /locus_tag="BVAF_379"
FT   CDS_pept        complement(423280..424077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="BVAF_379"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_379"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33772"
FT                   /db_xref="GOA:E8Q678"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q678"
FT                   /protein_id="ADV33772.1"
FT                   /translation="MNFIIIIPARFFSTRFPGKLLADIQGKPMIIRVIEQALTSQASKI
FT                   IVAVDNIRIQQVIESEYSLLKDKVEVCLTKSTHKSGTERLLEVVTLHKFKDKQIIVHLQ
FT                   GDEPLISSFMIHQVVRSIYAVSKKNNIRVATLASPIKYYYEVKDCNIVKVVINMYNNAL
FT                   YFSRSMIPWVKENNYSGEIINSLWLRHIGVYAYRADFLQHYSQWDKSPLEEFENLEQLR
FT                   VLWIGETIHVSIIHNNTSNIISVDTVESLKYVNKLFLKKQANK"
FT   gene            424106..424339
FT                   /gene="ycaR"
FT                   /locus_tag="BVAF_380"
FT   CDS_pept        424106..424339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycaR"
FT                   /locus_tag="BVAF_380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_380"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33773"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q679"
FT                   /protein_id="ADV33773.1"
FT                   /translation="MAEFFNRTGMPSFIGKNTLSMKQINLVFFKFKNSFLWQIGHTIIS
FT                   SNFFLLSNNLGTSNIVYISINKILLPRLKLAY"
FT   gene            complement(424344..425351)
FT                   /gene="lpxK"
FT                   /locus_tag="BVAF_381"
FT   CDS_pept        complement(424344..425351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="BVAF_381"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_381"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33774"
FT                   /db_xref="GOA:E8Q680"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q680"
FT                   /protein_id="ADV33774.1"
FT                   /translation="MFFRIWFNSSLCCLFLLPLSWIYGLLSILNRVSYQYGWRKIYKFS
FT                   VPVIVIGNLTAGGNGKTPMVLWLIKQLTIRGWKVGVVSRGYGGKSNEYPIIVNELTSSN
FT                   ECGDEPMLIWKRTGVLVAVSPKRVDAVLALLQVQSGLDIIISDDGLQHYALFRDIEWVI
FT                   INNSFRFGNGYWLPAGPMRERITRLNTVQAIIVNKADSNGSIKSGEILMQLYPSAVINI
FT                   VTGEKKTIRAFKNVVAIAGIGYPNQFFNTLKKNGIIPIKTVAFSDHHVYSEQMLTALVS
FT                   HNEVLFMTEKDAVKCLNFAHKNWWYVYIDVEIHPSDTEKLLYSVEGTIKQFNNK"
FT   gene            complement(425351..427108)
FT                   /gene="msbA"
FT                   /locus_tag="BVAF_382"
FT   CDS_pept        complement(425351..427108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="BVAF_382"
FT                   /product="lipid A export ATP-binding/permease protein MsbA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_382"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33775"
FT                   /db_xref="GOA:E8Q681"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q681"
FT                   /protein_id="ADV33775.1"
FT                   /translation="MRYFNNSCSSSAWKTFQRLWPIIFPFKLGLIAASITLVINAMSDA
FT                   LMLALLKPLLDDGFGQANRDVFVWMSLALMGLMSIRGVSGFISTYCISWVSGKVVMKIR
FT                   RLLFKHIMNMPVSFFVKQSTATLVSHITYDADQVASSSSGALITVIREGASIVGLCFVM
FT                   FYYSWQLSLILILIIPVISFGLKLVFNKFIEISKKIQNAMGQIANRVEQMLKGHREILI
FT                   FGGQHIEQKRFNYFSNQMRQYSMKMVQVSSIFEPLIQFIASLALACVLYIASIPRIMEI
FT                   LSAGTITVIFSSMIALMKPLKSLTNVSAQFQKGMAACQTLFSILDLKTEINIGTFHVNK
FT                   VKGDLIFDNVTFFYPEKNTPSLSNINCTLKSGQIVALVGRSGSGKSTIVNLLTRFYNVY
FT                   QGRILLDGLNLNDYTLSSLRDQVAVVTQNVYLFNDTIANNIAYAREHFYSRDSIETAAR
FT                   MACAMDFISQMKYGLDTIVGENGILLSNGQRQRIAIARALLRDCPILILDEATSALDSE
FT                   SEHMIYQSLDVLKKNKKLLIVVAHRLSTIEKSDEILVVENGCIIEQGVHIDLLSLQGIY
FT                   AQLYKLQFS"
FT   gene            complement(427424..429151)
FT                   /gene="rpsA"
FT                   /locus_tag="BVAF_383"
FT   CDS_pept        complement(427424..429151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="BVAF_383"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_383"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33776"
FT                   /db_xref="GOA:E8Q682"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q682"
FT                   /protein_id="ADV33776.1"
FT                   /translation="MIESFAQLFKESLQKIKTKPGSVIQGTVISIFKDVVWVDAGLKSE
FT                   SAIPIDQFYNSKGELEIAIGDSVDVILDAIEDGFGETVLSREKAKRLESWLFLEQAYRD
FT                   TTTVEGIINGKVKGGFTVELNGIRAFLPGSLVDVRPIKDTLDLEGQICEFKVIKLDYKR
FT                   NNVVVSRRAAIESENSAERDQLLNKLHEGVVLKGLVKNLTDYGAFIDLGGIDGLLHITD
FT                   ISWKRVKHPSDVINIGDSITVKVLKFDKERIRVSLGLKQLQDDPWASVIHNYKEGDKLV
FT                   GKVTNLTDYGCFIEIKGGVEGLVHISEMDWTNKNIQPSKVVAIGDLIEVIVLDIDKDRR
FT                   RISLGLKQCKINPWQKFSEMYTRGDKVSGKIKSVTDFGIFIGLEGGIDGLVHLSDISWD
FT                   MVNEESINKYKKGDEIEAVVLQVDIERERISLSIKQLTEDPLNSFLSIHKKSSIVSGSI
FT                   VSIDHNKKKLIVKLDGTNSIMGHLNLEDHSYNEPNLLIVKQEFIKKLPYLKIGNAIQAK
FT                   LDSIDRKNRIINLILYHSCENQKKSEVDMINNEKHFEKDKNNFSSVMIEAFKAATKHD"
FT   gene            complement(429253..429963)
FT                   /gene="cmk"
FT                   /locus_tag="BVAF_384"
FT   CDS_pept        complement(429253..429963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="BVAF_384"
FT                   /product="cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_384"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33777"
FT                   /db_xref="GOA:E8Q683"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q683"
FT                   /protein_id="ADV33777.1"
FT                   /translation="MSSSFNNGNIIPVITIDGPSGVGKGTLSRRLSNILGWNLLDSGII
FT                   YRILASIALDNNIDTNNEIKLIMLIPLIKIDFLRKNNRFIVLLNKKEIDKNIYTEIIGN
FT                   LASKIAIFPKLRASLLRYQRKFCIWPGLVADGRDMGTIVFPNAMVKIFLYASERKREQR
FT                   RLDQLQKTNFNVNFNCLLSQIRERDNRDYTRKIAPLIPSVDALMLDSTDLSENEVTNKV
FT                   LTYMKQVDIPLCNI"
FT   gene            complement(430073..431398)
FT                   /gene="aroA"
FT                   /locus_tag="BVAF_385"
FT   CDS_pept        complement(430073..431398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="BVAF_385"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_385"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33778"
FT                   /db_xref="GOA:E8Q684"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q684"
FT                   /protein_id="ADV33778.1"
FT                   /translation="MNNFIKLDPIYKVNGTVSLPGSKSISNRALLLAAQSVGTTRLINL
FT                   LDSDDVQYMLNALYKLGIQYKLSSDRKICEIDGIGGPLQFQNKSSLHPQLTLFLGNAGT
FT                   VVRPLIAALSIVTSQNIMLTGDVRMQERPIHHLIHALRQGGSQINYLKKEYHVPVCLNG
FT                   GYRGGTIIIQGNISSQFLSSILMMIPLAPENTCIKVDGKLVSKPYIDLTLSIMKIFGIT
FT                   IQHQDYKIFYCEGNRLYVSPKEYIIEGDASSASYFLAASAIKGGTVKVLGIDKHSKQGD
FT                   VYFSDILNRMGAFVSWGDNYIECTRGTTLNASIDIDVNHMPDAAMTLAIIALFTIEKKI
FT                   PMILRNIYNWRVKESDRLYAMATELRKVGAKVIEGYDYLYIFAPQKIQSAYINTYHDHR
FT                   IAMCFSLIALSGVSVIIDNPQCICKTFPDFFNQFFKISNTQQ"
FT   gene            complement(431509..432612)
FT                   /gene="serC"
FT                   /locus_tag="BVAF_386"
FT   CDS_pept        complement(431509..432612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="BVAF_386"
FT                   /product="phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_386"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33779"
FT                   /db_xref="GOA:E8Q685"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q685"
FT                   /protein_id="ADV33779.1"
FT                   /translation="MKKKFNFSAGPSMLPESVLNQIKEELLNWNNLGISVMEISHRSSE
FT                   FEELAQKTQRNLRILLDVPSNYTILFCQGGARAQFSAIPMNLLKKPTGNIDYINTGYWG
FT                   YRAAIEAQKFCNVNIVNVLDKDINGFYFIKPINEWNISKDSLYIHYCPNETISGISIND
FT                   IPIFSETKILIADCSSMLLSQPIDINRFGIIYASAQKNIGVPGLTVVIIRNDLIFNTVS
FT                   NYKKIPAILDYEILLSNNSMFNTPVTISWYIANLVLEWLKKLGGLSKINEFNKKKSALL
FT                   YKAIDDSDCYYNNINYKYRSIMNVPFFLKREKLTYLFLEESKFFGLYGLKGHKIHGGIR
FT                   ASIYNAMTLEGVLNLIKFMNFFSRQCS"
FT   gene            complement(432784..434097)
FT                   /gene="serS"
FT                   /locus_tag="BVAF_387"
FT   CDS_pept        complement(432784..434097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BVAF_387"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_387"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33780"
FT                   /db_xref="GOA:E8Q686"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q686"
FT                   /protein_id="ADV33780.1"
FT                   /translation="MLDPKLLYNNTDWVYKRLARKQFLLNTSELRQQNNLRKVLQKKIE
FT                   KIQSDKKSISKIIGKIKSQQEDIQSLCKQANLLNDQLTSIKFKIKVLQKKIKQYQLSLP
FT                   NIPDDNIPNGTTEQDNVEIMRWGNLNRYDDFKPIDHVTLGKLIGEIDLSSASKIAGSRF
FT                   IVLKGKIARLYRALSQFMMDTHIKNHGYQEYYVPYLVNTDSLYGAGQLPKFYKDLFHTQ
FT                   SIVDINCSKIKNKSYTLIPTGEVPLINLMRDIIVNEDELPIKMVAHTPCFRLEAGTYGY
FT                   RTHGLIRTHQFDKVELVQMVHPNKSTQALEEITNHSEQVLQLLELPYRKTLLCAGNISF
FT                   SSCKTYDLEVWLPTHNSYCEIASCSNVKDFQARRIKARFRNKIYKKTMLLHTLNASGLA
FT                   VGRTLVAILENCQLQKDRCIKIPKVLHSYMHGITHIHY"
FT   gene            complement(434693..435343)
FT                   /gene="lolA"
FT                   /locus_tag="BVAF_388"
FT   CDS_pept        complement(434693..435343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolA"
FT                   /locus_tag="BVAF_388"
FT                   /product="outer membrane lipocarrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_388"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33781"
FT                   /db_xref="GOA:E8Q687"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q687"
FT                   /protein_id="ADV33781.1"
FT                   /translation="MVTNKFHGIGKLIVHICFSMFMLQSIQTQVISSSSVLQNRLNLVN
FT                   KFYVNFIQKVYFFDYEENIEIARGELWVKRPNLFRWHFTDPEEFVLVSDGQTVWFYVPK
FT                   LKQVVAYCLKNQIAGNIFLELLFSSNLFVYQNYIILQKEDWFYLKSMHDNSLHIKECAI
FT                   QINKDGVINQINVEEENGQRVNYYLSNQCVNFIDKDKFNFFISKDMQLDDQRR"
FT   gene            complement(435392..437794)
FT                   /gene="ftsK"
FT                   /locus_tag="BVAF_389"
FT   CDS_pept        complement(435392..437794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="BVAF_389"
FT                   /product="DNA translocase ftsK"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_389"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33782"
FT                   /db_xref="GOA:E8Q688"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q688"
FT                   /protein_id="ADV33782.1"
FT                   /translation="MILIRIIILGFIFVYIVMILFSFDPADPGWMQHIGYNELMCSNIG
FT                   GKVGARIADFLFFSFGVVAYIMPLFILFYLWKFFLNKNNRPVFIFFLELIAIFIFLLIC
FT                   CVCAQSIMNDIFYFAPGGIIGSILLNIIKVPQYFLYYIIMNLISISIIGCMYFFNQNFL
FT                   NLIAKIYKKIIYILHIIFGKSLTSISKLNYYVQKVFCCSSIMSSIYFKKKYVVYKKFFN
FT                   RQSKISKLLIKNCDKSTQFVSFTNSPICNNIISSLPSAMNFGCVEWNWLNNRDQQQHIN
FT                   IPKSDQFKLNVDGNNQYYCSNRIKFINTLDRINYSNKNVDEKSNCYSKKIFSKNMFMLF
FT                   NNNVNRNHTLFKFMNHKSDSIFHNRKNRDKTKFIKSNLQKKTLPQNNMNHYHSIIVPKK
FT                   KYNDTINLGLPNKNLLISNVKKKSINSFKFEQDAELIESKLLEYRIKAKVMQITSGPVV
FT                   TLFALNLSAGIKSSKISGLSLDLARSLSVRAVRVIEVIPETPYIGLEIPNKNRDIVFLE
FT                   EIISSENFRNMNSPLALALGKDICGIPVIADLRNMPHLLVSGTTGSGKSMGINSMIISM
FT                   LYKSTPEEVRFIMIDPKILELSVYSNIPHLLKKVITDVNDVESILQLCIIEMERRYKLM
FT                   SILNVRNLENYNNQVEQSIFTQDTIENNVFCFEITKKLPYIVIIIDELSDLMILTDKKI
FT                   EVLITRLTQKARAAGIHLILSTQRPSVNVITGLIKANIPARIAFTVSSKIDSRTILGQS
FT                   GAESLLGKGDMLYLPANSSMLVRIHGACVQDEEICSVVKFWTTQKHY"
FT   gene            438190..439161
FT                   /gene="trxB"
FT                   /locus_tag="BVAF_390"
FT   CDS_pept        438190..439161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="BVAF_390"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_390"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33783"
FT                   /db_xref="GOA:E8Q689"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q689"
FT                   /protein_id="ADV33783.1"
FT                   /translation="MKNKNKHCKLLILGSGPAGYTAAIYSARANLSPILISGLEIGGQL
FT                   STTLSIENWPGDSENLTGPSLMNRMKAHAIKFNTNIIDDHIIKVNFQKRPFQLYGNTNQ
FT                   YTCDSLIISTGGSARSLGIPSEIKYKGKGVSSCATCDGFFFNKETVAVIGGGNTAVEES
FT                   LYLSNIAHTVHLVHRRSQFTSEKILIDRLMEKVYKGNIVLHTNCIVKTILGNDLEVTGL
FT                   RIKNTILLKEYTIDLKGVFIAIGYNPNTSIFCHQLKLNDNGYICVNSKNDNNNATTATS
FT                   VPGIFAAGDVMDYMYRQAITASGTGCMAAIDAERFLSTIQNN"
FT   gene            439300..439518
FT                   /gene="infA"
FT                   /locus_tag="BVAF_391"
FT   CDS_pept        439300..439518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BVAF_391"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_391"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33784"
FT                   /db_xref="GOA:E8Q690"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q690"
FT                   /protein_id="ADV33784.1"
FT                   /translation="MIKEENIEMNGIVLDTLPNTMFRVRLENGHIIMAHISGKIRKNYI
FT                   RILTGDKVTVELTPYDLSKGRIIFRSR"
FT   gene            complement(439596..441788)
FT                   /gene="oprC"
FT                   /locus_tag="BVAF_392"
FT   CDS_pept        complement(439596..441788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprC"
FT                   /locus_tag="BVAF_392"
FT                   /product="TonB-dependent copper receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_392"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33785"
FT                   /db_xref="GOA:E8Q691"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q691"
FT                   /protein_id="ADV33785.1"
FT                   /translation="MILKYVSNDFLKSVIYFVLYIATCICILCITNNIYANDDYLSSGS
FT                   LQHKTSSTLTCKKFPPLFKDSKNNKVVTIIAEVNTSLISVSDSIKSLQHYSFITDSVDY
FT                   LKNIPGFSMIRNGGTNNNFVLRGITSSKIRILADSGEIIGACCSGMDPATAYIIPETFD
FT                   ILNIIKGPQTVLWGPVTSGGILQFRRYHPHFNSPQIKTCSSMIVGSNDSIYRNIDSILG
FT                   NKYGYIRLIGNCNYSGNYYDGNNHPVHSAWYKWSADAILSFNFRSNTFIDINLGQGNSR
FT                   VNYAVTGMDGLCFARESYGFRIETPGINDVLNSIEIQSWYHHIHHIMIDSTVSFVKNLS
FT                   STLIPKQYYCCSTQCKTNVNDVERSLWGSRGFITCQWENFQFYSGIDIQINQYRKNTQL
FT                   MCDSKIHNYSLDSGIFNEFIFNMLPNKKIIGGIRIEHSVVDIHDDCYAVYYRDVTYPAG
FT                   FMRYEGVIYPEFLYYLGVGVCQRLPDYWELILNRFNDNIKSKNLIFQLKPEKTIQIDMG
FT                   AHLKKTKIDGWITSYIGYIKDFICYKYNNNVDSNLIQDNIVDCMKNSNANICGTEMGVS
FT                   YKLNDYWLGKSNISWAWGINKDNQCILPTIPPLEGKFTCQFKKQNYNLGILWRLVSSSQ
FT                   YIEKFLSTFCSYNFLFKKYTQDILHTPGFGVISAYLAWRIPNYYTYTVGIDNILNKTYR
FT                   EHVNNFLNNYDVTQYNSKKLIYESGRTWWIKAEIIL"
FT   gene            442136..442777
FT                   /gene="yqeI"
FT                   /locus_tag="BVAF_393"
FT   CDS_pept        442136..442777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqeI"
FT                   /locus_tag="BVAF_393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_393"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33786"
FT                   /db_xref="GOA:E8Q692"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q692"
FT                   /protein_id="ADV33786.1"
FT                   /translation="MQYIIHSNIIFDTTEYILKSLHNDNNLIKLSNSSGRILEELIKHR
FT                   HTGSPVTREHLFTVVWKSYGLEPSHGNLNQQISLIRKNLAIFGVDSSSILTIPKRGLKL
FT                   NNQLTIKQIENDPENNYISPNQYAHDSTKSNIDKNDNITSRNSNPFHTQTYIKYIITLI
FT                   ITLFFVFTIGFIYLYNKTNSIKLYCCKEINSCNICTFPIISEFEFQNNET"
FT   gene            complement(443025..443705)
FT                   /gene="emtA"
FT                   /gene_synonym="mltE"
FT                   /locus_tag="BVAF_394"
FT   CDS_pept        complement(443025..443705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emtA"
FT                   /gene_synonym="mltE"
FT                   /locus_tag="BVAF_394"
FT                   /product="endo-type membrane-bound lytic murein
FT                   transglycosylase A"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_394"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33787"
FT                   /db_xref="GOA:E8Q693"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q693"
FT                   /protein_id="ADV33787.1"
FT                   /translation="MKFYLVYIIFLIIIIPGCIMISPRLNNNQETLCFLKQQTNNYSNS
FT                   KKQISLSETYDKHINYYSKLYGVDALLIKSIIQVESNYNPNVVSKSNAVGLMQIKADTA
FT                   GKDIYRLKGRLGQPSVAELKNAVTNIELGTAYLYILQNQLADIMNLKTRRYAMIVAYVN
FT                   GLGALLKIFSTLDHTQAIKKINKLNSKQFCQYIQYHHPSVQAYRYLFKVNSVYMLNNKN
FT                   YAKH"
FT   gene            444456..445556
FT                   /gene="mnmA"
FT                   /locus_tag="BVAF_395"
FT   CDS_pept        444456..445556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnmA"
FT                   /locus_tag="BVAF_395"
FT                   /product="tRNA-specific 2-thiouridylase mnmA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_395"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33788"
FT                   /db_xref="GOA:E8Q694"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q694"
FT                   /protein_id="ADV33788.1"
FT                   /translation="MKKVIVGISGGVDSSVSAWLLKKRGYKVEGLFMKNWENDDTQEFC
FT                   ASKSDLIDACSVCNTLKIPLHTVNFSREYWNNVFKVFLKLYNIGLTPNPDILCNKEIKF
FT                   KYFLEFAIEDLGADFIATGHYVRRINFNNKISLIRGIDLNKDQSYFLYTLNQQQLKHCL
FT                   FPIGNFTKLKVRSIAKKLNLITANKKDSMGICFIGKRNFKKFLSNYIPIQPGPIVNVHG
FT                   YKIGTHQGVPFYTIGQRKGLNIGGIKNSNGKPWYVVDKKIENNSLIVAQGINHPCLMSN
FT                   QFVVQQIFWIEECILTSPLQCSVKTRYRQPDSKCYIFPISKNNLRIILKYPITAITPGQ
FT                   SAVFYLNERCLGGGIITKHFPLMSTQ"
FT   gene            445739..447130
FT                   /gene="purB"
FT                   /locus_tag="BVAF_396"
FT   CDS_pept        445739..447130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BVAF_396"
FT                   /product="adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_396"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33789"
FT                   /db_xref="GOA:E8Q695"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q695"
FT                   /protein_id="ADV33789.1"
FT                   /translation="MIKYSPLTAISPIDGRYHNYTHSLRNIFSEFGFLKFRVQIEICWL
FT                   KKISNTQEITEVPIFTETEHNFLNNLVDDFSIKDAKYIKKIERVTNHDVKAIEYFLKEK
FT                   INVVPSLKKKINEFIHFACTSEDINNLAYGLMLIHTKNIIILPIWRKIINSIKQLSINY
FT                   KEIPILSRTHGQPASPSTMGKEMANVAYRLIRQFHHLQLIKILGKINGAVGNYNAHIIA
FT                   YPRINWRKFDEEFVTSLGISWNPYTTQIEPHDYIAEISDCIARFNTILINFNQNIWGYI
FT                   SLNYFTQKHESYEIGSSTMPHKINPINFENSEGNLGLSNAILKHFSEKLPISRWQRDLS
FT                   DSTVLRNLGVAIGYSLISYYNTLQGIDKLIINEKYLSQDLNKNWMILGEALQTVMKRYN
FT                   IHNAYERTKDFMFNYSNNINANSIKSFIDSLPLPTIEKNRLKKITPSDYIGLASILASD
FT                   IEKIK"
FT   gene            complement(447279..448523)
FT                   /gene="lolE"
FT                   /locus_tag="BVAF_397"
FT   CDS_pept        complement(447279..448523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolE"
FT                   /locus_tag="BVAF_397"
FT                   /product="lipoprotein-releasing system transmembrane
FT                   protein lolE"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_397"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33790"
FT                   /db_xref="GOA:E8Q696"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q696"
FT                   /protein_id="ADV33790.1"
FT                   /translation="MFLSLRIALRFYQGGKRNILASLISLVSVIVIGVGIAVSIIIFSI
FT                   INGFEYELSKRILSIVPHGEITTVNNIPLINWKEILTYVIKIPQVINASPYIHFSSIIK
FT                   FHNKWHLVYIKSVNLLNNVNIYDHVLTNFIEKDSWKRFCENKNQIILGEGVSIALNIKE
FT                   GDWITVFLVNNFNLDNRLALTKQVSLQVSGILKLHSYLDNSLAIISLLDAQNYYNNRLG
FT                   VDGIEFSVNNVFHIKKIIKNMKFMINKNIKISSWIDMYGYIYHDIQIVRIIIYLSVILI
FT                   IGVSCFSVITVLILLTKHKNYDIAVLRAIGAQAILIQRIFLWYGFLIYCVSSVIGVGLG
FT                   VLVSLILKNFGARYINLFKINFDAKSVYFIDFLPVQVHILDIYLLLIVVLLLGFLISWY
FT                   GSLKVRKINLFRILR"
FT   gene            complement(448541..449254)
FT                   /gene="lolD"
FT                   /locus_tag="BVAF_398"
FT   CDS_pept        complement(448541..449254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolD"
FT                   /locus_tag="BVAF_398"
FT                   /product="lipoprotein-releasing system ATP-binding protein
FT                   lolD"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_398"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33791"
FT                   /db_xref="GOA:E8Q697"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q697"
FT                   /protein_id="ADV33791.1"
FT                   /translation="MVKKERTNSVLLNCIQLVKYYECPKFSIKVLNCITISVQYNEIIA
FT                   IMGTSGSGKSTLLHLMGGLDKPNSGDVFFEGYALNKLSDKNCAFIRNKRIGFIYQFHHL
FT                   LSDFSVLENVAMPLLIGGMKLNIAKKKAQILLELIGLQDRSNHHPHELSGGESQRIAII
FT                   RSIINNPALVLADEPTGNLDEQNSDNFFELLKKINSSYNTTFVIATHDPNLARKCHKIF
FT                   ILSNGVLKNIQNNYL"
FT   gene            complement(449247..450458)
FT                   /gene="lolC"
FT                   /gene_synonym="ycfU"
FT                   /locus_tag="BVAF_399"
FT   CDS_pept        complement(449247..450458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolC"
FT                   /gene_synonym="ycfU"
FT                   /locus_tag="BVAF_399"
FT                   /product="lipoprotein-releasing system transmembrane
FT                   protein lolC"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_399"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33792"
FT                   /db_xref="GOA:E8Q698"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q698"
FT                   /protein_id="ADV33792.1"
FT                   /translation="MHIAVVCFIAFRYIFGKTINQFSRYIYWVSSIFIMLSIAVMIIIL
FT                   SVMNGFESELKKNLLYLTPHILITSSSGYTHVNNIPNFLFHEMSDNIAYFKPLVISNII
FT                   LQGLKEISLGMLLGIDPNHFEPLSKYLKQNNNITKLVSGEYNIIIGSELAQKLSVKIND
FT                   QIRIIVPSVNQITPIGCLFSQRLFTISDIYFSNNGGFDTNQVLMHKDDAAVLLHYPDRC
FT                   VTGWRIWVHEPFKLNKFDYLDIPKDWIWKDWREYKGSLFQAIKMEKSIMFLLFILIIII
FT                   SGCNIVAFLVLSIVEKQKEIAILKTCGFNRSQVLILFIMQGMSNSIIGIVLGIGLGLLF
FT                   SIKLNQILLFFNISSEKIYFPVEIQYIQIFSIIIIICVLNLLIILFPAWRMSSIRAIQI
FT                   LRHG"
FT   gene            complement(450604..451179)
FT                   /gene="ycfM"
FT                   /locus_tag="BVAF_400"
FT   CDS_pept        complement(450604..451179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfM"
FT                   /locus_tag="BVAF_400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_400"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33793"
FT                   /db_xref="GOA:E8Q699"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q699"
FT                   /protein_id="ADV33793.1"
FT                   /translation="MRKNTGLVFSIVFFINIGMCIVDNIAIAVIIKTVNSELHDVIESM
FT                   IVVNWKIILYKMLQDVSFFKDNINYNSSVLINIFKNNSSRVVQTINITNILINLILENN
FT                   NDTYTIISLNKLYHIYRELEVSYEDVVNSYEFSVKVANYLKADYIIYGNIYDGDMQGFN
FT                   VELQLLSSNTGEILRVVNNIKSNDDMSL"
FT   gene            complement(451305..451661)
FT                   /gene="hinT"
FT                   /gene_synonym="ycfF"
FT                   /locus_tag="BVAF_401"
FT   CDS_pept        complement(451305..451661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hinT"
FT                   /gene_synonym="ycfF"
FT                   /locus_tag="BVAF_401"
FT                   /product="HIT-like protein hinT"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_401"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33794"
FT                   /db_xref="GOA:E8Q6A0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6A0"
FT                   /protein_id="ADV33794.1"
FT                   /translation="MKKNNPFIDIIQKKVKIDLVYQDDLVTAFYDLYPKAPIHILIVPN
FT                   ILIPTVNDVKVEHEITLGRLFLVASKIAAKKNINISGYRLIVNCNKNSGQEIYHLHMHL
FT                   LGGKLLGPLLHQDY"
FT   gene            complement(451722..452510)
FT                   /gene="ycfH"
FT                   /locus_tag="BVAF_402"
FT   CDS_pept        complement(451722..452510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfH"
FT                   /locus_tag="BVAF_402"
FT                   /product="TatD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_402"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33795"
FT                   /db_xref="GOA:E8Q6A1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6A1"
FT                   /protein_id="ADV33795.1"
FT                   /translation="MFLIDSHCHLNKLNYHNVHADISDVLSKAYQKGVKLVLSVSTDLS
FT                   DYENMIQFVGYRKDVLFSCGIHPMNICDFTIKRVDLNKLNNFVFNDNVIAIGETGLDYY
FT                   HNISNKNVQKEIFCQHIDIAKNIDKPLVVHSRNAMKDVLILLNETGAKQCKGVLHCFCD
FT                   DIDSARILLNMNFYISFSGMVTFKNIDNFKKVIQYVPENRMLLETDSPYLTPVPYRGLE
FT                   NQPAYVYDIARYISDIKKISLDEIASITTSNFCELFRVEL"
FT   gene            complement(452515..453543)
FT                   /gene="holB"
FT                   /locus_tag="BVAF_403"
FT   CDS_pept        complement(452515..453543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BVAF_403"
FT                   /product="DNA polymerase III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_403"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33796"
FT                   /db_xref="GOA:E8Q6A2"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6A2"
FT                   /protein_id="ADV33796.1"
FT                   /translation="MKIQWYPWLKTIYYRILHSYCINKGHHAMLFSSKWDNGEDRLIEF
FT                   LARWLICENPINMEYCDVCHHCYLMNIEQYPNYYQLCLQNHAPTINTDLIKICINSIYE
FT                   HTIYNKVRVVFIKYIEYLNAESVNLLLKIIEEPPINTYFFLKTREYMYIPATIRSRCMR
FT                   WFILSPPEHIGLKWIKTQEEGGNNDNVSIRTALRLNYGSPILAKFMLKSSDMWNYRLGL
FT                   YDILKNVCKNKSYLQLLSLLNSKKYMNVSVCWLITVLLDALKYKQGIQEDFFINLDQLK
FT                   LIYIVSMQWSVFALHEQLKQWLILFHYFQKFDSINHELLLTCRLLHWEQNLVETCSQLW
FT                   SI"
FT   gene            complement(453551..454186)
FT                   /gene="tmk"
FT                   /locus_tag="BVAF_404"
FT   CDS_pept        complement(453551..454186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BVAF_404"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_404"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33797"
FT                   /db_xref="GOA:E8Q6A3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6A3"
FT                   /protein_id="ADV33797.1"
FT                   /translation="MNNKFIVVEGLDGSGKTTIVSKIVQYFNNNNITNLITVHEPGGTK
FT                   ISDSLRFLIKNGAIDESITNMTEVLMLYAARSQLLENIVKPALTKGDWVIGDRFDLSSF
FT                   AYQGGGRGVDEFFLYLLSKSVINNLFPHLIFYLDIAPEISLLRVKNRDKLDRIEKEPLS
FT                   FFYKVREYYKKVAAIQKNIITINANQSLEIVSRSIYQYLDVWLYNWFK"
FT   gene            complement(454405..455223)
FT                   /gene="pabC"
FT                   /locus_tag="BVAF_405"
FT   CDS_pept        complement(454405..455223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BVAF_405"
FT                   /product="aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_405"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33798"
FT                   /db_xref="GOA:E8Q6A4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR017824"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6A4"
FT                   /protein_id="ADV33798.1"
FT                   /translation="MYWVNGVLQTQISLNNRALHFGDGFFTTSQIKKGEVQWLSYHMDR
FT                   LILSARRLMFDNVNFHILYKEILKAANYSKYGIIKIIITRMSYDRVVYGYGFDDKLEIL
FT                   RIIRVLPCSEHYKKLCYSGVRLKISSIRLSRNPLLSGIKHLNRLEQVLIASEIYRNKKN
FT                   IDDVLVLDTENNIVECCSANIFWRKKNKVFTPYLHHAGVNGVIRQVILKILPDLGYVVQ
FT                   EVMVGIEHLKEMEEVFITNSLLPLASVNVINNYFYSDKTLLNLLKFHIIN"
FT   gene            complement(455515..455760)
FT                   /gene="acpP"
FT                   /locus_tag="BVAF_406"
FT   CDS_pept        complement(455515..455760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="BVAF_406"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_406"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33799"
FT                   /db_xref="GOA:E8Q6A5"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6A5"
FT                   /protein_id="ADV33799.1"
FT                   /translation="MSTVEEKVKAIISEQLGVKKEEVVNHASFIDDLGADSLDTVELVM
FT                   ALEEEFDIEIPDEEAEKITTVQSAIDFINVNHNKLI"
FT   gene            complement(455919..456653)
FT                   /gene="fabG"
FT                   /locus_tag="BVAF_407"
FT   CDS_pept        complement(455919..456653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BVAF_407"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_407"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33800"
FT                   /db_xref="GOA:E8Q6A6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6A6"
FT                   /protein_id="ADV33800.1"
FT                   /translation="MIFIKKNILVTGARKGIGRIISELFVSYGATVIGTATDEGGVKNI
FT                   NMYLGSKGKGVCLDVTKQYSINFCLQEIHKEFGHIDILVNNAGITQDNILVYMKDDEWK
FT                   SVIDVNLNAVYRMSKAVIKPMIKNHYGRIINISSVVSMIGNVGQVNYAAAKSGLIGFTK
FT                   SLAKEVASWGITVNVVTPGFIDTDMTKNLTDKQKENILSKIPIRRFGNPKDVANAVVFF
FT                   ASDDSSYITGQTIHVNGGMYMG"
FT   gene            complement(456698..457660)
FT                   /gene="fabD"
FT                   /locus_tag="BVAF_408"
FT   CDS_pept        complement(456698..457660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="BVAF_408"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_408"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33801"
FT                   /db_xref="GOA:E8Q6A7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6A7"
FT                   /protein_id="ADV33801.1"
FT                   /translation="MNTKDKTLAVVFPGQSSQHLGMLSDFATRYKLVRKIFDEVSEILN
FT                   YDIWRLTQYGPITKLNKTCYAQPAILTASVIIWRVWREQGGQIPNLMAGHSLGEYSALV
FT                   CSESIDLLSAVKLIMVRSKLMQEVSPYGDGAMSVIIGLNNDTVIEFCKMTESIYNQIVA
FT                   PAGFNAPGNIVISGHIKAVEKVNLFCKKAGAKYVKFLPISVPSHCIIMKPMVNKFKEAL
FT                   KKVKIYPPKIPIINNTDVSIESEPLAIRDALIRQLYTPVRWHEIIQKIIGNNIEKFLEM
FT                   GPGKVLTQLIQRSMYDNIFSLSINNINRLLTAINMCVKN"
FT   gene            complement(457695..458651)
FT                   /gene="fabH"
FT                   /locus_tag="BVAF_409"
FT   CDS_pept        complement(457695..458651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="BVAF_409"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_409"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33802"
FT                   /db_xref="GOA:E8Q6A8"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6A8"
FT                   /protein_id="ADV33802.1"
FT                   /translation="MFTRIFGTGSYLPAHIRSNVVLEKMVDTSNEWIIARTGIQERRIS
FT                   NSYETVAKMGYFASRKALDMSNVQPNKIGVIIVATTSSSHAFPSSACQIQRDLNIRDTI
FT                   AFDLSAACSGFIYALNVADQYIKHGTAEYALIVGSDILSHSLNPKDRGTLILFGDGAGA
FT                   VILGRSKNPGIISTRLHANGKYGHLLTLPNYNRFNNSCSSVHLTMAGNKLFKMAISVCT
FT                   HIVQETLKENDLHQDELDWLIPHQANLRIISAAAKRLNIDMKKIVITLDKHGNTSAASV
FT                   PLALDEAVRDGRIKLNQLLLLEAFGAGLTWGSVLLRL"
FT   gene            complement(458658..459704)
FT                   /gene="plsX"
FT                   /locus_tag="BVAF_410"
FT   CDS_pept        complement(458658..459704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="BVAF_410"
FT                   /product="phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_410"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33803"
FT                   /db_xref="GOA:E8Q6A9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6A9"
FT                   /protein_id="ADV33803.1"
FT                   /translation="MKHLVLALDTMGGDFGPRVIVPASLEALDLCPRLVCLLVGNPSMI
FT                   RSVLKKFNSKYINRLTIIPSKSVISDNDRPSQAIRVSKDTSMRIALELIKSGNAQACVS
FT                   AGNTGALMGLSKLVLKPINGIDRPALTTFLPHQNKGKTVILDLGANIACSGSMLVQFAI
FT                   MGTVLSEQIVGIGNPKVALLNIGSEESKGLDNIRQASKILHTISSIRYIGYIEANDLLA
FT                   GKTDVIVCDGFIGNITLKTMEGVIRVVLSVFQKSEEKNTIYCYVIEHIKHWFSKIFFKK
FT                   FIQLNPDRYNGAYLVGLHNTVIKSHGGANQHAFTKAIIQAVHSVERRIPEKIADRLSQM
FT                   LSYQNNYY"
FT   gene            complement(459716..459898)
FT                   /gene="rpmF"
FT                   /locus_tag="BVAF_411"
FT   CDS_pept        complement(459716..459898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="BVAF_411"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_411"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33804"
FT                   /db_xref="GOA:E8Q6B0"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6B0"
FT                   /protein_id="ADV33804.1"
FT                   /translation="MAVQQNKSTRSRRGMRRSHNALKLTNISVDQISKEIHRRHCITTD
FT                   GFYKGLKMVEKNNSQ"
FT   gene            461718..463868
FT                   /gene="rne"
FT                   /locus_tag="BVAF_412"
FT   CDS_pept        461718..463868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rne"
FT                   /locus_tag="BVAF_412"
FT                   /product="ribonuclease E"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_412"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33805"
FT                   /db_xref="GOA:E8Q6B1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6B1"
FT                   /protein_id="ADV33805.1"
FT                   /translation="MKRMLINATQKEELRVALVDGQRLYDLDIEIIGHAQKKSNIYKGK
FT                   IIRIEPSLEAVFVDYGAERHGFLPIKEIAREYFLSSSCAQNKSNIKDILREGQELIVQI
FT                   NKEERGNKGAALTTFISLAGSYLVLMPNNPKSGGISRRIEGNDRIELKTTLATLALPEG
FT                   MSLIIRTAGVGKSVAELEWDLTSRLQHWKNIKNTASIRLAPFLIHQDSNVIVRAFRDYL
FT                   RPDIGEILIDNPDILNVAKEHITSLGRPDFVKKIKLYNGEIPLFSHYQIESQIESAFQH
FT                   EVRLPSGGSIVIDATEALTAIDINSARSTKGLDIEDTAFNTNLEATDEIARQLRLRDIG
FT                   GLVVIDFIDMTSNSHQREIENTLRTVVRQDRARIQVGRISKFGLLELSRQRLRPSLDES
FT                   SHHVCPRCSGTGSIRDNASLSLSILRLIEEEALKDNTCEVHAIVPVAIASYLLNEKRKA
FT                   ISDIEQRQKGVRAIIVPHEQMKTPNYEVRRIRKGETNNNQPSYALATYHNNNSTLSSEN
FT                   TIIQNYDFDVEQKKLLKKKQNTLSLTKLYQENILFSLNNFKLRLKKNIFKIIKLINFYL
FT                   LFKQLIRKHIYTMQTWIKTIHKCNIKNKIYISSFNKKKNLQYNKHPKKLLYQYSANFNN
FT                   KQSVNNKKKINSNIDYKNKKNNFNNHNSTQLRYKKQPYSSIYFSKFIKSDMNHSLDNFS
FT                   IMNIKKNTHQMKKKFKRKENSI"
FT   gene            464581..465486
FT                   /gene="erfK"
FT                   /locus_tag="BVAF_413"
FT   CDS_pept        464581..465486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="erfK"
FT                   /locus_tag="BVAF_413"
FT                   /product="Protein erfK/srfK"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_413"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33806"
FT                   /db_xref="GOA:E8Q6B2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041597"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6B2"
FT                   /protein_id="ADV33806.1"
FT                   /translation="MYIILNIHFHYVVAEIYLLSNNNNILGENLRYTIPNNNSHSLEYF
FT                   AKKFKVGLRNLLAANPDIDLYLPDSGKPILIPKKLILPNTPHKGIIINIAEMRLYYYPN
FT                   TKNNNIVMVFPISIGTPTHETPSQWITSIKDKKKDPIWIPTQNIRNEYIKRAEILPLMI
FT                   LSGPNNPLGSYALYLGNSYAIHGSNTNLGIGLRVTRGCIRLRTEDIKLLYTLVPLNTRV
FT                   QFINEPIKIAIDSNGMQYLEIHTPLSTINNKQDNKTATIHNLKIRTYTMLQKNNFKNIN
FT                   FLKVNQALEECLGIPIEITT"
FT   gene            complement(465722..465803)
FT                   /locus_tag="BVAF_414"
FT   tRNA            complement(465722..465803)
FT                   /locus_tag="BVAF_414"
FT                   /product="tRNA-Leu"
FT   gene            complement(465865..465935)
FT                   /locus_tag="BVAF_415"
FT   tRNA            complement(465865..465935)
FT                   /locus_tag="BVAF_415"
FT                   /product="tRNA-Cys"
FT   gene            complement(466323..466904)
FT                   /gene="pgsA"
FT                   /locus_tag="BVAF_416"
FT   CDS_pept        complement(466323..466904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="BVAF_416"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_416"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33807"
FT                   /db_xref="GOA:E8Q6B3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6B3"
FT                   /protein_id="ADV33807.1"
FT                   /translation="MLIIFTLIKCCNTFNIPIFLTLFRLVMVPCFTIVFYLPVQWGPIL
FT                   CTIIFITAAITDWFDGFLARRWKQTSKIGKFLDPVVDKIMIITAFVLISEYFHVWWMTL
FT                   PISSMIIREIIISALREWIAKIYNHRDLSVSWLSKLKTFIQMSALIVLLCRFNEWTMIT
FT                   GIVALYVSVVLALWSLCYYLYTACCIIVKL"
FT   gene            467133..467205
FT                   /locus_tag="BVAF_417"
FT   tRNA            467133..467205
FT                   /locus_tag="BVAF_417"
FT                   /product="tRNA-Lys"
FT   gene            complement(467351..467439)
FT                   /locus_tag="BVAF_418"
FT   tRNA            complement(467351..467439)
FT                   /locus_tag="BVAF_418"
FT                   /product="tRNA-Ser"
FT   gene            467594..467923
FT                   /gene="tusE"
FT                   /gene_synonym="yccK"
FT                   /locus_tag="BVAF_419"
FT   CDS_pept        467594..467923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tusE"
FT                   /gene_synonym="yccK"
FT                   /locus_tag="BVAF_419"
FT                   /product="Sulfurtransferase tusE"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_419"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33808"
FT                   /db_xref="GOA:E8Q6B4"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6B4"
FT                   /protein_id="ADV33808.1"
FT                   /translation="MKQDQFNINTDLEGYLINFEDWNSKIAIKLANSEGIKLNKIHWDL
FT                   IYFVRMFYKEYKMLPKIQTLISIITLKHGQIKGNSRYLIKLFPKKSVTQQISKIAGLPK
FT                   PKKCL"
FT   gene            468114..468431
FT                   /gene="hspQ"
FT                   /gene_synonym="yccV"
FT                   /locus_tag="BVAF_420"
FT   CDS_pept        468114..468431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspQ"
FT                   /gene_synonym="yccV"
FT                   /locus_tag="BVAF_420"
FT                   /product="heat shock protein hspQ"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_420"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33809"
FT                   /db_xref="GOA:E8Q6B5"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR022866"
FT                   /db_xref="InterPro:IPR036623"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6B5"
FT                   /protein_id="ADV33809.1"
FT                   /translation="MISSKFGIGQQVRHRLLGYLGVVIDVDPEYSLEKPTLSEITGDDS
FT                   LRQFPWYHVVMEDEDGKPIHTYLAEVQLGYVDTPGHLDQSTLDDLSASIKLQLKSPRLR
FT                   N"
FT   gene            468768..469286
FT                   /gene="fabA"
FT                   /locus_tag="BVAF_421"
FT   CDS_pept        468768..469286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="BVAF_421"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_421"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33810"
FT                   /db_xref="GOA:E8Q6B6"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6B6"
FT                   /protein_id="ADV33810.1"
FT                   /translation="MQNKRESYTKEDLLNSSKGKLFGNKGPVLPAPNMLMLDRITKMTM
FT                   NGGNYNKGFVSAELDIRADMWFFNCHFINDPVMPGCLGLDAMWQLVGFYLGWIGGEGRG
FT                   RALGVKEVKFTGQILPTSKKVTYFIHFRKIINRTLIMGMADGEVLCDKKIIYTATDLKV
FT                   GLFKNVTNF"
FT   gene            469520..470926
FT                   /gene="asnS"
FT                   /locus_tag="BVAF_422"
FT   CDS_pept        469520..470926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="BVAF_422"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_422"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33811"
FT                   /db_xref="GOA:E8Q6B7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6B7"
FT                   /protein_id="ADV33811.1"
FT                   /translation="MQTTSISNILQKFIPENTKITVHGWIRTLRHSKAKISFLDLYDGS
FT                   CLKTLQIVIGENLHNYKSEILHLTSGCSVTICGKIVKSIGNKQDIELVATNVTILGWID
FT                   QPNTYPITPKKHSLEYLRNVAHLRSRTHIFGAISRIRHILFQSMHNFMHKKGLLWIPTP
FT                   IITAADTEGNSKMFYLSENFNNKNISNNISTNQVNGEQFFFGKKAFLTVSGQLNLETYA
FT                   CALSKVYTFGPTFRAEHSDTNRHLSEFWMLEVEIAFSKLNDIIELAKAFLTNMIQIVLE
FT                   QCTPDITYCSNHSQCNLFKRLENFLNNKIAYIEYTDAINLLISCNKNFKNTVFWGGDLF
FT                   SEHEKYLSEEYFKSPVIIMNYPKNIKAFYMRLNDDNKTVASMDILVPGIGEIIGGSQRE
FT                   ERLNILKERLLENNLSNKYYWWYQDLRRYGTVPHSGFGLGFERLLIYITGITNIKDAIP
FT                   FPRVFKNINF"
FT   gene            471044..472258
FT                   /gene="aspC"
FT                   /locus_tag="BVAF_423"
FT   CDS_pept        471044..472258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="BVAF_423"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_423"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33812"
FT                   /db_xref="GOA:E8Q6B8"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6B8"
FT                   /protein_id="ADV33812.1"
FT                   /translation="MFESMLMAPSDPILGLSTIFRNDIRKKKINLGIGVYINEHNEAPI
FT                   LESVKHAEDFLLKKEMNKNYLNIEGIHAFNNATQSLLFGQDESIISKERIRTVQAPGGT
FT                   GALRIISECIAKHFNIYFGRKQRIWISDPTWVNHKNIFIASGLELHTYPYYNQYKHALD
FT                   FEKFLDTLNCSVKATDIVLLHCCCHNPTGIDPTIEQWKILSENSEKNGWIPLFDLAYQG
FT                   FDTDLKNDLQGLHIFCKHNSELIVCNSYSKNFGLYNERVGACTIIAQNNDHAERALSQL
FT                   KSTIRANYSNPPAHGASIVSTILTNPILYSIWENELKCMREHIKNMRFLLIQNLNHNNQ
FT                   HNKPNFDFITNQKGMFAYMDLNSNQVTKLRKNSGIYLVDSGRINLAGLSKQNIQYVCES
FT                   IRDLF"
FT   gene            complement(472403..473038)
FT                   /gene="ycbL"
FT                   /locus_tag="BVAF_424"
FT   CDS_pept        complement(472403..473038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbL"
FT                   /locus_tag="BVAF_424"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_424"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33813"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6B9"
FT                   /protein_id="ADV33813.1"
FT                   /translation="MKYHVIPVTSFNQNCSIVWCEQTHDAIVVDPGGEKEKLFRVIDNL
FT                   NVRINKIVLTHGHIDHVGHAVDLKKYYNVPIWGPHKDDEFLMNDLTLQCQILKIKEYCN
FT                   CAVSPDFWLKDGDIIEVGYEVFKVLHCPGHSPGHVVFWNESCKFIIMGDVLFKKNVGRS
FT                   DLPGGSYVTLINSIKNKLLVLEDDINFLPGHGPISSIGYERKNNTFLI"
FT   gene            complement(473152..473937)
FT                   /gene="fabI"
FT                   /locus_tag="BVAF_425"
FT   CDS_pept        complement(473152..473937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="BVAF_425"
FT                   /product="enoyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_425"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33814"
FT                   /db_xref="GOA:E8Q6C0"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6C0"
FT                   /protein_id="ADV33814.1"
FT                   /translation="MALLNNKRILITGVANSKSIACGIAKALHREGAELAFTYHTDKLR
FT                   SRVYEIAKLYSFNEIILPCDVSSDSSIEKLFVELKKSWSQFDGFVHSIAFAPTEQLRGD
FT                   YVNSVTRLGFEVSHMISSYSFVGMAKVCRSMLRKNSSLLSLTYLGSNRVVPNYNVMGLA
FT                   KASLESNVKYMANAMGADSIRVNAISSGPLKTLASSGILNFKKMLSFYAKHSPIRRNVT
FT                   IEEVGNVAAFLCSNLSSGITGEIIYVDGGFNTISGTEDM"
FT   gene            474890..475492
FT                   /gene="ribA"
FT                   /locus_tag="BVAF_426"
FT   CDS_pept        474890..475492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="BVAF_426"
FT                   /product="GTP cyclohydrolase-2"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_426"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33815"
FT                   /db_xref="GOA:E8Q6C1"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6C1"
FT                   /protein_id="ADV33815.1"
FT                   /translation="MRLKQVGKAKLPTLWGNFLIVGFEEKLTRQNHVALIYGSILGSEP
FT                   VLTRIHSECLTGDALFSSRCDCGFQLNTALNYITTEGQGILIYHRQEGRNIGLLNKIQA
FT                   YSLQDNGADTVEANQCLGFHADERDFTICADILKLLNIHTIRLLTNNPQKIKVLDNSNI
FT                   NIVERVPLIVGRNSKNAKYLNTKESKLGHLFNLRHKQ"
FT   gene            476166..477737
FT                   /gene="trpE"
FT                   /locus_tag="BVAF_427"
FT   CDS_pept        476166..477737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="BVAF_427"
FT                   /product="anthranilate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_427"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33816"
FT                   /db_xref="GOA:E8Q6C2"
FT                   /db_xref="InterPro:IPR005257"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6C2"
FT                   /protein_id="ADV33816.1"
FT                   /translation="MGYTKQRIESFKIQVHYHSNPTIVFNQLCKNRHSTLLLESSEIQK
FT                   QRNIESMMIIDSALRISAYNTNVIIQALTKNGANLLSVLEQALPNTVKVIKTHSTAIKL
FT                   KFPITQNTLDEDSQLKSISIFDGLRSLLKIMKPPQDNPKSVFLGGLFAYDLITCFEPIP
FT                   KLTDYPQCPDYCFYLSEILLIFDHQKHTAELNGTLFHSDTLEKNRLKNRMNELKKQINR
FT                   TLCTTIPYITVQNMTLSCNQNDTSYKKNIHRIQNFIRQGEILQAVPSRCFFLPCPSPLA
FT                   AYHTLKINNPSPYMFFMQDKVFTLFGASPESSLKYDANTRKIEIYPIAGTRARVYHDDG
FT                   SLDIDSDNRIELEMRLNQKELSEHLMLVDLARNDLARICKTGSRYISELLQVDRYSYVM
FT                   HLVSKVVGELSYNFDILHAYRACMNMGTLTGAPKIKAMQIIYEVEKKRRNAYGGAIGYL
FT                   VGSGSLDTCIIIRAAYVVNNLATVQAGAGIVLDSIPQSEADESRNKAKAVLQAIAIAHN
FT                   SKEIFS"
FT   gene            477737..478336
FT                   /gene="trpG"
FT                   /locus_tag="BVAF_428"
FT   CDS_pept        477737..478336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="BVAF_428"
FT                   /product="glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_428"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33817"
FT                   /db_xref="GOA:E8Q6C3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6C3"
FT                   /protein_id="ADV33817.1"
FT                   /translation="MVNIILLNNIDSFTYNLVDQLRSKKHQVLIYSNRLSDSVIINVIN
FT                   NIDNPILVLSPGPGSPQNSGCMMSLIKKLRGHIPIIGICLGYQALVQSYGGCISQSSEI
FT                   FHGRSSLIYHDEQAMFSNIPNPLLVARYHSLIGINIPSNLKINAYYKNHIAMAIRNDLD
FT                   RICGFQFHPESILTAYGTKLIHQTILWANTLIRTRA"
FT   gene            478357..479361
FT                   /gene="trpD"
FT                   /locus_tag="BVAF_429"
FT   CDS_pept        478357..479361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="BVAF_429"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_429"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33818"
FT                   /db_xref="GOA:E8Q6C4"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6C4"
FT                   /protein_id="ADV33818.1"
FT                   /translation="MKHILNILRQSNNLTRTQCKKLFFNIINKKFSSKEISEILINIKN
FT                   KGETIEEILGAADALLIHAKYFPKLRGLFADITGTGGDGKNTINISTASALIASTCGVK
FT                   IVKHGNYNASSSIGGSMNLLQQYNVCINMNTHQILKNFNELGICFLCASQYYPILRDVT
FT                   YIRKQLKTPTLFNIIGPLINPSKPPLTLIGVYKKELLSPITQTLKLLNYKRAIVVHCDG
FT                   IDEVGLHNQTNVFELRNGTIQHYTLTPSDFGLKKYPLEELWSSSQHQSYSSIINVLKGQ
FT                   GKPSHTAVITANVALLLTLFGHNNLRSNTSTILNKIYTGLPYKKLLALSSSLV"
FT   gene            479388..480776
FT                   /gene="trpC"
FT                   /locus_tag="BVAF_430"
FT   CDS_pept        479388..480776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="BVAF_430"
FT                   /product="tryptophan biosynthesis protein trpCF"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_430"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33819"
FT                   /db_xref="GOA:E8Q6C5"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6C5"
FT                   /protein_id="ADV33819.1"
FT                   /translation="MPNTILNQIISYKKNWILNQKYYLSIDKLKTNIKNSKRSFYNTLL
FT                   LAHRNNHTIFILEYKVASPSKNIICNNPDLVKIIHIYKKYASIISVVTDEKYFHGNFDN
FT                   LVQISNMTTQPILCKDFFISEWQIYFARLHQADAILLMLSVIDDNTYRKLSYIAHSLNM
FT                   GILTEITNSNELQRAIKLNAKIIGINNRNLNDLSIDLNRTINLSPNIPDSIIKISESGI
FT                   TNHYHIKKLKRYVHGFLIGTTLMSSSNYLDTAIKKLVLGENKICGLTRIEDAEVSYESG
FT                   AIYGGLIFVNYSPRFINIKNAQKIISAIPNLNYVGVFQNDLILNIVNIVRILNLSAIQL
FT                   HGTENQNYIDKLRTQLPHTCQIWKSINMNNQTPYTSNLLHIDRYLLDNKQGGSGKTFNW
FT                   GKLSFTNIPLNKSILAGGLTINNCSKAAKIDCVGLDFNSGIEIQPGIKNHQSILKIFQI
FT                   LRIY"
FT   gene            480810..482009
FT                   /gene="trpB"
FT                   /locus_tag="BVAF_431"
FT   CDS_pept        480810..482009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="BVAF_431"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_431"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33820"
FT                   /db_xref="GOA:E8Q6C6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6C6"
FT                   /protein_id="ADV33820.1"
FT                   /translation="MMQKKLTSYFGEFGGMYVPQILIPTLIELEKEFISSQNDPVFQKE
FT                   LKALLKNYAGRPTPLTLCRNLTHGTHSKLYLKREDLVHGGSHKTNQVLGQALLAKRMHK
FT                   TDIIAETGAGQHGVAVSIVAALLKLKCRIYMGQKDINRQKSNVLRMKLMGSQVIPVYHG
FT                   SATLKDACNEAMREWSKTYQYTHYMLGTIAGPHPFPTIVKEFQRIIGIETFEQIQNFEK
FT                   RLPDSIIACIGGGSNAIGIFSSFLDIPSVQLLGVEAGGLGLNTEYHGAALQCGDTGIYF
FT                   GMKAPILQTEEGQIKNSYSIAAGLDFPSVGPEHAYLKKINRVKYVSVSDQDAIYAFQQL
FT                   SIHEGIIPALESAHALAYALKIINQNPNKKQILIVNLSGRGDKDIITVNNQIHNKEKLT
FT                   "
FT   gene            482006..482824
FT                   /gene="trpA"
FT                   /locus_tag="BVAF_432"
FT   CDS_pept        482006..482824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="BVAF_432"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_432"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33821"
FT                   /db_xref="GOA:E8Q6C7"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6C7"
FT                   /protein_id="ADV33821.1"
FT                   /translation="MNRYQKLFTNLHQQKLGAFVPFITVGDPDPDSFINIIDTLIEAGA
FT                   DALELGIPFSDPLSDGPAIQKSMERAFKSGINFFLCLKLINDIRSKYPHLPIGLLIYAN
FT                   LIMKHGIKNFYCNCSKLNIDSVLIPDLPIEESSLFYKTAMYYKIAHIFICPPNANFNLI
FT                   KQITNQGQGYIYLLSRPGITGINNDEFNITVLNMLIQHIKQQKRVLPILQGFGIHTPDQ
FT                   AHQSLLSGTSGVIIGSAIANIIEDNLSSNPIILLTQLKKLTHLIKISMKL"
FT   gene            complement(483547..484287)
FT                   /gene="tonB"
FT                   /locus_tag="BVAF_433"
FT   CDS_pept        complement(483547..484287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="BVAF_433"
FT                   /product="TonB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_433"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33822"
FT                   /db_xref="GOA:E8Q6C8"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6C8"
FT                   /protein_id="ADV33822.1"
FT                   /translation="MFNTISKVIFLKLITSVFFSIILSCSLHVFFIIILFMFHNIYYET
FT                   GKHVTFCKKKYPYMITILSSSKDVKPSKMLPNHRKLLKSSKPLPVSSQRLESKVLSFLE
FT                   NQTPNNSENIMVNIKNNVYLDRKNDVEACDNNYGVKTTDIDNSTNNIIDNRVILSTSSD
FT                   LFPILYVYPEYPQNAKSLKIEGHVTVMYNIDAKGKVRKIRILSATSPGVFEKNIKFAMA
FT                   RWVYKIQKPKKDLVLTFKFLLNSA"
FT   gene            484511..486019
FT                   /gene="cls"
FT                   /locus_tag="BVAF_434"
FT   CDS_pept        484511..486019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="BVAF_434"
FT                   /product="cardiolipin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_434"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33823"
FT                   /db_xref="GOA:E8Q6C9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030840"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6C9"
FT                   /protein_id="ADV33823.1"
FT                   /translation="MELTNKYVILIIYNIFNYSVICGYWGLTILVTIRVLLKRRTVPSF
FT                   MAWLLMIYTLPLIGIITYLLFGEPNLGKKRLTKSKIVWSSSIFHINKLKNYYKNIFPKQ
FT                   KSDIASSVFTLCKHRQGIGALQGNQIQLFNKIDDTLISLIQDIELAQHRIDMIFYIWEP
FT                   GGLVDYISKKLIIAAQRGVKCRLILDSVGCINFFNSSYPKILQQAGINIVKALHISLLH
FT                   IFLRRMDLRQHRKMILIDSHIAYTGSMNMVDPNLFKKHIGIGEWIDIMLRIDGPVTSAM
FT                   GIIFAFDWEMETGEHIMPLLLNTPYLTTKKNLIPKSTKNQHTIQIIPSGPGFPEGIIHQ
FT                   VLITLLYKAQKQLIITTPYLIPSDDLLYALCSAAQRGVKVHIIIPQNNDSILVNWASRA
FT                   FFSELLDAGVFIHQFQTGLLHVKSISIDQKISLIGTVNLDIRSLWLNFEITLLIDSKSF
FT                   SNDLNKIQQDYIAHSKLIDPKVWANRPYWKQIVERLFYLLSPLL"
FT   gene            complement(486297..486902)
FT                   /gene="tdk"
FT                   /locus_tag="BVAF_435"
FT   CDS_pept        complement(486297..486902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="BVAF_435"
FT                   /product="thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_435"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33824"
FT                   /db_xref="GOA:E8Q6D0"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6D0"
FT                   /protein_id="ADV33824.1"
FT                   /translation="MAKLYFYYSAMNAGKTTALLQSSYNYQERGMHTLLYTAQSGSEKI
FT                   AYKSIQSRVGLTAYAKIISDNTNLFEQISAILHKKIIHCVLVDECHFLSRNQVLNLTEV
FT                   VDILNIPVLCYGLRTDFRSELFSGSLWLLAWADKLIELKTVCYCGRQANRVLRVDNQGV
FT                   VIKEGNQIMIGSNKHYISVCRKHFSEKFQSTLPVLQLK"
FT   gene            488188..489012
FT                   /gene="xthA"
FT                   /locus_tag="BVAF_436"
FT   CDS_pept        488188..489012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="BVAF_436"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_436"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33825"
FT                   /db_xref="GOA:E8Q6D1"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6D1"
FT                   /protein_id="ADV33825.1"
FT                   /translation="MRFVSFNINGLRARTHQLDQLINKLQPDVLGLQETKVHNDLFPIK
FT                   KIKKYGYHVYYDGQKQYHGVALFLKKLPLIVTRGFPLNPCPYQKRIITAQITTSIGSLT
FT                   VINGYFPQGENNQSEKFIYKKQFYQNLKNYIQNNYSNESLLLIMGDMNISPTDLDVGIG
FT                   KKNTDRWIKMGKCAFLPEERQWITDLMNWGLIDIYRSKYPYQNNRYSWFSYQSNGFKNN
FT                   RGLRIDLVLVTQPLAHLCTCSGINYDIRNMTHPSDHAPIWVDLDIEYDVSTK"
FT   gene            489112..490971
FT                   /gene="sppA"
FT                   /locus_tag="BVAF_437"
FT   CDS_pept        489112..490971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="BVAF_437"
FT                   /product="signal peptide peptidase SppA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_437"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33826"
FT                   /db_xref="GOA:E8Q6D2"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6D2"
FT                   /protein_id="ADV33826.1"
FT                   /translation="MKIAWNLICKIFKSGINVLNIIRITILNILLLIFIIIGISIYFHI
FT                   KNTKNTTSPSALILNLTGIIVDKPTTYTKFQKFSKQLFNINQSHIQENSLFEIIHILRQ
FT                   AKNDTNITGLILLLKNFSGGSQSSLEYIGKALYEFKNTGKPIYAISDHYDQIQYLLASY
FT                   ANKIYITPQGEVNLRGISTHKLYYQSLLKNLKINTHVFRVGSYKSAIEPFTRDNMSPQV
FT                   RDEENIWIHQLWDQYLKIISLNRNITTQQIFPGINKIIDELYEMQGDTAYYALQKKWVD
FT                   EISSYSDIENTMKKTFGTNKNNTSFNSISIYDYNLKPPITKNNNNQIAIICIQGTIIHG
FT                   NNDIAGSTGGDTIVRKIRNARFNPKIKAIILRVNSPGGSVHASELIRQEIIATRNSGKP
FT                   IIVSMGNIAASGGYWISTPANFIIASNSTLTGSIGVFGIINTFEDSLDTIGVHSDEVNT
FT                   SPVANLSIAKALPNEFKNMMQLYVNTSYQYFIKTVAKFRCKTITDIDRVAQGHIWLGYD
FT                   AIKNGLIDKIGDFDDAINKAAELAHLTEYQLNWHEDKINWINIIIQQTNKIVFYAITNL
FT                   LNHYIVLNNLEKFIKIHYTADNHFTWNDPKNCYAICCNYVSYH"
FT   gene            491212..492222
FT                   /gene="gap"
FT                   /locus_tag="BVAF_438"
FT   CDS_pept        491212..492222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="BVAF_438"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_438"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33827"
FT                   /db_xref="GOA:E8Q6D3"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6D3"
FT                   /protein_id="ADV33827.1"
FT                   /translation="MITKIGINGFGRIGRIVFRAAQEREDVNIVAINDVLDIEHIKYML
FT                   KYDSTHGKFNGDIKSFNDYLLINDKIVYYTSEKNPINLHWKKFKVDVVIESTGIFLTKT
FT                   DAQNHIQAGAKKVILTAPPKDNIPMFVMGVNNHLYQGDAILSNASCTTNCLAPIAKVIH
FT                   DNFGIIEGFMTTIHSVTSTQKTVDSPVYKDWRSGRGAYQNIIPSSTGAAQALGKIIKEL
FT                   DGKLTGMAFRVPTSNVSVIDLTVRLKKSVSYNNICDAIKFASENNFKNIIGYIDENVVS
FT                   SDFNGEKLTSIFDAKASMLLNNHFIKLISWYDNETGYSNKVLDLSVYIMKYQINH"
FT   gene            492458..492991
FT                   /gene="dsbB"
FT                   /locus_tag="BVAF_439"
FT   CDS_pept        492458..492991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="BVAF_439"
FT                   /product="Disulfide bond formation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_439"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33828"
FT                   /db_xref="GOA:E8Q704"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q704"
FT                   /protein_id="ADV33828.1"
FT                   /translation="MLYNFYIYSKSRKCWITLIYSIIGLISVALFEQYFLMLKPCVLCI
FT                   YQRCALIGIAISGIIALISPNRFLFRVIAIIIWTYSAYKGLYFSIKHITTILYSSPFFT
FT                   CDLIVSFPEWLPLNKWLPIMFKANGEDCSIHTWNFFLLNIHHWMFLIFISYLFVVICII
FT                   IAHFMRIYKHHYIL"
FT   gene            493110..493820
FT                   /gene="minC"
FT                   /locus_tag="BVAF_440"
FT   CDS_pept        493110..493820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="BVAF_440"
FT                   /product="septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_440"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33829"
FT                   /db_xref="GOA:E8Q705"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q705"
FT                   /protein_id="ADV33829.1"
FT                   /translation="MSKVISIDLQGSNFTLLVMHAHTTCMPKIRLALIRKIKESPNFFT
FT                   TNTPIIINVANINQSSDWLKLYQTVSEVGLLIMGVCCCYNNQLKKTITKSRIPILTKGT
FT                   NIINYNKNYNSKIVEYHNYSVLTFKTQIIYTPIRSGQQIYARNRDLVVIANVSSGAEII
FT                   SDGNIHIYGAMRGRVLAGASGHEESQIFCSNLSPELVSIGGHYWLIDQIPQEFLGKSAR
FT                   FYLKNNALVIQHIV"
FT   gene            493832..494656
FT                   /gene="minD"
FT                   /locus_tag="BVAF_441"
FT   CDS_pept        493832..494656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="BVAF_441"
FT                   /product="septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_441"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33830"
FT                   /db_xref="GOA:E8Q706"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q706"
FT                   /protein_id="ADV33830.1"
FT                   /translation="MTRIIVITSGKGGVGKTTSSAAIATGLAMYGHKTVVIDFDIGLRN
FT                   LDLIMGCERRVVYDFINVIQGEATLNQALIKDKHTHTNCLYILPASQTRDKSALTRIGI
FT                   ENIFNHLINKMNFDFIICDSPAGIDSGALMALYFADEAIIVTNPEISSVHDSDRILGIL
FT                   SSKSKRAENSSENIKEHLLLTRYSPNKVKQGNMLNLTDVIDILRIPLLGVIPEDSLVLK
FT                   ASNQGTPIILDNLSYAGQAYLDTTNRLLGKSCPLRFIKEKKQGFLKRFFKKR"
FT   gene            494663..494929
FT                   /gene="minE"
FT                   /locus_tag="BVAF_442"
FT   CDS_pept        494663..494929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="BVAF_442"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_442"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33831"
FT                   /db_xref="GOA:E8Q707"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q707"
FT                   /protein_id="ADV33831.1"
FT                   /translation="MIILINFFTRKKKLSTANIAKERLHIIIDEHRIKNKFELNSLPKF
FT                   KHELLEIIHKYIQKPQIISIKLKKHDENTSVLKVNILLSNKKI"
FT   gene            complement(495021..495692)
FT                   /gene="yeaZ"
FT                   /locus_tag="BVAF_443"
FT   CDS_pept        complement(495021..495692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaZ"
FT                   /locus_tag="BVAF_443"
FT                   /product="glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_443"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33832"
FT                   /db_xref="GOA:E8Q708"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q708"
FT                   /protein_id="ADV33832.1"
FT                   /translation="MTVRILAFNTVTELCSVAIMVGEKIYDYSILAPQSHDKKILFIIN
FT                   QLLIDSGVSLKSLDCIVFDQGPGNFIGVRIGISVAQGLAVGADLPLVAVSSLAVLAHKA
FT                   WRIFCIKNIIAMIDARMNKLFWARYLYNDFNNIWIRKDDDGFITLSVAQNIISNTLSGE
FT                   WMIVGTGWNNHQQLQCCIDKSDKIILKKVMLPEAHDMLLLGINSWNINNILTPDQIRPI
FT                   Y"
FT   gene            496011..497393
FT                   /gene="pabB"
FT                   /locus_tag="BVAF_444"
FT   CDS_pept        496011..497393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BVAF_444"
FT                   /product="para-aminobenzoate synthase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_444"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33833"
FT                   /db_xref="GOA:E8Q709"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q709"
FT                   /protein_id="ADV33833.1"
FT                   /translation="MTINLIELPYHPNATLNLFESLSNTPWSMLLYSGYENKHSEGRYD
FT                   ILVTNPVLTLLTYNDITTISSKKFHKISKEDPFLLLKKYIQTYQLQSDNNYPIPFQGGF
FT                   LGTFGYDLARRIEQLPNLSKKDIYLPDMALGLYRWAIISDHKLFKNYLVTHDHPDMTLS
FT                   WIKKQHIYHNCSHYTGSFKLLNPWKSNIDYSEYLKKIQIIKKNLISGNCYQICLAQRFL
FT                   APYIGNEWAIFRYLLNYNQVPFSAFIRLPNNSSILSFSPERFIQLKKSKIKTQPIKGTL
FT                   CKLNNKKSDKKQKLKLFQSVKNQSENLMIVDLLRNDLGKVSIPGSIYVTKLFDIQSFSK
FT                   IHHMVSTIIGILDTDNFSACDLLKACFPGGSITGAPKIQAMKLIEELEPHRRSVWSGSI
FT                   GYLSCCGNMDSNIIIRTLLSEKKYLFCFVGNGIIFDSNQELEYQEMQDKMLTLLIPILK
FT                   QN"
FT   gene            complement(497491..499068)
FT                   /gene="yoaE"
FT                   /locus_tag="BVAF_445"
FT   CDS_pept        complement(497491..499068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoaE"
FT                   /locus_tag="BVAF_445"
FT                   /product="membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_445"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33834"
FT                   /db_xref="GOA:E8Q710"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q710"
FT                   /protein_id="ADV33834.1"
FT                   /translation="MEFLTDLSMWAGFLTLVVLEVILGIDNLVFIAILADKLPKNQREH
FT                   VCIVGLTLALIMRITLLSLVSWIATLTQPLFKVIAFSFSGRDLILLFGGFFLLFKATTE
FT                   LHQQLEHKMHSRHSERGYASFWIVVIQIIVFDAIFSLDAVITAVGTVDRLSVMIIAVIV
FT                   SVIIMLSMSRLLINFVNNHQTVIVLCLSFLLIIGLSLMAEGIGFYIPKGYLYAAIGFSV
FT                   LIELLNQIAYCNFMKNQSNKSMRERTAEAIMKLMGGSSSASQWDFSEKKSSTFPLKTQF
FT                   AEEERHMITGVLSLASRSLRSIMTPRNEITWLDSQKSTQELYSVLTNTPHNMFPVCDGE
FT                   LDQLIGIVRAKDLMASISKGKPVETYAAKNLPVVVPETLDVLNLLTELRRAKGSMVIVS
FT                   NEFGVIQGLITPVDVLEAIAGEFPDEDETPEIKTIDEKSWLVKGSTDLHALQQALKTYN
FT                   LADICDHVASLAGLLLSRCDHIPKEGDILIINEWRFIIKQMIEYRIELVEVERLYRVND
FT                   VFYEPKNF"
FT   gene            499520..500494
FT                   /gene="manX"
FT                   /locus_tag="BVAF_446"
FT   CDS_pept        499520..500494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manX"
FT                   /locus_tag="BVAF_446"
FT                   /product="PTS system mannose-specific EIIAB component"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_446"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33835"
FT                   /db_xref="GOA:E8Q711"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR018455"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q711"
FT                   /protein_id="ADV33835.1"
FT                   /translation="MTIAVILSAHGSVSEKLLHTTEMIVGKQENVAWINLLPSENTDTL
FT                   IEKYNTQLSNLDINSGVLFLTDIWGGTPFNAAQQLILNHKNYDIITGMNIPMLIEVFIA
FT                   REHTHTIKKLVHIALQSGSESIKAVKNSLFSPDTKNLKKTSISTNQHNKHFNKNDKNNM
FT                   TICLIRIDDRLIHGQVVTRWAKEYKINRIIVVNDEIATDEIRKDLLTQVTPPGITAHVI
FT                   SVNKAIRVYNNPKYAKDKIIMLFSNPTDVVRLIEGGSVPIKSVNVGGMSFSTGKQQIHN
FT                   AVSVNSIDIKAFKKLDQLGIHLEIRKVPSDSPINLIKLIENIT"
FT   gene            500598..501407
FT                   /gene="manY"
FT                   /locus_tag="BVAF_447"
FT   CDS_pept        500598..501407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manY"
FT                   /locus_tag="BVAF_447"
FT                   /product="Mannose permease IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_447"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33836"
FT                   /db_xref="GOA:E8Q712"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q712"
FT                   /protein_id="ADV33836.1"
FT                   /translation="MEINTFQIILLFFTSCIVGMASILDEFQCHRPLIACTIVGLILGD
FT                   IKTGIIIGGTLEMIALGWMNIGAAVAPDAALAAIISTILVIAGKQPIGAGIALAIPLAA
FT                   AGQVLTIIVRTITVAFQHAADTVAERCNLTALSLIHITALILQAMRIAVPATIVSISMG
FT                   TEVIHRILNSIPEIITNGLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVITAFTNF
FT                   NLVALGALGIIIAILYIQLSSTHQKTEQKKYPYSTLSTENKLDNELD"
FT   gene            501420..502307
FT                   /gene="manZ"
FT                   /locus_tag="BVAF_448"
FT   CDS_pept        501420..502307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manZ"
FT                   /locus_tag="BVAF_448"
FT                   /product="mannose permease IID component"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_448"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33837"
FT                   /db_xref="GOA:E8Q713"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q713"
FT                   /protein_id="ADV33837.1"
FT                   /translation="MINNAAHNNNDNYNNKNKKQIIQLTKKDIRSVFIRSNFFQGSWNF
FT                   ERMQALGFCFAMIPVIRRLYLNNSKEQKEAIKRHLEFFNTHPYVAAPILGITMAMEEEK
FT                   ANGATAIDDASINGLKVGLMGPLAGVGDPIFWGTIRPVFAALGAGIAMTGNLLGPCIFF
FT                   IFFNTTRLITRYYGIIYGYKKGISIVKDIGKGGLLKKLTEGSSILGLFVMGALVNKWTH
FT                   VNIPFVLSSITDNEGNTTITTVQNILDQLMPGFVPLLLTFACMWLLNKKINALWIIVGF
FT                   FILSISGHWMGLLS"
FT   gene            complement(502558..502767)
FT                   /gene="cspC"
FT                   /locus_tag="BVAF_449"
FT   CDS_pept        complement(502558..502767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /locus_tag="BVAF_449"
FT                   /product="cold shock-like protein cspC"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_449"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33838"
FT                   /db_xref="GOA:E8Q714"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q714"
FT                   /protein_id="ADV33838.1"
FT                   /translation="MAKIKGQVKWFNESKGFGFITPSDGSKDVFVHFSAIQGNGFKTLS
FT                   EGQNVEFEIQDGHKGPSAVNVTTI"
FT   gene            complement(503548..505047)
FT                   /gene="zwf"
FT                   /locus_tag="BVAF_450"
FT   CDS_pept        complement(503548..505047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="BVAF_450"
FT                   /product="glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_450"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33839"
FT                   /db_xref="GOA:E8Q715"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q715"
FT                   /protein_id="ADV33839.1"
FT                   /translation="MNISFETPAEHACNLIIFGAKGDLARRKLIPALYKLEKIGFIHPD
FT                   TCILGVGRAEWDTLKYVKVIRSALEIFMREESIDENLWNRFSRRFEFCNLDINHTERFV
FT                   LLINKLKRLDLLTINYLAMPPHTFDNICKGLSSIGLNKELNRVVIEKPLGIDLDSARVI
FT                   NANVSKYFSETQIYRIDHYLGKEAVLNLLVLRFANSLCFSNWNNSTIDHIQITVAEEVG
FT                   IEGRWGYFDKIGQMRDMIQSHLLQILTIVAMSPPSCLSSDCIRDEKVKILRALRMVDPY
FT                   RIHEITVRGQYVAGFIGGKPVPGYLEEKGANQNSTTETFVSIRVNIDSWRWFGVPFYLR
FT                   TGKRLFKQYSEIVIYFKKPVLNLFSDLCSCLPNNKLIIRLQPNEGIDMQILSKVPGLGN
FT                   KNRLKPVNMNLYFNKIFSKEYVSDAYERLLLEVMRGIQVLFVHYDEVEGSWKWVDSIVK
FT                   AWEEQSSNSILNVYQAGTWGPSESTAMMLKDNRSWNEYISY"
FT   gene            505544..506995
FT                   /gene="pykA"
FT                   /locus_tag="BVAF_451"
FT   CDS_pept        505544..506995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="BVAF_451"
FT                   /product="pyruvate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_451"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33840"
FT                   /db_xref="GOA:E8Q716"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q716"
FT                   /protein_id="ADV33840.1"
FT                   /translation="MPKYLRRTKIIATLGPSTDQANNLEKIITSGVNVVRLNFSHGKPL
FT                   EHFTRANKIRALATQLKRYIAILGDLQGPKIRISTFQNDKVYLKSGDNFLLDSMNQDNK
FT                   GTQTYVGVNYKKLSQDVSPGDYLLLDDGKIQLQVIKINNTKIFTKVIIGGILSNNKGIN
FT                   KLGGGLSAKVLTDKDKTDIITAAKIGVDYLAISFPRSSIDLNYARKLVIDAGSNAKIIS
FT                   KVERAEAVKSDETIDDIIKASDAVMVARGDLGIEIGDPKLVEIQKKIIYRAHALNKAVI
FT                   TATQMMESMVTNSIPTRAEVMDVANAVLDGTDAVMLSSETATGLYPSETVTAMSNVCLG
FT                   AEKISNIDQPSISLNKPKKKITNVKEAVASSTMYIANHLDTIRAVISITDSEYTALLMS
FT                   RINSKLPIFVLSHDINTLNIVTLYRGVIPIYFSHTGNNIIDARHASNLLRDKGFVIPGE
FT                   LVIVIQDNILNQSNVTNMSYILAVE"
FT   gene            complement(507138..508514)
FT                   /gene="yebA"
FT                   /locus_tag="BVAF_452"
FT   CDS_pept        complement(507138..508514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebA"
FT                   /locus_tag="BVAF_452"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_452"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33841"
FT                   /db_xref="GOA:E8Q717"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q717"
FT                   /protein_id="ADV33841.1"
FT                   /translation="MYGIVCNSIKLICRCLYKRYSIIVPFVFIIIIIIMIVWNMFLLSY
FT                   EFNKNDYNQIIAVQKSTLCSFFKTINNNTYVEDNLFFLNILKKQVSQEQSLKIFSMNDY
FT                   SRLFSNNTLTQFVEKYNRNLVNIDEVYLLTQQYPVLDKLRIGQSLLWLIVNQKRLQCLI
FT                   WGVSEQEIRLYNKKMNAYFNQGIIKVLKKNSNEKKQCYTVLFSGSLHETFVDSARSLGL
FT                   EENCIVDVVNALRYQLDFKKLHSGDKFALLVSLIFDIKNNNIYSELIGARVRTAGQDYY
FT                   IFKANNGRFYNKEAVGSINKFIRLPILKPYRISSNFNMNRLNPVTGQVTQHVGVDFAVP
FT                   VGTPVLSIGDGVVLSSKYSKIAGNYVVIKHDFQCITRYMHLKKILVKSGQRVSRGDSIA
FT                   LSGNTGRSTGPHLHFEVWINRQPVNPLTTSILNVEKLLGNDRIKYLKQINEIIPKLNFD
FT                   "
FT   gene            complement(508810..510540)
FT                   /gene="aspS"
FT                   /locus_tag="BVAF_453"
FT   CDS_pept        complement(508810..510540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="BVAF_453"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_453"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33842"
FT                   /db_xref="GOA:E8Q718"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q718"
FT                   /protein_id="ADV33842.1"
FT                   /translation="MRTAYCGQLNSAHIGLEITLCGWISKLRNLGKLMFIELRDREGSI
FT                   QVCFDPNFQQEVCKNASISLKQEFCIQLRGIVRARPITQINKNMLTGMIEIVAKFFVIL
FT                   NVSEPLPLDITKNNTEENRLKYRYLDLRRPIMLLNIKTRSRVMSLTHRFMELEGFFNID
FT                   TPILTKSTPEGARDYLVPSRLHIDKKYALPQSPQIFKQLLMIAGFDRYYQITKCFRDED
FT                   LRSDRQPEFTQIDMEASFIDAKRIRELMEFFICTVWREILNIELGVFPQISYFDSMRRF
FT                   GSDTPDLRNPIEIVDVSDFFRSIWNQFLLNKIMIDIAVNQVIVMKIPNGYFLTDKQINK
FT                   YEDYIRRCGIQNFYWIKAQCNDQKEIVKVDGPIVKFLNKIILKALFKKINFKHNGVLFF
FT                   VFGNNKNLFITKILGSLRQKIGSDLNLIKKDTWAPLWVVNFPVFKKNELGSLIPVHHMF
FT                   TAPKNCDIEFLKNNPLLAVSEAYDMVINGYEIGSGSVRIHSYLLQQTIFDILGISRSTQ
FT                   QKKFGCLMNALKYGAPPHAGLAFGLDRLLMLLTGSKSIRDVIAFPKTTSAIDLMVDAPD
FT                   "
FT   gene            510945..512693
FT                   /gene="argS"
FT                   /locus_tag="BVAF_454"
FT   CDS_pept        510945..512693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="BVAF_454"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_454"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33843"
FT                   /db_xref="GOA:E8Q719"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q719"
FT                   /protein_id="ADV33843.1"
FT                   /translation="MNIQNLLLQHLYQALLKINAESFFHLIKIHISTHKQFGDYQINGL
FT                   IPISKLLNISVENFSKKLIKFINLQHMVEIIKFEQPGFINIFLSSTWIENQINYIGNLP
FT                   NFGIYSKQQKTIIIDYSGPNIAKEMHVGHLRSTVIGDSTARILSFLGHHVIKANHIGDW
FT                   GTQFGMLIAYIHKQIPHNFSLNKIQSFDVLEKYYQEAKKIYDIDPNFAKLARHYVVKLQ
FT                   QGDGYCKKIWQHLVNISVSNNQKLYNRLNITLKKSDIMGESMYQNMLPHIVRDLKNKKI
FT                   AVTSNNATVVFLNKDQKNEYYSSFGVIIQKKDGGYLYSTTDIACIKYRCEILHADRIIY
FT                   YTDSRQKQHLLQAWKIAHKAGYIPKSVSFEHHICGMILQKNRKPFQTRAGNVLKLTTLL
FT                   NEAFKKAHDLIYRKNPNLEDIKLNKLAHIISIGAIKYTELSKNRSTNYIFNWDTMLNFN
FT                   GNTALYIQYAYTRIFSILKKTGQPNLKKNKYKIQIITKKEKLLATCLLQFNEIIEIIAD
FT                   QGTPHLLCNYLYKLSALFSSFYESYPILETKNIHLQHSRLKLSLFTAHILKQGLELLGI
FT                   ETSEYM"
FT   gene            complement(512704..514266)
FT                   /gene="mviN"
FT                   /locus_tag="BVAF_455"
FT   CDS_pept        complement(512704..514266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="BVAF_455"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_455"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33844"
FT                   /db_xref="GOA:E8Q720"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q720"
FT                   /protein_id="ADV33844.1"
FT                   /translation="MNLLKPLIRVSFITTFSRVLGFIRDNIIARTFGASIMTDAFFVAF
FT                   KLSNFLRRIFAEGACYQIFLPILSEYKCFFDIKEIKTFISRAFGLLIIILIIIIFFGLL
FT                   LAPWIIRIAVPGFDNISEKFDTTVLLFRIMIPYILLISLASFMGATLNTWNFFLVPAFI
FT                   PIFLNISMIGFMLCSKYLYLCTPIVGLSWSVFVGGLLQCIYCLPFLKKVNLLVCPTVNL
FT                   HDNRIHRICRSAGLMLVAVLSNQISLTINTIFASFLPDGSISWIYYADRIIELPIGIFG
FT                   VTLTTVLLPCLSRFIAIGSSVEYFNLINWGLKLCCVLSFPSAVILGVLSKPLIITLFQY
FT                   GKFSGFDVLMTQYSVIAYSIGLPGLILTKVLTAGFYSRHDIQTPIRMIIITVVFSQFIN
FT                   MMFIHILKHVAFACSISLGAWLNAGLLFWQFKKKYLFRLSSGWLHFLCKLVIALCFMYI
FT                   AIFFMQLLIYGNGEGWVINHMFYRLLKIISILILGISSYLAILKLLGFRVKDFFWFHRD
FT                   TTN"
FT   gene            514786..516033
FT                   /gene="mdtH"
FT                   /gene_synonym="yceL"
FT                   /locus_tag="BVAF_456"
FT   CDS_pept        514786..516033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdtH"
FT                   /gene_synonym="yceL"
FT                   /locus_tag="BVAF_456"
FT                   /product="Multidrug resistance protein mdtH"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_456"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33845"
FT                   /db_xref="GOA:E8Q721"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR022855"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q721"
FT                   /protein_id="ADV33845.1"
FT                   /translation="MHSTSKARRLGKYFLIIDNMFVVIGFYAVFPLISIYFVEQLGWAA
FT                   FLVGFALGLRQFIQQGLGIFGGAFADKLGAKPMIVSGLLMRTVGFIIMSIAQTPILLCL
FT                   SCILSALGGTLFDPPRTALVIKLIRPWELGRFYSILMLEDSVCAIIGITLGTWLLQYNF
FT                   KLVCFTGAILFFIAGIFNAWGLPDYKISSSHLSLLDGIKKVLNNQRFVIYALTLTGYYI
FT                   LSAQMMLMLPIRVHEISGQLSCIKYIYIIEAILSLLFIIPITYWAEKYFRLETRLMMGL
FT                   IIMIISLFPIGLVKNLYELLLLVSLFYIGSIIAEPARETLIALFTDYKARSSYIGFNKF
FT                   SLALGGTLGYSGSGWLYDLGKKLNFLQLPWIALSVIGIITLLGLYYQFRYYSFQFSLLN
FT                   KKNCTYTHNKSIRKKN"
FT   gene            516261..516352
FT                   /locus_tag="BVAF_457"
FT   tRNA            516261..516352
FT                   /locus_tag="BVAF_457"
FT                   /product="tRNA-Ser"
FT   gene            complement(516638..516729)
FT                   /locus_tag="BVAF_458"
FT   tRNA            complement(516638..516729)
FT                   /locus_tag="BVAF_458"
FT                   /product="tRNA-Ser"
FT   gene            516889..516964
FT                   /locus_tag="BVAF_459"
FT   tRNA            516889..516964
FT                   /locus_tag="BVAF_459"
FT                   /product="tRNA-Asn"
FT   gene            complement(517003..517980)
FT                   /gene="gutQ"
FT                   /locus_tag="BVAF_460"
FT   CDS_pept        complement(517003..517980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gutQ"
FT                   /locus_tag="BVAF_460"
FT                   /product="arabinose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_460"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33846"
FT                   /db_xref="GOA:E8Q722"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q722"
FT                   /protein_id="ADV33846.1"
FT                   /translation="MINDRLLLEYAKETIKIEINEALHMLDRLDESIVVACQILLRCEG
FT                   KVIVSGIGKSGHIGKKLAASLSSTGTPAFFMHPSEALHGDLGMIESKDVVIFISYSGRS
FT                   YEISLLIPVLIENNIPIIALTGNSNSPLAVQSNCVLNIQIQREACPMELVPTSSAVNAL
FT                   MMGDALTMSLMRYKGFSIEKFAQFHPGGTLGAQLLNCVHHVMRIGNKISKVFWKSTVMD
FT                   AMFELLRTGLGLTAVCDDNQYVIGVFTDEDLRRWIIQQDKSLKDSICIAMTKPGHYVAQ
FT                   ECRVDEAIKILYKLNITAAPVVDKSGILVGSISINDLYKVKIIE"
FT   gene            complement(518319..518651)
FT                   /gene="yeeX"
FT                   /locus_tag="BVAF_461"
FT   CDS_pept        complement(518319..518651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeX"
FT                   /locus_tag="BVAF_461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_461"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33847"
FT                   /db_xref="InterPro:IPR007458"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q723"
FT                   /protein_id="ADV33847.1"
FT                   /translation="MSQDSIDKSFYDVLEFVRMLRRKNKLQREIIDNEKKIRDNQKRVL
FT                   LLGDLSNYIKSETSIDGIQAIIINMCNDYEDRVDEYIIKNAELSKERRELSKKLKYLKK
FT                   SYDDSE"
FT   gene            518921..520396
FT                   /gene="sbcB"
FT                   /locus_tag="BVAF_462"
FT   CDS_pept        518921..520396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcB"
FT                   /locus_tag="BVAF_462"
FT                   /product="exodeoxyribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_462"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33848"
FT                   /db_xref="GOA:E8Q724"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR013620"
FT                   /db_xref="InterPro:IPR023607"
FT                   /db_xref="InterPro:IPR034747"
FT                   /db_xref="InterPro:IPR034748"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038649"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q724"
FT                   /protein_id="ADV33848.1"
FT                   /translation="MTLLQNQPNFFIYDYETFGLNPALDRPAQFAGIRVDDKLCPIAKK
FT                   EIFFCQIPHDYLPNPESVLTTGITPQYTLQYGLTESEFAYRIFNIFNKPNTCIVGYNNI
FT                   NFDDEFTRHTFYRNFCDPYLWAYNHGNSRWDLLPILRAYYSLYPEKIYWPINNKNKISF
FT                   RLIDLTYANHIEHLNVHDAMSDVYATLEIMKLTQKTHPYFFQFLYNHRTKDQLKKIINF
FT                   DFIDPLIFISNTINDTYNNFIKFLAPISWHPNNKNILIAYDLNSKPDLLLNLNINKLYQ
FT                   NLYQGTQNLSDLFKQIPLQLIKLNSCPILIPIHLIKKENIFYYKNSLFSYYQYCLKNLN
FT                   FIQTNINHTYLKNKIKTFYTTIESYFKLKQTYQKVHVDNQLYFKFFNFSDRQLINKIRN
FT                   TNIQQLSKIKINSTDTRLKLLFFFYKARNFPYSLNVKEQKSWLDYKRLLLQQSKFQNYL
FT                   TNIDNLLLHQNNLIQINLLHKLKQYYKHYLNTI"
FT   gene            520698..521597
FT                   /gene="hisG"
FT                   /locus_tag="BVAF_463"
FT   CDS_pept        520698..521597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="BVAF_463"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_463"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33849"
FT                   /db_xref="GOA:E8Q725"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q725"
FT                   /protein_id="ADV33849.1"
FT                   /translation="MLNKSRLRIAMQKSGRLSKESKQLLERCGIKINLQQQRLLAFAEN
FT                   MTIDIMRVRDDDIPGLIMDGVVDLGIIGENVLEEELLTRRSQGENPCYIRLRRLDFGDC
FT                   RLSMALPVDDPWDGPLCLQGKRIATSYPNLLKQYLDKLGVYFKPCLLNGSVEVAPRAGL
FT                   ADAICDLVSTGATLEANGLREVEVIYRSKACLIQRPGQLSYMKQTLVNKLLIRIQGVIQ
FT                   ARESKYIMLHAPAERLEEIINLLPGAESPTVLPLAGNQDRVAIYMVSNETLFWETMEKL
FT                   KHLGASSILVLPIEKMME"
FT   gene            521603..522916
FT                   /gene="hisD"
FT                   /locus_tag="BVAF_464"
FT   CDS_pept        521603..522916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="BVAF_464"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_464"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33850"
FT                   /db_xref="GOA:E8Q726"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q726"
FT                   /protein_id="ADV33850.1"
FT                   /translation="MNFDNYLIPIYWDHCSLSEKKILLTRPVHKNKNKDIYSNVKHILD
FT                   QVSQYGDSALIQFNLYFDCIQTKYLKIPSQTINNSKKYLSNKTKQAICSAFNNIHQFHQ
FT                   KQYFSEIDLEPIPGVHCTQIIRPLNKVGLYVPGGTTPLPSTVMMLGIPAQIAKCKRVIL
FT                   CSPPPISNIILYTAQLCNITEIYQVGGSQAIAAMGFGTQSIPKVNKIFGPGNIWVTEAK
FT                   RQINYRTTDVAIDMLAGPSEILIIADETANPIFIAADLLSQAEHGPDSHVILITPNINI
FT                   ATQTRNEIYNQIKNLSRIDIINNSLKHGCIIITNNIIECFDISNDYAPEHLLIHIKNAN
FT                   NYLKYITNAGSIFLGNWSPESAGDYASGPNHVLPTYGSSANTSGLGVTDFQKKISVQEL
FT                   TQNGLIKLSKTIITLAQIEQLKAHEYAITHRVNYIKRK"
FT   gene            522918..523988
FT                   /gene="hisC"
FT                   /locus_tag="BVAF_465"
FT   CDS_pept        522918..523988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="BVAF_465"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_465"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33851"
FT                   /db_xref="GOA:E8Q727"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q727"
FT                   /protein_id="ADV33851.1"
FT                   /translation="MNIHCLVRNQILTLQPYQSARKFEYSGKIWLNANEHPIAPHYKYS
FT                   NTNNLNRYPMCQPKELIHNYATYSGVQNNQVLVSRGSDEGIELLMKVFCDPNKDTIIFC
FT                   PPTYGMYKTSAEILGINYRMIPTINNWQLNLSSIASQLNHVKLIYICHPNNPTGNIINI
FT                   NSIIKLLKIVENKALLIIDEAYIDFCSNNSLVKLLSIHPNLIILRTLSKAFALAGLRCG
FT                   FTLANAEIIKLLKKVIAPYPIPTPVIDIATQALTPEGIKYTQIRIKQIHNNRHILIEGL
FT                   KRCSCVQTIFPSCTNYILVKFTPKYQVFKKLLQQGIILRDQSYQWGLTNCLRITIGSYE
FT                   ECQQIISILQNEQFYT"
FT   gene            524011..525087
FT                   /gene="hisB"
FT                   /locus_tag="BVAF_466"
FT   CDS_pept        524011..525087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="BVAF_466"
FT                   /product="histidine biosynthesis bifunctional protein hisB"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_466"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33852"
FT                   /db_xref="GOA:E8Q728"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR005954"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020566"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q728"
FT                   /protein_id="ADV33852.1"
FT                   /translation="MNDNKILFIDRDGTLIHEPENNFQIDSLEKLSLEPYVIPVLTTLK
FT                   NIGFKFIIVTNQNGLGSLTFPYNKFNKPHQTMIQIFKSQGIIFDQILICPHLPEAQCNC
FT                   RKPNIGLVSKWLKNKLLNKFNSYVIGDRDTDMQLATNMGIQGIQYHQKNFNWIQVQNHI
FT                   TQNSYRSAHIQRITNETNVDIKIWLDQYKKNYINTGINFFNHMLEQIAIHAKIRIHIIV
FT                   QGDLHIDDHHTIEDTASVLGEAIKKSLGEKKGIGRFGFTLPMDECTAHCILDLSGRAYL
FT                   DYQAQYDFQKIGDLSSNMIEHFFRSLSLKMECTLHLKAHGKNDHHKAESLFKAFGQTLR
FT                   QAIHIYDNHVLSSKGTLI"
FT   gene            525084..525674
FT                   /gene="hisH"
FT                   /locus_tag="BVAF_467"
FT   CDS_pept        525084..525674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="BVAF_467"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_467"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33853"
FT                   /db_xref="GOA:E8Q729"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q729"
FT                   /protein_id="ADV33853.1"
FT                   /translation="MKIVIIDTKCSNLFSVKTILKRLGCNPKITNNPDIILKANKLFLP
FT                   GVGTAFTAMQQLEKTNLVQLIKNCTQPILGICLGMQLFGSISEENDNIKTLGIINTPVI
FT                   RIKYKKLSVPHMGWNNIIFLKKHPLFHGIKNNHFFYFAHSYIMKLTQSTIAYTKYGELF
FT                   SAAIAYKNFLGVQFHPEKSSAPGKQLLKNFLEM"
FT   gene            525678..526439
FT                   /gene="hisA"
FT                   /locus_tag="BVAF_468"
FT   CDS_pept        525678..526439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="BVAF_468"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_468"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33854"
FT                   /db_xref="GOA:E8Q730"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q730"
FT                   /protein_id="ADV33854.1"
FT                   /translation="MIIPALDIINGNAVRLYQGNYQAQSNYGDPVNILQKYIQQGATII
FT                   HLVDLSGAKNPKNKQTSLINKLIQKTKKSDSKVKIQIGGGIRSALDIKNLLKSGANRII
FT                   LGSIAITHPKETKKWFTYFDPDILVLALDVYIDFNKNKKIAIHGWQKKTDIQLEQVIQE
FT                   YNLVGLKHVLCTDILRDGALLGSNINLYKSICQIWPNIFFQASGGTIQLTEIFKLKQAG
FT                   VNSIIIGRALLENKFTLNEAISCWQNASSLV"
FT   gene            526409..527185
FT                   /gene="hisF"
FT                   /locus_tag="BVAF_469"
FT   CDS_pept        526409..527185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="BVAF_469"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_469"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33855"
FT                   /db_xref="GOA:E8Q731"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q731"
FT                   /protein_id="ADV33855.1"
FT                   /translation="MLAKRIIPCLDVKNNQVIKGVQFRNHEIVGDIVSLAQHYAKSGAD
FT                   ELVFYDISASPYNKIVDKKWILKVAKVIDIPFCVAGGINTITQAKQILKFGADKISINS
FT                   PALMNPSLIQDLAEHLGTQCVVVGVDIWFNSTENIYQVKCFSGDSHHMKSTPWKVLDWI
FT                   KKIQEYGAGEIVLNIMNQDGMKNGYDLHQLLEIRKHCKIPLIASGGAGSFQHFLDVFNY
FT                   SKVDGALAASVFHKNIIKITELKKFLFKKGVKVRLC"
FT   gene            527179..527838
FT                   /gene="hisI"
FT                   /locus_tag="BVAF_470"
FT   CDS_pept        527179..527838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="BVAF_470"
FT                   /product="histidine biosynthesis bifunctional protein
FT                   hisIE"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_470"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33856"
FT                   /db_xref="GOA:E8Q732"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q732"
FT                   /protein_id="ADV33856.1"
FT                   /translation="MLNNNDKQHELNWIKNNGLIPAIIQHSVSGEILMLGYMNKQSMSE
FT                   TEKTGYVTFFSRSKNRLWVKGETSGNLLKFINWYPDCDSDSLLILVLPQGYTCHKNTSS
FT                   CFYPASTDFSFLYQLENIISMKKKHNYALTQNQKELSSYTSDLYSNGIERIAQKVGEEG
FT                   LETALAAVSRNSTALVNEAADLIYHLLVLLQHESLTFNKIIQELKNRNKLKNKKIN"
FT   gene            complement(528091..529518)
FT                   /gene="gnd"
FT                   /locus_tag="BVAF_471"
FT   CDS_pept        complement(528091..529518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="BVAF_471"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_471"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33857"
FT                   /db_xref="GOA:E8Q733"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q733"
FT                   /protein_id="ADV33857.1"
FT                   /translation="MLKKQEIGVVGMGTMGRNLALNIESKGYNVAIYNRSSGKTTQIIQ
FT                   NNLKKNLTPYFSLEKFVCALQKPRLIFLMITSGSCVDYLIQSLLNYVDDGDVLIDGGNS
FT                   FYKDTIRRSLKLLEKKIHFIGLGISGGEEGALKGPSLMPGGSKDAYDIISCLLKKIAAR
FT                   IDNEACVEYIGPNGSGHYVKMVHNGIEYGDMQIISEIYCFLKQVLCLTYSQLIKVFNSW
FT                   NQGELNSYLMDITTKIFMKKDEETNLPVLEYILDVAGNKGTGAWSTKDALDLEIPVTMI
FT                   TEAVFARYLSMLKEQRVKASTILLSPINNNVNIFTESVDNWIEKARQALYLSKIILYTQ
FT                   GFYQLRVSSIHNNWNLNFEKIAKIFRSGCIIRSKFLQNIIDIYSITPGIENLLLAPYCV
FT                   NIANKYQQSLREIVSCGISYGIAMPALSSAISYYDSYRSAKLPANLIQAQRDYFGAHTY
FT                   CRLDKPGVFHTQWSYLD"
FT   gene            529879..531528
FT                   /gene="metG"
FT                   /locus_tag="BVAF_472"
FT   CDS_pept        529879..531528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="BVAF_472"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_472"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33858"
FT                   /db_xref="GOA:E8Q734"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q734"
FT                   /protein_id="ADV33858.1"
FT                   /translation="MSNKKILVTCALPYANNSLHIGHMLEHIQADIWVRYQRMQNNTVY
FT                   FICADDAHGTAIMLKAQQLNINPKIMISNIQKEHYKNCYDFNISYDNYHSTHSKENREL
FT                   LYEIYLKLKNNGLIKTRFISQLYDSKKKIFLPDRFIIGTCPKCHTSNQYGDNCEQCGAI
FT                   YTPMELIDPKSVISGTTPITKKSKHFFFNLPIFTKMLQHWVYSGVLQQEILNKIEEWFK
FT                   LGLKEWDISRDSPYFGFKIPNTGSKYFYVWMDATIGYMGTFKNLCKKNKNIFFEDFWDI
FT                   HSKNELYHFIGKDIIYFHSLFWPAILEGSQFRKPTGIFVHGHVTLNGLKISKSKGAFIK
FT                   ANTYLSYLHSDYLRYYYATKLSSKINDIDLNFNDFFNKINSDIINKILNLAARSASFIN
FT                   QYNDGQLSSKIEDPNLYNFFINFKHSIGKAFKNREFSEAMRSIMSLADEANKYIDQHSP
FT                   WHIIHQIGEIKNAVSIASMGIQLFRILMTYLKPVLPILSKYSEDFLNTHLLWNTLDTPL
FT                   INHKINKFEIIFRRINYNQIESIINSSHPHHQ"
FT   gene            complement(531829..532494)
FT                   /gene="folE"
FT                   /locus_tag="BVAF_473"
FT   CDS_pept        complement(531829..532494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BVAF_473"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_473"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33859"
FT                   /db_xref="GOA:E8Q735"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q735"
FT                   /protein_id="ADV33859.1"
FT                   /translation="MSTLTQEALLVRDALLIQGLENPVIELDIDNRIRMNQIEDHMAAI
FT                   MYLLKLNLNNDSLFHTPKRIAKMYVEEIFSGLDYSNFPKISVIKNTMKINEMITVRNIN
FT                   ITSICEHHFIIFNGKATVSYIPENSVIGLSKINKIVQFFSKRPQLQERLTQQIFLALQT
FT                   LLNTNNVAIFIDAVHYCVKARGIHDITSTTNTTALGGLFKSNENIRREFIHTITYTNS"
FT   gene            532778..533083
FT                   /gene="rplY"
FT                   /locus_tag="BVAF_474"
FT   CDS_pept        532778..533083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="BVAF_474"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_474"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33860"
FT                   /db_xref="GOA:E8Q736"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q736"
FT                   /protein_id="ADV33860.1"
FT                   /translation="MFKINAELRIAIKTAGVRRLRNQEKCPAIIYYKNKKFENLPIILN
FT                   NKDIQHPNSIIHFYKNNILKLNIQNKSIVQVQIKEIQYHPYRSKIIHIDFMCFKYN"
FT   gene            complement(533431..534561)
FT                   /gene="ddl"
FT                   /locus_tag="BVAF_475"
FT   CDS_pept        complement(533431..534561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="BVAF_475"
FT                   /product="D-alanine--D-alanine ligase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_475"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33861"
FT                   /db_xref="GOA:E8Q737"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q737"
FT                   /protein_id="ADV33861.1"
FT                   /translation="MEINFNILRVGLICGGCSTEHEVSLQSAAYIMQHIDKNLFEIVVF
FT                   WISKHGGWYIIYNDVSRNIFSDSREQKNKYIPVMIKQFSGRFVFFTDDITSALLKIDVI
FT                   FPIIHGSFGEDGSLQGLIRIMNLPYVGSSILGSSICMDKTITKRLLRDSGLPVASFKTF
FT                   SHYERSNITFVSFYNMFGLPFFIKPVNQGSSIGVSKVTNQNVFNKALDVAFAYGDKIMV
FT                   EPCIVGRELECAVLGNDDPISSVCGEIVINSNNDNGFYTYYKKYISSTTEVIIPALITN
FT                   IISDKVRHYSICAFQTLSCSGMARIDMFLTLNNQIIINEVNTLPGFTSHSMYPKLWEAT
FT                   GISPTLLLTKLITLSLERYEWEKYSFIILCIFEMIF"
FT   gene            complement(534776..535906)
FT                   /gene="omp"
FT                   /locus_tag="BVAF_476"
FT   CDS_pept        complement(534776..535906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp"
FT                   /locus_tag="BVAF_476"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_476"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33862"
FT                   /db_xref="GOA:E8Q738"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q738"
FT                   /protein_id="ADV33862.1"
FT                   /translation="MKLWCFANLIATMVIATSAFGASEIYNKNGNILNVYGNISGGQYF
FT                   SKSSNNSSSNYSFVRYGLFGETYLNGDKISGFGRWEHEFPLKNVEEGMYLADNGHALLG
FT                   YLGVKLGNFGSFDYGRNYGILHDVKSWTDFSSEFGGDTSLSDNFLSGRASNVITYRNSN
FT                   FFGLLNGLNFAVQYQGENNTNKATGRTVKTSNGEGYGISASYHLNNGMAASVVYANSNR
FT                   TFDQRSLDSDCSNEDPAEAYYVGVKYDAYGAYIAAVYGETYNMTPFGNFDEVLNPESMY
FT                   GFANKTRNVSVIAQYRFNCGLTPSISYLHSKASDLDNGYGNYLKKYVTLGSSYLFNKKI
FT                   SATMDYRLNLLVKNDFTTAAKICTDDMFAVGLSYLF"
FT   gene            complement(536407..538947)
FT                   /gene="gyrA"
FT                   /locus_tag="BVAF_477"
FT   CDS_pept        complement(536407..538947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BVAF_477"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_477"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33863"
FT                   /db_xref="GOA:E8Q739"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q739"
FT                   /protein_id="ADV33863.1"
FT                   /translation="MNDRAKEITQVYIEEELKRSYLDYAMSVIIGRALPDVRDGLKPVH
FT                   RRVLFAMQILGNYWNKNYKKSARIVGDVIGKYHPHGDSAVYDTIVRMAQPFLMRYVLID
FT                   GQGNFGSVDGDSAAAMRYTEIRMSKISNELLSDLEKETVDYEFNYDGTERIPEVLPARI
FT                   PNILINGSSGIAVGMATNIPPHNLSEVVNGCLAFIDNENITIDELMQHIPGPDFPSAAV
FT                   INDCSELKKAYETGKGKIYIRARAEINTDVKTGRESIIVYEIPYQVNKSKLLEKIAELV
FT                   KTKRIDGIHSLRDESDKDGMRVVIDIKHDAISEIVLNNLYSLTQLQVSFGINMVALHHG
FT                   QPKVMSLKDILSAFICHRRSVITRRILFELKKASNRIHVLEGLVIALSNIDIVIEVIRR
FT                   SNSAFNAGCILTSQSWRANDVTNMRKSISIDLLNSEWLDKNNFTKNNECYFTKNQARAI
FT                   LDLRLHKLTTLEHDKLLVEYDSLLKKMEKLIFTLKNKSSLMDVIRQELVSIKEEYSDIR
FT                   RTEINNTIPSIDVENLINQRDVVVTLSYQGYVKYQPLTDYEAQKRGGKGKLTTRIKEED
FT                   FITQLLIANTHDTVLLFSNYGRIYWMKVYRLPEVKRSSRGRPIINLLPLDVNERITTIL
FT                   PIQKYTKGHQVFMATSSGFVKKTALMEFSRPRNVGIIALNLNVGDELIGADVTDGNNEV
FT                   MLFTAYGKVVRFKETQVRSMGRSAVGVKGIHLLQGDRVVSLIIPKNKSSILTITKNGFG
FT                   KRTDQSEYPLKSRSTKGVISIKVTERNGNVVGAVQVSHDDQIMIITDAGRLVRIRVSEV
FT                   NIIKRNTKGVMLIRTACDEHVVGLQRVVESVDSN"
FT   gene            539202..539930
FT                   /gene="ubiG"
FT                   /locus_tag="BVAF_478"
FT   CDS_pept        539202..539930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="BVAF_478"
FT                   /product="3-demethylubiquinone-9 3-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_478"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33864"
FT                   /db_xref="GOA:E8Q740"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q740"
FT                   /protein_id="ADV33864.1"
FT                   /translation="MNKKITKNLTKNIDPKEIKRFNLSASQWWNTNGIFQSLHHINNTR
FT                   LHYIIKYSNGLHKKKILDIGCGGGILSESMARKGAKVTGLDYSSNSLNIAKKHALSHNL
FT                   IINYKLETIEQHLLNHTNHYDIITCMEVLEHVPNPLEIINACSSMIKIGGSIFFSTLNR
FT                   TLKAWLLVIIGAEYIFNLIPKGTHTLERFITPSELLDWIDITKLEANNISGIYYNPFTY
FT                   NCMITQDISVNYILHTQRTL"
FT   gene            540310..542601
FT                   /gene="nrdA"
FT                   /locus_tag="BVAF_479"
FT   CDS_pept        540310..542601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="BVAF_479"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_479"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33865"
FT                   /db_xref="GOA:E8Q741"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q741"
FT                   /protein_id="ADV33865.1"
FT                   /translation="MNQTLLVTKRDGHHEPINLEKIHRVINWAAQGLEKISVSQVELRS
FT                   HIQFYNGIKTSDIQETIIKAAADLISKEEPDYQYLAARLSVFHLRKKAYGQFEPPKLYD
FT                   HVLRLVKIGKYDKHLLNDYTHNEFEQMDTFIDHWRDMNFSYAAIKQLEGKYLVQNRVTG
FT                   EIYESAQFLYILTAACLFAKYPKNTRMDYIKKFYNAISTFKISLATPIMSGVRTPTRQF
FT                   SSCVLIECDDSLDSINATSSAIVKYVAQRAGIGINAGRIRAIGSPIRNGEAFHTGCIPF
FT                   YKHFQTAVKSCSQGGVRGGAATLFYPIWHLEIENLLVLKNNRGVESNRIRHLDYGVQIN
FT                   KLMYQRLITGKHITLFSPADVPDLYESFFSDQNLFDYLYHKYENDHKIRQLKIKAIELF
FT                   SLMMQERASTGRIYIQHTDHCNTHSPFNSALAPIRQSNLCLEITLPTKPLNNINDTNGE
FT                   IALCTLSAFNLGNLNNLDDLSELSTLIVRALDALLDYQSYPVLAAQYSAKNRRSLGIGV
FT                   INYAYYLAKHGVRYSDGSANTLTHHTFEAIQYYLLKASNLLAKEKGACAWFDDTSYAQG
FT                   ILPIDTYKKDLDYIISEPLRYNWEELRNQIKQYGLRNSTVSALMPSETSSQISNSTNGI
FT                   EPPRGYISIKASKDGILRQVVPNCEKLASNYELLWNIPNNQGYLELVGIMQKFIDQSIS
FT                   TNMNYDPSCFPESKVPIKQLLSDLLYAYKLGIKTLYYHNTRDGFSETQKKIEYNNNHQP
FT                   NTCASDACIM"
FT   gene            542648..543778
FT                   /gene="nrdB"
FT                   /locus_tag="BVAF_480"
FT   CDS_pept        542648..543778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="BVAF_480"
FT                   /product="ribonucleoside-diphosphate reductase 1 subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_480"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33866"
FT                   /db_xref="GOA:E8Q742"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q742"
FT                   /protein_id="ADV33866.1"
FT                   /translation="MMYTTFSRKKNNQLLEPMFLGQPVNIVRFDQQKHIIFEKLIEKQL
FT                   SFFWRPEEIDISKDRIDYQSLPDHEKHIFISNLKYQTLLDSIQGRSPNIALLPLISIPE
FT                   LETWVETWSFFETIHSRSYTHIIRNIVTHPSSVFDDIVTNKEILKRAKDISIYYDDLIK
FT                   LTNYYHILGPGIHTINKNIVAVNLHELKKKLYLCLISINVLEAIRFYVSFACSFAFAER
FT                   KLMEGNAKIIRFIARDESLHLSATQHILNLMQSGADDPEMAEISLMYQSESYNLFLMAA
FT                   EQEKMWAHYLFKDGSMIGLNKEILCQYIEYITNIRMQAIGLKAPFHIKANVIPWINSWL
FT                   VSDNVQVAPQEVESSSYLVGQINTQINDDEFNNFQL"
FT   gene            543753..544043
FT                   /gene="yfaE"
FT                   /locus_tag="BVAF_481"
FT   CDS_pept        543753..544043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfaE"
FT                   /locus_tag="BVAF_481"
FT                   /product="2Fe-2S iron-sulfur cluster binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_481"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33867"
FT                   /db_xref="GOA:E8Q743"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q743"
FT                   /protein_id="ADV33867.1"
FT                   /translation="MNLIIFNYKIIIINAHISHNIHFIYNNIRFQSLLEALEYHKIPTN
FT                   YQCRSGYCGSCRVNLIQGQIKYHSQPLASSFSSKEIFICSCFPEQDIIIKI"
FT   gene            complement(544200..545723)
FT                   /gene="nuoN"
FT                   /locus_tag="BVAF_482"
FT   CDS_pept        complement(544200..545723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="BVAF_482"
FT                   /product="NADH-quinone oxidoreductase subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_482"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33868"
FT                   /db_xref="GOA:E8Q744"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q744"
FT                   /protein_id="ADV33868.1"
FT                   /translation="MIKNCWDNMVILLPILIIGITIIVIMLSIAWNRGNLKHAIVTVVG
FT                   LIVSVVLSFNMMVSTKNNIQENSNIFQLVYVDNFSILHTVLVVFSSLASVISGYSWLLS
FT                   YPNDRRDEFYLLLLLSTMGGVLLTITNHLVILFLGIELVSIPMCGLISYSVFQKRSIES
FT                   GIKYIILSGVSSSFLLFGIAFIYCGSGSLSFIEIKELMLTYSNTKITCYQLSPMLLIVI
FT                   GLSMMMVGIGFKLSFVPFHVWVPDVYQGASSSVSMYLATGSKVAVVSALIRFFLILPDQ
FT                   YNEILYIFLLSSACLSMLFGSIMAIQQRSIKRILAYASITNSGYLLAMLSTLYINTVIA
FT                   QEAIHVYLISYLIANIGVFGIINMVSGSCVEKDNKDSDLIYLYDGLFWKSPVLSVMFTI
FT                   IILSLAGIPLTFGFIGKFYLLLLGVSSKLWILTTFIIISSIISMCFYLKIMANLFRDYS
FT                   MKRSNIAIDFNFLSNWIYKIEGWMIIIMVIIILYCGLYPQSIICLIQSM"
FT   gene            complement(545773..547329)
FT                   /gene="nuoM"
FT                   /locus_tag="BVAF_483"
FT   CDS_pept        complement(545773..547329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="BVAF_483"
FT                   /product="NADH-quinone oxidoreductase subunit M"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_483"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33869"
FT                   /db_xref="GOA:E8Q745"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q745"
FT                   /protein_id="ADV33869.1"
FT                   /translation="MLLLTIVLIPFIFGLLSWQLEQISVFAPRWVALLGVSIVLLISSI
FT                   LWLCQIECFNLLFSKFVIMNQPTSLWQLEYIADWIPRFGINFHLALDGLSLLMLMLSGI
FT                   LGFVAVLGAWNSNVDCHQRSQGLFYLNLLCLLGSGIGAVLSIDMFLFFFFWEITLIPMY
FT                   FLISEWGYIEFKSKNLRVISATKFFIYAQFSGLCMLVSIVIISYFNYQMNGFWSFDYDT
FT                   LLQVKLPRNIEYCFMLGFFLSFAIKMPIVPFHSWLPEVHSFSPIMGSVDLVGILLKTSI
FT                   YGFFRFVLPFCPCAAQDFSLVAMLLGLLNICYGSWMACAQTDIKKIIAYANISHMGLIL
FT                   IAIYSNNHLSYQGAIIHMISCSVSAAGMFMISGQLYERFNTRNITEIGGLWNNINFIPV
FT                   FSLCFVVAMLGIPGTGNFVGEAIILFGIFQTAPFIAIIAALVSILFSSIYSLILMQKVY
FT                   YGFPSKIRGFSVNIGFREKLISIVLLMCIFLIGLFPQFILDTSYKTTQYIYMRLQKYDR
FT                   T"
FT   gene            complement(547407..549296)
FT                   /gene="nuoL"
FT                   /locus_tag="BVAF_484"
FT   CDS_pept        complement(547407..549296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="BVAF_484"
FT                   /product="NADH-quinone oxidoreductase subunit L"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_484"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33870"
FT                   /db_xref="GOA:E8Q746"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q746"
FT                   /protein_id="ADV33870.1"
FT                   /translation="MNVFILTMLFPLLSFFILVAFQRKFGQNIIAIIGGGGIGISACVT
FT                   VFLIFNFYYHFYDNAADFMIVRELCSWFKIDNMNMKIAFRLDRLSLLMLSIITGVGFII
FT                   SIYSVGYMRGLEGYSRYFIYINLFIFNMILLILSDNLLLMYFGWEGVGLCSYLLIGFYY
FT                   LNPGNGYKALKAFIVTRFGDICIMCALFMLYDQYHTLSLDKLLKLSPQCLSTTLSSWVS
FT                   VFFVIGTVTKSAQFPLQTWLVSAMVGPTPVSALIHSATMVTAGVYLIYRLNDFFLVNSY
FT                   ILWAVSLVGAITLVIASCSALFQSNIKKILAYSTISQIGYMFLALGEKNWDGAFYHLTT
FT                   HAFFKALLFLSAGSLIRACKDEQNIFKMGGLFQSMPFLYICFLVGGASLSGFPMLTSGF
FT                   FSKKIILLNIFDNHNYFFLILGMIGVFLTPIYIFRMIFIIFHGKQLINPKVSFEISQYL
FT                   PLVILLILSTVVGIKIPLFLLGSIDNNDFYMFDNEKIYFLMTSEILVFLGMWIAYVFWF
FT                   NNDMYRTWNMVIFKGQLSSELITRYLVLLCHYGWGIDWLYKRIFVRPYAYIVNKLFYYD
FT                   DFIGMGINMCASFCDWLGRCLIYIESRKIHWYILLMNVGAIISLLVLLMNLNM"
FT   gene            complement(549313..549603)
FT                   /gene="nuoK"
FT                   /locus_tag="BVAF_485"
FT   CDS_pept        complement(549313..549603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="BVAF_485"
FT                   /product="NADH-quinone oxidoreductase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_485"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33871"
FT                   /db_xref="GOA:E8Q747"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q747"
FT                   /protein_id="ADV33871.1"
FT                   /translation="MIPLSHGLSLSIILFVLGLLGVIIKKNFFFMLLGLEIVINSAALA
FT                   FVVVGTYLGQEYGQIMYMLIITVAASESAVSLALLLHLYRRYGTLNTDEII"
FT   gene            complement(549604..550173)
FT                   /gene="nuoJ"
FT                   /locus_tag="BVAF_486"
FT   CDS_pept        complement(549604..550173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="BVAF_486"
FT                   /product="NADH-quinone oxidoreductase subunit J"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_486"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33872"
FT                   /db_xref="GOA:E8Q748"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q748"
FT                   /protein_id="ADV33872.1"
FT                   /translation="MMVVLFYISGCVSILATICVIFNNNTVHSLLYLVLSLLSVSLNLF
FT                   SLKASFVGAIEVIVYAGAIMVLFLFVIMMLDIDSVTINFDNKTGESFLLKKFNLGVSLF
FT                   MSSLLFVLLYSIGRIDNCFINIKNGAISVKQIGITLFGGNGEYILVVEIASLLLLGALI
FT                   SVLHIAQESKTCFDNVVFINNNKKNK"
FT   gene            complement(550218..550763)
FT                   /gene="nuoI"
FT                   /locus_tag="BVAF_487"
FT   CDS_pept        complement(550218..550763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="BVAF_487"
FT                   /product="NADH-quinone oxidoreductase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_487"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33873"
FT                   /db_xref="GOA:E8Q749"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q749"
FT                   /protein_id="ADV33873.1"
FT                   /translation="MIKLKQFFIHIFSILRSIWMVGRQAFNQRETQMYPDITCKVSSRY
FT                   RGRIILTRDKLGNERCVACNLCAVSCPVGCISLKKSETIDGRWYPDFFRINFSRCIFCG
FT                   MCEEACPTAAIQLISDFEMSDFKRGDLVYEKSDLLVSGQGKQLEYDFYHISGVTCDNKN
FT                   KGEAQNEDKPINVKTILP"
FT   gene            complement(550794..551762)
FT                   /gene="nuoH"
FT                   /locus_tag="BVAF_488"
FT   CDS_pept        complement(550794..551762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="BVAF_488"
FT                   /product="NADH-quinone oxidoreductase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_488"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33874"
FT                   /db_xref="GOA:E8Q750"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q750"
FT                   /protein_id="ADV33874.1"
FT                   /translation="MIVNFTELLEFLVISSYSVCVLFIIVACGAYMSFIERRLLALFQN
FT                   RYGPNRVGWQGSLQLLADLIKIIFKEDWVPIFSDRYIFTLAPIVAFIMSLMIAPIIPFM
FT                   PNSVIFDCNIGILFFLMVSGLMVYSVLLAGWSSNNKYALIGAIRAIAQTLSYEIFLGLS
FT                   LMGVVVKAGSFNLLHIIQDQENLWNIVPQFLGFIMFFISSLALCHRHPFDQPESEQELA
FT                   AGYHVEYSGMKFSLFFISEYISIIVISSFMVVLFFGGWSGPYFSSIIWFIVKTSIIILL
FT                   FILIRASLPRPRYDHVMFIGWKLLLPITLLNLLITAFIILI"
FT   gene            complement(551759..554581)
FT                   /gene="nuoG"
FT                   /locus_tag="BVAF_489"
FT   CDS_pept        complement(551759..554581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="BVAF_489"
FT                   /product="NADH-quinone oxidoreductase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_489"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33875"
FT                   /db_xref="GOA:E8Q751"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q751"
FT                   /protein_id="ADV33875.1"
FT                   /translation="MMIPVYIEGKKYFVDKSKNILDVCLSLGFDIPYFCWHPELGSIGS
FT                   CRQCAVKLYKNDTINVHSGRLVMSCMTPVEKDMYVSIFEEELKEFRKSILELLMINHPH
FT                   DCPVCEEGGNCHLQDMTVMTGHVFRRYRFTKRTHYNQYLGPFISHEMNRCITCYRCIRY
FT                   YRDYAGGDDLGVFGIHDNIYFGRVQDGILENEFSGNLVEICPTGVFTDKTQSKNYTRKW
FT                   DVTFAPSICQQCSVGCNIIVGERYGKLCRVENRYNGEINGYFLCDRGRFGCGYVNISNR
FT                   PTNPLKQYHNNCYIKINSGNAIEDSVNFLKDSKKIIGIGSSRASIESNFALRNLVGADN
FT                   FYSGVNSSEQERLLLILEILNNSGIHVPSVREIEDYDAILILGEDITQTGARVALSVRQ
FT                   AVKRKLSKIAESEGIFDWQSISVTNLSQNVQYPLLIIGFDRTKLDDLAMVTYYDSALNQ
FT                   ARFCFSVAHALNSTDFFVKDFSTELNVKLNLVVQQLKKARKPLIISGSNAGSKELIIAA
FT                   ANIAVSLKKIKKDAGILFITQDVNSIGLAMMTDKSLDDAFDVLCADDSSNITAGSSLSR
FT                   TTVIVLENDLYRYISMKRISNMLKNINYLIVLDHQYNLIQEKASLVLPVANFVESDGTV
FT                   VNYEGRAQRFFRLYDPNFYTKNTEILESWRWLYLIHDAYTNCIRTEKLHLDDVINSVVY
FT                   CFPELIGIKYAAPESNFRVHGQKIAQSTHRYSGRTSMHSNLNIHEPCISKNNETMFTFS
FT                   MEGNHRNTKSLYNQVAFAWAPGWNSPQSWNKFQDQVGGNLYPKDPGIRLFNGVSHKNCK
FT                   NNDGDIYKRTRWFDMMIPKIDSVNNENRWLIAPYWHLFGSDCMSQRTRCIQDCMPPVYA
FT                   MISSLDADRFNLKEAIYVQFMCGGYSFRLPIKISVNLPQKHIGLPIGFPGVPVFFLGMY
FT                   VESIEGFFKE"
FT   gene            complement(554702..556036)
FT                   /gene="nuoF"
FT                   /locus_tag="BVAF_490"
FT   CDS_pept        complement(554702..556036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="BVAF_490"
FT                   /product="NADH-quinone oxidoreductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_490"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33876"
FT                   /db_xref="GOA:E8Q752"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q752"
FT                   /protein_id="ADV33876.1"
FT                   /translation="MLKNKYLDPESNPLTWRMRLDKRPVWLHEYQSKNGYFALRKAITC
FT                   LSKLDIVELINKSRLRGRGGGGFLTGLKWSMMIKHQSILKVNYLICNADEMEPGTYKDR
FT                   LLMERLPHLLLEGILIAGYALSVSVAYIFLRYEYMIAAKYLNFAISELRSAGLLGKNIL
FT                   NTEFSLDIFLHTGAGRYICGEETALINALEGKRAVPRSKPPFPAQSGLWGKPTCINNVE
FT                   TLCNIPGIIEYGVSWYKNLSNKYSNDSGTKLMGFSGRVKNPGVWELPFGITAREILEDY
FT                   ARGMCDGLYLKAWQPGGASTDFLIPNHLDTPMDFHSISIIGSRFGTGMAIAIDNTVNMI
FT                   SLMRNLEEFFARESCGWCTPCREGLPWIVKLLISLEKNNGDPGDIEILEHLCNLLGPGK
FT                   TFCAHAPGAIEPLQSALKYFRSEFEAGIHLNNLNVSNKISTIQII"
FT   gene            complement(556048..556515)
FT                   /gene="nuoE"
FT                   /locus_tag="BVAF_491"
FT   CDS_pept        complement(556048..556515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="BVAF_491"
FT                   /product="NADH-quinone oxidoreductase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_491"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33877"
FT                   /db_xref="GOA:E8Q753"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q753"
FT                   /protein_id="ADV33877.1"
FT                   /translation="MQLTKEELSIIREECNCYESTRAASIEALKIVQKNYGWVSDDAIV
FT                   LIAQILHISVSDVEGVATFYNQIFRQPVGQNIIRYCDSIVCYVTGCNAIKKTLECILNI
FT                   KIGNTTKDNKFTLLPTCCLGMCDKSPVIMINEDVYSHIVLSKINKILNLYR"
FT   gene            complement(556606..558396)
FT                   /gene="nuoC"
FT                   /gene_synonym="nuoCD"
FT                   /locus_tag="BVAF_492"
FT   CDS_pept        complement(556606..558396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /gene_synonym="nuoCD"
FT                   /locus_tag="BVAF_492"
FT                   /product="NADH-quinone oxidoreductase subunit C/D"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_492"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33878"
FT                   /db_xref="GOA:E8Q754"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR023062"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q754"
FT                   /protein_id="ADV33878.1"
FT                   /translation="MNSNNKDNDNNLLFREENYILSSLISKFGSSNFIVQFAYTDAVIV
FT                   WISRQKIVPIIKFLKSNLKPYVMLYDLHGIDERLRIHRENLPEADFTVFYHIMSISINS
FT                   EIILKVPLLEKSMNVPTITSIFMNANWYERETWEMFGIKFDNHPNLTRIIMPKYWKGFP
FT                   LRKEYPARATEFIPDFTLTKQKEDLAMKGLTFNPEEWGMKQRNNNEDFMFLNLGPNHPS
FT                   VHGVFRIVLQLNGEEIVDCVPDIGYHHRGVEKMGERQSWHSYIPYTDRVEYLGGCVNEM
FT                   PYILAVEKLAGIIVPDRAKVIRIMLSELFRINSHLLYVSTYLQDIGVMTPVFLAFTDRQ
FT                   KIYDVIEAITGARMHPAWFRIGGVACDLPDNWDYLLKQCLSWLPRRIAFYIEMSLKNDI
FT                   LKKRTCGIGSYGVKEALDWGVTGAGLRATGIDFDIRKSRPYSGYENFDFDVPVGNGISD
FT                   CYNRVVLKVEEMYQSIRILDQCLNNMPEGPIKSTHPLTTPPEKTYSLQHIETLITHFLQ
FT                   VSWGPVIPPNESLQMIEATKGINSYYLISDGNTMSYRTRIRTPSFPHLQQIPSVIRGSL
FT                   ISDLIAYLGSIDFVMSDVDR"
FT   gene            complement(558541..559209)
FT                   /gene="nuoB"
FT                   /locus_tag="BVAF_493"
FT   CDS_pept        complement(558541..559209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="BVAF_493"
FT                   /product="NADH-quinone oxidoreductase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_493"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33879"
FT                   /db_xref="GOA:E8Q755"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q755"
FT                   /protein_id="ADV33879.1"
FT                   /translation="MKYTLTSVRTNTNDNDQYPLQDQKLVSDPLEKCVQKSVFFGKLTA
FT                   FLHKIVNWGRGNSLWPYNFGLSCCYVEMTTAFTAVHDVARFGSEVLRSSPRQSDFMVIA
FT                   GTPFIKMVPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFLPVDIYIPGC
FT                   PPRPEAYIQALLLLKKSIYEERRPLSWIIKDKGIYRINMQSERERKRDSRIAELYHTEV
FT                   "
FT   gene            complement(559212..559646)
FT                   /gene="nuoA"
FT                   /locus_tag="BVAF_494"
FT   CDS_pept        complement(559212..559646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="BVAF_494"
FT                   /product="NADH-quinone oxidoreductase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_494"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33880"
FT                   /db_xref="GOA:E8Q756"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q756"
FT                   /protein_id="ADV33880.1"
FT                   /translation="MKYLGICIYIVSAVLLCIFMLLCGYFCGGRSYSRSKHVPFESGIE
FT                   STGNSKVRFSVKFYLIGMIFVIFDAEGIYLYVWSVSVREAGWMGFIEIFIFIIILLISL
FT                   VYLIRTGAFNWVETSLKNENSNKTCLNVDNVLKLLKEYDR"
FT   gene            complement(559775..561061)
FT                   /gene="folC"
FT                   /locus_tag="BVAF_495"
FT   CDS_pept        complement(559775..561061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="BVAF_495"
FT                   /product="bifunctional protein folC"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_495"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33881"
FT                   /db_xref="GOA:E8Q757"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q757"
FT                   /protein_id="ADV33881.1"
FT                   /translation="MYTCFKSIKKKCSLIDWLDYIQNLNPVLVDLNLDRIKKVATVLKL
FT                   IPFQIYSILVGGTNGKGTTCYLLEQILLFNNFKVGLYTSPHLLSYSERIRVCGKQLPDD
FT                   IHIKSMSVVENARSGVLLTYFEFITLSALNIFKQFKLDLVILEVGLGGRLDATNIIDPD
FT                   ISVITNIAIDHVDFLGDTRYKIAIEKSGIFRVNRPAIVGEIDRPLVIDEIAKNCSSILF
FT                   ARGRDWDFYCCKDNTWIWRCYSESHGLLINFPMPLSIPLENAAVVLSILHWLPFKVSRK
FT                   SIEYGLQNAVLLGRFQVVNYNPFIVLDVGHNPHAAAHVKNKLHPIVLKRKGIVRIVIGM
FT                   LSRKDVKSTVLCLNNLIDVWYCADLNTPCSANMKYVFDCFSGFDVKYFEDIISAWYKAV
FT                   DDSDIDDCILVFGSFYAVHPILKLILKIM"
FT   gene            complement(561200..562069)
FT                   /gene="accD"
FT                   /locus_tag="BVAF_496"
FT   CDS_pept        complement(561200..562069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="BVAF_496"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_496"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33882"
FT                   /db_xref="GOA:E8Q758"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q758"
FT                   /protein_id="ADV33882.1"
FT                   /translation="MSWIERIINKNTILATHKMNVPEGIWTKCSHCSQLLYTKELERNL
FT                   KVCPRCDYHMQISARARLLAFLDQDGVFELGKEFVPKDILKFKDSKRYKDRLVSAQKET
FT                   KETEALVVMQGTLYNMIVIAAAFEFNFIGGSMSGAVGARFVQGVNQALKFKCPFICFSA
FT                   SGGARMQEAFISLIQMAKTSAVLSLLYKKKLPYISVLTNPTMGGVSASLGMLGDLNIAE
FT                   PKALIGFAGPRVIEQTVREKLPIGFQRSEFLLEKGVIDLIVRRPDMRIRLANLLSKLTK
FT                   QSISIKKA"
FT   gene            complement(562335..563102)
FT                   /gene="truA"
FT                   /locus_tag="BVAF_497"
FT   CDS_pept        complement(562335..563102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BVAF_497"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_497"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33883"
FT                   /db_xref="GOA:E8Q759"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q759"
FT                   /protein_id="ADV33883.1"
FT                   /translation="MQKIALGIEYDGSRYCGWQKQKNGISVQDCVENALNIVTAESVSV
FT                   FCAGRTDSGVHALGQVVHFETDVKYSKSAWTFGVNRYLPRSICIRWVSLMKQDFHARFS
FT                   AVSRRYYYYIYNDKIRSAILFQKTWHYTKLLDVCKMSRAAQYLLGENDFSAFRSAGCQS
FT                   YSRCRNLYHLRVIRIGQCVIIDIQANSFLYRMVRNIVGSLVEVGCGNRPAIWILELLKS
FT                   CKRSLAGMTAPADGLYLAEVKYPDHFFLSDERM"
FT   gene            complement(563391..564506)
FT                   /gene="pdxB"
FT                   /locus_tag="BVAF_498"
FT   CDS_pept        complement(563391..564506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxB"
FT                   /locus_tag="BVAF_498"
FT                   /product="erythronate-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_498"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33884"
FT                   /db_xref="GOA:E8Q760"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR020921"
FT                   /db_xref="InterPro:IPR024531"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038251"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q760"
FT                   /protein_id="ADV33884.1"
FT                   /translation="MRILADKEIPYVNELFGLTNQLRQYEGRFLSDKHIKNTDVLIVRS
FT                   ITKVDYELLHDSSVKFVGTVTSGTDHIDQDYLEKNNVKYISAPGSNAIAVVEYVFSALF
FT                   WLAHRDHFFLRDKIVGIIGVGHIGNLLNQRLNSFGVQTLLYDPYLSKINTDKSWKSLEI
FT                   LVSESDILTFHTPLTYTGSYPTWHMVNKDIIEALPSNKTLINTSRGEVFDNSALLKALD
FT                   HGKKINVILDVWEFEPKLLLPLLFCIDIGTAHIAGYSIESKIRSIIMIYNAFCQYFNIS
FT                   DKINVSNLFPSFINYIRIKKMDEANINSLIKIIYNIYNDHICLKSYALNSGGFDKLRKY
FT                   YFFRREWSSIFVDTGKDYTTEMLKNFGFSVF"
FT   gene            complement(564936..566147)
FT                   /gene="fabB"
FT                   /locus_tag="BVAF_499"
FT   CDS_pept        complement(564936..566147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="BVAF_499"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 1"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_499"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33885"
FT                   /db_xref="GOA:E8Q761"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q761"
FT                   /protein_id="ADV33885.1"
FT                   /translation="MKRVVITGLGIISSIGNNHSEVLRSLQHGLSGINFSKELEESGMR
FT                   SHIWGGIKLHTEGLINRKIVRFMSDASIYAYLSMQQAIQDSELSDEVIGSDKTGLIIGS
FT                   GGGSPRNQVVGSNNMRMKGLRGVGPYMVTRSMASGISACLATAFKIRGISYSISSACST
FT                   SAHCIGHAFELIQSGRQIVVFAGGGEELCWEMACEFDAMGALSTKYNTIPEKASRPYDV
FT                   NRDGFVISGGGGVVVLEELMHALNRGAYIYGEIIGYGATSDGFDMVAPSGEGAVRCMRI
FT                   ALKDLAIPIDYINMHGTSTQIGDVKELWAILEVFGTDHPYFSSTKSMTGHALGAAGVHE
FT                   TIYSMLMLKYNFIAPSINIDQLDPYLNHMKIVRQPVHRKLNTVMTNSFGFGGTNATLVI
FT                   QKYI"
FT   gene            566928..567824
FT                   /gene="yfcB"
FT                   /locus_tag="BVAF_500"
FT   CDS_pept        566928..567824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcB"
FT                   /locus_tag="BVAF_500"
FT                   /product="uncharacterized adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_500"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33886"
FT                   /db_xref="GOA:E8Q762"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q762"
FT                   /protein_id="ADV33886.1"
FT                   /translation="MKTYTILDILRWSISQFNSTPLYYGHGTNNVWDEALHLVLSSINL
FT                   PIDTPTEIFFSCLSKKERALIIKLVNLRVQKRIPVPYLTNKAWFCNLEFYVNNQVFIPR
FT                   SPIGELIMSNFHDILPTPPKHILDMCTGSGCIAIAIAMIMYPHSEIDAVDLSIKALQIA
FT                   EYNIKLYNLENQIIPIHSNLFKNIPKFKKYDLIVINPPYVNKADICNLPEEYLHEPILS
FT                   LSANCNGLEIIHQIFIQITDYLNTNGVLVCEVGNTQNELKKYYENIPFHWFTLNNGGTG
FT                   VFALTYQQLLSLNKNYT"
FT   gene            567850..568911
FT                   /gene="aroC"
FT                   /locus_tag="BVAF_501"
FT   CDS_pept        567850..568911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="BVAF_501"
FT                   /product="chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_501"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33887"
FT                   /db_xref="GOA:E8Q763"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q763"
FT                   /protein_id="ADV33887.1"
FT                   /translation="MTGNSIGQCFKVTTFGESHGFAIGGIIDGVPPGLSLKKEDIQHDL
FT                   NRRRPGTSQYTSPRSELDIIEILSGVFNGKTTGTSIGLMIKNTDQRPQDYEKIKNLYRP
FT                   GHADYTYEKKYGLRDYRGGGRSSARETAIRVAAGAIAKKYLLKVQNIKIQGFLAQMGNI
FT                   YCDLKNWDQINSNPFFCPDPNQLQKLDSLIRNLKKSGDSIGAKVTIMIKNLPVGLGEPV
FT                   FDRLDADLAHALMSINAVKGIEIGDGFLVVTKHGSEHRDEITTQGEFKSNHSGGILGGI
FT                   STGQPIVIHIAIKPTSSIAIPGKTITKNNEETQIITKGRHDPCIGIRVVPIAEAMTAIV
FT                   LMDHLLRFRAQCG"
FT   gene            569189..569260
FT                   /locus_tag="BVAF_502"
FT   tRNA            569189..569260
FT                   /locus_tag="BVAF_502"
FT                   /product="tRNA-Arg"
FT   gene            complement(569469..570707)
FT                   /gene="mntH"
FT                   /locus_tag="BVAF_503"
FT   CDS_pept        complement(569469..570707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="BVAF_503"
FT                   /product="Manganese transport protein mntH"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_503"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33888"
FT                   /db_xref="GOA:E8Q764"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q764"
FT                   /protein_id="ADV33888.1"
FT                   /translation="MLRTQSNVESNHAKRKIKLTLLGPAFIAAIGYIDPGNYATNIQAG
FT                   ATFGYKLLWVVVWANVMAMLIQLLSAKLGIATGKNLAEHIRDQFPKSIVWMYWVQAEVI
FT                   AMATDLAEFIGAAIGFQILLGISLFKGALLTGVATFLILTLQNYGKKPLELIVGSLLLF
FT                   VAGAYCIELFYSKPELIGLGMGMLFPVLPNKEAVFLSAGVLGATVMPHVIYLHSSLTQD
FT                   NVMEATKLERYDSTKLDVAIAMTIAGFVNLSMMATAAAVFHFSGHTGVASLNEAYLTLS
FT                   PLLNHTAAVIFGLSLTAAGLSSTVVGTLAGQVVMQGFVRFYIPMMLRRVVTMLPSFIII
FT                   ALEIDSTHILIMSQVLLSFGIALALIPLLLFTGDVNVMNELVNSTWINFIGWMITSIVI
FT                   GLNIYLLIGIFTE"
FT   gene            complement(572514..573956)
FT                   /gene="gltX"
FT                   /locus_tag="BVAF_504"
FT   CDS_pept        complement(572514..573956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BVAF_504"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_504"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33889"
FT                   /db_xref="GOA:E8Q765"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q765"
FT                   /protein_id="ADV33889.1"
FT                   /translation="MTIRTRFAPSPTGELHIGNIRTALYAWLFSKQQKGKFILRIENTN
FT                   FSNTTTDNYIANIFAIMRWLHLDWDEGPYFQSDRLNRYDYIINDMLKYNIAYKCYCSLD
FT                   RLKMLRLKQMKDGQKPKYDGYCRMKNHMGAISNSNNDCTNNKSNPYVVRFANPLSGKVT
FT                   FYDHIRGMITVDNTELDDVIICRTNGVPTYNFCVVIDDMDMKITHVIRGEEHINNTPRQ
FT                   INILKSLNATIPQYVHVPIILDGNRQKLSKRHGQVGMITYKDGGFLPEAILNYLVRLGW
FT                   SYGNQEIFSVEQMKKYFSFNKVSRSASVFDFKRLLWLNNYYINNLPVEYVAKYLLQYME
FT                   EQNIDAESIKPKLFDVVQLLSKRSNTLREMVLNFLSIHREFNIFDNPTIADKFLTPIIL
FT                   PILKILIKKLNAISTWTISLIKLAIKETIYELRMDISIIGMPLRIALIGSSNSPELSTI
FT                   IYFLGKYQALYRLKQAEAYINK"
FT   gene            574095..574166
FT                   /locus_tag="BVAF_505"
FT   tRNA            574095..574166
FT                   /locus_tag="BVAF_505"
FT                   /product="tRNA-Val"
FT   gene            574235..574307
FT                   /locus_tag="BVAF_506"
FT   tRNA            574235..574307
FT                   /locus_tag="BVAF_506"
FT                   /product="tRNA-Lys"
FT   gene            complement(574446..576242)
FT                   /gene="ligA"
FT                   /locus_tag="BVAF_507"
FT   CDS_pept        complement(574446..576242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BVAF_507"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_507"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33890"
FT                   /db_xref="GOA:E8Q766"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q766"
FT                   /protein_id="ADV33890.1"
FT                   /translation="MKIIEKRIKKLIKKLRQWEYAYYLKNESETSDEEYDKTLQELRQL
FT                   EFEYPCLITENSPTKFLGKILENNFRQVYHRAPMLSLNSVMNKSQLLLFNDRIEYKLRD
FT                   NNQNKSIIYCCELKIDGVAISLLYKSGKLLKAATRGDGKIGEDVTKNVRVVSSIPECLR
FT                   KNDGMQLPYLLEIRGEIFISKLCFLKLNQKILKSGNKPFSNARNAASGSLRQLNPNITA
FT                   SRSLMFYCYGISYYVGADELPNSHWDRLQLCLKLGIPINDHIQLVNGVDKVLKYYDHIT
FT                   YIRSNLKYDIDGIVVKVDNCVFQKKLGYGTRAPHWAIAYKFPAESKLTQLNDIIFKVGR
FT                   TGLITPIVYIKPIVINNVVIKKVSMHNVNEIRRFNLMFGDTVLVQRSGDVIPKIVKVIL
FT                   SKRTNDMKVITLPQFCPVCGTLLITSNCRSSVLRCPAKLICLAQRKSMLKHFVSRKAMN
FT                   IHGMGEKVINQLVDKNLVFSPVDFFYLNRENLLFNLDGYGVKSVEKLLRSIDLAKHTTL
FT                   ANFIYALGIPNVGESVANSLAVKYKTIEKLISADFQSLSTLQYVGDSIAFTIYSFFKDP
FT                   INLKNIKDLINPDIGIRWILNN"
FT   gene            576557..577501
FT                   /gene="cysK"
FT                   /locus_tag="BVAF_508"
FT   CDS_pept        576557..577501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BVAF_508"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_508"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33891"
FT                   /db_xref="GOA:E8Q767"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q767"
FT                   /protein_id="ADV33891.1"
FT                   /translation="MNKIYQDNSYTIGNTPLVRLNHIGNNYILAKIESRNPSFSVKCRI
FT                   GSNMIWDAEKKKLLNPDVVIVEATSGNTGIALSYVAAARNYKLILTMPDTMSIERRKLI
FT                   TALGSKIILTAGNLGMKGAIAKANEIVSKNPKKYLLLQQFDNPANPEIHEKTTGPEIWN
FT                   DTNGEIDIFVSGVGTGGTITGVGRFLKRVQNKKIFIVAVEPKQSPIITQKLSGKPIKPA
FT                   PHKIQGIGAGFIPSNLDLNIIDHVETVDSDDAINCAKFLMKKEGILSGISSGAALTAAI
FT                   QLQKQKKYMNKNIVIILPSSGERYISTTLFSEL"
FT   gene            577873..578130
FT                   /gene="ptsH"
FT                   /locus_tag="BVAF_509"
FT   CDS_pept        577873..578130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="BVAF_509"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_509"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33892"
FT                   /db_xref="GOA:E8Q768"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q768"
FT                   /protein_id="ADV33892.1"
FT                   /translation="MFQKEITITAVNGLHTRPATALVKEAKNFSSDITIISNGKQANAK
FT                   SLFKLQTLGLSKGSIITISAQGKDEKQAVQHLTTLIENLK"
FT   gene            578182..579903
FT                   /gene="ptsI"
FT                   /locus_tag="BVAF_510"
FT   CDS_pept        578182..579903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="BVAF_510"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_510"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33893"
FT                   /db_xref="GOA:E8Q769"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q769"
FT                   /protein_id="ADV33893.1"
FT                   /translation="MISGISVSPGIVSGKALLLKEEKIIINTKKIAASSITTEIHKFLS
FT                   ARSKTIEQLKQIKQKVKKGLESKQETIFEGHILLLEDTELEQDIVTLIKEELFSADSAV
FT                   HSVIETQAKALEKLEDEYLKERAIDVRDIGNRLLKNILNIPIIDLNTITEEVIIIAVDL
FT                   SPSETAQLNLTKVLGFITDVGGKTSHTAIMARSLELPAIIGTSIATKQIANGDYIILDA
FT                   LNNKIYINPDTNIINTINIINQKHIADKYELKKLKYLPSTTIDGHHVRICANIGTMHDI
FT                   VKAQENGAEGVGLYRTEFLFMNRNELPTEEEQFQAYKNAAEYMSNKSIIIRIMDIGGDK
FT                   NLPYMNLPYEENPFLGWRAIRIMIDKKDMLHTQLRAILRASFFGKLLIMYPMIISVEEI
FT                   QQLNIELNLLKTQLRNERKKFDENIKVGIMIETPASAIIAHHLIKEVDFFSIGTNDLTQ
FT                   YTLAVDRGNKLISHLYNPISPSILILINKVIEASHAAGKWTAMCGEMAGDELAIPLLLG
FT                   MGLDEFSMSSTSILQIKKIIRNTHYKDAKKLAQKALNYSTTESLMQLLKNKKKQHI"
FT   gene            complement(580249..581316)
FT                   /gene="cysA"
FT                   /locus_tag="BVAF_511"
FT   CDS_pept        complement(580249..581316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="BVAF_511"
FT                   /product="sulfate/thiosulfate import ATP-binding protein
FT                   cysA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_511"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33894"
FT                   /db_xref="GOA:E8Q770"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q770"
FT                   /protein_id="ADV33894.1"
FT                   /translation="MNIEIDKITKFFDCGAVLTNISIYIKSGEIVALLGPSGSGKTTLL
FT                   RIIAGLESHSSGYLRFYGKDVSKLNARDRSVGFVFQNYALFRHMTVLDNISFGMRVLPR
FT                   HKRPNKQVINNKVMQLLNMVQLKHLAYRYPSQLSGGQKQRVALARSLAIEPKILLLDEP
FT                   FGALDVQVRKELRRWLRNLHHELKFTGVFVTHDQEEAMEVAHRVVIMNCGNIEQIGTPQ
FT                   DIWCMPATRFVLKFLSEVNCVNGMVYGSKVFIGPYHWSLSYVPDVQGEIELFFRPWEME
FT                   IRKEFSICTPLPVKIVNVNLHGYYWQLSVEPLGWHCDLLTIILGVKDVFGVPKSGMYCY
FT                   VSGQNARLYSGETIL"
FT   gene            complement(581349..582173)
FT                   /gene="cysW"
FT                   /locus_tag="BVAF_512"
FT   CDS_pept        complement(581349..582173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="BVAF_512"
FT                   /product="sulfate transport system permease protein cysW"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_512"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33895"
FT                   /db_xref="GOA:E8Q771"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q771"
FT                   /protein_id="ADV33895.1"
FT                   /translation="MNSNFFSSIEWGKWILIIFSVSISIILLFIPLIMIFISALSAGLH
FT                   MVVLNLLNTDMIHAVLLTVIVALIVIPVNVVFGIFMAWLITRFNFFGKQFLLAFLSISV
FT                   AVSPVVVGLLYLLCYSNGSIIGDWLDSYNIQIMFSWIGIVLVTICITCPFVANELIPVM
FT                   INQGNQEDEAAVLLGASGWKMFWYVTFPNIRWALLCGIIITNARAMGEFGASSIVSGLI
FT                   RGETYTLPLYIELLYQDYNIVGAFIAASLLALVSIIMLFIKNYFKYYYENNM"
FT   gene            complement(582210..583040)
FT                   /gene="cysU"
FT                   /locus_tag="BVAF_513"
FT   CDS_pept        complement(582210..583040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysU"
FT                   /locus_tag="BVAF_513"
FT                   /product="Sulfate transport system permease protein cysT"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_513"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33896"
FT                   /db_xref="GOA:E8Q772"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q772"
FT                   /protein_id="ADV33896.1"
FT                   /translation="MLFVGNQKLPGFGIALGNSLLFICLVLFLPLSALVIQLCKISWSQ
FT                   YWDIITDPALLIAYKVTFLSAGTAALFNAMFGIMVSWVIVRYKFVGQRLLDAIIDLPFA
FT                   LPTAVAGLTLAALFSESGWYGSLLVHSGISLSYTWIGIAIVMIFTGIPFVVRSVQPVLE
FT                   EISTEYEESAKILGANNWQIFSNIIFPELAPAWLSGIVLSFIRGLGEFGAVIFVAGNIS
FT                   CKNEVISLVIFVRLQEFDYPAASAISSVILMISLLLLIIINVFQLRLQQRFKGF"
FT   gene            complement(583043..584074)
FT                   /gene="cysP"
FT                   /locus_tag="BVAF_514"
FT   CDS_pept        complement(583043..584074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysP"
FT                   /locus_tag="BVAF_514"
FT                   /product="thiosulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_514"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33897"
FT                   /db_xref="GOA:E8Q773"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q773"
FT                   /protein_id="ADV33897.1"
FT                   /translation="MIIIAVVYRIIKITILLLYCLICTSVYSIILLNSSYDVSRELFSE
FT                   INSNFILYWKNIHPEDKLIIRQSHSGSTRQAIAILQGLRADVVTYNQIIDVQILHDRGQ
FT                   LIPKDWQNRLPNRSSPFYSTMSFLVRQGNPKSIYNWNDLTQDGLKIVFPNPRTSGNGRY
FT                   TYLAAWVAFLKSSNNNIELTRSKMKKVLKNVMVFDSGGRSSTITFVDRDQGDVLINFES
FT                   ESKFIKNQFKDNNYEIIIPDPNILVEFPVTWIDKNVVRNGTQNIAKAYLEYLYTDAARK
FT                   IISKFGYRVNVTSMLQINRSMFPVVHLFTVEEQYGADWNNIMKIHFRRGGELDQLLSSV
FT                   GKD"
FT   gene            584825..585667
FT                   /gene="tal"
FT                   /locus_tag="BVAF_515"
FT   CDS_pept        584825..585667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="BVAF_515"
FT                   /product="transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_515"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33898"
FT                   /db_xref="GOA:E8Q774"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q774"
FT                   /protein_id="ADV33898.1"
FT                   /translation="MNQLDILKKIPMISSNTEIIEDIVLYKIQYTITHHLLLSVKSPLF
FT                   TISAILFEDNLNYTHKLIHNPNKQVINASHKCTVNIRSKILKKITECISFPKINTTLFL
FT                   KKHFSIQQAYKLIKIYQEKNTNTSLVLTKIKTTWKRIKSTKKLEKFKIKYIVTSLFFFT
FT                   QTHSYTTNNLYLISPFIVYIDDWYNKNNLLKRHYINNDPNVKTLKKNYHFYKTHYNIIT
FT                   MEPNLHIFQQILTTISEYDYLILFLNFLKEILYKNLKSVEGQLSPCNLIILNCQNPFS"
FT   gene            585811..587811
FT                   /gene="tktA"
FT                   /locus_tag="BVAF_516"
FT   CDS_pept        585811..587811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="BVAF_516"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_516"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33899"
FT                   /db_xref="GOA:E8Q775"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q775"
FT                   /protein_id="ADV33899.1"
FT                   /translation="METQTYKTLANAIRILSIDCVQHANSGHPGAPMGMADIAEVLWRD
FT                   YMNHNPNNPNWINRDRFILSNGHASMLLYSILHLTGYNLSIEDLKNFRQLHSKTPGHPE
FT                   YKHTDGVEITTGPLGQGLANAVGFAIAERTLAKQFNRPSFNIIDHYTYVFAGDGCMMEG
FT                   ISHEVCSLAGTMHLNKLIVFYDSNNISIDGNTSEWFTDNTAIRFKSYGWHVIDNIDGHH
FT                   RNSIKIAIDQARSELNRPSLLIFKTIIAFGSPNKSGKASAHGSPLGKIEVYETRRALLW
FT                   QEKTAFLIPKEIYNAWNATQLGEKKENDWNKIFYQYQIHYPNLSQELKRRIKHELPQNW
FT                   EIEIKKIIEKLNINPKNLATRQASQIIIEHLYKKLPELLGGSADLTPSNLTTCSQSTSI
FT                   MHNPAGNYIHYGVREFGMTAIANGISNHGGFLPYTATFLTFSDYARNAIRMAALMNTHH
FT                   IMIYTHDSIGLGEDGPTHQPIEQLSSLRIIPNLQIWRPCDQIETAIAWKSAVEYQGPTA
FT                   LILSRQTLKTQEYTSTQITNIARGGYILKNFQEDLDLIIIATGSEIELAIQTYYILTKK
FT                   GYKIRVVSMPSTNLFDKQHIKYQEYVLPKKTLNKLVIEAGSDNFWYKYIGSYGKIIGIN
FT                   EFGKSAPAHELFNFFNFTIDYVLQKSYELLK"
FT   gene            587942..589114
FT                   /gene="dapE"
FT                   /locus_tag="BVAF_517"
FT   CDS_pept        587942..589114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="BVAF_517"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_517"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33900"
FT                   /db_xref="GOA:E8Q776"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q776"
FT                   /protein_id="ADV33900.1"
FT                   /translation="MTISLIELTKKLINQPSITPKDHNCQNIIACYLKSLKFNIELMNF
FT                   YDTHNIWAYRNGQHKQKQQHTTTLLFLGHTDVVSPGNTQNWKYPPFSGLINNGVLYGRG
FT                   ASDMKGALAAMLIAAQHFIQRHPNHKKKIAFLFTSDEEGSGKNGTIKAVQQLIERNEHI
FT                   EYCIVGEPSSQNKLGDVIKNGRRGSCTGKLIIQGSSGHVAYPQFLINPIHLTIPMLFDL
FT                   MNIKWDQKNSIIFPKTSIQITNINTVPANCTTHNITPDQLILNFNLRFSDQSSIKSIQN
FT                   NINKILSMHSLNYHIYWDPCISEPYFSNPGKLTNVVTNIITKHYHYNIIPRLETTGGIS
FT                   DGRFIAKTGSEVLELGALNHTIHKFNEHIKLTDLKLLSYFYFKIMEKMLL"
FT   gene            complement(589673..590551)
FT                   /gene="dapA"
FT                   /locus_tag="BVAF_518"
FT   CDS_pept        complement(589673..590551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="BVAF_518"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_518"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33901"
FT                   /db_xref="GOA:E8Q777"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q777"
FT                   /protein_id="ADV33901.1"
FT                   /translation="MFAGSIVALITPMNLRGSIDRKSLKKLVEYHVRSGTSAIVSVGTT
FT                   GEMSGLTHTEHVNVVMWTLEFSDGRLPIIAGTGSNSTAEAILLTQQFQNSKIAACLSVT
FT                   PYYNRPNQEGLFKHFQSISENTSLPQILYNVPSRTGCDLLPETVGRLSKIKNIIGIKEA
FT                   TGNLNRVNQIKKLVEEDFILLSGDDLSALDFMRLGGNGVISVTANIAAKEMSILCDLAK
FT                   KNDFKHAYRVNNYLIPVHKSLFLDSNPIPVKWACKELGLIPYDTLRLPMTPLSKENHNV
FT                   VRQSLINANLL"
FT   gene            590994..591474
FT                   /pseudo
FT                   /gene="bcp"
FT                   /locus_tag="BVAF_519"
FT   gene            complement(591682..592308)
FT                   /gene="upp"
FT                   /locus_tag="BVAF_520"
FT   CDS_pept        complement(591682..592308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="BVAF_520"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_520"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33902"
FT                   /db_xref="GOA:E8Q778"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q778"
FT                   /protein_id="ADV33902.1"
FT                   /translation="MKIIEIKHPLVQHKLGLMRICDISTKRFRELSAELGSLLTYVATD
FT                   NLEIETVTIKGWSGLVKITRIKGKKITIVPILRAGLGMMDGVLEHIPSARISMIGVYRD
FT                   EITLEPIPYFHKLASKINERMAMLLDPMLATGGTIIAAINLLKQAGCNNIKILSLVAAP
FT                   EGITALEQKHPDIELYLASIDQKLNKYGYIIPGLGDAGDKIFGTK"
FT   gene            592587..592772
FT                   /locus_tag="BVAF_521"
FT   CDS_pept        592587..592772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BVAF_521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_521"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33903"
FT                   /db_xref="GOA:E8Q6D4"
FT                   /db_xref="InterPro:IPR022576"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6D4"
FT                   /protein_id="ADV33903.1"
FT                   /translation="MKKNKAKTRIAKGVFLISFIVLFARLIFSLIQSWDFYKKTTLTSI
FT                   PIILQIMTNIYVNLFL"
FT   gene            complement(592919..593551)
FT                   /gene="ureG"
FT                   /locus_tag="BVAF_522"
FT   CDS_pept        complement(592919..593551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureG"
FT                   /locus_tag="BVAF_522"
FT                   /product="urease accessory protein UreG"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_522"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33904"
FT                   /db_xref="GOA:E8Q6D5"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6D5"
FT                   /protein_id="ADV33904.1"
FT                   /translation="MVVLKNNRIKPLKIGVGGPVGSGKTSLIEVLCKRLKNKYQLAVVT
FT                   NDIYTTEDKRILVDSGALEADRIIGIETGGCPHTAIREDASMNLLAIDELTNKFKNLDI
FT                   IFVESGGDNLSATFSPDLTNLNFYVIDVAAGDKIPRKGGPGITKSDLLIVNKIDLAIYV
FT                   GASLDIMNSDINLARHNKKGSWIFTNLKIGDGVQNIIDFISQQEVFM"
FT   gene            complement(593674..594357)
FT                   /gene="ureF"
FT                   /locus_tag="BVAF_523"
FT   CDS_pept        complement(593674..594357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureF"
FT                   /locus_tag="BVAF_523"
FT                   /product="urease accessory protein ureF"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_523"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33905"
FT                   /db_xref="GOA:E8Q6D6"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6D6"
FT                   /protein_id="ADV33905.1"
FT                   /translation="MNTYKSDGSLLSLMQLVSSNLPVGSFSYSKGLESAIEFGWIKSIE
FT                   NFLDWQKQWIYGELMYLDWPMLKRCYNCAEINDAVKFEQCAVQVLSYRDTYELRVEEQQ
FT                   RGKAMSKLILQWYSPVDENWISGFQYSGLASVAWLGHAWDIPIKNLALGYAYNILESSV
FT                   IIGLKLLPFGQNIAQQLIRYLSSFFSQVWDRSKSVSDFELGSNFLCKSIASSCHEIQYS
FT                   RLFRS"
FT   gene            complement(594688..596391)
FT                   /gene="ureC"
FT                   /locus_tag="BVAF_524"
FT   CDS_pept        complement(594688..596391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /locus_tag="BVAF_524"
FT                   /product="urease, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_524"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33906"
FT                   /db_xref="GOA:E8Q6D7"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6D7"
FT                   /protein_id="ADV33906.1"
FT                   /translation="MYKLNRKAYAEMYGPTCGDSIRLADTNLWARIEKDFTVYGEELKF
FT                   GGGKVIRDGMGQSQLSNKECVDLVLINAIIIDYWGIVKADLGIANGRIVKVGKAGNPDV
FT                   QPGVTICIGPGTEVIAAEGKIITAGGVDTHVHFVCPQQIEEALCSGITTLIGGGTGPAT
FT                   GTNATTCTPGPWFISRMLQAADSLPINIGFTGKGSASLPEALIEQVESGVVGLKIHEDW
FT                   GATPAVIDCCLNVADQFDIQVSIHTDTLNESGFVEDTISAINNRTIHTYHTEGAGGGHS
FT                   PDIIRMCEFSNILPSSTNPTMPYTINTIDEHLDMMMVCHNLNCSLPEDIAFADSRIRRE
FT                   TIAAEDILHDLGALSMISSDSQAMGRIGETILRTWQTADKMKLQRGSLKEDDRYSDNMR
FT                   IKRYIAKYTINPAITHGIAHEVGSVEQGKLADLILWNPSFFGIKPDLVIKGGMIVSSIM
FT                   GDPNASIPTPQPVYYRSMFGECDQAKRFIRMTFVSKISYSLDIIGRLKLISLIGKVKQC
FT                   RNIQKRDMIHNTWQPVIEVDPQTYEVRADGELLICEPVSVLPMSQRYFLF"
FT   gene            complement(596398..596706)
FT                   /gene="ureB"
FT                   /locus_tag="BVAF_525"
FT   CDS_pept        complement(596398..596706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="BVAF_525"
FT                   /product="urease subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_525"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33907"
FT                   /db_xref="GOA:E8Q6D8"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6D8"
FT                   /protein_id="ADV33907.1"
FT                   /translation="MIPGELYIIDGLIELNSGRRYSTVMVLNYGDRPVQVGSHFHFYEV
FT                   NNFLKFNRDVAIGFRLNIPSGTSIRFEPGQTRKVELVQYSGKLKIFGFCKKIMRRLS"
FT   gene            complement(596743..597045)
FT                   /gene="ureA"
FT                   /locus_tag="BVAF_526"
FT   CDS_pept        complement(596743..597045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureA"
FT                   /locus_tag="BVAF_526"
FT                   /product="urease subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_526"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33908"
FT                   /db_xref="GOA:E8Q6D9"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6D9"
FT                   /protein_id="ADV33908.1"
FT                   /translation="MKLLPREKDKLLIFMAALVAEKRRNRGLKLNYPEAIALISAVILE
FT                   GAREGKNVSELMELGKSVLSRNDVMLGVPEMISNVQVEATFPDGTKLVTIHDPII"
FT   gene            complement(597066..597920)
FT                   /gene="ureD"
FT                   /locus_tag="BVAF_527"
FT   CDS_pept        complement(597066..597920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /locus_tag="BVAF_527"
FT                   /product="urease accessory protein ureD"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_527"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33909"
FT                   /db_xref="GOA:E8Q6E0"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6E0"
FT                   /protein_id="ADV33909.1"
FT                   /translation="MIKDVWLYKLHDGWLGKLELSFSLKKRRSVLVKNSHLGPFMVQKS
FT                   FYPEDDEMTPHVYLLHPPGGMVGGDQLRLLVNLEPGSRALLTTPSFSKFYRTNGKVAYQ
FT                   ENFFRIKSNAVLEWIPQGNIFLPKSKARIHTTFQLDKGACMISFEILCFGSTNIIGVHE
FT                   IPKKIDVSLYICKFGCVGLRDRLRVSDQQENCVNTQLGGFKISAFLFAIPANLMMLKQV
FT                   QQLVRSIVDEQIGGATLLNTLLIVRLLGNDSHKLRKLLFRIWSIIRPVIIGKKAVIPRV
FT                   WFT"
FT   gene            complement(598181..599770)
FT                   /gene="guaA"
FT                   /locus_tag="BVAF_528"
FT   CDS_pept        complement(598181..599770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BVAF_528"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_528"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33910"
FT                   /db_xref="GOA:E8Q6E1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6E1"
FT                   /protein_id="ADV33910.1"
FT                   /translation="MQCTKYRILVVDFGSQYTQLVLKRIRELGVYSVSYAWNCNVSKFY
FT                   ELNPHGIILSGGPCSVTQKDNPCIPSVIFKLNIPILGICYGMQIMVAQLGGTVRYSDNQ
FT                   GEFGYARVKIVTENILVNGIYDSTNRDGYRILDVWMSHRDVVTVIPDEFNIVGLTQYNK
FT                   IAIMAHKKYHWYGVQFHPEVTHTKKGNNILNRFVTDICKCESFWKPSNIIKDIIKTVRA
FT                   VVGRDRVVLAFSGGIDSCVTALLLKYAIGNNFVCVFVNNGLLCYDEIEKLSSFKKKYQY
FT                   LNIVCLSEEKRFLSALVGVVDPEEKRKVVGRVFIEIFETYINSDKVKNIKWLVQGTVCS
FT                   DVIESGISAVYNNSTPNVIKSHHNVGGLPDYLNIKLLEPIKTLFKDEVRKIGLRLGLPQ
FT                   DVVYKHPFPGPGMAVRILGEVKEEYCNILRQADQIFIEELRNRNLYTKINQAFAVFLPI
FT                   SSVGVQGDNRKYKWVIALRAVETIDFMTAKWVNLPYDFLDKVSNRIVNEIQDVSRVVYD
FT                   ISSKPPATIEWE"
FT   gene            complement(599889..601358)
FT                   /gene="guaB"
FT                   /locus_tag="BVAF_529"
FT   CDS_pept        complement(599889..601358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BVAF_529"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_529"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33911"
FT                   /db_xref="GOA:E8Q6E2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6E2"
FT                   /protein_id="ADV33911.1"
FT                   /translation="MLRFSFQEALTFDDVSLVPERSSVLPIEAILKTRLTNSVFLNIPI
FT                   VSAAMDTVTESNLAIAIAQEGGVGFIHKNMSLIEQINEVSRVKRHESGVVTNPQCVSPN
FT                   TTLLEVKERTRRNGFAGYPVVVNKNELVGIVTSRDVRFIDNLNTLVSNVMTPKAQLVTV
FT                   CEKKDREIVLAKMHEKRVEKILLVDSSFHLKGMITAKDFEKSERKPNACKDKDGRLRVG
FT                   AAIGINTDYKSRIDGLVKAGLDILLIDSSHGHSESVLNYISTIRKLYPDLPIIGGNVVT
FT                   TEGALALKKVGVNAVKVGIGPGSICTTRIVTGVGIPQITAIYNVSRALKNTNIPVIADG
FT                   GIRFSGDIAKAIAAGAHCVMVGSLLAGTEESPGDIEFYQGRSFKSYRGMGSLGAMHRGS
FT                   SDRYFQQDENVVGKLVPEGIEGRVIYKGKLKTIIHQLMGGLRSCMGLTGCETIDELRTK
FT                   TKFVRVSYSGMREGHVHDVTIIKEAPNYRLK"
FT   gene            601854..603401
FT                   /gene="mqo"
FT                   /locus_tag="BVAF_530"
FT   CDS_pept        601854..603401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="BVAF_530"
FT                   /product="malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_530"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33912"
FT                   /db_xref="GOA:E8Q6E3"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6E3"
FT                   /protein_id="ADV33912.1"
FT                   /translation="MNSNTFDQTPVQLNKKNVLPPIDVVLIGAGIMSTTLGMFIAMLEP
FT                   NWKINVYERLHKPAQESSNAWNNAGTGHASFCELNYTEYNDVDKSINIEKALSINTAFE
FT                   LSLQFWAFLTKNNILKNPKSFIRNIPHISFVTDDKHISFLRKRFQALKTNNIFNGMIYS
FT                   ENSKQIESWIPLIMTGRNKNQKVAATYMEMGTDVDFEEITQQILNQLNKNSNFNIYFQH
FT                   NVTSIQPHNNNTCWNISIINTQHKNKQNVYAKHVFIGGGGQSLNLLQTSGIRETKGYAG
FT                   FPVGGQFLITYNPKIVSQHSAKVYGQSSLNMPPMSVPHMDARILNGNKVLLFGPFATFS
FT                   GKFLKYGSWWDLFYSLNKHNLIPIIQAGLDNKFLIKYLIHQVTMSHKDRINSLKKFYPE
FT                   AHIKDWSLIQAGQRVQIIKKNQHNRGTLQFGTEIVSSNNGSLSALLGASPGASIAVSIA
FT                   IRLLHIMFNTQIHSSAWQTKLQEIIPVYSQYIQNNNIIITNQLIKNTRDALSLTFTE"
FT   gene            complement(603509..604945)
FT                   /gene="engA"
FT                   /locus_tag="BVAF_531"
FT   CDS_pept        complement(603509..604945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="BVAF_531"
FT                   /product="GTP-binding protein engA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_531"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33913"
FT                   /db_xref="GOA:E8Q6E4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6E4"
FT                   /protein_id="ADV33913.1"
FT                   /translation="MDKKELFIVVLVGQKNVGKSTLFNRLTQNYRALVADYFGVTRDRQ
FT                   YGYIQHKNDKCIIVDTGGVDESSDSFLQNAINYQTNLAIREADIVLFVVNGRAYESSID
FT                   YNIIGNLRKLGKNNIFVVINKIDNFRFKNKNLETKYSYYSFGIKEVIVISAMHGYGIDI
FT                   LLDKIFLKIKKEVFLDKKNTLCLIDKKNKKTVSLVSENNSIKLAVVGRPNSGKSTFINY
FT                   VVQESRVITSSIPGTTRDSVYIPIICYNQKYMLIDTAGIRRGNNKYIDNLPERISVLKT
FT                   FQVIKDAHVILLIIDINEGIVDQDLSLLNFIIRHGRSLVIALNKWDNFSPLIKNSKSII
FT                   LQSLTRKLNFLGFSTVKMHFISSLYGYGVKLLFKSIEKIHFDASKIINTVFLTSIMNKA
FT                   ITECTPPFVSKVRGGGIPKFKYVHIGGYDPITIIIYGTQINRLPNEYRKYLKKYFCRAL
FT                   NFDGIFFHLKFKEGVKSMSY"
FT   gene            complement(605020..606297)
FT                   /gene="hisS"
FT                   /locus_tag="BVAF_532"
FT   CDS_pept        complement(605020..606297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="BVAF_532"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_532"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33914"
FT                   /db_xref="GOA:E8Q6E5"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6E5"
FT                   /protein_id="ADV33914.1"
FT                   /translation="MKKIQSIRGMHDCLPQDAVLWQSVENILKTVLNSYGYNEIRFPIV
FT                   EFTDLFKRAIGEVTDVVEKEMYNFNDRNGNNLTLRPEGTAGCVRAGIEHSLFYHQEQRL
FT                   WYMGPMFRRERPQKGRYRQFHQFSIEAFGQIGPDIEVELILIIVRCWKMLGISEHLTLE
FT                   LNSIGLLSSRIIYRSKLINFLEKNKDSLNSDAIRRLYSNPIRILDTKDVQLKKLLMKAP
FT                   ILYDYLDEYSKNHFNKLCKLLDLSGVSYVVNPYLVRGLDYYNSTVFEWVTNRLGVQKTI
FT                   CAGGRYDELTKQLGGQSVPAVGLSIGLERLLLLMKDVDNNAIVASSCVYIDVYVINLSC
FT                   CFQQYSFMLSEHIRNELPFLRLMMNQGGGNFDKQFNRAIKNNSRFVLIINDHNVYEKTV
FT                   VLKDLVCKSQETVSYTEVIKKFKNLY"
FT   gene            complement(606398..607486)
FT                   /gene="ispG"
FT                   /gene_synonym="gcpE"
FT                   /locus_tag="BVAF_533"
FT   CDS_pept        complement(606398..607486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /gene_synonym="gcpE"
FT                   /locus_tag="BVAF_533"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_533"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33915"
FT                   /db_xref="GOA:E8Q6E6"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6E6"
FT                   /protein_id="ADV33915.1"
FT                   /translation="MNNLTNIIRRKSTRIYVGNVPIGDGAPIAVQSMVNTRTVDVSGTV
FT                   NQINDLKKAGVDIVRVSIPTMDAAEAFKQIKLKVVNVPLVADIHFDYRIALKAAEYGAD
FT                   CLRINPGNIGNNNRIRAVVDCARDKNIAIRIGVNSGSLERDLVDKYKDSSVERILLESA
FT                   MRHIDILDKFNFHQFKVSVKSSDLFSTLRAYKEISSKIEQPLHVGLTESGLLRNGTVKS
FT                   SIALGLLLLEGIGDTIRVSLAADPVEEVKVAFDILRALKIRSRGINFIACPGCARQEFN
FT                   VIDVVNELEKKVCDVTTSMDVSIIGCVVNGPGESLSSTIGVAGAKNKSGIYENGIRQKE
FT                   RCDNSSIVDELERRIRAKSITS"
FT   gene            complement(607766..608845)
FT                   /gene="rlmN"
FT                   /gene_synonym="yfgB"
FT                   /locus_tag="BVAF_534"
FT   CDS_pept        complement(607766..608845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmN"
FT                   /gene_synonym="yfgB"
FT                   /locus_tag="BVAF_534"
FT                   /product="Ribosomal RNA large subunit methyltransferase N"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_534"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33916"
FT                   /db_xref="GOA:E8Q6E7"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6E7"
FT                   /protein_id="ADV33916.1"
FT                   /translation="MMLKKINLLDMSPKKLLVFFNKLGECAFRSDQIMDWIYKKYCSDF
FT                   NKMTNLHKDLRVKLNQISEINAPIITHEQESSDGTRKWMMRIHDDKYVETVYIPDNNRA
FT                   TLCISSQSGCALGCSFCGTAKLGFIKNLRTSEIVGQVWRIARFISHYNKQQVKNCNNLI
FT                   PITHIVFMGMGEPLLNLMNVVSSIQIILNSSGFNLSKHHVTLSTSGVVPGIDKLKDMVD
FT                   VSLAVSLHAPNDVIRNKIMPINKKYNIDCLLQSIRCYLQKTKSNNKKVTIEYVLLNRIN
FT                   DEIEHAHELAKKLITLPCKVNLMRWNSIKNIKYLKSTSDARLNNFYKVLKNYGIVTTIR
FT                   KVRGADIHASCGQLMGEIN"
FT   gene            complement(609050..609457)
FT                   /gene="ndk"
FT                   /locus_tag="BVAF_535"
FT   CDS_pept        complement(609050..609457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="BVAF_535"
FT                   /product="nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_535"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33917"
FT                   /db_xref="GOA:E8Q6E8"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6E8"
FT                   /protein_id="ADV33917.1"
FT                   /translation="MRKEHTLSIIKPDAVSKNIIGAIINRFEISGLVVVSVQMLQLTWK
FT                   QASEFYYVHRNKFFFNDLIQFMTSGLIFIQILEGDCAIQRNREIIGATNPSDALSGTIR
FT                   ADYGENYTRNAIHGSDSKSSAQFEISYFFDK"
FT   gene            complement(609661..610845)
FT                   /gene="iscS"
FT                   /locus_tag="BVAF_536"
FT   CDS_pept        complement(609661..610845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS"
FT                   /locus_tag="BVAF_536"
FT                   /product="Cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_536"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33918"
FT                   /db_xref="GOA:E8Q6E9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6E9"
FT                   /protein_id="ADV33918.1"
FT                   /translation="MRLPIYFDYAATSPVDVRVADKMYQYLMVDGIFGNPSSRSHCYGW
FT                   KAEEAVEISRKHIASLIGARSSEIIFTSGATESINLAIKGIAHSCYKKGKHIITSATEH
FT                   RAVLDTCRSLEKQGFEITRIVPQRNGLIDINQINQVLRDDTILVSIMHVNNEIGIIQDI
FT                   AEFGKLCQLNNIIFHVDATQSVGKLHIDLSVLPVNLMSFSAHKLYGPKGIGGLYIRKYS
FT                   DNRIINPEVNLIAQIHGGGHEYGLRSGTLPVHLIVGMAESYQIAKKEMEVEMSYLKTMR
FT                   NRLWKGLQQIEGIMVNGDLNHCIGTLLNVSFRNIDGETLMIALKDFALSSGSACTSDTM
FT                   SVSHVLTALGIPNELAYNSIRFSLGRFTTEEEIDYAIHQIVAIVMKLNEMIHLL"
FT   gene            611288..612124
FT                   /gene="suhB"
FT                   /locus_tag="BVAF_537"
FT   CDS_pept        611288..612124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="BVAF_537"
FT                   /product="Inositol-1-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_537"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33919"
FT                   /db_xref="GOA:E8Q6F0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6F0"
FT                   /protein_id="ADV33919.1"
FT                   /translation="MHPILNIAMQAIRKAGNFIIKQYEFFGRNNIRLPNYIQTFLNDVR
FT                   NESNQIISTIIKKFYPSHIIIDIHNTHTIMSIREHNQTYWIIDSIDSDINFSKQFPFLT
FT                   LSIAVQQNKNIEIGVIYDPIHNELFSACRGKGARFNNYHRIRLYQNNNIFPPSNNFMFT
FT                   AISCDTEYTQYNNRAIRILNKLHNSQSQMIMNFRCTGSVNLDLIYVSMGRTDGCFILSS
FT                   NKNIKLISSVLILKESGGIITDFEGNNINDYLFNENVIAGHPKLIKKILPLIKKNI"
FT   gene            complement(612141..613400)
FT                   /gene="glyA"
FT                   /locus_tag="BVAF_538"
FT   CDS_pept        complement(612141..613400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="BVAF_538"
FT                   /product="serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_538"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33920"
FT                   /db_xref="GOA:E8Q6F1"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6F1"
FT                   /protein_id="ADV33920.1"
FT                   /translation="MHDDIEVWNIIKKEIIRQEQHIELIASESYISPQAMRAQGSAFTN
FT                   KYAEGYPGHRYYGGCEYVDLIEQLAIDRAKKLFSAKYVNVQPHSGSQANFSVYNALLNP
FT                   GDTIIGMNLQHGGHLTHGSKVNFSGKLYNTVFYGLDEFGNIDYEQLQCLAQIHKPRMII
FT                   GGFSSYSGIVNWDKMREIADSVKAYFFVDMAHVAGLVAAGVYPNPIPYAHVVTATTHKT
FT                   LSGPRGGMILSNGSSSNSANNLDFYKKIDASVFPGSQGGPLVHVIAAKAIAFKEAMTLD
FT                   FKRYQRQVVENAQVMAREFSLRGFKVISGVPQNHLFVLDLTNHNITGQDASLALERANI
FT                   IVNKNCIPNDSRPPFITSGIRIGTSAITKRRFNNDDILELSEWISDILKQINNEKIILT
FT                   IKENVLKKCNLYPVYSKIKI"
FT   gene            complement(613580..614047)
FT                   /gene="tadA"
FT                   /gene_synonym="yfhC"
FT                   /locus_tag="BVAF_539"
FT   CDS_pept        complement(613580..614047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /gene_synonym="yfhC"
FT                   /locus_tag="BVAF_539"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_539"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33921"
FT                   /db_xref="GOA:E8Q6F2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6F2"
FT                   /protein_id="ADV33921.1"
FT                   /translation="MFDLLDMDIIWMRYAITLASVAALSGNVAIGAVLVYDGRLVGYGY
FT                   NAALIFHDPSAHAEIIALRVGGNYLGNYRLLNTTLYVTMEPCIMCVGAIINARIHRLVC
FT                   GAIGNKIRWINLLRINYFIDHAMINHQCDIKTGVLSEVCSKQIRDFFKYKR"
FT   gene            complement(614226..614603)
FT                   /gene="acpS"
FT                   /locus_tag="BVAF_540"
FT   CDS_pept        complement(614226..614603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BVAF_540"
FT                   /product="holo-[acyl-carrier-protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_540"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33922"
FT                   /db_xref="GOA:E8Q6F3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6F3"
FT                   /protein_id="ADV33922.1"
FT                   /translation="MIHGIGMDIIEIDRIKKIIVRSGDKLAQRILSKLELEIYYQKKNS
FT                   VYFLSKRFVAKEAASKAFGTGMKQGIAFNQFEIFNDDYGQPGLRFFSCAAQLAERLALK
FT                   KTYVTLTDTRVYACAVVILEC"
FT   gene            complement(614563..615351)
FT                   /gene="pdxJ"
FT                   /locus_tag="BVAF_541"
FT   CDS_pept        complement(614563..615351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="BVAF_541"
FT                   /product="Pyridoxine 5'-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_541"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33923"
FT                   /db_xref="GOA:E8Q6F4"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6F4"
FT                   /protein_id="ADV33923.1"
FT                   /translation="MSDVLLALNVDHIATIRNLRGTKYPDPVHAAFIAEKSGKIDGITV
FT                   HLREDRRHITDRDIKLLRETIQTTMNLEIAVVDEMINIAYQIKPDFCCLVPEKRQELTT
FT                   EGGLNLINQVNRLKDVVSKLQDVGIRVSLFIDPDEKQIDAACLIGAACVELHTGLYANA
FT                   LNNNNIRIIDTEYKRIANSIKYADNCGLIVNAGHGLNYSNVQAISKFIEIQELNIGHSI
FT                   ISRAIFDGLLQAILDMKTLLIESRRIRSDSWNRNGYNRNR"
FT   gene            complement(615641..616336)
FT                   /gene="rnc"
FT                   /locus_tag="BVAF_542"
FT   CDS_pept        complement(615641..616336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="BVAF_542"
FT                   /product="ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_542"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33924"
FT                   /db_xref="GOA:E8Q6F5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6F5"
FT                   /protein_id="ADV33924.1"
FT                   /translation="MSSLDFNVLQGKLGYFFCKLDLLELALTHRSFSNQHNERLEFLGD
FT                   AILNYVVANLLYHRYNCISEGDMSRIRSNLVCSKTLVRLAKEFNVGEYLKLGQGELKNG
FT                   GISRESILSNTVEAIIGGVFLDSNMKTVEILINNWYLCHLNAINFMNKQKDPKTRLQEY
FT                   LQRHGCPLPIYYVNRIQGKAHSQMFTIFCQISQLTDPSIGYGSSIQKAEQSAAENALKI
FT                   LIQNEDCEG"
FT   gene            complement(616407..617408)
FT                   /gene="lepB"
FT                   /locus_tag="BVAF_543"
FT   CDS_pept        complement(616407..617408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="BVAF_543"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_543"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33925"
FT                   /db_xref="GOA:E8Q6F6"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6F6"
FT                   /protein_id="ADV33925.1"
FT                   /translation="MINTFSFILMFITGLSGICWILKKLYVIFLYKRNEFKKINLKEIQ
FT                   SDCWSSNNVLNLFTLFFSKSYECISSIFPVLLLIFIFRSFIFEPFQIPSGSMMPTLLIG
FT                   DLILVNKFVYGIKDPINHKTLINFNKPKRGDLVVFKYPKDLKLNYIKRVIGEPGDKIIY
FT                   NIISKKLIIYPIDDHGEYSKELSITYSNIMLSNFVQTFYKSRTGEINTNFIKIEDDSVK
FT                   DYPDGIRLVETVESFGGLKHNILTMISPGDIRFMKMYDQHSSHLVSEWIVPKNEYFVMG
FT                   DNRDNSSDSRYWGCVPTQNIIGKAVMIWLSLKKQERQWPTGIQFNRIGNIIR"
FT   gene            complement(617463..619253)
FT                   /gene="lepA"
FT                   /locus_tag="BVAF_544"
FT   CDS_pept        complement(617463..619253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="BVAF_544"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_544"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33926"
FT                   /db_xref="GOA:E8Q6F7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6F7"
FT                   /protein_id="ADV33926.1"
FT                   /translation="MKYIRNFSIIAHVNHGKSTLSDRFIQMCGGLNEREMKSQVLDSMD
FT                   LERERGITIKSQSVTLNYVSKNGERYKLNLIDTPGHVDFTHEVFRSLSACEGALLVIDA
FT                   SQGIEAQTVANYQIAMEMNLKVLVILNKVDLLTANIEQMSRTIHNVIGTNIKDIILCSS
FT                   KTGFGVSKILECLIDNVPPPQGDPNAPLQVLIIDSWFNKYLGVVSLICVKNGVIHKGDM
FT                   LKSMSTEKIFVVEQIGIFTPKQIECALLHCGEVGWLVYASKHIASAEVGDTLTAVADPA
FT                   KVALPKFKKVQHCVYSGLFPVGSTTHKFFSDALYKLSLNDASLHYEPENSEYLGLGFRC
FT                   GFLGLLHMDIIQERLKREYSVDLVATAPEVAYEILTIGNKILSVDNAAKFLSIPNIKEI
FT                   REPIALCSFVFPKIYLGRIIELCTKKRGVQISLNYKKDQVSLIYELPMSEIILDFFDNI
FT                   KSISRGYASFEYEFKRFQVSDVVCLEILINGKRINELAMITHRTLVRRKGYALINRLQL
FT                   LIPRQQFDISIQAAIGNRIICRNTVKQLRKNVTHKCYGGDITRKNKLLYNQKMGKKRMK
FT                   QLGNVSLTRGAFLSLLSRND"
FT   gene            619403..620071
FT                   /gene="ung"
FT                   /locus_tag="BVAF_545"
FT   CDS_pept        619403..620071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="BVAF_545"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_545"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33927"
FT                   /db_xref="GOA:E8Q6F8"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6F8"
FT                   /protein_id="ADV33927.1"
FT                   /translation="MNQRLTWKLLLSKETKLPYFKKIFNILNQKNKLGITIYPKSTDIF
FT                   NAFRFTEFESVKVVILGQDPYHRPNQAHGLAFSVSPGITPPPSLKNIYKELSTDISDFI
FT                   TPKHGYLLSWAKEGVLLLNSILTVEQGKSCSHAYIGWEKFTDKIIHILNIYQKNIVFLL
FT                   WGNYAKRKGKIINTQKHYILSAAHPSPLSAHYGFLGCKHFSKTNALLLKHNKNTINWKL
FT                   "
FT   gene            complement(620358..620948)
FT                   /gene="grpE"
FT                   /locus_tag="BVAF_546"
FT   CDS_pept        complement(620358..620948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="BVAF_546"
FT                   /product="protein grpE"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_546"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33928"
FT                   /db_xref="GOA:E8Q6F9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6F9"
FT                   /protein_id="ADV33928.1"
FT                   /translation="MIDNNKDNLDDKIACSNAVNLKEESSESTSNINNIIDLKNDQIIK
FT                   LELQLSQLKEHERDTVLRLQAEIENIRRRNIQEIEKAHKFALERFVAELLPVIDNLERA
FT                   LGMVDRTNNSFSMIVEGIDLTLKSFLDTVYKFGVESIHEIHVPFNPEIHQAISTIESKE
FT                   CQANQVLTIIQKGYLLNGRLIRPAMVTVSKSKC"
FT   gene            621074..621949
FT                   /gene="ppnK"
FT                   /locus_tag="BVAF_547"
FT   CDS_pept        621074..621949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="BVAF_547"
FT                   /product="Probable inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_547"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33929"
FT                   /db_xref="GOA:E8Q6G0"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6G0"
FT                   /protein_id="ADV33929.1"
FT                   /translation="MTISIFHTIGLIGNTYYPQAIHIYYTLYNWLHKKGIKVIIEQHTA
FT                   NLLHARKAIIGNLKDIGNLADLAIIIGGDGNILRAANILIRYNIKIIGINLGTVGFLAD
FT                   LHPKSALAELSKVLTGNFTNEKRFLLDVKIKRNNTVFKLGTAINEVILHTNTIRQLIKF
FT                   KLYINNKFIFSSRSDGLIIATPTGSTAYSLSAGGPIVTPAINAVILIPICPHILSSRPI
FT                   VVDNKSIISLKFSQFISKIRLGCDNQAPINIYGKKEILIQRSNYFLDLIHPNTYNYFKN
FT                   LTIKLGWSKK"
FT   gene            622056..622454
FT                   /gene="smpA"
FT                   /locus_tag="BVAF_548"
FT   CDS_pept        622056..622454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpA"
FT                   /locus_tag="BVAF_548"
FT                   /product="Small protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_548"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33930"
FT                   /db_xref="GOA:E8Q6G1"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6G1"
FT                   /protein_id="ADV33930.1"
FT                   /translation="MDKKPHIKLKKKWNPFNRIHIYYYIWILLNSNCSSINQINYHLNY
FT                   LNTKQGSYLQSQDIQKIRIGMTKSEILSNIGITPTLKNCFGSNIWYYIYHQYINGKLQY
FT                   QTVILTFNNNDILTDFNILNNIKKNNHN"
FT   gene            complement(622517..622954)
FT                   /gene="yfjG"
FT                   /locus_tag="BVAF_549"
FT   CDS_pept        complement(622517..622954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjG"
FT                   /locus_tag="BVAF_549"
FT                   /product="polyketide cyclase/dehydrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_549"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33931"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6G2"
FT                   /protein_id="ADV33931.1"
FT                   /translation="MCYVKCLALVPYSVEQMFCLINDVGAYTEFIPGCNLIHVIQQSDT
FT                   ELIAEIHFTVSGVKQSVITHNFFTKNKSIIIYLINSPFKSFYGCWQFVPVTNVICKIEY
FT                   ISYYEFKSVLFKKFFNYSFQKVYKNIIKIFILRAKNIYSCF"
FT   gene            623119..623580
FT                   /gene="smpB"
FT                   /locus_tag="BVAF_550"
FT   CDS_pept        623119..623580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="BVAF_550"
FT                   /product="ssrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_550"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33932"
FT                   /db_xref="GOA:E8Q6G3"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6G3"
FT                   /protein_id="ADV33932.1"
FT                   /translation="MNQSYSKQIIQNKGVYHKYFIEKKIESGLVLLGWEVKAIRSKQVV
FT                   IDNSYISFQNQEAFIYNSFFKKINTNNNPIYDTNRIRKLLLKKQELLFLKEKIKRYKYT
FT                   IVIINLFWKNSWIKATIGLAKGKRNFDKRNIVHSNEWKSKKQNLVKYRQ"
FT   gene            623630..624061
FT                   /locus_tag="BVAF_551"
FT   tmRNA           623630..624061
FT                   /locus_tag="BVAF_551"
FT                   /product="tmRNA"
FT   gene            624214..624543
FT                   /gene="qacE"
FT                   /locus_tag="BVAF_552"
FT   CDS_pept        624214..624543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qacE"
FT                   /locus_tag="BVAF_552"
FT                   /product="quaternary ammonium compound-resistance protein
FT                   qacE"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_552"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33933"
FT                   /db_xref="GOA:E8Q6G4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6G4"
FT                   /protein_id="ADV33933.1"
FT                   /translation="MDYLYLFVAIISEVIATTSLKASEGLSKFCPAVVVIIGYSLSFIL
FT                   LSLVLRTIPMGIAYSYWAGLGIIFITFVGYFFYNQKIDIYSIVGIILIITGIILINIFS
FT                   QTVKH"
FT   gene            624639..626018
FT                   /gene="pssA"
FT                   /locus_tag="BVAF_553"
FT   CDS_pept        624639..626018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BVAF_553"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_553"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33934"
FT                   /db_xref="GOA:E8Q6G5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6G5"
FT                   /protein_id="ADV33934.1"
FT                   /translation="MFHKIKKSKNQLNYNIHNKFLIELPKITQKSKDFKVIYSPKEFYS
FT                   ALLNAIYQAYQHIYLVALYLENDQGGQNIINAILNVKKIRPSIQIKIVVDWYRAKRGRF
FT                   GESTYYTNIYWYNDIINKYPHTDIAIFGIPINISEILGVLHLKGFIIDDTILYSGANLN
FT                   NEYLHIYDKYRHDRYHIIKNKILSYTMLEYIEKTLLNSKVTKKFNQHELLPKLNKNKIL
FT                   IFRNKLRKFTYNYTNNANFNELSISPLVGLGKNSILNQTIYHLISSVKHKIIFCTPYFN
FT                   IPNTFIRIIHSLLHQNKIIEIIVGDKIANDFYNANQEHEPFKFINALPYLYEINLRLFV
FT                   KKLQNFIDNKQLIIRLWKAGNNGYHIKGIWVDDEWQLITGSNLNPRALRFDLENALLIH
FT                   DPLNELIHQKKQELNQIQSYTYLIPHYTSLQNISDYPAKIKRLILRIRQIKFDKLINKL
FT                   L"
FT   gene            complement(626114..629174)
FT                   /gene="rrl"
FT                   /locus_tag="BVAF_554"
FT   rRNA            complement(626114..629174)
FT                   /gene="rrl"
FT                   /locus_tag="BVAF_554"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(629395..629467)
FT                   /locus_tag="BVAF_555"
FT   tRNA            complement(629395..629467)
FT                   /locus_tag="BVAF_555"
FT                   /product="tRNA-Glu"
FT   gene            complement(629612..631222)
FT                   /gene="rrs"
FT                   /locus_tag="BVAF_556"
FT   rRNA            complement(629612..631222)
FT                   /gene="rrs"
FT                   /locus_tag="BVAF_556"
FT                   /product="16S ribosomal RNA"
FT   gene            631735..633417
FT                   /gene="purH"
FT                   /locus_tag="BVAF_557"
FT   CDS_pept        631735..633417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BVAF_557"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_557"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33935"
FT                   /db_xref="GOA:E8Q6G6"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6G6"
FT                   /protein_id="ADV33935.1"
FT                   /translation="MSSLLPIHQALISVFNKSELLNFSRALFKQGVCLISTEGTAHMLS
FT                   NAGVTTHPVSNYTKLPELMNGRVKTLHHKISAGILNRKGIDDTIMHKYNIKPIDMIVVN
FT                   FYPLNEILKKNNNYDLDKMLNHIDIGGPNMVRAAVKNYKNKVVIIDHNDYNNILSEMAI
FT                   YNGSISLKTRFILAKKAFRYITQYDSAILDYFNNDTLHKYLHQPVLNSTHKYIHYSNKS
FT                   PFPNTMNCMNLKFIKKQNMRYGENPHQRAALYQEAQYAQQKMIGTVITSKQLQGKPLSY
FT                   NNITDIDTALECVKLFTQPTCVIVKHTNPCGVATAHTINDAYHKAYQADPISAFGGIIA
FT                   FNQPLKDEKTAQSIINQHFIEAIIAPDINQNCLQILSKKQNIRVLKSGMWQNPNTSSLN
FT                   ITNNNNIDFKKISGGLLVQDYNQNCINDLQNLEIVTTTHPTDQEMQDLLFCWKIVKFVK
FT                   SNAIVCGKNYQTTGIGTGQMNRVFAVKIATDLQPRHSSINVKGSVLASDAFFPFTDGIH
FT                   VAAQMGIRGIIQPGGSIKDKEIINTANNYKIAMIFTHVRHFRH"
FT   gene            complement(633700..637950)
FT                   /gene="rpoC"
FT                   /locus_tag="BVAF_558"
FT   CDS_pept        complement(633700..637950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BVAF_558"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_558"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33936"
FT                   /db_xref="GOA:E8Q6G7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6G7"
FT                   /protein_id="ADV33936.1"
FT                   /translation="MKDLFGFFNKIHNSNKIEEFNAIKIELASPDMIRSWSFGEVKKPE
FT                   TINYRTFKPERDGLFCARIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTQSKVRRER
FT                   MGHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTSLECRQVL
FT                   TEEEYLDALEEFGDEFEAKMGAEAIQILLKNINLKNECEYLRELLADNNSETKRKKISK
FT                   RIKLIESFLYSDNKPEWMVLSVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNR
FT                   LKRLLDLSAPEIIVRNEKRMLQEAVDALLDNGRRGRAITGANKRPLKSLADMIKGKQGR
FT                   FRQNLLGKRVDYSGRSVITVGPYLKLHQCGLPKKMALELFKPFIYGQLESKGLASTIKS
FT                   AKKMVDREESVVWDILEDVIREHPIMLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCA
FT                   AYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMT
FT                   RERINAKGEGMVLSSEKEAERLYSLGIAELHAKIKIRITEYDLQEHGIWVSKTSVVDST
FT                   IGRSIFWMIVPKGLPFSLVNQVLGKKSISILLNHCYRVLGLKSTVTFADQIMYTGFLYA
FT                   ARSGASVGIDDMIIPVKKVDIVEAAESEVSEIQDQFQTGLVTAGERYNKVIDIWASANE
FT                   QVSKAMMDNLATETVINSDGIKETQASFNNIFMMADSGARGSAAQIRQLAGMRGLMAKP
FT                   DGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVV
FT                   TQDDCNTFSGITMSSIIEGGDVKESLRERVLGRVLLDNVFESNDNNKVLITRNTLLDEF
FT                   WCDVLDQHSIDIVKVRSVVTCDADFGVCASCYGRDLARGQLVNKGEAIGVIAAQSIGEP
FT                   GTQLTMRTFHIGGAASRVASESSIQVKHKGTIRLKHVKFVLNTQGKLIITSRHAELNVV
FT                   DKFDRTKESYKIPYGSTVIKQDGELVISGEVVAYWDPHTMPVIAEVSGFVKFIDMLDGQ
FT                   SVVNQTDELTGLTSIVVLDTSERVSSAKDLRPAIKIVDINGYDILITGTDISAQYFLPG
FT                   RSVVQLVDGSRIISGDVLARLPHETSGTRDITGGLPRVADLFEARRPKDSAILAEVSGV
FT                   ISFGRETKGKRRLMISSADGDAYEEMIPKWRHLNVFEGEYVDRGDVISDGPESPHDILR
FT                   LRGIHAVTSYIVNEVQEVYRLQGVRINDKHIEVIIRQMLRKAIVTNPGNSDFLTGEQVE
FT                   YSRIKIANRRLEGEGKIKVDSVRILLGITKASLATESFISAASFQETTRVLTESSVAGK
FT                   RDELRGLKENVIVGRLIPAGTGYSYHQERILKNYVTKKYTEDGNITKTIKPESISVTAD
FT                   EASANLTELLNATT"
FT   gene            complement(638065..642102)
FT                   /gene="rpoB"
FT                   /locus_tag="BVAF_559"
FT   CDS_pept        complement(638065..642102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BVAF_559"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_559"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33937"
FT                   /db_xref="GOA:E8Q6G8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6G8"
FT                   /protein_id="ADV33937.1"
FT                   /translation="MVYSYTEKKRVRKDFGKRPKVLDIPYLLSIQLDSFEKFINKDLNG
FT                   QYGLDAAFKSVFPIKSYNGNSELQYIDYTLGEPVFDVKECQARGVTFSASLRVQLCLVV
FT                   YEKDGSGSCNVIAKKIQEQEVYMGEIPLMTNNGTFIINGIERVVVSQLHRSPGVFFDSD
FT                   KGKTHSSGKVLYTARIIPYRGSWLDFEFDLKDNLFVRIDRRRKLPVTVLLKALSYTNDQ
FT                   ILNIFFDVVVYEVVGNRWYMHLIPDRLRGETALFEVRVNDTVYVDKGRRITTQHINKLK
FT                   FDNISKIEIPVEYLLGKVLIKDYINSSTGALIVSANTEISYEILNNLIKSGFNFIEVLF
FT                   SNDLDCGNYISETLRIDTTITRFDALVEIYRVMRPGEPPTKDAAEYLFSSLFFSEERYD
FT                   LSNVGRMKFNRSLQRNSIEGLGVLTKKDIVDVIKKLIDIRNGKGDVDDIDHLGNRRIRS
FT                   VGEMAENQFRIGLVRVERAVKERLSLGDVHMLSPQDLINAKPISAAVREFFNSSQLSQF
FT                   MDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLIN
FT                   SLSVYARANEYGFLETPYRKVNNGVVGNNIHYLSAIEEGDFIIAQANTNLNFQGQFIDD
FT                   FIICRNKGESGLFRKDQIDYMDVSTQQIVSVAASLIPFLEHDDANRALMGANMQRQAVP
FT                   LIRSEKPLVGTGMERAVAVDSGVTVVANRGGVVKYVDSSRIIIHVNLGELNSEESGIDI
FT                   YSLTKYIRSNQNTCINQRPCVSLGERVSIGDVIADGPSTDLGELSLGQNMRIAFMPWNG
FT                   YNFEDSMLVSERVVQEDRFTSIHIQELICISRDTKLGSEEITADIPNVGETALSKLDES
FT                   GIVYIGAEVIGGEILVGKITPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVCGT
FT                   VIDVQIFTRDGVNKDKRALQIESMKLNQVKKDLEEEFKIFESALFDRVYELLLNSGEVE
FT                   EERLLKMERRFWLKLELNDLVNRNQLFQLYNQYLDLKSLFEKKIEAQYQKVTQGDELAP
FT                   GILKVVKVYLAVKRHIQPGDKMAGRHGNKGVISKINPVEDMPYDEYGVPVDIVLNPLGV
FT                   PSRMNIGQILETHLGMAAKGIGDKINYLLQQHKEVYRLREFIQKAYDLGKGLRQNVNLD
FT                   NFSDVEILELAKNLKKGMPIATPVFDGATEQEIKDLLKLSGLPESGQITLFDGCTGEVF
FT                   ERQVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEA
FT                   YGASYTLQEMLTVKSDDVNGRTKMYKNIIDGNHSMEPGMPESFNVLLKEIRSLAINIEL
FT                   EE"
FT   gene            complement(642310..642690)
FT                   /gene="rplL"
FT                   /locus_tag="BVAF_560"
FT   CDS_pept        complement(642310..642690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BVAF_560"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_560"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33938"
FT                   /db_xref="GOA:E8Q6G9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6G9"
FT                   /protein_id="ADV33938.1"
FT                   /translation="MSLKKEEILDGISEMSVMDIMQLVSMIEKKFGVVSGPFITNNETK
FT                   ITESSQPTEPEQTEFTVILSVVGNNKIPVIKMVRSITGLGLKESKELVESAPVTLKESM
FT                   SKTDAEDLKKQLEEIGAKIEIK"
FT   gene            complement(642788..643288)
FT                   /gene="rplJ"
FT                   /locus_tag="BVAF_561"
FT   CDS_pept        complement(642788..643288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BVAF_561"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_561"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33939"
FT                   /db_xref="GOA:E8Q6H0"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6H0"
FT                   /protein_id="ADV33939.1"
FT                   /translation="MVLSMKKKEEIVYRIKENFKSALSVVVASLHGVTACIMNELRKES
FT                   RDLGVYIKVVPNSLLKKAVVDTSFECLSKVFVGSNVVAFSTKHPRDAGHILVKFFKERE
FT                   CFKIAGAAFEGNFIGSEQIDLLSNLPDHKDSLLRLILILRRISIGNLINILKRLSSQKK
FT                   LKS"
FT   gene            complement(643625..644338)
FT                   /gene="rplA"
FT                   /locus_tag="BVAF_562"
FT   CDS_pept        complement(643625..644338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BVAF_562"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_562"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33940"
FT                   /db_xref="GOA:E8Q6H1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6H1"
FT                   /protein_id="ADV33940.1"
FT                   /translation="MKQIGDGIKRTLSRRNGTRVQYSIVDGLKLLKNTVKAKFIESVEA
FT                   AINLGIDARKSDQSIRSNVILPHGIGKSVRVAVFTQGKDKIKLAKDAGAELVGLEDLYD
FT                   KIKADGCVGFDVVLASPDVMHIVSKLGSILGPRGLMPNPKMGTISSDIQESIKNVKLGQ
FT                   VRYKNDKNGIVHAIFGKIDFSIIDLKENLETLIASIQQVKPVQFKGTYIKKISISTTMG
FT                   KSVILDKNSFSMVIY"
FT   gene            complement(644335..644775)
FT                   /gene="rplK"
FT                   /locus_tag="BVAF_563"
FT   CDS_pept        complement(644335..644775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BVAF_563"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_563"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33941"
FT                   /db_xref="GOA:E8Q6H2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6H2"
FT                   /protein_id="ADV33941.1"
FT                   /translation="MISKKVQAFIKLQIFAGSANPSPPIGPALGQQGVNIIQFCKEFNA
FT                   KTIKLETDLIVPVVVTVYSDRSFSFIVKTPPTAFLLKRAVGMQSSSGNAKILNPGKISR
FT                   AQINDIAKIKFVDMTGVDLEAVSKSIIGTARSMGLEVVEENL"
FT   gene            complement(644906..645448)
FT                   /gene="nusG"
FT                   /locus_tag="BVAF_564"
FT   CDS_pept        complement(644906..645448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BVAF_564"
FT                   /product="Transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_564"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33942"
FT                   /db_xref="GOA:E8Q6H3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6H3"
FT                   /protein_id="ADV33942.1"
FT                   /translation="MDSVKKRWYVVQAFSGFENRVVHSLNEYIKLKNMGSMFGDIMVPT
FT                   EEVVEMRAGQRRKSERKFFPGYVLVQMVMNDASWHLVRSIPKVMGFVGGTCDKPAPIGD
FT                   KEIDNIIYRLQQIGDKPRPKTLFEPGELIRVSDGPFSDFNAVVEEVDYEKNRLKVSVSI
FT                   FGRATPVDLDFSQVEKS"
FT   gene            complement(645460..645834)
FT                   /gene="secE"
FT                   /locus_tag="BVAF_565"
FT   CDS_pept        complement(645460..645834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BVAF_565"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_565"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33943"
FT                   /db_xref="GOA:E8Q6H4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6H4"
FT                   /protein_id="ADV33943.1"
FT                   /translation="MNIQGLKKKIEFIEIIKWIGIVSLLCLSCIASYFFYDYNFYIKKM
FT                   MVFFCLAVAIGIFLITKIGKLLIIFLKESSIELRKVVWPTYQDSLNTTLIVVVVTVIVS
FT                   LVLWGLDTVLLHVISFGLRL"
FT   gene            complement(645965..647149)
FT                   /gene="tuf"
FT                   /locus_tag="BVAF_566"
FT   CDS_pept        complement(645965..647149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BVAF_566"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_566"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33944"
FT                   /db_xref="GOA:E8Q6H5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6H5"
FT                   /protein_id="ADV33944.1"
FT                   /translation="MSKEKFQRIKPHINVGTIGHVDHGKTTLTAAITTVLAKKYGGCAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTGLRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLARQVGVPHIVVFLNKCDMVDDIELLELVEMEVRELLSRYDF
FT                   PGDNASIIQGSALKALEGEEVWTKKILDLANALDSYIPEPKRLIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVESGIIKVGEEVEIVGIRDTVKTTCTGIEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEVERGQVLSKPGCIKPHSHFESEVYILNKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPKEVEMVMPGDSVKMVVNLIVPIAMGDGLRFAIREGGRTVGAGIVSKVMA"
FT   gene            complement(647258..649387)
FT                   /gene="fusA"
FT                   /locus_tag="BVAF_567"
FT   CDS_pept        complement(647258..649387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BVAF_567"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_567"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33945"
FT                   /db_xref="GOA:E8Q6H6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6H6"
FT                   /protein_id="ADV33945.1"
FT                   /translation="MNNRITPIEYYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVH
FT                   TGSATMDWMEQEQERGITITSAATTCFWSGMSNEFPLHRINIIDTPGHVDFTVEVERSM
FT                   RVLDGVVMVYCAVGGVQPQSETVWRQANKYKVPRIAFINKMDRMGADYLRVVSELRTKL
FT                   CANPVPIQLALGAEDQFTGIIDLIKMKSIKWNDTDQGVTFVYEDVPKHLFELTNVWRKN
FT                   LIESAVEESEELLDKYLSGCGTITESEIKVALRRRVLKNEVLLVTCGSAFKNKGVQSML
FT                   DAVVEYLPSPTDIRSVKGVLKDGSTVVERYSRDDEPFSALAFKVSNDPFVGNLTFFRVY
FT                   SGIVNSGDNIFNSVKDKRERFGRIVQMHANKREEIRVVYAGDIAAAIGLKDVSTGDTLC
FT                   DVNNPIILERMEFPEPVISVMVEAKTKLDQEKMGTALNRLSQEDPSFRVWIDQDSGQTI
FT                   IAGMGELHLEILVERMKREFNIEAHVGRPQVAYRETIRAAIQQEGKFIRQSGGRGQFGH
FT                   VWLRIEPINPNIIGGGDAIYKFSSEIVGGVIPKEFIPAIDKGVQEQISNGVLAGYPIVG
FT                   VCVTVFDGSYHEVDSSEIAFKIAGSMAFKEGFMKANPVLLEPIMKVEIETPEDYVGDVI
FT                   SDLNRRRGMIINLESVTVIGRIICAHVPLSEMFGYATTLRSKTQGRASHSMEFFKYNEV
FT                   PYNVAQSIIETRRIR"
FT   gene            complement(649551..650021)
FT                   /gene="rpsG"
FT                   /locus_tag="BVAF_568"
FT   CDS_pept        complement(649551..650021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BVAF_568"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_568"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33946"
FT                   /db_xref="GOA:E8Q6H7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6H7"
FT                   /protein_id="ADV33946.1"
FT                   /translation="MSRRRIAKKRMILTDSKFQSSLLAKFINILMLNGKKSVAEFIVYS
FT                   ALDIVKHRSGKDCIESFERALDNVRPVVEVKSRRVGGSTYQVPVEVRLVRRNTLAMRWI
FT                   IESARKRQDKSMEIRLANELLDASEGKGNAVKKREEVHRIAESNKAFAHYRW"
FT   gene            complement(650145..650516)
FT                   /gene="rpsL"
FT                   /locus_tag="BVAF_569"
FT   CDS_pept        complement(650145..650516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BVAF_569"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_569"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33947"
FT                   /db_xref="GOA:E8Q6H8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6H8"
FT                   /protein_id="ADV33947.1"
FT                   /translation="MVTINQLVRSARSIRISKSNVPALGGCPQRRGVCVRVYTTTPKKP
FT                   NSALRKVCRARLPNGLEVTCYIGGEGHNLQEHASILIRGGRVKDLPGVRYHVIRGALDC
FT                   AGVKDRKKGRSKYGTKKPK"
FT   gene            complement(651329..651913)
FT                   /gene="pabA"
FT                   /locus_tag="BVAF_570"
FT   CDS_pept        complement(651329..651913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BVAF_570"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase component II"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_570"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33948"
FT                   /db_xref="GOA:E8Q6H9"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6H9"
FT                   /protein_id="ADV33948.1"
FT                   /translation="MNKILIIDNYDSFTWNLYQYFREMGGMVEVRRHDSISVLDLDHLT
FT                   PDRLVISPGPGTPGNSGISLQALSYFCNRIPIFGVCLGHQVIAQFFGAKLKCAQSIMHG
FT                   KSSIISHNNKGVFCGLMQSLRVIRYHSLVVDLNSVPVSLEITAWSTCSSSQGREIMGIR
FT                   HRSLLIEGVQFHPESVLTEQGYEMLFNFMLY"
FT   gene            complement(652119..653117)
FT                   /gene="trpS"
FT                   /locus_tag="BVAF_571"
FT   CDS_pept        complement(652119..653117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="BVAF_571"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_571"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33949"
FT                   /db_xref="GOA:E8Q6I0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6I0"
FT                   /protein_id="ADV33949.1"
FT                   /translation="MDKLLVFSGTQPSGKLTIGNYIGAIRHWIVMQKYYECMYCIADLH
FT                   LISTVSSSNVYAFRKMSLDTLALYLACGVDPNVSTIFMQSHVPEHTQLNWLLNCCAYYG
FT                   ELSRMTQFKEKSKFKQDSVNVGLFNYPILMAADILLYQTNFVPVGDDQKQHLEFTCNIA
FT                   RRFNNKFGTVFTIPKILVPDFGSRIMSLLNPLKKMSKSDQDSNNYISLLDDATLISKKV
FT                   KRAITDSDQPPAIYYDPVEKPGVSNLLAILSGIGGESISNLELIFKNKTYSCLKSNLIQ
FT                   SLSTVLKQIQNRYFNERSNENKLNNILCVGAKKARQKANLTLKKVYQLIGL"
FT   gene            complement(653401..654072)
FT                   /gene="rpe"
FT                   /locus_tag="BVAF_572"
FT   CDS_pept        complement(653401..654072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="BVAF_572"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_572"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33950"
FT                   /db_xref="GOA:E8Q6I1"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6I1"
FT                   /protein_id="ADV33950.1"
FT                   /translation="MMNKFLIAPSILSADFAKLGEEVLCVISAGADMLHFDVMDNHYVP
FT                   NLSIGPMVLKSLRNYGVTVPVDVHLMIKPIDGLISDFVDAGAHCISFHPEATENIDRSI
FT                   QLIRKHGCGVGLVLNPGTTLECLKYVINKVDVITLMSVNPGFGGQVFLPETLNKIRQTR
FT                   KLINAIDDTISLAVDGGINFGNFNAVRESGANIFIIGSAIFNSTNYHDVICRFRSMLPQ
FT                   Y"
FT   gene            complement(654350..655450)
FT                   /gene="aroB"
FT                   /locus_tag="BVAF_573"
FT   CDS_pept        complement(654350..655450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="BVAF_573"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_573"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33951"
FT                   /db_xref="GOA:E8Q6I2"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6I2"
FT                   /protein_id="ADV33951.1"
FT                   /translation="MMKRIFIELQERSYFVYIAHGILKDTKFRWKLKKGDVAVLITDIQ
FT                   VAPLYLKRICNTLNSFGVITDRLVLPVGEQSKSLSVLDQIFTKLLNKNYDRNIVLIALG
FT                   GGVIGDLTGFAAATYHRGIRLIQVPTTLLAQVDASVGGKTGINHVLGKNMIGAFYQPVE
FT                   VIIDLDCLFTLSMKEFSAGLAEVIKYAVAFDASFFNWLENNLDDLLKFHPQSLMYCVYR
FT                   CCKLKASIVSLDEREIQIGKRSLLNLGHTYGHAIESYFSYTGWSHGEAISVGIVMAVNA
FT                   ALHLQKFLSTRDAMRIKLLLERAHLPVHGPQEMQSKDYLRYMARDKKSRLGKINLVLPV
FT                   SIGRARVFLNIDQNVILNSIEYNLIK"
FT   gene            complement(655503..656063)
FT                   /gene="aroK"
FT                   /locus_tag="BVAF_574"
FT   CDS_pept        complement(655503..656063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="BVAF_574"
FT                   /product="shikimate kinase 1"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_574"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33952"
FT                   /db_xref="GOA:E8Q6I3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6I3"
FT                   /protein_id="ADV33952.1"
FT                   /translation="MLVERRNIFLIGPMGAGKSTVGRQLAKQLSLLFFDSDQEIEIRTG
FT                   ANISWVFDVEGESGFRDREEKIINELTKKTGIVLATGGGSVLSSITRKNLSSRGLVVYL
FT                   KTTIDKQLIRTKRDKRRPLLLQSLNDGFSTNDDSIRETLELLAKARNPLYEEIANITVS
FT                   TDEQNVRFVVNKILVLCKKQNIL"
FT   gene            657022..657630
FT                   /gene="nfuA"
FT                   /gene_synonym="gntY"
FT                   /gene_synonym="yhgI"
FT                   /locus_tag="BVAF_575"
FT   CDS_pept        657022..657630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfuA"
FT                   /gene_synonym="gntY"
FT                   /gene_synonym="yhgI"
FT                   /locus_tag="BVAF_575"
FT                   /product="Fe/S biogenesis protein nfuA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_575"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33953"
FT                   /db_xref="GOA:E8Q6I4"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6I4"
FT                   /protein_id="ADV33953.1"
FT                   /translation="MLYITKAAQQYLAELLKKQNTNTHIRLSVTNPGTLHAQCNLHYYT
FT                   PKQNDSYNYLKIQFNQFAIYLEKIIAPFIQNTQIDIITDDLRTQITIQSPNLTNSIDNP
FT                   SDNINKKITNNSSLTDRIKYVITQQINPQLAMHGGSVSLIKVNTDGMAILQFHGGCNGC
FT                   SMALYTIKEGIEKTLKKFFPELKGVIDSTSHQRGKHSFY"
FT   gene            complement(657799..658914)
FT                   /gene="asd"
FT                   /locus_tag="BVAF_576"
FT   CDS_pept        complement(657799..658914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="BVAF_576"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_576"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33954"
FT                   /db_xref="GOA:E8Q6I5"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6I5"
FT                   /protein_id="ADV33954.1"
FT                   /translation="MKTVGFVGWRGMVGSVLMNRMKEESDFNHFNAVFFSTSQAGEKAP
FT                   VVIQDHQNLILQNAWDIEYLKSLDILVTCQGSTYTKFIYPRLRASGWTGYWIDTASYLR
FT                   MHQDAVIVLDPVNKLVIERGINNGVKTFVGGNCTVSLMLMALGGLFNQNLIEWIFVSTY
FT                   QAASGYGAKAIKELLVQIGQVYNTISDLLDDSNIPILEIERVITEFSKTNTISTDCFKK
FT                   PLIGNVLPWIGEECVEYKGQSREEWKGQLETNKILNTSKLILIDSLCVRVCSLRCHSQS
FT                   LMIKLKKNLCLTEIENLIESHNNWVKVVSNQADISLGQLTPLSVSGTLRIAIGRLRKMN
FT                   IGDEFISAFTVGDQLLWGAAEPIRRILNRLL"
FT   gene            659139..659732
FT                   /gene="yhgN"
FT                   /locus_tag="BVAF_577"
FT   CDS_pept        659139..659732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhgN"
FT                   /locus_tag="BVAF_577"
FT                   /product="putative MarC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_577"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33955"
FT                   /db_xref="GOA:E8Q6I6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6I6"
FT                   /protein_id="ADV33955.1"
FT                   /translation="MNDMISATILLFLIMDPIGNLPIFMSILKDLSPKRRQIIVIREML
FT                   IALLLMLSFLFVGEHILTFLNLHTETVSISGGIVLFLIAIKMIFPEQEGNNSGFSSEEE
FT                   PFLVPLAIPLVAGPSVLATLLLLSHQYPHHINLIIIALIIAWGLSILILMLSNLLSNLL
FT                   GNKGINALERLMGLLLIMISTQMLLDGIRTYLYP"
FT   gene            complement(660117..660923)
FT                   /gene="yigL"
FT                   /locus_tag="BVAF_578"
FT   CDS_pept        complement(660117..660923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yigL"
FT                   /locus_tag="BVAF_578"
FT                   /product="cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_578"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33956"
FT                   /db_xref="GOA:E8Q6I7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6I7"
FT                   /protein_id="ADV33956.1"
FT                   /translation="MFCVVVSDLDGTLLTPSNQLTYFTRKILKLLVSNFRVHFILATGR
FT                   HYVNVTAIRNYLDIHDYIITANGSRIHNSDSKLIASYDLDLDIIYDLLQMTQYDLKIVT
FT                   NVCKHDGTWVVSRYPYNNTSIFRNFVSYNEIYEKKVFFCSDVSKIYFTSENCQELCFLE
FT                   KRITERWGARVNVSFSFPTCLEVMPGGISKGFALEQVVNLLGYRLKDCISFGDGMNDQE
FT                   MLSMTGKGCIMYNAQKRLKDSLPLLEVIGSNADEAVPHYLKDMYFC"
FT   gene            complement(661094..662035)
FT                   /gene="corA"
FT                   /locus_tag="BVAF_579"
FT   CDS_pept        complement(661094..662035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="BVAF_579"
FT                   /product="Magnesium transport protein corA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_579"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33957"
FT                   /db_xref="GOA:E8Q6I8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6I8"
FT                   /protein_id="ADV33957.1"
FT                   /translation="MLKVFQLKNNYLFRIDEKDLFNAINDILWVDIIKLNNNENYCVQH
FT                   ILEQYKVNFFKLKDIESKRFCSNQDGTYISSFFFSCDDHNQISNVIVFFIIHNDRLYTL
FT                   RGSRFPVFCTYQRSLSDHWLGDGNAYELLLSLFSVKIDDLTDKIENIYSTLETLSFVVM
FT                   GGQQIDEYDSILSDLAELESMSWKIQINLLDTERAIKFLARQSKLPTTQKRYANEILND
FT                   IILLLSYNESIFQKVSFLTQSVMGLINIEQNRIIKIFSIVFLPPTLIASSYGMNFEFMP
FT                   ELKWLFGYPIAIILMILTGLVPYLYFKYKNWL"
FT   gene            complement(663058..663774)
FT                   /gene="yigB"
FT                   /locus_tag="BVAF_580"
FT   CDS_pept        complement(663058..663774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yigB"
FT                   /locus_tag="BVAF_580"
FT                   /product="putative HAD-superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_580"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33958"
FT                   /db_xref="GOA:E8Q6I9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6I9"
FT                   /protein_id="ADV33958.1"
FT                   /translation="MIQICRSIKPFYAITLDLDNTLYDNKPIICRAEDKLVFFLRRYHP
FT                   ALYNVRKSDFYFSKKMVKSLDPEIYHDVNSWRWKSLENILLKSGLSKHDAQLGADCAME
FT                   MIIYWRNQIDVSINTIQALKALSSKWPLIAITNGNSNLIMCGLRRYFSDVLRAGIHGRA
FT                   KPYKDMYLLSSKYFGMSCKYILHVGDDLYSDIQGAILSGMQSCWMQRYSLSSIIVNTKL
FT                   LPHLVISDLTSLAYFL"
FT   gene            complement(663812..664645)
FT                   /gene="dapF"
FT                   /locus_tag="BVAF_581"
FT   CDS_pept        complement(663812..664645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="BVAF_581"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_581"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33959"
FT                   /db_xref="GOA:E8Q6J0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6J0"
FT                   /protein_id="ADV33959.1"
FT                   /translation="MRFSKMHGLGNDFMVVDSITQKVHVTFEKIQWLSNRYRGIGFNQL
FT                   LIVEPPYDPSIDFHCRIYNADGSEVYQCGNGIRCVARFVYIKKLTNKENIRISTRFGNM
FT                   YVSIIDDDLISVNMGEPIFEPDKIPFIFPQYQKNYILFLPTQTILCGVVSIGNPHCIVL
FT                   VETIESVSLNILGPALEDHHCFPKKSNISFMRIIDSENIELRVYERGVGETQACGSAAC
FT                   AAVAFGIQQGLLIREERLVQVHLLGGSLFVSWKGIGYPLYMIGSTSYVYDGCIHL"
FT   gene            665210..666142
FT                   /gene="hemC"
FT                   /locus_tag="BVAF_582"
FT   CDS_pept        665210..666142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="BVAF_582"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_582"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33960"
FT                   /db_xref="GOA:E8Q6J1"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6J1"
FT                   /protein_id="ADV33960.1"
FT                   /translation="MNTKFLRIATRKSRLAICQSEYVCNELKRFHPNIKIKLVPIVTTG
FT                   DKFFNSTTKIKIKKGAFIKELEYALIENRADIAVHSMKDMTASLPNELILPILCKRIDP
FT                   RDAFVSIKYSNIDMLPSGSIIGTSSLRRQCQIQARRSDLTLHNLRGNIDTRIKKLHQGK
FT                   YDAIILAVAGLNRLHLTQYIKTYINPKDLLPAMGQGAIAIECRKKDIDTLSLLSPLYHQ
FT                   ETSLRIQSERAVTTYLEGYCQFPIASYSEIHNHQIWLRALIGLPDGSKIIRTEGRAPFD
FT                   QAEKLGLFLAKKLLNQFKETTQLDINAIK"
FT   gene            666173..666922
FT                   /gene="hemD"
FT                   /locus_tag="BVAF_583"
FT   CDS_pept        666173..666922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="BVAF_583"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_583"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33961"
FT                   /db_xref="GOA:E8Q6J2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6J2"
FT                   /protein_id="ADV33961.1"
FT                   /translation="MNILVTRPSPNGEELVHKLLAIGKFAHHLPLIYFSSGKNLPLIKK
FT                   YLNLLESGDLLFFLSQHAVKYAHFQLLKTGGHWPSTITYYSIGSRTSLKMYILSGISSK
FT                   YPYNEETSENLLQFPELIQNISGRRALILKGNNGRTLLQNTLQQRGALVLSFECYTRNP
FT                   IKYNGQEQLNLMLALNITTIVVTTKETLKQLYYLIPQHYRDTWLIQCQLIVVSIRLSKI
FT                   AENLGWNKTNIIIAKSANNNAIFNILK"
FT   gene            complement(667043..667116)
FT                   /locus_tag="BVAF_584"
FT   tRNA            complement(667043..667116)
FT                   /locus_tag="BVAF_584"
FT                   /product="tRNA-Pro"
FT   gene            complement(667211..667296)
FT                   /locus_tag="BVAF_585"
FT   tRNA            complement(667211..667296)
FT                   /locus_tag="BVAF_585"
FT                   /product="tRNA-Leu"
FT   gene            complement(667371..667445)
FT                   /locus_tag="BVAF_586"
FT   tRNA            complement(667371..667445)
FT                   /locus_tag="BVAF_586"
FT                   /product="tRNA-His"
FT   gene            complement(667551..667624)
FT                   /locus_tag="BVAF_587"
FT   tRNA            complement(667551..667624)
FT                   /locus_tag="BVAF_587"
FT                   /product="tRNA-Arg"
FT   gene            complement(667835..669094)
FT                   /gene="rho"
FT                   /locus_tag="BVAF_588"
FT   CDS_pept        complement(667835..669094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="BVAF_588"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_588"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33962"
FT                   /db_xref="GOA:E8Q6J3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6J3"
FT                   /protein_id="ADV33962.1"
FT                   /translation="MNLTKLKNIPVSELVKLGEGMGLENLARMRKQDIIFAIFKQHAKT
FT                   GEDIFGDGVLEILQDGFGFLRSSDSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNDVNYDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSISHNYPDCVLIVLLIDERPEEVTEMQRL
FT                   VHGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHRKDVIILLDSITRLARAYNTIVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNMEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTHDELQKIWILRKIIHPMGEIDAMEFM
FT                   MNKLSMTKTNDEFFDMMKRC"
FT   gene            complement(669516..669860)
FT                   /gene="trxA"
FT                   /locus_tag="BVAF_589"
FT   CDS_pept        complement(669516..669860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="BVAF_589"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_589"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33963"
FT                   /db_xref="GOA:E8Q6J4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6J4"
FT                   /protein_id="ADV33963.1"
FT                   /translation="MSQNILCLTDDNFSEYFSDSVNVKNNFLFLIDFWAEWCNPCKMLA
FT                   PILEEIAVEFRGKIKVAKLNIDSNPIVTKKYNIRSIPTLLLIKNDTIVATKVGLMSKQQ
FT                   LCDFINTYVN"
FT   gene            complement(670088..671584)
FT                   /gene="ilvC"
FT                   /locus_tag="BVAF_590"
FT   CDS_pept        complement(670088..671584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="BVAF_590"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_590"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33964"
FT                   /db_xref="GOA:E8Q6J5"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6J5"
FT                   /protein_id="ADV33964.1"
FT                   /translation="MSNYFNKLSFIQKLKHLGKCRLISTNEFSKGIQLLKFKKIVIIGC
FT                   GSQGLNQGLNMRDSGLQVAYALRYESIINKTESYINAVRHGFVVGTYTELVPEADLVIN
FT                   LTPDKNHDFVINQIEPLMKYKSVLGYSHGFHIVEIGKKIRRDITVIMVAPKCPGTEVRR
FT                   EYERGFGVPSLIAVHEENNLSGSGIELAKAWAFALGSHKAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQVGSILCFNRMVESGVDVAYAGKLVQNGWEVITEALKQGGITLMMDRLSNFS
FT                   KLRAFELSKQLKKILRPVFEKHMENILTGFFSKEMIADWANKDCNLLSWRENTKKLLFE
FT                   QAPVYDKKIPEQIYFDHGVLMVAMLKAGIELSFDIMIESGIKPESAYYESLHELPLIAN
FT                   TIARKRLYEMNMVISDTAEYGCYVFSNTVIPILQKEFMPNLKKGDLDNIMVNDVDNNHW
FT                   VMSIDNVVLRDVNETIRSHPVEKIGVYLRSYMKKMVSLSF"
FT   gene            complement(671636..673168)
FT                   /gene="ilvA"
FT                   /locus_tag="BVAF_591"
FT   CDS_pept        complement(671636..673168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="BVAF_591"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_591"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33965"
FT                   /db_xref="GOA:E8Q6J6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6J6"
FT                   /protein_id="ADV33965.1"
FT                   /translation="MFSSRERSSLLYLKTALRSHVYEVVQVTPLQIMNKLSQRFKNVIL
FT                   VKREDRQPVHSFKLRGAYAMISSLTQAQKSAGVITASAGNHAQGVAFSAKYLGIDSIIV
FT                   MPINTADIKIDAVRHLGGEPLLFGSNFDEAHIEALRLSKKNHLIFVPPFDHSLVIAGQG
FT                   TLAMELLQQDAHLDRIFVPVGGGGLAAGVAVLIKYLMPQIKVVGVESEESASLSAALLA
FT                   GVPVSLNTVGSFAEGVAVRCVGNETFRLCKNYLDDVITVDNDEICAAIKDLFEDVRAIA
FT                   EPAGALALAGMKKYIQQHEIHGERLAHILSGANINFHELRYISERCELGEEREALMVVT
FT                   IPEKKGSFLEFFKILENRSVTEFNYRYSGTNEVCIFIGVRLKHGRYERNCIVRNILSHG
FT                   FSVIDVSDNEMAKLHARYMIGVRALHSVHERIFSFEFPESPGALLKFLNTLGTHWNISL
FT                   FHYRNHGTDYGHVLAGFELSNQESKFDQYVSQLGYVCRDVTTNPVFQFIRIN"
FT   gene            complement(673224..675086)
FT                   /gene="ilvD"
FT                   /locus_tag="BVAF_592"
FT   CDS_pept        complement(673224..675086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BVAF_592"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_592"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33966"
FT                   /db_xref="GOA:E8Q6J7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6J7"
FT                   /protein_id="ADV33966.1"
FT                   /translation="MPKYRSSITTQGQNMAGARALWRATGMVSEDFNKIIVAVVNSFTQ
FT                   FVPGHIHLRDVGKIVAKEINMNGGVAKEFNTIAIDDGIAMGHSGMLYSLPSRDLIADSV
FT                   EYVINAHCVDAMVCISNCDKITPGMLMAALRLNIPTIFVSGGPMESGSIRLSESNGHNT
FT                   INKLSLVDVIVSSADPKVTTEDKERIELAACPTCGSCSGMFTANSMNCLTEALGLAQPG
FT                   NGSLLATHCDRRTMFIDAGRNIMKLANLYYEEDNYSVLPRNIANRLAFENAMMLDIAMG
FT                   GSTNTVLHLLAAAQEGEIEFTMKDIDQLSKKVPYLCKIAPNSKQYYVEDFHKAGGVMGI
FT                   LGELNSCGLLNTNVNNILNKSLLETLLQYDILSCNDFKIKKMYAAAPAGIRTTKAFSQN
FT                   KRWSALDIDRCSGCIRSRAYAYSQDGGLAVLYGNIAKGGCLVKTAGVSISLRKFRGPAK
FT                   VYESQEESVQAILTGKICPGDVIVIRYEGPKGGPGMQEMLYPTSFLKSMNLDMCCALIT
FT                   DGRFSGGTSGLSIGHISPEAASGGLIGLVYDGDIINIDIDERNITLEVSKYVLDRRNEL
FT                   EINRGIKSWTPINRDRVVSMSLKAYAKLVTSADKGAVRDKSQLL"
FT   gene            complement(675180..676103)
FT                   /gene="ilvE"
FT                   /locus_tag="BVAF_593"
FT   CDS_pept        complement(675180..676103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="BVAF_593"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_593"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33967"
FT                   /db_xref="GOA:E8Q6J8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6J8"
FT                   /protein_id="ADV33967.1"
FT                   /translation="MIKKSNFIWFNGKMVPWDKANIHVLSHALHYGSSVFEGMRCYQSY
FT                   KGAVIFRLKDHIQRLINSAKIYRMPISWSRQELIEACKIVIRKNNLIDAYIRPLLFIGD
FT                   VGIEINPIIQYDTDLVIIAFYWESYLGKDSLNLGIDAMVSSWNRVSANTIPYMAKAGGN
FT                   YLSSMLISNEAHRHGYHEGIGLNIFGYISEGSGENLFVIKDGIILTPSCSSSVLLGITR
FT                   DSIIKLAASINLEVRECMLPREYLYIADEVFMVGTAAEITPVRSIDGIKIGSGGVKGPI
FT                   TMKLQELFFGLFTGEVKDEWDWLEEV"
FT   gene            complement(676176..676415)
FT                   /gene="ilvM"
FT                   /locus_tag="BVAF_594"
FT   CDS_pept        complement(676176..676415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvM"
FT                   /locus_tag="BVAF_594"
FT                   /product="putative acetolactate synthase isozyme 2 small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_594"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33968"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6J9"
FT                   /protein_id="ADV33968.1"
FT                   /translation="MIVYYSLFIQARFCSEVVERILRVTRHRGFELCALNTIVYNIDNN
FT                   KQITLFLTVSSEKAIYLLCTQLNKLVDIQYIEVR"
FT   gene            complement(676457..678139)
FT                   /gene="ilvG"
FT                   /locus_tag="BVAF_595"
FT   CDS_pept        complement(676457..678139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="BVAF_595"
FT                   /product="Acetolactate synthase isozyme 2 large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_595"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33969"
FT                   /db_xref="GOA:E8Q6K0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6K0"
FT                   /protein_id="ADV33969.1"
FT                   /translation="MNGAQWVIKELQQRGVDVIFGYPGGAIMPMYDALFDSEIKHLLCR
FT                   HEQGAIIAAIGYARATGRVGVCFATSGPGATNLITGLADALLDSIPIIAITGQVGLKFI
FT                   GTDAFQEIDVLGLSLACTKHSFLVHSLDVLPDIIDEAFSIALYGRQGPVLIDIPKDIQL
FT                   SSSREGGIFSFAQASVKNDKHSVCNHHIYTNKDNIALARVLMSQSKCPVIYVGGGVGMA
FT                   GAVLSLRKFIANTGIPTVVTLKGLGAPDYTEDYYLGMLGMHGNQAANLAVQQCDLLIVI
FT                   GARFDDRVTGELNTFAPKAKIIHLDIDLAEFNKLRTAHVCISGSLNDLLLELTQTLSIA
FT                   LWQEQVKLLKSKYKWSYDSGNDKISAPVLLKTISDNAPVDTIITTDVGQHQMWAAQHMQ
FT                   FNRPENFITSGGLGTMGFGTPAAIGAQIGRPNDMVICVSGDGSFMMNVQELATIKRRKL
FT                   PIKIILLDNKRLGMVRQWQELFFDKRYSETILDDNPDFLILAKAFNISGVYISQRSQIL
FT                   DAIDMLFSNTGPFLLHALIDESANVWPLVPPGASNDSMLIRNE"
FT   gene            complement(678983..679055)
FT                   /locus_tag="BVAF_596"
FT   tRNA            complement(678983..679055)
FT                   /locus_tag="BVAF_596"
FT                   /product="tRNA-Trp"
FT   gene            complement(679098..679171)
FT                   /locus_tag="BVAF_597"
FT   tRNA            complement(679098..679171)
FT                   /locus_tag="BVAF_597"
FT                   /product="tRNA-Asp"
FT   gene            complement(679373..679445)
FT                   /locus_tag="BVAF_598"
FT   tRNA            complement(679373..679445)
FT                   /locus_tag="BVAF_598"
FT                   /product="tRNA-Ala"
FT   gene            complement(679694..680539)
FT                   /gene="murI"
FT                   /locus_tag="BVAF_599"
FT   CDS_pept        complement(679694..680539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="BVAF_599"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_599"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33970"
FT                   /db_xref="GOA:E8Q6K1"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6K1"
FT                   /protein_id="ADV33970.1"
FT                   /translation="MMSNQDIIYRYSTVLILDSGVGGLFFYETVRRIVPFVNYLYLIDN
FT                   KCFPYGNCSEKFIIQRVILIIERICRFLKFDLVVIACNTISVVALSILQINFRFPIIGV
FT                   VPEIQLACQCTKNGVVGILGTCRTVNNKYIFNSIKRFAYKKNIVLLGTSRLVELAESKV
FT                   YGNLVSKLELIDILNPWLNLKKIPDTIVLGCTHFSWLKSELQSVLPVDSCLIDSSNRLI
FT                   NHIKYLLNSRCLKKKNKCYFDVLLYQNKAYYTMHTADIVKLRSILLFNYNFFSLEMLPI
FT                   "
FT   gene            complement(680866..681762)
FT                   /gene="metF"
FT                   /locus_tag="BVAF_600"
FT   CDS_pept        complement(680866..681762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="BVAF_600"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_600"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33971"
FT                   /db_xref="GOA:E8Q6K2"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6K2"
FT                   /protein_id="ADV33971.1"
FT                   /translation="MSMFHATQQEILNRYLVELKENISVSFEFFPPKNAEMEKVLWHSV
FT                   NKLSKLGPDFVSVTYGAYSGRREYTNRIIKDIKERTGLIAAPHLTCIDTTPEILRNIAW
FT                   EYWNNNIRNIVALRGDQVVQRHSSSMYAVDLVSLLREVGDFDIAVAAYPEVHPEAKTPQ
FT                   SDLINLKKKIDAGASKVITQFFFDVEQYLRFRDLCVSVGIEIEIIPGILPIFNFSQLKR
FT                   FITFTKVKVPNWMCIIFDGLDQDLDTQKMLGVFIAIDMVKILVKEGVRNFHFYTLNRSD
FT                   LTYAVCHALGVKNKRHK"
FT   gene            complement(682153..683310)
FT                   /gene="metB"
FT                   /locus_tag="BVAF_601"
FT   CDS_pept        complement(682153..683310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="BVAF_601"
FT                   /product="Cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_601"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33972"
FT                   /db_xref="GOA:E8Q6K3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6K3"
FT                   /protein_id="ADV33972.1"
FT                   /translation="MNKINQSTISVRSGLNSDEQHGCVVSPITLSTIYNFTGFNEPRMY
FT                   DYSRRRNPTRDVAQKALADLEQGQYAIITSSGMSAISLICMTFLNPGDFLIAPYDCYGG
FT                   TYRLLESLDQKGICRVRFINQCDLKSVLRSVSKYSPKLILIETPSNPMLRVTDIAFICN
FT                   LKKNGVICVVDNTFMTPILQNPLQLGADLVLHSCSKYLNGHSDVISGVVITDNIKFYER
FT                   LFWWVNTLGITGSAFDSYQLLRGIRTLVPRIYQQQKNTKNIIDFLLNQAEIKSVYYPGL
FT                   PGNTGYEIACAQQRGFGSILSFELHGSENTLIKFLRSLKLFTLAESFGGVESLISHPAT
FT                   MTHAAMSQDSRKKAGISNMLLRISVGLEDSVDLINDLNQALGSIR"
FT   gene            complement(683466..683708)
FT                   /gene="rpmE"
FT                   /locus_tag="BVAF_602"
FT   CDS_pept        complement(683466..683708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="BVAF_602"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_602"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33973"
FT                   /db_xref="GOA:E8Q6K4"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q6K4"
FT                   /protein_id="ADV33973.1"
FT                   /translation="MKKDIHPQYNSIQATCSCGNIINVKSTLKNNIHLDVCSLCHPFYT
FT                   GTQRVIDTRGRVNLFNKRFNKNNDNAFLSKFNKSK"
FT   gene            684194..684949
FT                   /gene="fpr"
FT                   /locus_tag="BVAF_603"
FT   CDS_pept        684194..684949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="BVAF_603"
FT                   /product="ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_603"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33974"
FT                   /db_xref="GOA:E8Q779"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q779"
FT                   /protein_id="ADV33974.1"
FT                   /translation="MPTWIDGKIISITHWTNNLFSIVINAKTDKFIAGQFSKIGLKINN
FT                   KIIQRAYSYINSPNSPNLEFYISKVISGKLTTLLYSLSSEDTILISKESYGQFTINTIP
FT                   ISNNYYFLWMIATGTGISPYLSILDSFDNRLNHFSKIILVHATKYSKNLNYLHKMHTLK
FT                   KLYKKKLIIQTILSQEQTSHSLYGRIPILIENNTLEKSIGLYLNNKSHIMLCGNPHMIL
FT                   DTKTILYKKYGIKNCPKNKIKRITQERYW"
FT   gene            685222..686037
FT                   /gene="tpiA"
FT                   /locus_tag="BVAF_604"
FT   CDS_pept        685222..686037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="BVAF_604"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_604"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33975"
FT                   /db_xref="GOA:E8Q780"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q780"
FT                   /protein_id="ADV33975.1"
FT                   /translation="MTSPLIIGNWKLNGTRQKIQESLSILTKEKIIQYKKHIDVAIAPP
FT                   IVYLSLVNDYLLKNCTYFSNQTKHKYIELCAQNVDINLSGAFTGDISAAMLKDLGVKYV
FT                   LIGHSERRKYHKENTTYIAKKITTVKKIKLIPILCIGENQQDYDSGSTQLTCAYQIDSV
FT                   INLTGIQAFKNTIIAYEPIWAIGNGINVCPKHVQSIHEFIRQRIALHDTHIAKQILIQY
FT                   GGSVNLNNAIQLLEQKDVNGLLIGAASLNMNTFIQIIQTIEQYLQNKLY"
FT   gene            complement(686079..687044)
FT                   /gene="pfkA"
FT                   /locus_tag="BVAF_605"
FT   CDS_pept        complement(686079..687044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="BVAF_605"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_605"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33976"
FT                   /db_xref="GOA:E8Q781"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q781"
FT                   /protein_id="ADV33976.1"
FT                   /translation="MIKRIGVLTSGGDSPGMNAAIRGVVRTGLSEGLEVYGIYDGYLGL
FT                   FQNRMILLNHCSVSDIINRGGTFLGSSRFPDFRKYTIREKVVRNIKKRNLDALVIIGGD
FT                   GSYIGAKKLSDMGCPCIGLPGTIDNDVSGTDYTIGYFTALETIIEAIDRLRDTSSSHQR
FT                   VSIVEVMGRYCGDLTIAAAIAGGCEFVVVPELKFEVQDLVNKVKFDIAKGKKHAIVAIT
FT                   EHICNVFDLAKYIEKKTGKETRATVLGYIQRGGKPVAYDRILGSRMGVYSVELLLQGCS
FT                   GCCIGIQNEKLVYNDISSIIQQCVHRPFRQDFFRTAKRLF"
FT   gene            complement(687369..688106)
FT                   /gene="cysE"
FT                   /locus_tag="BVAF_606"
FT   CDS_pept        complement(687369..688106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BVAF_606"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_606"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33977"
FT                   /db_xref="GOA:E8Q782"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q782"
FT                   /protein_id="ADV33977.1"
FT                   /translation="MVVNKIDMVWSNMIFEAKLLLNSEPLLMNFLYMFLLKHNSFKDAL
FT                   VYMLSTKLSNVDIKKNDLIGMLKNIYEDDNDIVISAAWDVYVIRLNDPSVSKYITPFLY
FT                   FKGFHALQAYRIIHWLWNNNREELAMYFYNCISVIFNVDIHPAAKIGRGIMLDHATGVV
FT                   IGETAVIENNVSIMQSVTLGSTGKIQGNRHPKIKQDVLIGAGAIVLGNIEIGCGAKIGA
FT                   GSIVLHSVPPYSTVTGKSAQLVS"
FT   gene            complement(688139..689176)
FT                   /gene="gpsA"
FT                   /locus_tag="BVAF_607"
FT   CDS_pept        complement(688139..689176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="BVAF_607"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_607"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33978"
FT                   /db_xref="GOA:E8Q783"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q783"
FT                   /protein_id="ADV33978.1"
FT                   /translation="MCILSLAQKPIAITVIGAGAYGTAIAVALSKGGNAVVLWGHNSKH
FT                   IEILKSNRSNPINLPNIPFPPLLYLEKSLSIALSVSKNILIAVPSYVFSCVLLKIKINL
FT                   TDKIRVIIASKGLEPNTGRLLKDVVDDVLGNNVSFAIISGPTFARELAIGLPTAITLTS
FT                   NDVDFSYDIQKLLFSVKNLRVYRNTDVVGVQVAGAVKNVIAIGVGISDGLGFGANARTA
FT                   LITRGLAEMSRLGVAMGATDSVFSGLAGLGDLVLTCIDNQSRNRRFGVLLGEGINIDQA
FT                   RKKIGQVIEGVYSAKAIHMLSIKHKVIMPITNQIYQILYENKNIYESVYELLRQTYVDE
FT                   IEISS"
FT   gene            complement(689428..689694)
FT                   /gene="grxC"
FT                   /locus_tag="BVAF_608"
FT   CDS_pept        complement(689428..689694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="BVAF_608"
FT                   /product="glutaredoxin 3"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_608"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33979"
FT                   /db_xref="GOA:E8Q784"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q784"
FT                   /protein_id="ADV33979.1"
FT                   /translation="MSYNIEIYIRKGCPYCDKAKSFLKSKSLNFKEIFVGRDSSDATYL
FT                   EMRTRSGGCVTVPQIFINGKHIGGSDDLLKFNDDQEALNLVLK"
FT   gene            complement(689700..690182)
FT                   /gene="yibN"
FT                   /locus_tag="BVAF_609"
FT   CDS_pept        complement(689700..690182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibN"
FT                   /locus_tag="BVAF_609"
FT                   /product="rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_609"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33980"
FT                   /db_xref="GOA:E8Q785"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q785"
FT                   /protein_id="ADV33980.1"
FT                   /translation="MMLLRELVAFTERHLFLVSVWCVFFFIVVYNFIIGYVFGYFEISC
FT                   DKVVFLINKRNAVVLDIRSSNEYLSGHIINSINVKIEDIKYGVVFSMSDWVKNKRSPLI
FT                   IVHDVCRGWSLFALRRHLKKLGYMEVYLLKGGILSWEENFPLFLKTNKIGANQKRE"
FT   gene            691255..692229
FT                   /gene="hldD"
FT                   /gene_synonym="rfaD"
FT                   /locus_tag="BVAF_610"
FT   CDS_pept        691255..692229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldD"
FT                   /gene_synonym="rfaD"
FT                   /locus_tag="BVAF_610"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_610"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33981"
FT                   /db_xref="GOA:E8Q786"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q786"
FT                   /protein_id="ADV33981.1"
FT                   /translation="MIIVTGGAGFVGRNIIKKLNEVEKKEILVVDNLSNGKKYRNLMNL
FT                   DISDYLDKDYFINKLLDNPSYFKNIEVVFHEGACSNTREWNGKYLMKNNYEYSKLLLFY
FT                   CIKYEIPFIYASSASVYGSNMCNVYCRNNKIINSIENPVTMYGYSKFLFDRYVHNILPK
FT                   VKSQVCGLRYFNIYGPHEFHKGRMASVILNIYKKVKNKESPILFVGSKNFKRDFVYIDD
FT                   IVNVNLWIWYNKISGIFDCGTGHARSFEFVTSIVLNLLNYNTIKYVTMPKEIQKYYQYF
FT                   TKANISQLQGIGYENKFIDVNEGIYKYLNWLNLYMCMIVYYFV"
FT   gene            693482..694462
FT                   /gene="rfaC"
FT                   /locus_tag="BVAF_611"
FT   CDS_pept        693482..694462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /locus_tag="BVAF_611"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_611"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33982"
FT                   /db_xref="GOA:E8Q787"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q787"
FT                   /protein_id="ADV33982.1"
FT                   /translation="MSTYHALIIKISSMGDIIHTLPAVTDAANFIPNVLFDWVVEETFA
FT                   EIPQWHLSVFQVIPIKLRLWKKKWYTLRSWKEYNNYITQVGAKKYDAIIDAQGLLKTSL
FT                   FATYFAVGIKHGLDRFSAKEPISCWVYDKCYRINKIQHAIERIRKLFAYSLGYSVPSCI
FT                   GQYNIRHIFQSCIKKSEAPYLILLHSTTCLLKCWPESSWLIFIQKVLKFSDYRIKIPFW
FT                   TKREEWFVKCLKNYFSQIIVLPHLTLWEVSIQIIQASAIISVDTGLSHLAAAYDCSNLT
FT                   LYGPTNPELIGTYGLNQTILRSKTGRMDNLHPEFVWSKFKDKFFT"
FT   gene            694892..696196
FT                   /gene="kdtA"
FT                   /locus_tag="BVAF_612"
FT   CDS_pept        694892..696196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="BVAF_612"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_612"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33983"
FT                   /db_xref="GOA:E8Q788"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q788"
FT                   /protein_id="ADV33983.1"
FT                   /translation="MYIFYFVIYDIIMYIVQPIIWIRLLWLSIKVPEYRKNWLERYSYH
FT                   YTTIGSSKLGGIVLHAVSVGEILSIVPLIKKFKKKYPNLAIIVTTMTPSGLKLACQVTI
FT                   NYQNVQCMYLPYDLPNAVKRFINRIKPKLFIIVETELWPNLIRTLYLYKIPIVILNARL
FT                   SHSAFKKYKKISCFFKYIVQCITIVLAQDKENAGRFLKLGLKRYQLRIIGNLKFDVVVT
FT                   HDILKQISDLKQNWTRNRIVWIAGSTHQGEEKILLKVHENLLTIFPNLLMILSPRHPER
FT                   FSHVINITKNFGFSYITKSSGVIPSENIQVIINNTIGELMLLYGISDIAFVGGSLVPHG
FT                   GHNPLEPATYAIPIIMGPYVFNFNSICSTLHKLGGLINIVDVDSLIKVMYLLLKDQELR
FT                   LHYGKCAYKAFQKNEGVTSQAFNILNDYLTKNYVQ"
FT   gene            complement(696461..696634)
FT                   /gene="rpmG"
FT                   /locus_tag="BVAF_613"
FT   CDS_pept        complement(696461..696634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BVAF_613"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_613"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33984"
FT                   /db_xref="GOA:E8Q789"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q789"
FT                   /protein_id="ADV33984.1"
FT                   /translation="MAKEIREIIYLFSSSKNGHFYSTTKNKRSNIEKIRLKKYDPIIRK
FT                   HVIYVERSKNKK"
FT   gene            complement(696639..696887)
FT                   /gene="rpmB"
FT                   /locus_tag="BVAF_614"
FT   CDS_pept        complement(696639..696887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="BVAF_614"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_614"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33985"
FT                   /db_xref="GOA:E8Q790"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q790"
FT                   /protein_id="ADV33985.1"
FT                   /translation="MSRICRITGKRPINGNKRSHSMNATKRWFIPNIHYHRIWIDSKKK
FT                   FCSIRISAKGLRFIDKLGIDQYLSNLSSKNIKITKKK"
FT   gene            697528..697983
FT                   /gene="dut"
FT                   /locus_tag="BVAF_615"
FT   CDS_pept        697528..697983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="BVAF_615"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_615"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33986"
FT                   /db_xref="GOA:E8Q791"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q791"
FT                   /protein_id="ADV33986.1"
FT                   /translation="MKKTIDIKIVDNRVCRDFLLPRYMTEGSAGLDLFVCLDRPVIIYP
FT                   NKTKLFSTGIAVYISDPKIAGIILPRSGLGHYHGIILSNSVGLIDSDYQGEIQVSLWNR
FT                   GEEEFILTPGKRVAQLLFISLVQVQFSLVTSFKSCSMRGTKGFGHSM"
FT   gene            698325..699197
FT                   /gene="yicC"
FT                   /locus_tag="BVAF_616"
FT   CDS_pept        698325..699197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicC"
FT                   /locus_tag="BVAF_616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_616"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33987"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q792"
FT                   /protein_id="ADV33987.1"
FT                   /translation="MINSMTAFSRQEISYVWGCGFWEVRSLNQRYLDICIDLPKNFQCL
FT                   SWTIRKIIKTHIARGRIECNLKFDIDYCNEYSNFIINENLVSFLIKSAEKIKLKIPDGT
FT                   IDLTKILFYPGVISYEKYDMNHISRELLIHFKSALNQLMKNRNEEGICLKKQLVDRLYK
FT                   IFEIIKKIKLYIPDFLNKKRIKLLEQVQNICSMVDKTRLEQELLVMTQKLDISEEIDRL
FT                   FIHIQSMDKCISKDKVGPIGRKLDFVIQEIQREANTLISKSADMNIIRLSISLKVLVEQ
FT                   IREQVQNIE"
FT   gene            699769..700203
FT                   /locus_tag="BVAF_617"
FT   CDS_pept        699769..700203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BVAF_617"
FT                   /product="marR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_617"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33988"
FT                   /db_xref="GOA:E8Q793"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q793"
FT                   /protein_id="ADV33988.1"
FT                   /translation="MNRLTDISNMVESLSRVYHRLRKEVNGQLINEGLSMSKMKILHLI
FT                   TTGQISATDIKNYMGFSSRTVVTVLDALEKDEMLRRQQSLTDRRVKYVHITEKGRDKLR
FT                   IAKNTHNIILDRIFSPLSEVQLKNFYEVCHLLEIQQKTSR"
FT   gene            700431..701099
FT                   /gene="gmk"
FT                   /locus_tag="BVAF_618"
FT   CDS_pept        700431..701099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="BVAF_618"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_618"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33989"
FT                   /db_xref="GOA:E8Q794"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q794"
FT                   /protein_id="ADV33989.1"
FT                   /translation="MKKCIGSLCAVSAPSGTGKSTLICALQKKNCLLFDTQLSISYTTR
FT                   KRRFGEKHGVDYYFISFKKFKFMIDNNMFFEYAKIFNNYYGTGKNKIESMLNAGTHIIL
FT                   DIDWKGVQQIKNRVTNFFTIFILPPSKEELELRLRLRRKDTNEIISNRMKHAVNDICHF
FT                   KEYDYIIINDDFNIALFHLQSIILSEQLRLVYQKQQHNDLIIDLLSENYCKIKRTYSIE
FT                   "
FT   gene            701133..701309
FT                   /gene="rpoZ"
FT                   /locus_tag="BVAF_619"
FT   CDS_pept        701133..701309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="BVAF_619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_619"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33990"
FT                   /db_xref="GOA:E8Q795"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q795"
FT                   /protein_id="ADV33990.1"
FT                   /translation="MNETTIKQSLKTEIKNRFNLILVASRRARQIQNEERENCFVKQNT
FT                   SKCTVRAFKEMEL"
FT   gene            complement(702354..705206)
FT                   /gene="polA"
FT                   /locus_tag="BVAF_620"
FT   CDS_pept        complement(702354..705206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="BVAF_620"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_620"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33991"
FT                   /db_xref="GOA:E8Q796"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q796"
FT                   /protein_id="ADV33991.1"
FT                   /translation="MTNIIDNPIILIDGSFYIYRAYHAYPPLTTSTGYPVWVIYGVINM
FT                   IRSLLIKYRPIHMGIVFDSPGKTFRNDLFKQYKSNRPQMPEDLCIQITPLNTIIKAMGI
FT                   TALSVPYVEADDVIATLSNFYAQLKNKTVLISTGDKDMAQIVSSNIILINTMSNIILDS
FT                   LEIKKKFGVSPNLIADYLALIGDRSDNIPGVPGIGIKNAKILLNNIGNLQTLYQNLHKI
FT                   SILNLRNSQSIKNTLIKNKKLAFLSYKLATVKIDVPLNQSDYKLLIQNIDSQQLFLLFK
FT                   KYEFNTWVSELQAGTWLKKYKNTKKSSTQNSQLSNTSLISNTITHTCNYYPSFPSSNNN
FT                   DIISNISSLTNWIKQNNTHHCFILNIYSNNFDIFTPNIIGICISTYTMNSMHNAYIPIN
FT                   IQHTLNIDNNNDTYQWYLNLTEVLSILKPILENIKIKKIGHNMKFIFSLLKQHNIHLSG
FT                   PIFDVILELYVLYGTSNYQNIKRFLNKTTILDHIFKFQQIYNNNKYLIKKNIRDIQLES
FT                   SCSTQLIYAISNLHQILWTEIKQHNELKKIFINIEIPLISVLSRIEDYGVLIDKKFLYS
FT                   HSIKLNSQLNNLKTQAYQLTGSSFNLDSPKQLQEILYNQEKLPIFKKTPHGAPSTSEEV
FT                   LKKLSKKHSIPKIILKYRSLSKLKSTYTNKLISMINKKSNRIHTSYNQTRTSTGRLSST
FT                   NPNLQNIPNRNYDGRKIRQAFIAPENSLIISADYSQIELRIMAHLSRDLKLINDFLEEK
FT                   DIHTTTASEIFVTSLHLVTGEQRQRAKTVNFGLIYGMTAFGLSKQLSVTCQEAQKYVDR
FT                   YFQRYPGVMQYMQYIKDYAKKNGYVSTLDGRKLYLPDIYSSNISQKKGAERSAINAPMQ
FT                   GSAADIIKRAMISIDSWLQTDNIPVHMIMQVHDELVFEVNNTFVDIAVKQIRKLMEECF
FT                   ILNVPLKVDIGVGKNWEQAH"
FT   gene            complement(705364..705993)
FT                   /gene="dsbA"
FT                   /locus_tag="BVAF_621"
FT   CDS_pept        complement(705364..705993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="BVAF_621"
FT                   /product="thiol:disulfide interchange protein dsbA"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_621"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33992"
FT                   /db_xref="GOA:E8Q797"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q797"
FT                   /protein_id="ADV33992.1"
FT                   /translation="MKAIYFLLVMTFCIYLHNHASSSIIEGKQYIKLHKPIHNAPKILE
FT                   FFSFYCTHCYQFEQIYNISNNIQKKLPKNIIFYKYHVNYIGDLGKQLTHAWAVAMALGI
FT                   ENQVSSFLFTAIQKQQSIHTIDDIRKTFIKLGIDADTYDTTWNSILVQSLIKDQEQAAI
FT                   NFQLKSIPAIFVDGKYMVKNDQLNIASIPIYIQQFSELLHLLIEKK"
FT   gene            complement(706211..707686)
FT                   /gene="ubiD"
FT                   /gene_synonym="yigC"
FT                   /locus_tag="BVAF_622"
FT   CDS_pept        complement(706211..707686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /gene_synonym="yigC"
FT                   /locus_tag="BVAF_622"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_622"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33993"
FT                   /db_xref="GOA:E8Q798"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q798"
FT                   /protein_id="ADV33993.1"
FT                   /translation="MKYKDLRDFIKTLEQKKLLKKIMFPIDPNLEITEIANRTIKAKGP
FT                   ALLFTNPIGYSIPVLCNLFGTTHRIELAINQNNNISSLRNIGKILAYLKEPTPPKGLLD
FT                   LLSKMTHFKHILHMPTKILKKGVCQENIQYTQDVDITRMPIMKSWPQDITRAITWGITI
FT                   TRGFHNKRQNLGIYRQQVLSKNKIIIRWLPHRGGALDFKEWCINSTEKKFPIAIAIGAD
FT                   PATLISAVIPVPNSLSEYAFSGLLRGSKTEIIKCVSCDLYVPAHSEIVLEGYIERNNMA
FT                   PEGPFGDHTGYYNSIEQFPVCTITHITHRNNPIYHSTYTGRPPDEPSILGMAMNELFIP
FT                   IIQKQFPEITDFYLPPEGCSYRLAIITIQKKYIGHAKRIIFGVWSVLYQFMYTKFVIVC
FT                   DNDINARDWKDVIWAMTTRMDPNRDIIIIKNTPIDYLDFSSPIAGLGSKMGIDATNKWP
FT                   GETQRTWGIPIKMNTNTQSRIDNIWNELNILNL"
FT   gene            complement(707797..709434)
FT                   /gene="ubiB"
FT                   /gene_synonym="aarF"
FT                   /locus_tag="BVAF_623"
FT   CDS_pept        complement(707797..709434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /gene_synonym="aarF"
FT                   /locus_tag="BVAF_623"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_623"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33994"
FT                   /db_xref="GOA:E8Q799"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q799"
FT                   /protein_id="ADV33994.1"
FT                   /translation="MIFNEWNRFCLIIKIILNYGLLDFIPINRLILPLKIGIQLLLNTF
FT                   NQHSQSLPGERLRLALQELGPIWIKLGQMLSTRHDILPDDIAQQLAILQDRVHPFDGYL
FT                   AKTYIEKSIGSSLETWFEDFQETPLASASISQVHSAKFKKNGKNIVIKVIRPGILPIIT
FT                   IDIKLMYKLSKWTYKILPKDRKFKFSDIIAEYEKTLFNELNLLKETANTIQLRRNFKSS
FT                   NILYIPKVYVDFCSKNVMVMERIYGIPVYKKSLLKKKGINMKLLAERGLEIFFTQVFRD
FT                   SFFHGDMHPGNIFICHKDPQNPKYISIDCGIVGSLGKKDKYYLASNFIAFFNRDYRKIA
FT                   ELHLDSGWIPMNTNIEDFEYAMRTVFEPIFEKPLKDIPFSNILLYLFNTARFFNMEVQP
FT                   QLILLQKSLLYVEGIVRQLYPNFNLWESVKPFLEQWMKEQLKLSNIIYMLNEKMPYWIN
FT                   KIPELPALLSNEFKNSNEIHKKIDILTIELRTQRTHNTRVLFLFGIGLVFIIVSIYLVI
FT                   HNQYTTFLPICIFSLGISIWIIGWKQII"
FT   gene            complement(710042..710797)
FT                   /gene="ubiE"
FT                   /locus_tag="BVAF_624"
FT   CDS_pept        complement(710042..710797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="BVAF_624"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase ubiE"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_624"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33995"
FT                   /db_xref="GOA:E8Q7A0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q7A0"
FT                   /protein_id="ADV33995.1"
FT                   /translation="MKNKHKDDTTHFGFQNVNKHIKSYLVNAIFKTIATKYDLMNDCMS
FT                   FGIHRLWKHFLICQSEIFYGCKVLDLAGGTGDLSILFSKLVGQTGIVVLLDNNTEMLKI
FT                   GRKKLRNLGILNNVQYIQADAEALPFANNTFHRIAVSFGLRNFTNKSAALLEMYRVLNP
FT                   GGKLLILDFGVPIFKLLSVLYDLYSFHVIPKIGAIIAKDMKSYQYLIESIRMHPDQETL
FT                   KTMIANTGFQDIKYINMTGGIAVLHYAYK"
FT   gene            complement(710827..712311)
FT                   /gene="rmuC"
FT                   /locus_tag="BVAF_625"
FT   CDS_pept        complement(710827..712311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmuC"
FT                   /locus_tag="BVAF_625"
FT                   /product="DNA recombination protein rmuC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_625"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33996"
FT                   /db_xref="GOA:E8Q7A1"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q7A1"
FT                   /protein_id="ADV33996.1"
FT                   /translation="MKIISIIIYITIGTAIGIIFFYIFSKKLIKKNIQKYKDNCITYEK
FT                   SLNTTLQNLKHESTFRNEIEKKLYNKTHIIHELHSKLSATEERLKSLDHYRHQYERLCN
FT                   ELKIQLNINHEQALQLKELCVRFEEYKISTINKEKILINNEHRLTMQFENLANRIFDQN
FT                   RNTINEQNRLTLDNILHPLREQINIFINQIQNNFSKEERMRHDLTYEIHKLHQLNTKIT
FT                   QETINLTQALKGNNKIQGNWGEMILTKALEASGMREGYEFHLQVSMTKEINGRKLQPDV
FT                   IVHLPHGKDVVIDSKISLIAYERYFNSNNEQDKRLAINDHIQSLRTHIKSLNKKNYQEL
FT                   FQLNTLDYILMFIPIESAFTIAIEKESSLLTDAMNKNIMLVSPTTLLIALRTINNLWRY
FT                   EHQNFNAKKIAEKAGRLYDKLKLFMDDLNKIGQYLNKAEIIYNSAKNKFSEGKGNIISQ
FT                   AENFRTLGVQIKHPIVSNNINLANETGLFSDDKTKR"
FT   gene            complement(713481..715799)
FT                   /gene="metE"
FT                   /locus_tag="BVAF_626"
FT   CDS_pept        complement(713481..715799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="BVAF_626"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_626"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33997"
FT                   /db_xref="GOA:E8Q7A2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q7A2"
FT                   /protein_id="ADV33997.1"
FT                   /translation="MTVLGHTLGFPRIGLYRELKYALEQYWRNTINQDKLLNIGKMIRI
FT                   RHWGQQIKAGIDLIPVGDFAWYDHVLTTSMMLNNIPKRYYSSISNQTTNNLDILFNIAR
FT                   GYSKNNVNIIPSEMKKWFNTNYHYIVPEFIQDQEFKLNWTQLFDEIDEASSYYNHPIKP
FT                   IILGPLTYLWIGKTKEKEFDKLSLLSPLLLVYQEILDILSKKNINWVQIDEPALVLELP
FT                   NEWKQAYLYAYQKLHHNNFKILLTTYFDSIYHQLDLIEKFSIDGLHVDLVSNQKNNNIL
FT                   LLHEQLPKNWVLSAGIINGKNIWKTNLYYWFKQLYPIITQRKIWIGSSCSLLHSPIDLN
FT                   LETNLNNNIKTWFSFALQKCSEIKMLCDTLNNRNHNNSLKINILKQHYDSVHNTRLHSD
FT                   FIHNSKVQERCKNISDVPVSRQTAHHIRFKLQRKRFNLPLYPTTTIGSFPQTQDLRNLR
FT                   LKFKNNQINKNHYHANLEQYIKQIITEQEKLDLDILVHGEPERNDMVEYFGEHLNGFSF
FT                   TQHGWIQSYGSRCVKPPIIIGDISRTKPITQKWINYAQSLTKKPIKGILTGPVTILTWS
FT                   FVREDIKRHTVALQLALSIRDEVMDLEKSGISIIQIDEPAFREGLPLKKSEQKKYLTWA
FT                   IHAFKITVSSVQNDTQIHTHMCYSEFDEIMHYLLKLDADVISIEASRSDLKLLQFIQKN
FT                   TEKYLNEIGPGIYDIHSTNKPSISSLVKKLNTFLKYIPKDKLWVNPDCGLKTRSWSETK
FT                   HSLHNMVAAAKILRSSLNH"
FT   gene            complement(716089..716943)
FT                   /gene="rpoH"
FT                   /locus_tag="BVAF_627"
FT   CDS_pept        complement(716089..716943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="BVAF_627"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_627"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33998"
FT                   /db_xref="GOA:E8Q7A3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q7A3"
FT                   /protein_id="ADV33998.1"
FT                   /translation="MTAENMYKNISLVPQGTLEAYIRATNLYPMLTAEEERELAERLYY
FT                   NSDLNAAKKLIVSHLRFVVHIARNYSGYGLAQADLIQEGNIGLMKSVRRFNPELDVRLV
FT                   SFAVHWIKSEIHEYVLKNWRIVKIATTKAQRKLFFNLRKTKQRLGWFNEEEIEMVAKTL
FT                   HVTCKDVREMESRMAAQDMTFEQSSDDDEKNILSIPMLYLQDKVTMIDEEEEWINQVSN
FT                   KLNIALNSLDKRSQHIIRARWLNTNDNKTTLQELANQYGVSAERIRQLEKNAMKKMKLI
FT                   IQN"
FT   gene            717771..718388
FT                   /gene="rsmD"
FT                   /gene_synonym="yhhF"
FT                   /locus_tag="BVAF_628"
FT   CDS_pept        717771..718388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmD"
FT                   /gene_synonym="yhhF"
FT                   /locus_tag="BVAF_628"
FT                   /product="putative ribosomal RNA small subunit
FT                   methyltransferase D"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_628"
FT                   /db_xref="EnsemblGenomes-Tr:ADV33999"
FT                   /db_xref="GOA:E8Q7A4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q7A4"
FT                   /protein_id="ADV33999.1"
FT                   /translation="MKIQANFSKSNNGKIRIIAGKWKGRSIPVISKIEVRPTLSRIRET
FT                   LFNWLNPVIVNSICLDCFSGSGALGLESLSRGAKKVTFIDNSKACINFLKKTITSFQED
FT                   SSSITICTDCVSWLKQLSKNTVTGYNIVFIDPPFNNRFIIYDIVYLLEKNNYLQKKSWI
FT                   YIETSKLFNKGLFNKNKFPNNWVLYRKIVTQTILCCIYFRSS"
FT   gene            complement(718616..720292)
FT                   /gene="pgi"
FT                   /locus_tag="BVAF_629"
FT   CDS_pept        complement(718616..720292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="BVAF_629"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_629"
FT                   /db_xref="EnsemblGenomes-Tr:ADV34000"
FT                   /db_xref="GOA:E8Q7A5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q7A5"
FT                   /protein_id="ADV34000.1"
FT                   /translation="MKNINPSHTKAWKSLKRHFNQMKKIHIIDLFRQDTDRFKHFSKTF
FT                   NNEILIDYSKNLITHKTMNKLIKLAKECELNEAISAMFRGEKINRIENKSVLHVALRNR
FT                   QNIPIVVDKQDVMPQINKVLENMKKFCQDVIQGKWKGYTNKNITDIVSIGIGGSHLGPY
FT                   MVTETLIPYKNHLNIHFISNIDGTHIFETLNRINPETTLFIIASKTFTTQETMTNACSA
FT                   RNWFFSKTTTNRNLKHISKHFIALSANSEAVKKFGINPITNMFELWDWVGGRFSLWSSI
FT                   GLPIMLSLGSDNFELLLNGAYAMDLHFQNTPLNENLPVILALIGIWYNNFFLTETEAIF
FT                   PYDQYMHRFPAYLQQSNMESNGKSIDRNGHPINYQTGSIIWGEPGTNGQHSFYQLLHQG
FT                   TKMIPCDFIAPTISHHPIHDHHEKLIANFLAQTKVLAFGKNISEIQQEYETTNSKTPYE
FT                   ENINFNSAPFKILPGNNPSNSILIKKITPYTLGALIALYEHKIFTQGIIFNIYSFDQWG
FT                   VELGKKLADSIYLKLQHTNNISYYDSSTNGLINRYKFWTRP"
FT   gene            complement(720599..721546)
FT                   /gene="metA"
FT                   /locus_tag="BVAF_630"
FT   CDS_pept        complement(720599..721546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metA"
FT                   /locus_tag="BVAF_630"
FT                   /product="homoserine O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BVAF_630"
FT                   /db_xref="EnsemblGenomes-Tr:ADV34001"
FT                   /db_xref="GOA:E8Q7A6"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:E8Q7A6"
FT                   /protein_id="ADV34001.1"
FT                   /translation="MPVRVSDELPAIKFLKKENIHILKKTKDIFKIPSVLKILILNLMP
FT                   KKIDSENQFLRLLAHSPLQIDVQLLRIDEHISKNTSIEHLNNFYCTFSDIQNQYFDGLI
FT                   ITGAPLGLIEFSNVTFWPKLKQLCNWAKQHITSILFICWSVQAALKILYNLPKFVRKKK
FT                   LVGIYKHRITKSNSLLTQGFDEIFSVPHSRFSYFPKDLIYQDTDLEILAESDDAGVYLL
FT                   ISRNNQLIFVTGHPEYDAHTLSQEYHRDLILGLHPSLPDHYFPKNNSNLIPKITWRSHA
FT                   HLLFNNWINYYVHRNSHNNLSKNFNNSNTSNNSV"
FT   gene            complement(721908..721980)
FT                   /locus_tag="BVAF_631"
FT   tRNA            complement(721908..721980)
FT                   /locus_tag="BVAF_631"
FT                   /product="tRNA-Ile"
XX
SQ   Sequence 722585 BP; 263962 A; 96586 C; 102184 G; 259853 T; 0 other;
     atgtcttatt taactaattt tgatgttatt gttgtaggag gtggtcatgc tggtacggaa        60
     gcagcattag cggcatctca gttaaagtgt catactttat tgattacaca taatattgat       120
     actctaggac agatgtcgtg taatccatca atcggtggaa ttggtaaggg tcatttagta       180
     aaagaaatag atgcaatggg tggaataatg gctaatgcta ttgatcgatc tggaattcaa       240
     tttagaatat taaacagtag taaaggcgct gcagttaaat cgacaagagc acaagcagat       300
     aagattttat ataaacaaat tatacggcaa tctttagaag atcaaagtta tttatatatt       360
     ttacaggcgt ctgtagagga tgtaattatt agacacaata aagttatggg ggtgattatt       420
     ccaaatatag aaatgaagat ttttgcaaga tctgtgatct taacaacagg tacttttctt       480
     aatggcaaaa tttatattgg aatgaataat tttgaaggag gaagagcagg ggatttagaa       540
     tcatcatcgt tattgtcacg aagattacaa gaattatctt taaaagtgaa tagactgaaa       600
     actggaactt ctcctaggat atatgctaag ggagttaatt ttgagtgtat ggtcgagcag       660
     catagtgatt gtcctattcc tgttttttct tttataggat cgtcaaaaca acatcctaaa       720
     caaattccgt gttatattac acatacaaat agtaaaacac atgatataat tagatctaat       780
     ttacatcata gtcctgtgta tgcaggattg ataaatggga ttccacctcg ttattgtcca       840
     tctattgaag ataaggtaat acgttttcca gataaagata cacatcaaat ttttttagaa       900
     cctgaggggt tgactacatc agaaatatac ttaaatggtg ttgctactag tttaccattc       960
     aacgttcaaa tacaaatcat tcaatctatt aaagggttag aaaatgctcg tatattaaga      1020
     cctggatatg cgattgaata tgattttttt aatcctatag atttaaagtt aacattagaa      1080
     agtaaattta tttcaggttt atttttatct ggtcaaatta atggcactac tggttatgaa      1140
     gaagcagcag cacaaggatt attgtctggt attaatgcgg ctaggtatgc gcaaaataaa      1200
     acagaatggt atccgaaacg agatcagtcg tatttgggag tattagtaga tgatttatgt      1260
     acccatggta ctacagaacc gtatcgtatg tttacatcta gagcagaata tcgtttatct      1320
     ttaagagaag ataatgctga tttaagatta actgatattg cccgacagct tggattaatt      1380
     actgataata gatggagaat tttttgtgtg aaacaagaaa atattgaaag ggaatttcaa      1440
     agatttcgca atacttatat ttttccaaat actacagata ttattaaatt aaatagcatt      1500
     ttaaaggttc ctttaatgaa taaggtgaat ggagaagatt tattaaaaag accggaaata      1560
     aattacgcta ctttgtccca attgagtact tttaaaccag ttatatcaga taatcaagta      1620
     tatgaacaaa ttgagattca gattaagtat gcaggctatt tgaatcgtca aaaagaggaa      1680
     attgatagaa atttgcgtaa tgaagatact ttattacctt ttgatatcaa ttataataat      1740
     attgttggat tatctacaga ggtggtagag aagctaaatt attgtagacc ttactctgta      1800
     ggacaagctt ctagaatttc aggaattacc cctgtggcta tttctatttt attagtgtgg      1860
     ttaaaaaaga aaggtttact taaaaaaaag aataatatta atagcgtata atatattatg      1920
     tatgtgttat tatataattt tatttgagcc tttgtgtaga taatgaagaa tggttttttt      1980
     gggtttatat tgaaataatt tataatatca gatatttatt attttcttag tgtagtaaga      2040
     gttttaataa tgtttgaatt atattgatta aaattattat aaaatgaggg tagtatatta      2100
     ctaacacagt cctattttat tatttaatgt aatttttatt tttaaacatc agaattatgt      2160
     attaattgtt aaataattag ttgatttgtt aaataagatt ttcaaattta ggtaagattt      2220
     gtattgcttt aaatatttaa agtaatgtaa tgtttttata aattcagaga gaaagatata      2280
     taagtatttt atatatctat atatttaaat atgaatgtgt ttgtaataaa gattatataa      2340
     aagataaata tattagtttt ttaaattata tttaatgcaa tttagtagga gtttagagaa      2400
     tagattatgt tagaaattaa aaattctaca caacaatata ttacacatca tcttcatcat      2460
     ttacaatttg atttgagata ttggcattgg gtaggatcag aagtaaatgc atcatcgttt      2520
     tggatattaa atgtggattc tttgtttttt tcaatattat tatgtacatc atttttaatg      2580
     atttgcagtt atatagtgca attcgctact tatggtactc caggaaaaat gcaaacattt      2640
     atagaattaa taatcttatt tattgatcag catgttaaag atatgttcca tggttcaaaa      2700
     aacaaactaa tttctccttt atcgatgaca atttttattt ggattgtttt aatgaattct      2760
     atggatttaa ttcctataga tttttttcca tatatagctg atcgtgtttt tggattttct      2820
     tcattgagaa tagtgccgtc cgctgatatc aatatcactt gttcaatggc tttaaatata      2880
     tttgttttaa tgttatttta taatatcaaa actagtggta ttactgggtt gtgcgcagaa      2940
     ctaatgtatc atcctttcaa tagtgtttta tgtataccga taaattttgt tctggaagtc      3000
     attagtttat tatctaaacc aatatcgtta agtttgagat tatttggaaa tatgtattct      3060
     ggtgaattga tttttgtatt aataactgct ttattgcctt ggtggtgtca atgggtgtta      3120
     agtgttccat gggctatttt tcatatttta attatttttt tgcaagcttt tatttttatg      3180
     gtattgacaa ttatttattt gtcgataaca cagatacatt ttaaatcgta attttttgaa      3240
     agtgtagttt taaaataaaa aaatagtaca gactttattg ataaaatata agataataag      3300
     aagaggtaat cattattgta tggaaaattt aaattttgat atgttgtata tcgctgcggc      3360
     gataatgatg ggattggcgg ctattggagc tgctgtcgga attggtattt taggaagtaa      3420
     atttttagaa ggggctgctc gacaacctga tttaattcct atacttcgta ctcagttttt      3480
     tattgtgatg ggattagttg atgcaattcc tatgattact gtaggactgg gtttatatgt      3540
     tatgtttgca gtggtttgat tttaatgtat tatattttat attattgtgt atataatttt      3600
     ttatatatat aagtttttgt ttttttattt taaattaggt ttgatgctgt gaatttgaac      3660
     gcaacaatat taggtcagtc agtttcgttt attttttttg tatggttttg tatgagatat      3720
     gtatggtctc cgttaatgtt gattattgaa aaacgtcgga gaaaaatttc tgatagttta      3780
     gaaaacatta aacaatcaga aataaaatgc aagcttatgc ataatgaggc ggagatttgt      3840
     ttaaggaaag ctcgaataaa atctgaagaa attattaaac atgcatataa atgtaaatct      3900
     caaatattac atgatgctca acaagaagct catcaagaat ttagtaagat tgtatgtaaa      3960
     gcaaaagctc aaatcgatca agaaagaaaa cgtgttgctg atgaattaag aaaaaaaatt      4020
     gggcaattta tcatggaagg tgtagaaaag attgttgaca atagatcaat tagtaatatt      4080
     atctctgatg attatattca tgctgtagtg caaacgttat tgaatgagga ttgaatgttt      4140
     tttgaaaaga ctatagcgta tgtttatgct aaagctgtat tcagtttagc tacagagcaa      4200
     aataatataa tttattggaa aacattgctt gaattgttct caaaggttag tcaaaatttt      4260
     gtcattaaat ctttatgtta tagattgttg tcttctcaac aaatatttga aatttttatt      4320
     aatatttgtg aatgttatga aaaattagat ttttttagta agaattttgt acgtattgtt      4380
     tcagaaaata atagagtatt attgtttcca gttattcttg aacaatttaa tagtttaaat      4440
     gatatatata tgaatgttat agcagtaaaa gtaatttcag ctacaaaatt acatattgct      4500
     caaattcaaa aaatttctac atgcatgaca aattatttat ctaaaatggt aaaaatagaa      4560
     tgttctatat gcccaaatat tattgggggt ataataattc gtatagaaga tgttgtaatt      4620
     gatgggagtg tgaaaggccg aatattgcgt ttacgggatg tattgcaatt ttgattattt      4680
     catattttaa tatatatttt ttatggtata aaaatttatg caattaaatt cgaatgagat      4740
     tagtgaatta ataaaacgtc gtatcaaaca atataatatt gaagttgaga tacgaaatga      4800
     aggtactatt actactgtaa gggatggagt cattcatata tatggattgt ctaatgtgat      4860
     gcaaggtgaa atgattgctt tgccagaaca taaatttgct gttgcattaa atttagaacg      4920
     aaattctgta ggagctgtag tattggggtc ttatgagaat atctctgaag gaatgttaac      4980
     taaatgtacg ggggatattt taaaagttcc agtaggtaag gaattattgg gaagagtagt      5040
     aaatgccttg ggtattccta tagataataa gggtgcagta aattgttctt gttattatcc      5100
     tatagaatct aaagcgccag gagttattga taggcaatca attagtgaac ctattcaaac      5160
     tggttataaa gctattgatt ctatgatacc tataggtaag ggtcagcgtg aattgattat      5220
     aggagataga caaacaggga aatctgcatt agcgatagat actattatta atcaacgttt      5280
     tagtggagta aaatgtattt atgttgctat tggccaaaaa gcaacaactg ttgctaatgt      5340
     agtaaaaaaa ttggaagaac ataatgcatt aggtaatact attgtgattt tagcttcagc      5400
     atctgaatct gctgtgttgc aatatttggc tccatatgct ggatgcgcaa tgggtgaata      5460
     tttcagaaat cacggggagg atgcgttgat tgtatatgat gatttatcta agcaagctat      5520
     agcgtatcgt cagatttctt tacttttaaa aagaccacca ggtagagaag cgtatccagg      5580
     agatatattt tatttacatt cccgtttgtt agaaagatca gctaaagtta atgtgaatta      5640
     tattgaacat aatactgagg gcagagttat gggtaaaaca ggatctttaa ctgctttgcc      5700
     tatcattgag actcaagctg gtgacgtatc tgcatttatc ccaactaatg ttatttctat      5760
     aactgatggt caaatcttct tagagtctta tttgtttaat gctggtattc gtcctgcggt      5820
     taatccagga atttctgtat caagagttgg gggtgctgct caaactaata ttatgaaaac      5880
     tttatcggga ggcattagaa ctgctttagc tcaatataga gaattagctg ctttttcaca      5940
     attttcttcc gaattagata gttcaactag aaaacaatta catcatggac aaaaagtaac      6000
     tgaattatta aaacaaaagc aatatcaccc tatatctatc gcatgtcaat ctttagtttt      6060
     atttgcagta atttttggtt atttagatga tattgagtta tctaaaattg gtagatttga      6120
     atttgaatta gtatcgtact ttatgcgaac tgaatcggaa ttaattaaac atattaatat      6180
     aaatgggtta tatgatagta ctattgagag taattttaaa agaattttac aagattttaa      6240
     attaaatcaa tttaattaat tacaataaaa tgtctagtct tcaagaagta cgattaaaaa      6300
     taaaaagtat taggaatata caaaaacttg ctaaagcgat ggaaatgatt tctgcatcaa      6360
     aaatgtacaa agctcaaaag cttatattga ttagtcagcc gtatttagaa aatattcaaa      6420
     gagtaattaa tcatattgta ttaggaaaat tagaatataa acatatgtat ttgatagaaa      6480
     gaaaaataaa gtctgttgga tattgggttg tatctagtga tcgaggatta gctggtggat      6540
     taaatattaa tttgtttaga atgttgttaa atgatataaa aaaatggaat gaattaaata      6600
     taacaattaa gcttgctgtt attggaacaa aggctgcttc ttttttcaat agtattaatt      6660
     ctaatatgat agttagttat gtttctggaa taggagacgt tcctaaaatt tctgatttaa      6720
     ttggatcagt tagaataatg ttaaaattat attgtaataa tcaaatagat ttgttatatg      6780
     taatttacaa taagtttgtt aatacgttaa cttatactcc tcaaatgtgt caaattttac      6840
     cgattcttcc tctgcctgat tcaaataaaa ctgaagtagt taatcgatat tgggattatt      6900
     tatacgaacc tgatccaaaa acattattgg atattttatt aaataggtat attgaatcaa      6960
     aaatatatca aggggtggtt gaaaatttag ctagtgaaca gtctgctcgt atgatggcaa      7020
     tgaaagttgc ttcggataat ggagaaactc ttattcaaga tttaaaatta ttttataata      7080
     agattagaca atcaaaaatt actcaagaac ttactgaaat tatttcagga gcttctgtag      7140
     tataaacata acattattaa ggtatagctg tatgagtgtg agtgttggga aaataattca      7200
     aattattgga gcagtggttg atgtagagtt caatcaaaat gaagttccta atttgtatca      7260
     tgcattagaa gtatgtgtta ataataattt aaaaaatgaa aaaaaaataa ttttagaagt      7320
     agagcagcag ttaggaggag gggtggttcg ttgtattgct atgggaagta cagatggatt      7380
     gtgtaggggt ttaatagtag gtaatttaaa gcgttgtatt gaagtaccag tagggaaaga      7440
     aacattagga agaattatga atgtgctagg ggagccgata gataaaaaag gttctatcaa      7500
     aacaattgaa agaagatcta ttcatcaatt ttctccattg tatcatgaat tatcaacaaa      7560
     ccaggaattg ttggttactg gaattaaggt tatagattta atgtgtcctt ttattaaagg      7620
     gggcaagata ggattgtttg gtggtgcagg cgttggtaaa actgttaata ttatggaatt      7680
     aattcgaaat atagctgtag agcattctgg ttattcagta tttgttgggg taggagaacg      7740
     tactcgtgaa ggtaatgatt tttatcatga aatgatacat tctgatatta ttaataaagt      7800
     tgctttagta tatgggcaaa tgaatgaacc tcctggaaat aggtttcgtg tagctttaac      7860
     gggtcttact atagctgaaa agtttagaga tgatgggtat aatgtattgt tatttataga      7920
     taatatatat cgatatactt tagcaggtac tgaagtatct gctttgttgg gaagagtgcc      7980
     atctgcagta ggatatcaat ctacgttatc tgaagagatg ggtatgctgc aagagcgtat      8040
     tgcttctact aaatctggtg ctattacttc tgttcaggcg atatatgtgc ctgcagatga      8100
     tttaactgat ccatctccta ctactacttt tgcacattta gatgctacta tagtgcttag      8160
     ccgtcaaatc gctgctcttg gcatatatcc tgcagttgac cccttggatt ctcatagtca      8220
     acaattagat ccatttattg taggtcaaga gcattatgat gttgctaatg ctgtgagatc      8280
     tattttacag cgttatcaag agttaaagga tattattgca attttaggaa tggatgaatt      8340
     atctgaatca gataaattaa tagtattaag atctagaaaa attcagagat ttttatcgca      8400
     gccatttttt gtagctgaag tgtttaccgg attttctgga tcttatgttt ctttacagga      8460
     tactatttta ggatttaaag gaattataga tgggaagtat gatgatttgc cagaacagtc      8520
     attttacatg gttggatcta ttaatgaagc tatagaaaag agtaaaaaac tttagtttta      8580
     aattttttat ttttataata ttatttatca tgtatatggt accgtaggta ttataagaaa      8640
     tgattactta taattttcaa ttacatgttg tttctgttga aaaaaaattg tttgatggaa      8700
     tcattaataa gattcaagtt atgggggtag aaggggaaat ggggatttac cctggtcatt      8760
     ctccgtttat tactttcatt aaacctggga ttttaaaaat ttctaaatta tgtaattccg      8820
     aagagtatat gtatttatca ggaggaatac ttgaagtgca acctaatata gtgattatat      8880
     tagcagatat ggcaattaga gcagaagatt tagatgaaaa gaaagcccag gaatctaagc      8940
     gtttagcaga agaaaaaatt aaaaatatga ctagtagagg cgtggattat attaaaattt      9000
     ctacagaaat atctaaagct attgctcaac tgagattgat tgagttatta aaaaaatagt      9060
     gtaattattt atatacaata ttggtaatta aaaagttaaa atttgtaaag tgtgttttta      9120
     gttttttagt ataaagtgat ttatttgttt gtaatgctac tgatcataat ggtagcaatg      9180
     aattataatt tggtttttaa ctgtgtgtta tgtatatata ttatatatga aattatattg      9240
     taaatttaag tatgtgtact gtgtggaata aaaattttaa tgttattatt cttgctgctg      9300
     ggtatggaga aagaatgcta tcggatattc caaaggttat gcataaaata gccggcaaat      9360
     ctatgttaca gcatttaatt gattctgtgt gtgaattgga tatccaactg tctatatatg      9420
     tagtatatag ttgtaagaaa gatatgtttg ttaattcaat ttgtataaat gataaaaata      9480
     tatctatttc ttgggtattt caaggcattc ctaaaggaac aggacatgca gtacagaaag      9540
     ttcttcccat gttgtatgaa gattctgaaa ttttagtttt atatggtgac gtgcctttga      9600
     tatctagtag gactttaaaa aaattattga gcgttaaatt ggaaagtgat attgcgctat      9660
     tgacagctaa tgttaatgat cccacagggt atggaaggat aatacgtaat gaatttggac      9720
     aggtaattga tattaaagaa gattctgata ttgttaatga taatcataga aaaattacag      9780
     aaattaattc tggaattttt atttctgttt caaaatatat aaaaaattgg gtgggaatag      9840
     tacaaaataa taatgtaaaa aatgaattgt atttgactga tatttttaag attgcttatc      9900
     aaaataaata tagaattaat actattaatc caattgatga gtttgaaatt attggaataa      9960
     atagtaaact ggatttaatt aaggtagaac gaatatatca gaaaaatcag gcatataatt     10020
     ttgtaaaatc aggagtagtt atattagatc cgtatagatt tgatttaaga ggaactttag     10080
     tgtgtggaaa ggatgtgtat attgatgtta atgtgattat tgaaggatgc gtgtctttag     10140
     gaaatcgagt taaaattgga gcaggttgta tattaaaaaa tgtagaaatt ggagatgatg     10200
     ttattatttg tccattttct tttatagaga attctaaaat aagttttgca agtaaaattg     10260
     gtccgttttc tcgattaaga ccaaatacac aattaggaga aaaaacatat ataggaaatt     10320
     ttgttgaatt aaaaaatgtg caattaggta aaaaatcaaa agttggccat cttagttatt     10380
     taggtgatgc tcaaatagga aatcaagtta atataggagc gggaactatt atttgcaatt     10440
     atgatggtat aaaaaaacat caaacttata ttgaagatga tgtttttatt ggatctgata     10500
     gtcagttaat tgctcctatt agaattggaa agagtgcgat tattggagct ggtactacgg     10560
     taactaaaaa tgtagaagaa ggaaagacag ttattagcag aatacagcaa ttttctattt     10620
     caaataaaaa atatactgat aaaaaataaa gtcataatta aatgatgtgc tatataccat     10680
     tgtggtaaat gacgaataca attaatttta tttaaaaatt attttccaat gcaaaatgaa     10740
     ctaaaaattt tttttaataa attatcagga gtagattttc caaatatttt attcagttca     10800
     tcgtgggcgt atcttaaatc ttcagcaaaa cgatcattaa tgatggttac tccacagtag     10860
     tagtggttta gttgtttttg agcagataat agatattgat aagcgttttt aattatgttc     10920
     aaatgtcttt gtcgagcaat aaaattgttt tgattttctt caatagaatg gggtagtgta     10980
     taatgttgta ttttatgttt ggtattgtta taaagatatt tttttagtaa gtctattcca     11040
     gagtttaata atgcagataa agttatgcat gtatatccat ttattatata gatcccgttt     11100
     ttttctaaac ttaaatcaga tttgtttcgt ataattgtaa tagtcgtttt tttatttata     11160
     tttggaagag ttttttgtaa aggaagtaac atatcatcat atttattgga gcaagaacta     11220
     gaatctacaa cccataaaat gtgatcagct aattttaatt cattttttgc gcgttttatt     11280
     ccaataagtt caatttcatt agtactatgt tcttgtaatc ctgcagtatc cgtaatatga     11340
     aatgttatcc cgtttaattg aatagtttca tataaagtat cccgtgtagt tccaggtatt     11400
     gaactaataa tagcacggtc aaggtttatg agtgcattaa ataaactaga ttttccagca     11460
     ttaggttttc ctgcgattat tatttttatt ccatctcgta ataaagagcc agaatatgct     11520
     gatttatata ttttgtctgt ttctgtgatt atatttttca gaattttttt tattttgttg     11580
     tatgagatag tgtcaatgtc ttgatctgaa aaatcaatag ttgattcaac atgcatacga     11640
     caatatatga ttttatctaa aatattgtga atttgattag agaagaaccc ttgtaaagaa     11700
     ttgtatgctg ccttagcggc ttgataggaa gtagcgtcaa taatatcagc tattgattca     11760
     gcttgaataa gatctatttt gttatttaaa aatgctcttt cggtgaattc tccaggatta     11820
     gctagtcgta ttttagaaga tatttctaaa atacgactta ataatatatt taatattata     11880
     tatcctccgt gcccgtgtat ttctaatata ttttctcctg taaaggaatg gggttttggg     11940
     aaaaacaatg taattacttt ttctattgta gatccttgtt tatctcgaaa tggtaagtat     12000
     tctgctgttc taggtttagg tacttttcct aataattcta aagcaatttc cggtattaat     12060
     tcgccggata tacgtataat tccaatacca cctcttccta ttggagtaga aatagcagca     12120
     attgtatcag aataatattt cataataatg ttttatatat gggtataata attatggtat     12180
     aatcgattat tttttagtat ttaaaagttt aatattttga ttcagtatac atataattat     12240
     tattacttta tgatctatgt atgttcatat tatttttttt tgataatcca tggtaaataa     12300
     tgtgttgttg aataatagta ataacgttac taatgatata atataacacc aatcctgatg     12360
     gaaaccatag aaaaaataca gtaaaagctg ttaacataat tgtcatgatt tttttttgtg     12420
     ttgggtcagt gatagtggtt ggggctaatt tttgtattaa aagcatagtt atgcccataa     12480
     taattggtaa aatataataa ggatcttgtg tagataaatc gttaatccat agcataaatt     12540
     tggcgtgtct taattcaact gaatttgata gcatataata taacgctaaa aaaattggca     12600
     tttgtattaa taaaggcaaa catcctccta gtgggttaac tttttctttt ttgtatagtt     12660
     ctatagtttt ttgatgacat tgatatttat tatgtttata tttttcttgt attaaaacaa     12720
     gttttggttg taacatacgc atttttgcca tagaggtata ttgcgctttt gtgaggggat     12780
     acataataat tcggattatt attgtgatta atatgattga tactccccaa ttatttatat     12840
     agttgtgaat taattgtaat aatttaaata atggttggga aataaaccag aaccagccat     12900
     aatcaataac taaatttaaa tttggagcta ttgttgattt aatatggtct tgaattttag     12960
     gtccaatcca taaaattgtt tgaaattcct ttttttgtcc aggtggaatc tgtatcaaat     13020
     cagattgaaa tcctatagac atataatgat catcaatgta agtagtgtga aaaacgttat     13080
     taacgggggt gataggtaac catgctacta cgaaatattt ttgtaataat gcaacccatc     13140
     ctcctatact gtgaatattt aaattattgt gcttcatatc attaaagcta tatttttgat     13200
     atttttcttt attggtagag tatgcagatc cttcgtattc ggaagataag tatattttat     13260
     ttttattatt ttttaatgga atcggtaagt aatattgtga ttgtactaaa ttgccaagta     13320
     ttctagtata tatggaatga atactagtat tatctatagt atgatttatg gtgataaagt     13380
     aattgtttct atgaaatagg tattgtttag tgtaaataat accgttgggg tcgtaatgca     13440
     ttaaagtaaa ttggagtgta tttttgttat ttttaagaat atatttgttt tgattattta     13500
     tatcagtata taaaaatttt ttacattgat tttcttcatt tgaaagattt gtgtttgttg     13560
     ttaattcgct gtaagtttgg tattgatatt tttttgatga atttaataat cgcaatggtt     13620
     gttgagaatt taaattgtct aaatatttta gaagataagc gtcttcaata tttcctccat     13680
     atttattgat ttttaataaa aaaacatcgg tttgcactgt gattatatct ttattttctg     13740
     aatgaacaat atttttttgt atgttgtttg gtggtgtaga agatgatatt ttagaattta     13800
     ggtatgaatt tgtatagtta tcttttaaat tatttaaatg agttttttga tagtaatgct     13860
     caatttccca tgtttgccat aatataaatg aaatgattaa aaaaattcca ataaaaaaat     13920
     tgcgttgtga atccatattc actatatcct tagttttttc atgttgaaag gagtggtaat     13980
     ttttattttt tttaaaattt aaagggtggc attgtaaaat acgaatacat attttccaaa     14040
     taccttttaa tattccaaat tgaagtatgg aattaattcc gtattgtgaa catgttatgg     14100
     agaaacggca atgatgccct aatatagggc taattgttat ttggtatgcg cgtattaacc     14160
     atattattaa ttttgttatt agtattcgtg ttgcttccat agttttttaa attcttcatt     14220
     taaattgtta tgttttaaat aaagaatttt ttttgaataa atagttaata caaaatctaa     14280
     atttaataag ttatgttgaa gtattcgaaa ggtttctcgt gcgtgtcgtt taattgtatt     14340
     tcggtcatgc gctcggttga tatatttttt tgaaatagct aatcctattc taggaaatcc     14400
     taattgatta ggtcgactaa ataaaagtat accatttgat ttaataattt tttttgcttt     14460
     aaaaacagag aagaattctt tagaatttaa taattttgtt tgttttgata aacggattct     14520
     attcattttg aattttattc atttctgata gaaatatgtt tgagattctt aaaattttta     14580
     agaagatgtc gataatctaa tccgaccctt ggatcttcgt cttgatatta tatgtcttcc     14640
     atttttagta gacattctaa ttctaaatcc atgagttcgg tttcgtttta atatagaagg     14700
     ttgaaaggta cgtttcatac atgtcactat atctttagtt gatatatacc tatatttttt     14760
     aactaaaact taattatata aaataaaatt aagaaagtca atcatatttc aatgaaaacc     14820
     ctacttcaaa aataaatatt attatatcat atttatgata tgatagtgtt tgttatgtat     14880
     gcgatcaaat aaataacggg cgtatattaa gttaaaaaac gatactaatc aatcataatt     14940
     atgacttttt gtgttgaaag gcaatcttta tatccaattt tgcagaaaat tatttctgtt     15000
     gttagtaata gaccaagatt acctatttta aaacatatat tgttagaaat taataataat     15060
     tgtttgattt taattgttac gaatttagag gtagaaatta tagctcatgt ttttttagag     15120
     aaaagatatg tttttaggtc ggttactgta tcgggtatta aattgtatga gatttttcgt     15180
     aatttatcgg catgtgctaa aatttttata aaattagaaa ataacaaact gcttgtaaat     15240
     tctgggtgta gtagctttgt tttatctact ttacctgctt cagattttcc taatgtagaa     15300
     acattgaaag ttgattgtga atttaatgta attatatcac aattgatgtt taaaaaaata     15360
     attgaattaa ctcaatttgc tatgggatat cgtgatgctc gtcattactt aaatggtatt     15420
     ttttttgaaa ttgaagataa ggttgttcgt gttgtagcaa ctgacgggca ccggttagca     15480
     atgtgtgaaa taactgcgga tacgttatca tcatcgcatt ccataattat accacgacaa     15540
     ggaatagtgg aaattttacg tttgttaaat tatacaaaga atttggttaa aataaaaatt     15600
     tatgataatc gaatttgtgt gaaaattgat aattatattg ttcattctaa attaattgat     15660
     tctgtatttc caaattataa aagagttttg acgaataatc taaaattatt ttttgaggtt     15720
     gatcgtatta tattaaagca ggcattaaaa cgagtttcta ttttatctaa tgaaaaactt     15780
     agagtcgttc attttaattt aatgcatgac cagttgaaaa taacggcaaa taattttaaa     15840
     caagaaactt cagaagagat tttagagata ttgtacgata atgaaaatat tgggatatct     15900
     tttaacgtag attatatatt agatataatt aatgtaatag attctaaaac tttaaaattt     15960
     tttttgacgg atccagtatc cagtgtgaaa attgaaggaa ttcctaaatt ttatgaagca     16020
     acttatgttg taatgcctgt tagagcatga gatgtgtgtt aatacgtatc agggtatagg     16080
     ggtatatgat taatttattt tttgatattt ttattgttgg atctatgtat tatagatata     16140
     tatagaaggt atatatgcaa attattatta tataatgtca atatattaat tatactaata     16200
     ttagtagaat atagatgtca attgtgatgt ataaatttga gtatttaagc gtacgaatat     16260
     agaaatgtaa taatatttat atagattgta tattttaata aaaaggacgg tgtttttgta     16320
     tttagatatt attataaata atagtgcgtg tatatcaaat tatgatatct gttcatataa     16380
     gtttttatat gtttatgaat aaagtaacaa ggaaaaaata tgttaagttc ttatgattct     16440
     tctagtatta aaattttaaa aggtttagat gcagttagaa agcgacctgg tatgtatatt     16500
     ggagatactg atgatggaac tgggttacat catatggtat ttgaagttgt ggataattct     16560
     attgatgaag ctattgcagg gtattgtcaa aaaatagtag taattattca tcaggataat     16620
     tcagtttcta ttcaagatga tggtcggggg attcctactg gcttacatga ggaagagggc     16680
     atatctgcag cagaagttat tatgaccgta ttacatgctg gaggtaaatt tgataataat     16740
     agttataaag tatcaggagg tttgcatgga gtaggagttt cagtggtaaa tgcattatct     16800
     gaaaaattag aattgattat tgaaagagat ttgaaaattt ataaacagat ttattttttt     16860
     ggtaagccga agtcgccttt gtctatagta ggagatagta ataaaagtgg caccactata     16920
     cgtttttggc caaattttca aatatttaca aataagattg aatttcagta tgctgtttta     16980
     gctcgacgtt ttcaagaatt atcattttta aatgctggag tatcaattgt tttatgtgac     17040
     gagcgtaatg gtaaagagga agttttttgt tgtaatggag gaattaaaga atttataaaa     17100
     tatttaaata ttaataaatc accaattcat tctaatatat tttattgtat gggaaataaa     17160
     ggggaagtta atgtggaagt tgctttacaa tggaatgatt cttttcaaga aagaatttat     17220
     tcttttacta ataatattcc acaaagggat ggtggcaccc atttatcagg gttaaagtct     17280
     gcaattacac gtaccatgca tttttatata gataaggaag gatataataa taaaaaaact     17340
     aaaattatta ctcttggaga ggatgccaga gaggggcttg ttgctgtttt atctgttaaa     17400
     atacaaaatc ctaagttttc ttctcaaact aaagagaagt tggtttcatc agaggtaaag     17460
     cctgctgttg aatccttgat ttatgaaaaa ttaatggaat tttttcttga gaatccaatt     17520
     gattctaaaa atattatagg aaaggtaatt agtgcggccc gtgctcgaga atcggcaaga     17580
     aaagttagag atttgagcag aaggaaagga ttatcggatt tttctatctt acctggaaaa     17640
     ttatctgatt gtcaagaaaa gaacccaagg tattctgaat tgtatttagt agaaggagat     17700
     tctgctggag gatcagcaaa acaaggtaga aatcgtaaaa atcaggcaat attgccatta     17760
     aaaggaaaaa tattaaatgt agaaaaagct agatttgata aaatgttgtc ttctcaagaa     17820
     gtaatgactt taattaccgc attgggttgt ggcataggtc aaaacgagta taatttaaat     17880
     aaattgcgtt atcatagtat tattttaatg accgatgcag atgtagacgg agcacatatc     17940
     cgtactttat tattaacttt tttttatcga catatgcctg aaattattga aagaggacat     18000
     atatttatag cacaacctcc tttgtataaa gttcaaaagg gtattcaatc aaaatattta     18060
     aaagatgaag aagaaatgta tcaatatcaa atatctattg ccgctcgtca tgctcggctg     18120
     tatttagatg tcaatgatac ttttccgtta tctgaaaaaa tgttaaaaaa gttaatttta     18180
     gagtattttg tcatacaaaa gattattgta agaatggaac gtcaatttcc aaaagtttta     18240
     ttaaatagat taatttatca tcctgtttta tctacagaac aatgtttagt ttattcagat     18300
     gtagaaatat ggattcaatc gctagttgaa tcattaagcc gatttcaaga atatggagat     18360
     ggtaatgatt atagttttgt tatacaaaaa aatattaagg agaagtattt tgtgcctatt     18420
     ttacggataa ggacttatgg tgtagataga gattatttgt tagggttaga tttaattcaa     18480
     agttatgaat atggaaagtt agtatctttt ggaaaaaaga tgaatgagtt gctattgtct     18540
     aatggatata ttgagtatga agattgtcat aaaaatataa attcttttaa tcaagcaatt     18600
     gaatggctta tgcaacaatc gagaaaaggg ttgattattc agcgttataa agggttagga     18660
     gaaatgaatc cagatcaatt gtgggagact actatgaatc ctcaaaatag atgtatgttg     18720
     cgtgtgacgg taaaggatgc aatagaagcg gataatttat tttctacttt gatgggagat     18780
     ttagtagagc ctagacgtgc gtttatagaa gctaatgcat taaaggctac gaatgtagat     18840
     tattaataca ttattgaaag agagtttttc tatattaaaa caaaaattca ccacaaagtg     18900
     tgaatgttat ctttgtatat tatgagtctt tataatagag tacagaggag gaatatcata     18960
     gttacataat agtataaata aaaattgtta aacatatagg tatatgttaa aatgggcttt     19020
     agtagtgtaa aggtggggag tggtgtgttt gatttaaaat atatttagaa gagaggtttt     19080
     tatgcataat tttgattttt caccattata tggatctgtt ataggatttg atagattagt     19140
     aaatttttta gaggtagggc aaagtaatgg taattatcct gcttataatg ttgaattagt     19200
     tagtgaacat aaatattgca tttctattgt agtggctgga ttttcaagtg atgaattaga     19260
     tattactact catgataata tgttaattgt aaaaggtatt cacactagaa atgatagtaa     19320
     ttctaattca gattctaaga attatttata tcaaggaatt actgatcatg attttgaaag     19380
     aaaattccaa ttagctgaac atattcaaat tactggagct aaattagatc gaggtatttt     19440
     gtatatacat ttaactagag tattaccaga tattcttaaa ccaaagcata tagaaattaa     19500
     gtaaaaatat actaatttgc acttttttag cagactcagc tattgtatac ttcagatttt     19560
     tctgaagtat acaatagctg agtctgctaa aaaagtgcaa attagtatat ttttacttaa     19620
     tttgtaatgt tataactaac aaatttagaa attaatttta aaatttataa gtaatcgtta     19680
     aattaagatg tttatagatg tagaaaagta tgttaaagta ttaaattata ttttttagtt     19740
     gtaattctat ttttaaataa gcataaaaaa tgggggccgc tattagtcct tctagtccaa     19800
     aaattgattc taaaaaaatc atagccagaa ctaattccca ggtatgagaa tttattttat     19860
     tcccaatgat ttcggcattt aaaaagtatt ctaatttatg aattaaaatt agatatatta     19920
     acattgttat tccaatactt aatgaaatgg ataaagctga aatagttatc ataatattag     19980
     aaattaaatt tccaacgatt ggtaataatc ctagaacaaa agtaataata attaaggttt     20040
     ttcctaatgg taatgtttct ccaaatactg gaatcaatat aaaaatcatg atagatgtta     20100
     acagggtatt aattgaagat atttttaatt gagcaaatac tatattatga aatgcgtgag     20160
     ataaattata tattcgttct aataattgat tagtaaaata tgtattgctt tctatatatt     20220
     tttttttata ttgaggataa gcaatcattg ctccaattat taatccgatt aataaagtga     20280
     tacatccgtg taaaataaca tgtcccatat ttcgaattag gatgatgttt aattcaatcc     20340
     acgaaaatat tcgttctttt agttctgatg ttgtatttgg aaaaaatttt ggtaaaaaat     20400
     tagggagttt ttttttaaag tcagaaaaaa tatgattaat ttcattcaac atattaattt     20460
     tatttgtatt ttctgaaaaa aaattagtac aatttgagat acttattgca atagtagaaa     20520
     taagaataat aattattatt aaaatagaaa gttgacgtgc tcgataggtt cctataaatc     20580
     gttcaaaata tgttgataaa gatacgataa tttcataagt taaaaatcct gaaaaaaaac     20640
     aaggaaataa ccctaatgga ataatcataa gaatagatgc aaacattatt atataagaaa     20700
     ttgctgtaat ccaagttttt atagaaaaca ttataatttt cctaatatat aaattatttg     20760
     taataataaa gtattttaag ataattttta ttattagtat ttggtattta taatttatat     20820
     aaatgtttat atggataaaa aagtatcttt ttatataaaa aaaagagtat agtatatatt     20880
     atactaataa ttcagtagta aattatgtat aatatatact ataagatata tcagtattgt     20940
     agtatatgaa aattttacaa tataaacaat gtattaatag taagtgtttt attaatttga     21000
     ttttttaaaa atttatcaaa ataatgagta agaattttta tatgataata ggggtataac     21060
     aatagttgga attaatataa acaaaaagtt tgtattgaga tacataatat cattgtattt     21120
     cataattttc agcgtatgtt caatatgtat aaatatatta atacattatt agtgatttgg     21180
     ttaatatgca acaacagtat tatgatgtta atgtcaaaac tatacaagat ttaataatgg     21240
     atttagaaaa gttttggata cataatggat gtattatagt gccatcgcta gatatggaaa     21300
     ttggtgcagc aacgtctcat cctattactt tttttaaagc tattggtcca gaaccagtag     21360
     ctgcggctta tgtacaagca tctcgtcgtc ctgctgatag cagatatgca aaaaatccaa     21420
     gtaggttaca gaaatattat caatttcaag tgattataaa accatctcct gaaaatatgt     21480
     cacaattata tttaaattct ttaaaagcaa ttggaataag tgaatcagaa aatgatatca     21540
     gatttattga agataattgg gaaaatccta cgttgggagc atatgggtta ggatgggaag     21600
     tgtggttaaa tggaatggaa ataactcaac ttacttattt tcaaagaatg gggggattag     21660
     aatgttttcc gattactgga gaaataactt atggattaga aagattagcg ttatttcttc     21720
     aagatatgga taatatatac gatttaattt ggggcaatac tataactggt gatattacgt     21780
     ataaagactt atattatcaa aatgaattag aacaatctag ttataatttt aaatatgtta     21840
     atgttagtta tttatttcag aattttaatg aatatgaaaa tgagataaac tatttacttt     21900
     ctttagatga accgttaata gttccatctt atgagttaat tttaaaatta atacatattt     21960
     ttaatttatt agatgcaaga aaagttattt ctgttacaga gcgtaaaaat tatattttac     22020
     gcattcaaag gttatcacat atggtagcag aaatgtatta tttttttcgt aaaaaaatag     22080
     gattcccttt atgtgcgaac aaaacgaata atataatcga ataataatta tgaaacaata     22140
     tactttgtta gtagaaatag gtactgatga gttacctgct aagtttttaa aaaatatagg     22200
     aaaagatttt tattcacata ttaaaaatga atttaaaaaa aataatattc tttataatga     22260
     aatttattgg tttgcttctc ctaggcattt agcagttaaa tctcgtattt caatcggtaa     22320
     aaatcaaagt ttatttaagt ctgacgtata taatcgtagt gatattgata attgtattgt     22380
     tgataaaaat ttatttttaa agaaaaaaaa taataaattt tctcaaaata tttcaagtca     22440
     tgttaatatt ttagaattta atagatttga aacggaaggt attcgtcaag ataagtttat     22500
     aaatgttagg caatttaagc ttttattggt tcaaattatt aaaaatgctt taggaaattt     22560
     gattaattat gaaacgatgc gatgggggga tgtactaatc ccatttattc gacctgttaa     22620
     tactgttaca attttattgg atactaatat agtttctggt cgtattttta ataaaaatat     22680
     aaatagaatt gtatatggta ataggtatat aaaaaataat aaaattattt tgaataatgc     22740
     aaatgattat cctaatgtgt tgtttgaaca aggttatgtg attgtagatt ataatatacg     22800
     taaacagaag atacgtatgg atgttgagca taaagcttta aaacttggag gcgtagttga     22860
     tataaaaaat gatgattttt tagaaaaaat cacttcttcg atagaatggc ctattatttt     22920
     atttggtaaa tttaataaaa gatttttaaa attaccaaaa gaattaataa ttcatatcat     22980
     gcaagataaa caacaatatt ttcctgtata tgggaaaaat caggatatac ttttaccgta     23040
     ttttattttt gtgattaata taattattga taattataac aaaataatta atgatcatga     23100
     aaatattatt aatatgcgtt ttttagatgc agaatttttt ttaaaaaatg ataataaaaa     23160
     tcgtttagag gattattttc ctaaattaag tgaaatagta tttcatagtc aacttggaag     23220
     tttaaaagat aaagtgcatc gaataacaga attatctgga tggatagcta atcaagttaa     23280
     tgaaaatgaa tttaaagcta gaagagcggg atatttatgt aaatgtgatt tagttactga     23340
     tgtggtgtta gaatttcctg aggttcaggg tattatgggt atgtattatg ctcagagaga     23400
     tggagaagaa aaagaagtag cattagctca aaaagagcat tatcaaccta gatattatac     23460
     agataaatta cctacagaac gaatttcttg tattgtgtct attgctgata agatggatac     23520
     aatatctggt atttttagtg ttaaggaatt tcctacagga agtagagatc cgtttggatt     23580
     aaaaagggca gctaaaggta tattaaatat tgttcttgaa aagaacatgc ctataaattt     23640
     attagatttg ataagtaagt caattatgtt atataaattg caattagttg acgatgattt     23700
     aataaatatt aaaaatgatg tttatacttt tatgtgtcaa cgtctttgtt tgtattatcg     23760
     agcattaggt tataaagaaa atatagttcg atctgtttta aatattaggt ttgggaatat     23820
     aattaattta gggaaacata ttgactcggt tcataatttc tataccattc agaaagaaaa     23880
     aggggctatg ttcaatttag tttataaacg tatatcaaat cttattagaa atcaaaatgt     23940
     cttttgtaat ataacagaag aaattaataa aactttactt aaaagtttag aagaaattaa     24000
     attatttgag cagataactt atactaagat gaatttaaat tctgtattgc aagagagtcg     24060
     ttatagtgat gcattaaaca ttgtagaaaa tctattccat agaactaatt ttttcttaga     24120
     taatgttttt ataatgagca aaaatcaaaa tataaaagaa aaccggctat ctttaattaa     24180
     gacggtgaaa gatttagttt caagagtaat agatatatct gttttactta aataagtcat     24240
     tttaatgctt aaaacttaag caatgggcaa attatttaag aaactttttt aattcaaata     24300
     aaaagattca tcaaaccttc tagaagcctc atcccaattt atgatattcc aaaaagcttt     24360
     cacataatct aaacgtctat tttggtattt taaataataa gagtgttccc atagatccag     24420
     tccaaatatt gggaatccgt atgtatgaga taatttgttt tccataagag gattatcttg     24480
     atttggggta gaaacgattt ttaaattatt attgtgtatt attaaccaag tccaacctga     24540
     tccaaaacga ctcatagaaa cttgttcaaa ttcttttttg aagttattat aatctataaa     24600
     ggtgttttct attgcttttt ttagtgatcc ttttaattct gtacctagtt taagagattt     24660
     ccagaaaagg ctatgattaa aatgaccacc tccattatta cgtaatatat cttttttttc     24720
     ttggggcaag aaatctagtt gtttaattag attttctatt gttaaatttg aaaatttggg     24780
     taaatttttt aaagcggaat tggcattatt gatatacgct tgatgatgtt tagaataatg     24840
     aatttccata gtttttgcat cgaaaaaagg ttccaaagag tcatatgaat atgataaatc     24900
     aggtagttta aaaaccattt taaaatctct cttaattgaa taatgctagt atctaatgat     24960
     ttaattatat tgaataataa tgaataagta aagcataatt taaaaattag aagaaggtag     25020
     tgggaatata taacttgggt agtattttaa ttgttatata tttttaattg tgtaaaaata     25080
     tgtattttaa atataaaatt catatttttc aagaaattaa gatataaata taggtgtcat     25140
     gagtgaataa gaaattttgt aattttgatt tacctttgtt ttctatgata aagttaaata     25200
     gtattaatga tctgataaag aagagaatag ataactgtta tactgaagta gatcgaattg     25260
     tatcattaaa taaatcaata acttattgga aggatgtata tgaaccatta agaatatcgg     25320
     aaaataaatt aaaaaaggtt tggtctataa taactcattt aaattcagta aaacatgatt     25380
     taaagttacg tgttatttat caaaacaatt taatgtctat tttggaatat agaaactggg     25440
     taaatcatca ccttggttta tatcggttat ataaatcttt acaaaataat agttcttatc     25500
     aattattaag tactatacag caagtagcat taagaaaaat tttatctcgt tatgagatat     25560
     cgggaattca tttatgtggt gataagagaa aatgttattg tagaatgatg tgtatgttat     25620
     ctcaacttaa tacaattttt gataataatg ttctagattc tatacgagga tggaaaaaaa     25680
     taattacaga tcaaagttta ttatcaggta ttccagatga tcaattacat atagctcgtt     25740
     tggaggctca acgtaatcaa cgactaggat ggttatttac attacaatat cctgtatatt     25800
     tatcagtgtt atcttattgt gacaatgaag attttagaaa ggaattatat tgggctttta     25860
     atactcgagc atctgatcaa ggtcctaatg ctggaaaatg ggataatact ttagttatag     25920
     atgaaatttt atctttacgc tatggaatag ctaaaatttt aggatttaat agttatttcg     25980
     aaaaatcttt acagacaaaa atgattcaaa atcctacaag tatacttaat tttcttaaga     26040
     atttacttaa tcatgttcat cctaatgcaa agaaagattt tttaaaaata caaagttttg     26100
     ctaaaaaata ttactctcat aaatgtgtaa atccatggga tgtaaagtat tttcaagaaa     26160
     aacagaaatc gcatcttttt cagatttcag aaaaagaatt gcgcttttac ttttcggaag     26220
     aaaaagtttt atctgagatg ttttcgatag ctaatcgtat gtatggtatt gtgataagag     26280
     aacgaaagga tgtagatgta tgggattcaa atgtacgatt ttttgatata tttaatcata     26340
     aaaatgagtg gcaaggagga ttttatttgg atctttatat gcgaagaaat aaatgtgaag     26400
     gagcatggat ggatatatat tcggatacga agaatgaaga tgatatggaa tatcaaatgc     26460
     ctattgcata tcttatttgc aattttaatg cttctgaaga ttcaggtaga ccatctttat     26520
     taactcatgg gaatatagtg acattatttc atgagtttgg tcatgttttg catcatattt     26580
     taacatctat aagtatttct gaaatatctg gggttaatgg agtggaatta gatgttgcag     26640
     aaattccaag tgtgtttatg gagaaatttt gctgggatcc aactgtattg aaatctattt     26700
     ctcaacatta tcaaacaaaa aattctttat caaataacat gattaatgat ttattaagat     26760
     taaaaactga acaagctaca catgatttgt taaagcaaat tatgtgtagc ttgtttgatt     26820
     ttaagattca tcatgagtat agcccaaaag agaaaaaccc ggtattaaac atttttaatg     26880
     aaatcaaaca aaatacaata gtgtatccac cgtttggtga cgataggttt cctcattctt     26940
     ttgctcatat tttttctgct gatgattatg cggcaggata ttatagttat ttatggtcag     27000
     atatgttagc gtcaagtatt tggttacatt gtaaagattt acggttaacc gattctcaaa     27060
     tgggaaattt gtttcttgat catatggtgt gtatgggaca atctattgat ttcaaacagt     27120
     gttttacttg tattaaaaat aaggtagtta caactcaagc tattttaaaa tattataata     27180
     ttcctataca aaataatcta ttttttaagt tatgttagtg taaatatatt gatttgttaa     27240
     tagcggtatt atcatatttt aattcataat ataatttata tacatagaga ataaataaag     27300
     attaataaga ggagaatata tatttttata ttgtgattag tatcatgata atatgatact     27360
     atattaattg atgaggtttt attttgttaa ttttaaaaaa ataattcaaa taatgaatat     27420
     atgtattata tttaaatgtt ttggtaaaat aatttaaaaa ttaataaata gaacccccca     27480
     cttaatataa tagatatagg tatagttaaa gaccaagtca ttaggatatt ttttattatt     27540
     ttccattgta ctccttccca tctatgggtt aacatacttc cagtaataga tgaggataat     27600
     atatgcgtag tagaaacagg cataccaata taactggctg tacctataga tatagcagta     27660
     gttaattgag cagataaacc ttgtgcgtag gtcatttttt gtgtacctat tttttctcct     27720
     atagtaatag caacgcgttt ccatcctatt gttgttccca aggataaaga taaagctact     27780
     gctacaataa tccaggttgg agcgtattca atggtgttta gtaggttaat ttttaagtgt     27840
     tttaagaatt ttttgttttt gtttgatatg tctggatgtt tgatgatttg atctaagata     27900
     tcggttatat acattagtaa ttgtctaatt tgtaagcgtt ggttcaaatt tagttgttca     27960
     taattttcta agttttcaag taagcataaa gaattttgca taatagttaa agttaatgaa     28020
     aaatcgtaaa agattttttt tatttgagct gtagtcagta ctgtggatat tcgacaattg     28080
     caattagatt gatgattatg ttcatgtatt aagtgtgttg taattttttg aatggatggg     28140
     tcaataatta ccaattggtt taaagcgaca gatataggca tagacataat ttctgaagga     28200
     ataatatttt tgaagtgatc atggtgttgt atataatatc gttgaaaatt gtttattgca     28260
     tttcgagtat tagtaatatc attattatta gcatgcatat ttaaaacaaa gctagcagga     28320
     gctactccta ctaaaagcaa cataataaat ccaattcctt tttgtccatc atttgcaccg     28380
     tgtgaaaaac taa