(data stored in SCRATCH3701 zone)

EMBL: CP002205

ID   CP002205; SV 1; circular; genomic DNA; STD; PRO; 2153198 BP.
XX
AC   CP002205;
XX
PR   Project:PRJNA31347;
XX
DT   16-SEP-2010 (Rel. 106, Created)
DT   07-AUG-2014 (Rel. 121, Last updated, Version 4)
XX
DE   Sulfurimonas autotrophica DSM 16294, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Sulfurimonas autotrophica DSM 16294
OC   Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
OC   Helicobacteraceae; Sulfurimonas.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2153198
RX   PUBMED; 21304749.
RA   Sikorski J., Munk C., Lapidus A., Ngatchou Djao O.D., Lucas S.,
RA   Glavina Del Rio T., Nolan M., Tice H., Han C., Cheng J.F., Tapia R.,
RA   Goodwin L., Pitluck S., Liolios K., Ivanova N., Mavromatis K.,
RA   Mikhailova N., Pati A., Sims D., Meincke L., Brettin T., Detter J.C.,
RA   Chen A., Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D.,
RA   Rohde M., Lang E., Spring S., Goker M., Woyke T., Bristow J., Eisen J.A.,
RA   Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Sulfurimonas autotrophica type strain (OK10)";
RL   Stand Genomic Sci 3(2):194-202(2010).
XX
RN   [2]
RP   1-2153198
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Munk A.C., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Spring S., Lang E., Aumann P., Schneider S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Sulfurimonas autotrophica DSM 16294";
RL   Unpublished.
XX
RN   [3]
RP   1-2153198
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Munk A.C., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Spring S., Lang E., Aumann P., Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (09-SEP-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ba44f5d5bbec98bc8cb1f7b885553681.
DR   BioSample; SAMN00713560.
DR   CABRI; DSM 16294.
DR   EnsemblGenomes-Gn; EBG00001067177.
DR   EnsemblGenomes-Gn; EBG00001067178.
DR   EnsemblGenomes-Gn; EBG00001067179.
DR   EnsemblGenomes-Gn; EBG00001067180.
DR   EnsemblGenomes-Gn; EBG00001067181.
DR   EnsemblGenomes-Gn; EBG00001067182.
DR   EnsemblGenomes-Gn; EBG00001067183.
DR   EnsemblGenomes-Gn; EBG00001067184.
DR   EnsemblGenomes-Gn; EBG00001067185.
DR   EnsemblGenomes-Gn; EBG00001067186.
DR   EnsemblGenomes-Gn; EBG00001067188.
DR   EnsemblGenomes-Gn; EBG00001067190.
DR   EnsemblGenomes-Gn; EBG00001067192.
DR   EnsemblGenomes-Gn; EBG00001067194.
DR   EnsemblGenomes-Gn; EBG00001067195.
DR   EnsemblGenomes-Gn; EBG00001067196.
DR   EnsemblGenomes-Gn; EBG00001067197.
DR   EnsemblGenomes-Gn; EBG00001067198.
DR   EnsemblGenomes-Gn; EBG00001067200.
DR   EnsemblGenomes-Gn; EBG00001067201.
DR   EnsemblGenomes-Gn; EBG00001067202.
DR   EnsemblGenomes-Gn; EBG00001067203.
DR   EnsemblGenomes-Gn; EBG00001067204.
DR   EnsemblGenomes-Gn; EBG00001067205.
DR   EnsemblGenomes-Gn; EBG00001067206.
DR   EnsemblGenomes-Gn; EBG00001067207.
DR   EnsemblGenomes-Gn; EBG00001067208.
DR   EnsemblGenomes-Gn; EBG00001067210.
DR   EnsemblGenomes-Gn; EBG00001067211.
DR   EnsemblGenomes-Gn; EBG00001067212.
DR   EnsemblGenomes-Gn; EBG00001067213.
DR   EnsemblGenomes-Gn; EBG00001067214.
DR   EnsemblGenomes-Gn; EBG00001067216.
DR   EnsemblGenomes-Gn; EBG00001067218.
DR   EnsemblGenomes-Gn; EBG00001067220.
DR   EnsemblGenomes-Gn; EBG00001067222.
DR   EnsemblGenomes-Gn; EBG00001067224.
DR   EnsemblGenomes-Gn; EBG00001067225.
DR   EnsemblGenomes-Gn; EBG00001067226.
DR   EnsemblGenomes-Gn; EBG00001067227.
DR   EnsemblGenomes-Gn; EBG00001067228.
DR   EnsemblGenomes-Gn; EBG00001067229.
DR   EnsemblGenomes-Gn; EBG00001067230.
DR   EnsemblGenomes-Gn; EBG00001067231.
DR   EnsemblGenomes-Gn; EBG00001067232.
DR   EnsemblGenomes-Gn; EBG00001067234.
DR   EnsemblGenomes-Gn; EBG00001067235.
DR   EnsemblGenomes-Gn; EBG00001067236.
DR   EnsemblGenomes-Gn; EBG00001067237.
DR   EnsemblGenomes-Gn; EBG00001067238.
DR   EnsemblGenomes-Gn; EBG00001067240.
DR   EnsemblGenomes-Gn; EBG00001067242.
DR   EnsemblGenomes-Gn; EBG00001067248.
DR   EnsemblGenomes-Gn; EBG00001067249.
DR   EnsemblGenomes-Gn; EBG00001067251.
DR   EnsemblGenomes-Gn; EBG00001067253.
DR   EnsemblGenomes-Gn; EBG00001067255.
DR   EnsemblGenomes-Gn; EBG00001067257.
DR   EnsemblGenomes-Gn; EBG00001067259.
DR   EnsemblGenomes-Gn; EBG00001067260.
DR   EnsemblGenomes-Gn; EBG00001067261.
DR   EnsemblGenomes-Gn; EBG00001067262.
DR   EnsemblGenomes-Gn; Saut_R0001.
DR   EnsemblGenomes-Gn; Saut_R0002.
DR   EnsemblGenomes-Gn; Saut_R0003.
DR   EnsemblGenomes-Gn; Saut_R0004.
DR   EnsemblGenomes-Gn; Saut_R0005.
DR   EnsemblGenomes-Gn; Saut_R0006.
DR   EnsemblGenomes-Gn; Saut_R0007.
DR   EnsemblGenomes-Gn; Saut_R0008.
DR   EnsemblGenomes-Gn; Saut_R0009.
DR   EnsemblGenomes-Gn; Saut_R0010.
DR   EnsemblGenomes-Gn; Saut_R0011.
DR   EnsemblGenomes-Gn; Saut_R0012.
DR   EnsemblGenomes-Gn; Saut_R0014.
DR   EnsemblGenomes-Gn; Saut_R0015.
DR   EnsemblGenomes-Gn; Saut_R0016.
DR   EnsemblGenomes-Gn; Saut_R0017.
DR   EnsemblGenomes-Gn; Saut_R0018.
DR   EnsemblGenomes-Gn; Saut_R0019.
DR   EnsemblGenomes-Gn; Saut_R0020.
DR   EnsemblGenomes-Gn; Saut_R0021.
DR   EnsemblGenomes-Gn; Saut_R0022.
DR   EnsemblGenomes-Gn; Saut_R0023.
DR   EnsemblGenomes-Gn; Saut_R0024.
DR   EnsemblGenomes-Gn; Saut_R0025.
DR   EnsemblGenomes-Gn; Saut_R0026.
DR   EnsemblGenomes-Gn; Saut_R0027.
DR   EnsemblGenomes-Gn; Saut_R0028.
DR   EnsemblGenomes-Gn; Saut_R0029.
DR   EnsemblGenomes-Gn; Saut_R0030.
DR   EnsemblGenomes-Gn; Saut_R0031.
DR   EnsemblGenomes-Gn; Saut_R0032.
DR   EnsemblGenomes-Gn; Saut_R0033.
DR   EnsemblGenomes-Gn; Saut_R0034.
DR   EnsemblGenomes-Gn; Saut_R0036.
DR   EnsemblGenomes-Gn; Saut_R0037.
DR   EnsemblGenomes-Gn; Saut_R0038.
DR   EnsemblGenomes-Gn; Saut_R0039.
DR   EnsemblGenomes-Gn; Saut_R0040.
DR   EnsemblGenomes-Gn; Saut_R0041.
DR   EnsemblGenomes-Gn; Saut_R0042.
DR   EnsemblGenomes-Gn; Saut_R0043.
DR   EnsemblGenomes-Gn; Saut_R0044.
DR   EnsemblGenomes-Gn; Saut_R0045.
DR   EnsemblGenomes-Gn; Saut_R0046.
DR   EnsemblGenomes-Gn; Saut_R0047.
DR   EnsemblGenomes-Gn; Saut_R0048.
DR   EnsemblGenomes-Gn; Saut_R0049.
DR   EnsemblGenomes-Gn; Saut_R0050.
DR   EnsemblGenomes-Gn; Saut_R0051.
DR   EnsemblGenomes-Gn; Saut_R0052.
DR   EnsemblGenomes-Gn; Saut_R0053.
DR   EnsemblGenomes-Gn; Saut_R0055.
DR   EnsemblGenomes-Gn; Saut_R0056.
DR   EnsemblGenomes-Gn; Saut_R0057.
DR   EnsemblGenomes-Gn; Saut_R0058.
DR   EnsemblGenomes-Tr; EBT00001669911.
DR   EnsemblGenomes-Tr; EBT00001669912.
DR   EnsemblGenomes-Tr; EBT00001669913.
DR   EnsemblGenomes-Tr; EBT00001669914.
DR   EnsemblGenomes-Tr; EBT00001669915.
DR   EnsemblGenomes-Tr; EBT00001669916.
DR   EnsemblGenomes-Tr; EBT00001669917.
DR   EnsemblGenomes-Tr; EBT00001669918.
DR   EnsemblGenomes-Tr; EBT00001669919.
DR   EnsemblGenomes-Tr; EBT00001669920.
DR   EnsemblGenomes-Tr; EBT00001669921.
DR   EnsemblGenomes-Tr; EBT00001669922.
DR   EnsemblGenomes-Tr; EBT00001669923.
DR   EnsemblGenomes-Tr; EBT00001669924.
DR   EnsemblGenomes-Tr; EBT00001669925.
DR   EnsemblGenomes-Tr; EBT00001669926.
DR   EnsemblGenomes-Tr; EBT00001669927.
DR   EnsemblGenomes-Tr; EBT00001669928.
DR   EnsemblGenomes-Tr; EBT00001669929.
DR   EnsemblGenomes-Tr; EBT00001669930.
DR   EnsemblGenomes-Tr; EBT00001669931.
DR   EnsemblGenomes-Tr; EBT00001669932.
DR   EnsemblGenomes-Tr; EBT00001669933.
DR   EnsemblGenomes-Tr; EBT00001669934.
DR   EnsemblGenomes-Tr; EBT00001669935.
DR   EnsemblGenomes-Tr; EBT00001669936.
DR   EnsemblGenomes-Tr; EBT00001669937.
DR   EnsemblGenomes-Tr; EBT00001669938.
DR   EnsemblGenomes-Tr; EBT00001669939.
DR   EnsemblGenomes-Tr; EBT00001669940.
DR   EnsemblGenomes-Tr; EBT00001669941.
DR   EnsemblGenomes-Tr; EBT00001669942.
DR   EnsemblGenomes-Tr; EBT00001669943.
DR   EnsemblGenomes-Tr; EBT00001669944.
DR   EnsemblGenomes-Tr; EBT00001669945.
DR   EnsemblGenomes-Tr; EBT00001669946.
DR   EnsemblGenomes-Tr; EBT00001669947.
DR   EnsemblGenomes-Tr; EBT00001669948.
DR   EnsemblGenomes-Tr; EBT00001669949.
DR   EnsemblGenomes-Tr; EBT00001669950.
DR   EnsemblGenomes-Tr; EBT00001669951.
DR   EnsemblGenomes-Tr; EBT00001669952.
DR   EnsemblGenomes-Tr; EBT00001669953.
DR   EnsemblGenomes-Tr; EBT00001669954.
DR   EnsemblGenomes-Tr; EBT00001669955.
DR   EnsemblGenomes-Tr; EBT00001669956.
DR   EnsemblGenomes-Tr; EBT00001669957.
DR   EnsemblGenomes-Tr; EBT00001669958.
DR   EnsemblGenomes-Tr; EBT00001669959.
DR   EnsemblGenomes-Tr; EBT00001669960.
DR   EnsemblGenomes-Tr; EBT00001669961.
DR   EnsemblGenomes-Tr; EBT00001669962.
DR   EnsemblGenomes-Tr; EBT00001669963.
DR   EnsemblGenomes-Tr; EBT00001669964.
DR   EnsemblGenomes-Tr; EBT00001669965.
DR   EnsemblGenomes-Tr; EBT00001669966.
DR   EnsemblGenomes-Tr; EBT00001669967.
DR   EnsemblGenomes-Tr; EBT00001669968.
DR   EnsemblGenomes-Tr; EBT00001669969.
DR   EnsemblGenomes-Tr; EBT00001669970.
DR   EnsemblGenomes-Tr; EBT00001669971.
DR   EnsemblGenomes-Tr; EBT00001669972.
DR   EnsemblGenomes-Tr; Saut_R0001-1.
DR   EnsemblGenomes-Tr; Saut_R0002-1.
DR   EnsemblGenomes-Tr; Saut_R0003-1.
DR   EnsemblGenomes-Tr; Saut_R0004-1.
DR   EnsemblGenomes-Tr; Saut_R0005-1.
DR   EnsemblGenomes-Tr; Saut_R0006-1.
DR   EnsemblGenomes-Tr; Saut_R0007-1.
DR   EnsemblGenomes-Tr; Saut_R0008-1.
DR   EnsemblGenomes-Tr; Saut_R0009-1.
DR   EnsemblGenomes-Tr; Saut_R0010-1.
DR   EnsemblGenomes-Tr; Saut_R0011-1.
DR   EnsemblGenomes-Tr; Saut_R0012-1.
DR   EnsemblGenomes-Tr; Saut_R0014-1.
DR   EnsemblGenomes-Tr; Saut_R0015-1.
DR   EnsemblGenomes-Tr; Saut_R0016-1.
DR   EnsemblGenomes-Tr; Saut_R0017-1.
DR   EnsemblGenomes-Tr; Saut_R0018-1.
DR   EnsemblGenomes-Tr; Saut_R0019-1.
DR   EnsemblGenomes-Tr; Saut_R0020-1.
DR   EnsemblGenomes-Tr; Saut_R0021-1.
DR   EnsemblGenomes-Tr; Saut_R0022-1.
DR   EnsemblGenomes-Tr; Saut_R0023-1.
DR   EnsemblGenomes-Tr; Saut_R0024-1.
DR   EnsemblGenomes-Tr; Saut_R0025-1.
DR   EnsemblGenomes-Tr; Saut_R0026-1.
DR   EnsemblGenomes-Tr; Saut_R0027-1.
DR   EnsemblGenomes-Tr; Saut_R0028-1.
DR   EnsemblGenomes-Tr; Saut_R0029-1.
DR   EnsemblGenomes-Tr; Saut_R0030-1.
DR   EnsemblGenomes-Tr; Saut_R0031-1.
DR   EnsemblGenomes-Tr; Saut_R0032-1.
DR   EnsemblGenomes-Tr; Saut_R0033-1.
DR   EnsemblGenomes-Tr; Saut_R0034-1.
DR   EnsemblGenomes-Tr; Saut_R0036-1.
DR   EnsemblGenomes-Tr; Saut_R0037-1.
DR   EnsemblGenomes-Tr; Saut_R0038-1.
DR   EnsemblGenomes-Tr; Saut_R0039-1.
DR   EnsemblGenomes-Tr; Saut_R0040-1.
DR   EnsemblGenomes-Tr; Saut_R0041-1.
DR   EnsemblGenomes-Tr; Saut_R0042-1.
DR   EnsemblGenomes-Tr; Saut_R0043-1.
DR   EnsemblGenomes-Tr; Saut_R0044-1.
DR   EnsemblGenomes-Tr; Saut_R0045-1.
DR   EnsemblGenomes-Tr; Saut_R0046-1.
DR   EnsemblGenomes-Tr; Saut_R0047-1.
DR   EnsemblGenomes-Tr; Saut_R0048-1.
DR   EnsemblGenomes-Tr; Saut_R0049-1.
DR   EnsemblGenomes-Tr; Saut_R0050-1.
DR   EnsemblGenomes-Tr; Saut_R0051-1.
DR   EnsemblGenomes-Tr; Saut_R0052-1.
DR   EnsemblGenomes-Tr; Saut_R0053-1.
DR   EnsemblGenomes-Tr; Saut_R0055-1.
DR   EnsemblGenomes-Tr; Saut_R0056-1.
DR   EnsemblGenomes-Tr; Saut_R0057-1.
DR   EnsemblGenomes-Tr; Saut_R0058-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01069; purD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002205.
DR   SILVA-SSU; CP002205.
DR   StrainInfo; 377678; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084296
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Sulfurimonas autotrophica OK10, DSM 16294
CC   collection_date     :: Missing
CC   lat_lon             :: 27.266 127.166
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Japan
CC   environment         :: Marine, Sediment
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 16294, ATCC BAA-671, JCM 11897
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Missing
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02544
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 81592
CC   Funding Program     :: DOE-GEBA 2007
CC   Gene Calling Method :: Prodigal, GenePRIMP
CC   Isolation Site      :: Deep-sea sediments at the Hatoma Knoll in
CC                          the Mid-Okinawa Trough hydrothermal field in
CC                          Japan
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 24C
CC   pH                  :: 4.5 - 9.0
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: Missing
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2153198
FT                   /organism="Sulfurimonas autotrophica DSM 16294"
FT                   /strain="DSM 16294"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan"
FT                   /isolation_source="deep-sea sediments at the Hatoma Knoll
FT                   in the Mid-Okinawa Trough hydrothermal field"
FT                   /db_xref="taxon:563040"
FT                   /culture_collection="DSM:16294"
FT   gene            111..1418
FT                   /locus_tag="Saut_0001"
FT   CDS_pept        111..1418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation; InterPro
FT                   IPR020591:IPR013159:IPR013317:IPR003593:IPR 001957; KEGG:
FT                   tdn:Suden_0001 chromosomal replication initiation protein;
FT                   PFAM: Chromosomal replication initiator DnaA; Chromosomal
FT                   replication initiator DnaA domain; SMART: Chromosomal
FT                   replication initiator DnaA domain; AAA ATPase; SPTR: Q30UP9
FT                   Chromosomal replication initiator protein dnaA; TIGRFAM:
FT                   chromosomal replication initiator protein DnaA; PFAM:
FT                   domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08050"
FT                   /db_xref="GOA:E0UP17"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP17"
FT                   /protein_id="ADN08050.1"
FT                   /translation="MNIGQEVLKALKEEISELEYNRYIRHLSYDIKKSTGDAAIFYAPN
FT                   ALVVNWIKNKYREKIAHLFEIKNGSKVNIKITLKNTIEKRKTKKNVEVKQNSSLLNPSH
FT                   SFDNFMVGGSNQFAYAAVKSVSENAGKVYNPLFIYGGVGLGKTHLMQAAGNVFQNEGKV
FT                   VIYTTVEQFLNDFIRHVRNKTMERFQEKYRKCDVLLIDDIQFLSNKEGIQEEFFHTFEA
FT                   LKGAGKQIILTADKHPKKIGGLEARLQSRFEWGLVADIQPPELETKIAIIKKKCEINKV
FT                   KLSEDIVNYIATVIDSNVREIEGILSKLHAYSQLMHVDIDLDFTKNVLKDQMNENRANL
FT                   TMETITQIVAKDLNIKPSEIRSKGRSKNIVYARRISIYICRELTQNTMPQLAQYFGMKD
FT                   HTAISHTIKKINSLIKDDEDFKVKIDELTNKITSSS"
FT   gene            1601..2668
FT                   /locus_tag="Saut_0002"
FT   CDS_pept        1601..2668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: tdn:Suden_0002
FT                   DNA polymerase III subunit beta; PFAM: DNA polymerase III
FT                   beta chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: O25242 DNA polymerase III
FT                   subunit beta; TIGRFAM: DNA polymerase III, beta subunit;
FT                   PFAM: DNA polymerase III beta subunit, C-terminal domain;
FT                   DNA polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08051"
FT                   /db_xref="GOA:E0UP18"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP18"
FT                   /protein_id="ADN08051.1"
FT                   /translation="MKITVSKSILENILIHASPFLEKKDTSQITSHVYMNVSNSELTLK
FT                   ATDYEIGFLVSTDNLKIEKEGSITANGKKFLDIVRILKDDEINLEVKNDNLLISQGHSN
FT                   FKLPTFSYNEFPEFPAYEGKPRISIESHTLIESLKKITPAIDTNNPKFELNGALIDIQK
FT                   NSINFAATDTRRLAVVTIDNQSDNELSIIIPKKAIVEIQKLFFDNIELYYDETNLIIHS
FT                   QQYTFFTKLINGKFPEYSRIIPKETKYNLVLPKAIMIDSIKQITTISTDLKITFMNDII
FT                   SFESLSDDNIEAKTEISYNTGFSKPFSIAINSKYLLDFLNSINSSEFTIGLNEGNLPFI
FT                   LKDQNFITVVMPIVI"
FT   gene            2755..5073
FT                   /locus_tag="Saut_0003"
FT   CDS_pept        2755..5073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit; InterPro
FT                   IPR001241:IPR000565:IPR002288:IPR006171:IPR
FT                   003594:IPR013506:IPR018522:IPR011557; KEGG: tdn:Suden_0003
FT                   DNA gyrase subunit B; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; PRIAM: DNA topoisomerase
FT                   (ATP-hydrolyzing); SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein; SPTR: O87667 DNA gyrase
FT                   subunit B; TIGRFAM: DNA gyrase, B subunit; PFAM: Toprim
FT                   domain; Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; DNA gyrase B; DNA gyrase B subunit, carboxyl
FT                   terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08052"
FT                   /db_xref="GOA:E0UP19"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP19"
FT                   /protein_id="ADN08052.1"
FT                   /translation="MQQEYGASNIKVLKGLEAVRKRPGMYIGDTGHRGLHHLVYEVIDN
FT                   SIDEAMAGYCDTITVTLTKNGTCKVSDNGRGIPTDMHPTENMSAATVVLTVLHAGGKFD
FT                   KDTYKVSGGLHGVGVSVVNALSSDLHMTIYREGKIHEQDFKMGIPQGPLEVTGTTRKTG
FT                   TTIEFAADPSIFTETITFEYEYLAKRFKELAYLNPFITIKFNDERTNTKEVYHFEGGIA
FT                   QYVSDMNKREVVANVYSFSGKAEDIEFDIAIMYNDSYEEKLASFVNNIRTPNGGTHEAG
FT                   FRAGLTRVISNYNSKNGAAKEKDVKISGDDVKEGLIAIVSARVPEPQFEGQTKGKLGNT
FT                   YVRPLIQKATGEALNKYFEENPIEAKAIVSKALMAARGREAAKKARELTRRKDSMSVGT
FT                   LPGKLADCQSKDASICELYLVEGDSAGGSAKMGRDRVFQAILPLKGKILNVEKARLEKI
FT                   LKSDEITNMITAMGCGIGEEYNEEKLRYHKIIIMTDADVDGSHIQTLLLTFFFRYFRDI
FT                   IEKGYLYLAQPPLYRYKKGKKEIYFKDDRAMNDYLIDNGIESLDIDGVGHNDLVAYFKM
FT                   VDHYASSLEALNRRYALVKLIRHFIENPDLIALPAKEMFVEIEKFLTSIGNNILTYTIN
FT                   EETNEIHLFVQTQTGMEELLINDDLFSAPHFNEASFVYKKIMEWDIHFDKDIIEVLEDI
FT                   KDYAKKGAYIQRYKGLGEMNPEQLWETTMTPENRVLLQISIEDAEVASDAFTLFMGDEV
FT                   EPRRNYIETHAKDVKHLDV"
FT   gene            5074..6465
FT                   /locus_tag="Saut_0004"
FT   CDS_pept        5074..6465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0004"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro
FT                   IPR001633:IPR000160; KEGG: cff:CFF8240_0004 diguanylate
FT                   cyclase/phosphodiesterase, putative; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein; SPTR: A0Y5Z9
FT                   Sensory box protein; PFAM: EAL domain; GGDEF domain;
FT                   TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08053"
FT                   /db_xref="GOA:E0UP20"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP20"
FT                   /protein_id="ADN08053.1"
FT                   /translation="MMLSQTKEREYRFKLALRMGLPIFALILALIFHTLITNYTTLQTS
FT                   FYIEAILLLLVSVYFIFFLIYRGFDVKITDSVTKTFTREYLYQYLQKEIRHKKDCTLIL
FT                   ISIDNLNDINILYGIKNGDKVLKYVADWIMEYLKKEGIENIPIGHIKGGDFIIGLEGFK
FT                   DKYSTLLELLCLKSNNLNIDDIEVKISGVITDTSYSKDLNYLIENLFELQNKNKNSKYE
FT                   EEIINPNELELLVIDAIENKNLLIMSQEVYNNADGIVFRECYVKLKGQNNKIIHPKTYL
FT                   KVINKLGLGVSFDLMVLEEILKNCIYEENIYAVNILPTSLRNDKFLAKTKELLKEYAGT
FT                   QVMFVLNEMQYYSYISRYNSIIKSLKSLGVLIAIDRLGAIHTSFLYLRELDIDVVRFDT
FT                   YYSNIDKISQNRSIIDGFNVMAHENGVKTWIKNIEDEATYILVKEMDIDYVEGKYLSKI
FT                   QNNAN"
FT   gene            6482..6949
FT                   /locus_tag="Saut_0005"
FT   CDS_pept        6482..6949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08054"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP21"
FT                   /protein_id="ADN08054.1"
FT                   /translation="MFAKIFGKKNKSQDEQTDSHLIEKILKMNLTEMRSYVKNSMKDFK
FT                   VSVDGINEIMKKLTSLDEKTQTYYIKSDDMDVKKKKAFDLFIAILSSKQIDIQTIELAQ
FT                   KFLENYKEIVDDFDTRNKQIYASKLADTLNTAINTINQYVQLQKKMNVLGK"
FT   gene            complement(6938..8176)
FT                   /locus_tag="Saut_0006"
FT   CDS_pept        complement(6938..8176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0006"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="COGs: COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase; InterPro IPR002646; KEGG: tdn:Suden_0005
FT                   polynucleotide adenylyltransferase region; PFAM:
FT                   Polynucleotide adenylyltransferase region; SPTR: Q31J37
FT                   Multifunctional CCA protein; PFAM: Poly A polymerase head
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08055"
FT                   /db_xref="GOA:E0UP22"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP22"
FT                   /protein_id="ADN08055.1"
FT                   /translation="MIKYPESLDTIFNKLYKHNIKPVIVGGYIRDVILNIPSNDIDIEL
FT                   YGIASLDEVEHILQEFGDVNSVGKSFGVCKLLYNNLDLDFSLPRQDNKIASGHQGFKIT
FT                   VDTNLDFKTAASRRDFTINAIGYDVKNKKILDPYHGREDLDKKILKAVDNEKFKEDPLR
FT                   VLRAVVFASRFDMKLDKSLEFTCKHMIQNKLLNELPKERIFQEIKKLLLKSNNPSCGFY
FT                   LLKDLGAFSFFQEFNTLDEKEYAEILNALKKLKTFQITSDKEFVILALAVITSKFSDIQ
FT                   TQTFLNRITNEKIIIEKVFTLHQINFNLESLNDYDIYTLARKINIKFYSHYLHVTQNKK
FT                   EKIEYLLKKAKKMSVLHQPIPPLIKGKDLIKLGLQPSKEFSKILEYTYQAQIRNAFKDK
FT                   PSALSWLKKNLLS"
FT   gene            8263..10065
FT                   /locus_tag="Saut_0007"
FT   CDS_pept        8263..10065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0007"
FT                   /product="GTP-binding protein TypA"
FT                   /note="COGs: COG1217 membrane GTPase involved in stress
FT                   response; InterPro
FT                   IPR000795:IPR000640:IPR004161:IPR006298:IPR 005225; KEGG:
FT                   tdn:Suden_0006 GTP-binding protein TypA; PFAM: protein
FT                   synthesis factor GTP-binding; elongation factor G domain
FT                   protein; elongation factor Tu domain 2 protein; SPTR:
FT                   Q9ZLZ3 GTP-binding protein TypA/BipA homolog; TIGRFAM:
FT                   GTP-binding protein TypA; small GTP-binding protein; PFAM:
FT                   Elongation factor Tu domain 2; Elongation factor G
FT                   C-terminus; Elongation factor Tu GTP binding domain;
FT                   TIGRFAM: GTP-binding protein TypA/BipA; small GTP-binding
FT                   protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08056"
FT                   /db_xref="GOA:E0UP23"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP23"
FT                   /protein_id="ADN08056.1"
FT                   /translation="MQKIRNIAVIAHVDHGKTTLVDGLLEQSGTFGSHEQHDERAMDSN
FT                   DLEKERGITILSKNTAIRYKDYKINIIDTPGHADFGGEVERVLKMVDGVLVLVDAYEGV
FT                   MPQTKFVVKKMLALGKMPIVVINKIDKPSADPERVVDEMFDLFAAMGATDEQQDFPIIY
FT                   AAARDGMAKLDMEDPDGNFECIFETIINNIPEPEGDAANPLQAQVFTLDYDNYVGKIGI
FT                   SRIFNGTVNKGDNVMLAKADGEMVKGKISKLIGFLGLNRMEIDQAEAGDIVAFAGMETV
FT                   DVGDTVCDPTNPVALDPMHVEEPTLTVVFAVNDSPLAGKEGKHVTSNKLRERLEFEMNT
FT                   NVAMKLEIIGEGKFKVSGRGELQITVLAENMRREDFEFSISRPEVIVKEINGVKCEPFE
FT                   HLVIDVPEDLSGTVIERLGKRKAEMKSMLPMGQGFQRIEFEIPARALIGFRGQFLTDTK
FT                   GEGVMNHSFLEFRPFTGEVESRSYGALVSMTAGSTLAFSLFGIQDRGVLFIGVQTEVYE
FT                   GMIVGEHSRSNDLVVNPIKGKAQSNVRSSGADEAIKLVPPRDMSLERALEWIEDDELLE
FT                   VTPKNVRIRKKYLTESERKRHARK"
FT   gene            complement(10099..11070)
FT                   /locus_tag="Saut_0008"
FT   CDS_pept        complement(10099..11070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0008"
FT                   /product="Alcohol O-acetyltransferase"
FT                   /EC_number="2.3.1.84"
FT                   /note="COGs: COG0429 hydrolase of the alpha/beta-hydrolase
FT                   fold; InterPro IPR000073:IPR000952; KEGG: lpc:LPC_1051
FT                   alpha/beta hydrolase; PFAM: alpha/beta hydrolase fold;
FT                   PRIAM: Alcohol O-acetyltransferase; SPTR: A0Y430 Putative
FT                   enzyme with alpha/beta-hydrolase domain; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08057"
FT                   /db_xref="GOA:E0UP24"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP24"
FT                   /protein_id="ADN08057.1"
FT                   /translation="MNFKPSFLLKNRHLQTVYASLFRRLPIKNFEIEKFRLSDGDFLEC
FT                   YWQKIDNHQKDTPIVILFHGLAGSYKSPYVQGTMQELKEAGFSSVVMHFRGCSGKENLK
FT                   PRSYHSGDTQDAYEFINSVKKRYPQAKLFAVGFSLGANMLLKLLGERKSDCILSAAVAV
FT                   SAPMLLDVCAAHMNKGFSKFYQKLLLKDLKRDLDKKYDKFPMQKLIHLKRSDIKKLKTF
FT                   WAFDEAYTAPIHGFSSAQDYYTKSSSRQFLKFITIPTLIIHAKDDPFMPSDILPTHNEI
FT                   SPTIKLEISEYGGHVGFISGSLFHPEYWMEKRIVKFCKTFLE"
FT   gene            11143..12165
FT                   /locus_tag="Saut_0009"
FT   CDS_pept        11143..12165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0009"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="COGs: COG0208 Ribonucleotide reductase beta subunit;
FT                   InterPro IPR000358; KEGG: tdn:Suden_0013
FT                   ribonucleotide-diphosphate reductase subunit beta; PFAM:
FT                   ribonucleotide reductase; PRIAM: Ribonucleoside-diphosphate
FT                   reductase; SPTR: Q9ZKC3 Ribonucleoside-diphosphate
FT                   reductase subunit beta; PFAM: Ribonucleotide reductase,
FT                   small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08058"
FT                   /db_xref="GOA:E0UP25"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP25"
FT                   /protein_id="ADN08058.1"
FT                   /translation="MNRKQIYNPDSTENVNDRKVFGGNPTGIFELNNIKYQWAYNLWEM
FT                   MLNNTWFPKEVDMTRDVNDYKQLTDAEKTAYDKALSQLIFMDSLQTNNLIDNVNPYVTA
FT                   PEINLILVRQSFEEALHSQSYAVMVDSISTNSEEIYDLWRRDMMLKHKNDTIAAVYQEL
FT                   AKNPTDSNFVKACFANQILEGIYFYSGFTYIYTLARSGKMLGSAQMIRFIQRDEVTHLV
FT                   LFQNLINTLRKERPDLFTDELRADVIEMFKEAVKLETEWGKYITQGQILGLTDEIVEQY
FT                   IQYLADDRLNSVGFDKLYNVSNPIKWVDDFAKFNDQKTNFFEGTVTNYSKGSLSFDDDF
FT                   "
FT   gene            12152..12892
FT                   /locus_tag="Saut_0010"
FT   CDS_pept        12152..12892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0010"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="COGs: COG0388 amidohydrolase; InterPro IPR003010;
FT                   KEGG: tdn:Suden_0014 nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase; PFAM: Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase; SPTR:
FT                   A3I7Y6 Putative uncharacterized protein; PFAM:
FT                   Carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08059"
FT                   /db_xref="GOA:E0UP26"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP26"
FT                   /protein_id="ADN08059.1"
FT                   /translation="MMTSKTSEHTLCSLLFETTDNYEHNLQTLLTLLTQTQENSIIVAP
FT                   EVCLTSYDYERMDEMLFFASKATAAIKKASYNKIIILTMLEEKEGKVFNFAKVFYNGEV
FT                   VFQRAKAKLFKFGDEDKYMQAGNDEDFKIVEVAGIKLAVFVCFELRFKELWQKSEGADV
FT                   IAVPSWWGELRTEHFKILTQALALMNQCYVIASDSANKECTAMSGIITPQGEAFRNGNK
FT                   PCLKVEYNKKEIALMRRYMDVGIR"
FT   gene            12894..13532
FT                   /locus_tag="Saut_0011"
FT   CDS_pept        12894..13532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0011"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="COGs: COG2518 Protein-L-isoaspartate
FT                   carboxylmethyltransferase; InterPro IPR000682; KEGG:
FT                   tdn:Suden_0015 protein-L-isoaspartate O-methyltransferase;
FT                   PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; PRIAM:
FT                   Protein-L-isoaspartate(D-aspartate) O-methyltransferase;
FT                   SPTR: B5Z887 Protein-L-isoaspartate O-methyltransferase;
FT                   TIGRFAM: protein-L-isoaspartate O-methyltransferase; PFAM:
FT                   Protein-L-isoaspartate(D-aspartate) O-methyltransferase
FT                   (PCMT); TIGRFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08060"
FT                   /db_xref="GOA:E0UP27"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP27"
FT                   /protein_id="ADN08060.1"
FT                   /translation="MDRITATKTARLANECDAKFKLSDEVKKAIASTNREAFVPTGFKH
FT                   NAYKLDALPIGADQYISSPLTVAKMTEYLFPRGADRVLEVGCGSGYQAAVLSHLFRGVF
FT                   TIERIEPLILEAKKRFRELGINNIHTRTDDGQNGWIQYAPYDRILFSATAKEIPTKLFE
FT                   QLADGGILVAPLQKRNTQVITRFIKNGDYIEEEELEDCDFVPILDGVLK"
FT   gene            13594..14427
FT                   /locus_tag="Saut_0012"
FT   CDS_pept        13594..14427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0012"
FT                   /product="thymidylate synthase complementing protein ThyX"
FT                   /note="COGs: COG1351 alternative thymidylate synthase;
FT                   InterPro IPR003669; KEGG: tdn:Suden_0017 thymidylate
FT                   synthase complementing protein ThyX; PFAM: thymidylate
FT                   synthase complementing protein ThyX; SPTR: Q5HXD2
FT                   Thymidylate synthase thyX; PFAM: Thymidylate synthase
FT                   complementing protein; TIGRFAM: thymidylate synthase,
FT                   flavin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08061"
FT                   /db_xref="GOA:E0UP28"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP28"
FT                   /protein_id="ADN08061.1"
FT                   /translation="MEDMYGIKYSKPEVVLLQETGIGVAETAARTCYDSFCNSENEVVQ
FT                   EIENILPDTQMCESLNNIEESQLLDDLAWTYFHHSILEHANLSYLIRSTSRGVLQEHAR
FT                   HRIQAISVRSTRYTMSSLINAFVASKHGEDKEFFINKVLEFDMFVTADEAYNRLEIGGM
FT                   YEKLDFQSKKVENFHDIAVAKSSLHLIKELQGKSQELYNALQAGKKKRNVGDAFKHIIT
FT                   DNVKVDMVVTFNLRSLKNYLTLRDSGAAYFQIRWLAQEMMKVTPQKYLDLIIKKK"
FT   gene            14436..14654
FT                   /locus_tag="Saut_0013"
FT   CDS_pept        14436..14654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08062"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP29"
FT                   /protein_id="ADN08062.1"
FT                   /translation="MYKILILATLFFTGCSNITITAAMCDKLESEPGATVPQECKAYSE
FT                   KEADKAFNKVVNEKKVSDSDIEFHIEK"
FT   sig_peptide     14436..14501
FT                   /locus_tag="Saut_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            14689..15219
FT                   /locus_tag="Saut_0014"
FT   CDS_pept        14689..15219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0014"
FT                   /product="PhnA protein"
FT                   /note="COGs: COG2824 Uncharacterized Zn-ribbon-containing
FT                   protein involved in phosphonate metabolism; InterPro
FT                   IPR013988:IPR013991; KEGG: tdn:Suden_0019 PhnA protein;
FT                   PFAM: PhnA protein; SMART: PhnA protein; SPTR: A2UVH4 PhnA
FT                   protein; PFAM: PhnA protein; TIGRFAM: alkylphosphonate
FT                   utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08063"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="InterPro:IPR013991"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP30"
FT                   /protein_id="ADN08063.1"
FT                   /translation="MARSEVCELCGSSEDVSLLELPVSDSSEDQSVYVCATCKNQIEND
FT                   ELDETHFNCLNDAMWSEVPAVKVMSYILWNKLGRTDMTDMMYLEEEEQKLADAAINAYA
FT                   NKVVFRDANGVELKAGDSIVILKDLDVKGAGFTAKRGTTVTRIALPNDIDDHVEGRVNG
FT                   TKIYLKTEFIKKA"
FT   gene            15219..16286
FT                   /locus_tag="Saut_0015"
FT   CDS_pept        15219..16286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0015"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="COGs: COG0232 dGTP triphosphohydrolase; InterPro
FT                   IPR006674:IPR003607:IPR006261; KEGG: tdn:Suden_0021
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; SPTR: Q7MAE7
FT                   Deoxyguanosinetriphosphate triphosphohydrolase-like
FT                   protein; TIGRFAM: deoxyguanosinetriphosphate
FT                   triphosphohydrolase; PFAM: HD domain; TIGRFAM:
FT                   deoxyguanosinetriphosphate triphosphohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08064"
FT                   /db_xref="GOA:E0UP31"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP31"
FT                   /protein_id="ADN08064.1"
FT                   /translation="MKPYERFYKIEKDFRNPYARDRDRIIHSGSFRKLEYKTQVFLNHE
FT                   GDFFRTRLTHSIEVSQIARSITSQLELNESLAEAIALAHDLGHTPFGHVGGDTLDECLK
FT                   ADGFSNGFEHNFQSFRVVTKLEKRYKGFNGLNLTFATLEGILKHSYPYKKLFLPRIIDE
FT                   QFDLSRHPTYEAMVVDRADEIAYMSHDIDDGVNSGIITFEDLRASELACEILEKVAAEG
FT                   VTDENDEMFRYRFSSHLINHLVYSLLEYSKQKVAHREEMPIGFEKELETQIKKLKKILF
FT                   VKMYQHKNIVRKMYAGKQAIKGLYKGLMEQDKMLPQFYYKQLHVRNKHRVIADYIASMS
FT                   DRYAVNFHNEMYANI"
FT   gene            complement(16303..17436)
FT                   /locus_tag="Saut_0016"
FT   CDS_pept        complement(16303..17436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0016"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089; KEGG: cff:CFF8240_1223 methyl-accepting
FT                   chemotaxis protein; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer; SPTR: Q9X0N0
FT                   Methyl-accepting chemotaxis protein 3; PFAM:
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08065"
FT                   /db_xref="GOA:E0UP32"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP32"
FT                   /protein_id="ADN08065.1"
FT                   /translation="MTSLFLRMRLVHWIGIVLLLINAFVFTDNIISQIVQVIIAIVILV
FT                   HDIDEKINGVDVAKKIIATLADFKAGDTINIKLAFSKEYREMVELINKFTAKVNEAKQL
FT                   AATSSKIDKDLEELNQSVLQLEDDFSASANSANNLLKKLNLIEDESKQNLEFSEDVLSS
FT                   LNNVSEKLDNSVSQMSMLENQVMQTHDGEITVNDDLKSLTQNAEDIKGILNIISDISDK
FT                   TNLLALNAAIEAARAGEHGRGFAVVADEVRKLAENTQRALTEINASVNVIVQSISDASG
FT                   SVEVNAKSTLELVEISKELQSSLSEASHEVESAYQKSLADTENSKIIKSEAQNSVNVTS
FT                   EQIDKMHTTKKFIDTIRKKLLHVDNVTKELVTKISHI"
FT   gene            complement(17541..17753)
FT                   /locus_tag="Saut_0017"
FT   CDS_pept        complement(17541..17753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0017"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="InterPro IPR001911:IPR018278; KEGG: tdn:Suden_0022
FT                   30S ribosomal protein S21; PFAM: ribosomal protein S21;
FT                   SPTR: Q30UM8 30S ribosomal protein S21; TIGRFAM: ribosomal
FT                   protein S21; PFAM: Ribosomal protein S21; TIGRFAM:
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08066"
FT                   /db_xref="GOA:E0UP33"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP33"
FT                   /protein_id="ADN08066.1"
FT                   /translation="MPGIVLRSDDNFDAAYRRFKKQVDRNLIVTEARARRFHETETEKR
FT                   KKFKIASRKKMLKRLYMMRRYESRL"
FT   gene            17924..19315
FT                   /locus_tag="Saut_0018"
FT   CDS_pept        17924..19315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08067"
FT                   /db_xref="GOA:E0UP34"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP34"
FT                   /protein_id="ADN08067.1"
FT                   /translation="MSKFYSISVVNGYAFILYLEKNNNNLSILDNEEIEVSELASFIKE
FT                   KKNLYISTLQKFEFSQNIQVPVAIAKSRNIKNYLLYKIKESNPDIDVLFNFHKLPKQND
FT                   EENISYNIEVLDEKAYLNTLDFIDDFSKIKSSTTSKFALLSLANRCIDEDHYICVYTTA
FT                   TTIIVLAVEQQELIFSRTIVVEPSSMETMQMDITEHITQTISYINNQFRDIEFKTLALS
FT                   GSIALDDIIPQHIVMFNNLNISVLYPNTFIKNINAEESQEYILSLGTALVSKSNQFLPK
FT                   LILGIRQFNIASALGLAASLILVFCMFYFTFNEYEKYSNLSNQNKVLEAKYSKVLSQTK
FT                   MLSQEELEKYVNHISMVDKYLKNTPVNTLAILKPLIKLSKPSKFEYKDENGLIYFKVDF
FT                   EKSFTELINLYKFEKEFNKRLNDINSSMKINKNVIIDYKKLIYKVQLSTLSKKNKLNST
FT                   RARRP"
FT   gene            19312..19827
FT                   /locus_tag="Saut_0019"
FT   CDS_pept        19312..19827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08068"
FT                   /db_xref="GOA:E0UP35"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP35"
FT                   /protein_id="ADN08068.1"
FT                   /translation="MIKISFIVINVVLAIFLYFLNTWYEQQDIKIQKINKKYVSDTRKL
FT                   KEIKKIDNWLNENVKHNLIKIPKSTENADINLIHFFDTHAKEYSFQVEKFIYKDEMAHF
FT                   LNIKYSISRDNYNNLFKFMKQEYKNGYLFIKSFNIEKTILNGELIVVQPYPSKNKKIKK
FT                   RSLEDVPQ"
FT   gene            19814..20296
FT                   /locus_tag="Saut_0020"
FT   CDS_pept        19814..20296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08069"
FT                   /db_xref="GOA:E0UP36"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP36"
FT                   /protein_id="ADN08069.1"
FT                   /translation="MYLSNKQIIQLLTPFLLGIILLFFQDEILTFMHSKFPTFKSISNK
FT                   DFHKNVDEYLRIDQEMHTYNDVVKNVKERKNSLKWITSNVLYQKQLTQSEKKANISEHK
FT                   QLWNLEAVFPKYDMAIINSQFVHKGSIINKAKIIQIKFDSVLLKTNKGLKWVHLFH"
FT   gene            20275..21783
FT                   /locus_tag="Saut_0021"
FT   CDS_pept        20275..21783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0021"
FT                   /product="type II and III secretion system protein"
FT                   /note="COGs: COG1450 Type II secretory pathway component
FT                   PulD; InterPro IPR001775:IPR004846; KEGG: ilo:IL0367 type
FT                   II secretory pathway; PFAM: type II and III secretion
FT                   system protein; SPTR: A3WP66 Type II secretory pathway;
FT                   PFAM: Secretin and TonB N terminus short domain; Bacterial
FT                   type II and III secretion system protein; TIGRFAM: pilus
FT                   (MSHA type) biogenesis protein MshL"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08070"
FT                   /db_xref="GOA:E0UP37"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP37"
FT                   /protein_id="ADN08070.1"
FT                   /translation="MGSFISLGLILLLISGCATTSVTPAAKKKESIKSATKVIKSFQQY
FT                   NDEKQNLAPAMILPPVYEEVSVFDGQNITFSAENANLYKVLYSVSKIAGLNLIIDRDVE
FT                   NNIPVTLSVKDANLEDVLSIIMQMSGCYYKLEGNILHVKEYMRKRFNISYVHSNSSFST
FT                   KLGGDTLSSATSGGSSGGSSGGSSTQGISGKYSLKYDTPKDANNFYKHLDDNIKLLISK
FT                   NGKYTLNKFSGVLSVYDKKQNIDAISNLIKDVKKQFNKQVLIEAKILEVTLNKSHQLGI
FT                   NWDVVGKSVFSPGDTLNIQQSLGLTGAVAGTVNYSANNFNALINAIDQNGNIDTISNPR
FT                   IKVLNGQSAIISSGKLVPYWEKQVDTSQGTSTNNILVTYNRRDVLDGVTMGVTPTVMEN
FT                   GRIMLNVTPISSSIESEKVYHDDQGVSVATAPIINIKEAGTIIYAKNNDLVLIGGLMST
FT                   SIKKNKQEVPFLSNLPLVGSLFTQVNNTKEKKELVILLRLKVIE"
FT   sig_peptide     20275..20334
FT                   /locus_tag="Saut_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            21780..22673
FT                   /locus_tag="Saut_0022"
FT   CDS_pept        21780..22673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08071"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP38"
FT                   /protein_id="ADN08071.1"
FT                   /translation="MIRLILGVVFLVSVAFASDGISFGQKKRVYSIQLFSTKNTHSEEE
FT                   IINKTPLNLRDEIHLHRVKNQIVACYSQASKYDEIRSKLQKVKKAGYKRAYIITTTRWY
FT                   MPNKTKHQSPKLSKYVISKMIAKANKAYKNANESKAMMYYEMLLSAGAKSDKIKNNLCY
FT                   LYGKNGAWGQAKDIIDKSKYASGLIYAYANGAVQTSQKTFYTDLIDYIMLDRSGHLALL
FT                   AGYYFEQNANGKKAGEFYKMAYGKNRNDIYNMYAYARYLDIIGQKMQAINLYKNVYNRT
FT                   DETNGLHKALKSRLYR"
FT   sig_peptide     21780..21830
FT                   /locus_tag="Saut_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            22686..23570
FT                   /locus_tag="Saut_0023"
FT   CDS_pept        22686..23570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0023"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: hypothetical protein;
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08072"
FT                   /db_xref="GOA:E0UP39"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP39"
FT                   /protein_id="ADN08072.1"
FT                   /translation="MKKSAFTLVELSIVLVIIGLLVGGSFKVLKIMRDRAQTSRAQDDV
FT                   QVAKEAVIGNTVQNSNTLPSVTFFNQNLSPIKNNQHQLFYADDTNLENIDVCSFNTTNL
FT                   KVVTAARTIDNVAFVIASESSNHNMQTAIKDNGDGTFSVKTYDYSTKVDDNTSPVNIID
FT                   YYDDIVDWVTLSQLQQEAKCSNNLLRIVNSSLPDTDTLNSASYQAKIVIDGNYSAPTAD
FT                   NCTFSPTNNFSYNNFSITNSGGATAGTVTVDCSVSADGKTVRKKFAITVNQASGTGGGS
FT                   GGGGFGGFGGFGG"
FT   gene            23621..25276
FT                   /locus_tag="Saut_0024"
FT   CDS_pept        23621..25276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0024"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG2804 Type II secretory pathway ATPase
FT                   PulE/Tfp pilus assembly pathway ATPase PilB; InterPro
FT                   IPR001482:IPR007831:IPR003593; KEGG: sde:Sde_1345 ATPases
FT                   involved in pili biogenesis, PilB-like; PFAM: type II
FT                   secretion system protein E; General secretory system II
FT                   protein E domain protein; SMART: AAA ATPase; SPTR: A1HQ24
FT                   General secretory pathway protein E; PFAM: Type II/IV
FT                   secretion system protein; GSPII_E N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08073"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP40"
FT                   /protein_id="ADN08073.1"
FT                   /translation="MAQNKPIGKLLEDAGFINEKQIQVALNVQKSNPMFFGEILQDLDF
FT                   VTSNEIAEAIAMQNGLEYVDLSTIVPTAEALKLVPHEIAKNKNILPIAVENNTLVVAMQ
FT                   DVNDIMTLDYLKKVSSKQVKLVVANQASIARYSEIYYYQMTNPIEAEIAELVKQTLNNK
FT                   EIDVPHLVDLILNNAIKDRVTDIHITPENSAIHVFYRIDGVLRHYFSLPKKLHSQIVAR
FT                   IKITCNLDISEQRKPQDGSFSYTFLNEDFDLRVSTLPTNYGENIVMRLLGKGTSLFSLA
FT                   HLGLTAQNSKKVENYFSKPYGIVLIVGPTGSGKTTTLYSALRKVNSLEKNVMTIEDPIE
FT                   YKFTFIKQTQLHEKAGYTFDAAIRAFMRQDPDVMLVGEIRDPQTAELAVRASITGHLVL
FT                   STLHTNDAIGTIPRLIDLKIPPYLIGSGLLGVIAQRLVRKLCHYCKKELDINKKELIEM
FT                   GVPETIINEYSDYKVYEAVGCQQCKYTGYNGREVVVEILDVDKEIESLITEEASTLELL
FT                   KVAKHKGMHTMKEDGYIKVLQGITSFSEIDRVID"
FT   gene            25276..26484
FT                   /locus_tag="Saut_0025"
FT   CDS_pept        25276..26484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0025"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR018076; KEGG: sfu:Sfum_0118 type II
FT                   secretion system protein; PFAM: Type II secretion system F
FT                   domain; SPTR: A3J9Z8 Type II secretory pathway, component
FT                   PulF; PFAM: Bacterial type II secretion system protein F
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08074"
FT                   /db_xref="GOA:E0UP41"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP41"
FT                   /protein_id="ADN08074.1"
FT                   /translation="MYFFVKFITKDGKTGFDFIESQSYTTLLKKLQQDQAIPVDIKVLP
FT                   AFISKIIPKGQGKVSPDEVVELMESLHLVIKSGLPLYEGLQELAKESDNKRFRDMMLYI
FT                   ANAINNGQSLSTAFEAYKNVIGTIILNLIKIGEETGQLEVTLKRAAEFLKRTITLKKKA
FT                   KGALIYPTFAFVAVLGAMLVWMIYVLPQMLDLFKSMDIKLPALTLGIIAVSNFLSAYWM
FT                   YMIASIVIFIVGFKILHKKYQKVRLFTDKMILKIPVVKEIISGFNIAFISEYLRLALVS
FT                   GVPIFNALQSLTDNLKNEVFKQALSVSTGEVSKGSQISSAFSKTGIFTPFTVRMIGVGE
FT                   SSGSLDSQLDLIAEHYYERVNYYAENIGKVIEPIVLIFVGGFMALVIAGLLGPMYDLIS
FT                   QIK"
FT   gene            26571..27188
FT                   /locus_tag="Saut_0026"
FT   CDS_pept        26571..27188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0026"
FT                   /product="putative type II secretion system protein"
FT                   /note="InterPro IPR012902:IPR001120; KEGG: bbr:BB0790
FT                   putative type II secretion system protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08075"
FT                   /db_xref="GOA:E0UP42"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP42"
FT                   /protein_id="ADN08075.1"
FT                   /translation="MKRSGFTLIELSIVLIIIGLIIGAVMKGKDLINSADQKKIYNTWV
FT                   NQWQVTFNTYQDRTGGVLGDGIINGGTATDPNGQCDNVRLDTTTSVQNKLKAIGLDIPV
FT                   SNIATSNGGAYKIKGKYTTSTATAYLYWLYSHTDGTYKNRLYITGMPTDVAIAFDTMTD
FT                   GAINPSAGSFRRYADTSTGTDGTSNTWPDASVTKTVNVSLEL"
FT   gene            complement(27236..27427)
FT                   /locus_tag="Saut_0027"
FT   CDS_pept        complement(27236..27427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: wsu:WS0780 hypothetical protein; PFAM: Protein
FT                   of unknown function (DUF2892)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08076"
FT                   /db_xref="GOA:E0UP43"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP43"
FT                   /protein_id="ADN08076.1"
FT                   /translation="MCINVGKADRIIRVVLGLGLIAYGLLAQNYIVAGIGVIPLLTAVF
FT                   GFCPFYPLFKLNTGCKKD"
FT   sig_peptide     complement(27347..27427)
FT                   /locus_tag="Saut_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(27498..28109)
FT                   /locus_tag="Saut_0028"
FT   CDS_pept        complement(27498..28109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0028"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR001808:IPR000595; KEGG:
FT                   cff:CFF8240_0428 Crp family transcriptional regulator;
FT                   PFAM: cyclic nucleotide-binding; regulatory protein Crp;
FT                   SMART: regulatory protein Crp; SPTR: A3JR16 Cyclic
FT                   nucleotide-binding protein; PFAM: Bacterial regulatory
FT                   proteins, crp family; Cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08077"
FT                   /db_xref="GOA:E0UP44"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP44"
FT                   /protein_id="ADN08077.1"
FT                   /translation="MNLENFPFYKELEPQAKNFLQMHLKPVSVPKDSILFFQGDICDGI
FT                   LFLTSGEVRLYIQSDNADEITLYHLNPGEQCIVNTASTLSQTEAIGSAVTLCDVEGYIL
FT                   DMHSVKELAHNSDVYQRYLFSIYTLRMGNLIKLINDIKFKNLDQRIIDWLQNKNEKEIK
FT                   TTHEAIANELGSTREVISKILKSLENDGMVKLGRGSITLM"
FT   gene            complement(28112..28423)
FT                   /locus_tag="Saut_0029"
FT   CDS_pept        complement(28112..28423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0029"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845; KEGG: sun:SUN_0786 AsrR family
FT                   transcriptional regulator; PFAM: regulatory protein ArsR;
FT                   SMART: regulatory protein ArsR; SPTR: A1HUC1
FT                   Transcriptional regulator, ArsR family; PFAM: Bacterial
FT                   regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08078"
FT                   /db_xref="GOA:E0UP45"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP45"
FT                   /protein_id="ADN08078.1"
FT                   /translation="MEKLVTLAKILSDSNRLRIVALMHREKELCVCEICDTLELSQPLV
FT                   SRHLKQMREASLVQTKQSGKWIIYSLHENKTLECLLETIKKDIQKLPKIIACAAQEKE"
FT   gene            28493..29044
FT                   /locus_tag="Saut_0030"
FT   CDS_pept        28493..29044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0030"
FT                   /product="cytochrome c, class I"
FT                   /note="InterPro IPR009056; KEGG: sun:SUN_0797 cytochrome c,
FT                   class I; SPTR: O67706 Uncharacterized protein aq_1854;
FT                   PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08079"
FT                   /db_xref="GOA:E0UP46"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP46"
FT                   /protein_id="ADN08079.1"
FT                   /translation="MKKLLLVFILGFVSLQANSGEEVYKAKCASCHAMKGMMDETQMKE
FT                   MRQKMQNASKEEKMAMRQKMMQKMQKSDMKAPPMPMVSKRLKMMLKSREEFITFVDDYI
FT                   QNPSQKKGFCMPMAYKRFGTMPPIGKSLSKEERTAVASWLYDNFKGSWGGSMGGKMCEM
FT                   KNKNMKCGAGKCGAVKIQTH"
FT   sig_peptide     28493..28549
FT                   /locus_tag="Saut_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            29052..30194
FT                   /locus_tag="Saut_0031"
FT   CDS_pept        29052..30194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0031"
FT                   /product="permease"
FT                   /note="COGs: COG0701 permease; InterPro IPR005524; KEGG:
FT                   sun:SUN_0785 hypothetical protein; PFAM: permease; SPTR:
FT                   Q12UN0 Conserved hypothetical membrane protein; PFAM:
FT                   Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08080"
FT                   /db_xref="GOA:E0UP47"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP47"
FT                   /protein_id="ADN08080.1"
FT                   /translation="MEYITLFFSALVDLSNAMAPYILFGLIFAGFLHELVPDSIVKNHL
FT                   GKNSILSVIKATIFGIPLPVCSCGVIPLATSIKKSGASNGSTLSFLISTPITGIDSMLA
FT                   TYGMFGWVFTIYRVITSMIISIIAGILSNIYAHEEKEETVQKKPAFSMAAPTNNASVMN
FT                   FSAVATTSNEEACSEGSCCSGENCNDKKSCMVKSAFSYAFTTLLKDIASPLLVGLLVGA
FT                   LITVAVPDNLSEILIKYNWLSYIIVIAIAIPMYVCATASLPIAAGLMLAGVSPGAAFVF
FT                   LSAGPATNTVTIGVVKKMLGTRTLYIYLGTIIIGSIVFGLGLDYLFRDVNVKELVHMDE
FT                   HAGLIAWASTFILWGFVLYYVVKPYFFKDKECSDGSCCTA"
FT   gene            30209..30526
FT                   /locus_tag="Saut_0032"
FT   CDS_pept        30209..30526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_0775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08081"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP48"
FT                   /protein_id="ADN08081.1"
FT                   /translation="MKNRLLTLFLLLSMSFNIVHAYVIEAHDTHSCHVSEYVHDINDNL
FT                   KNDIAEDDICHMHHFFHIAFILPETNVILSRENFAAKPYANNKKYEYNSTKNFLKPPIN
FT                   S"
FT   sig_peptide     30209..30271
FT                   /locus_tag="Saut_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            30598..31773
FT                   /locus_tag="Saut_0033"
FT   CDS_pept        30598..31773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0033"
FT                   /product="outer membrane efflux protein"
FT                   /note="InterPro IPR003423; KEGG: sun:SUN_0773 hypothetical
FT                   protein; PFAM: outer membrane efflux protein; PFAM: Outer
FT                   membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08082"
FT                   /db_xref="GOA:E0UP49"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP49"
FT                   /protein_id="ADN08082.1"
FT                   /translation="MKRLLLVPFIVWNLQAQDYEGLLKDAMQTSPYLKANALEVKRADE
FT                   QSSLIQRYKNPTLSLEASQFSPDIGKSKAGYRAALSQPIRLWGVGDDRANLAVATKEEA
FT                   QGLVTLKRAEFVKVFSLLYNEYITQTALFHLAKEEFAISKNIAAITKERYEAGTTAKVK
FT                   YLRAKVDLAGSKNALDEKKAMQIASYYKLLAFSGLEDEKALDDNYVFKLSNRAVKEAQN
FT                   NSAELHYLQTQQNSSSAKAKLNTNKIEWMNLYAEYEAEPDQSIARVGVDIPLAVFNTKK
FT                   EEKRIAALQAKESEFLLQNQKIILSSNLTRLKKELLILQSVISSTQKLYNSQKELLKMY
FT                   EDGYKIASINLLELQNIKNQMIQTKEKEITLQNKINKNIVIYNYEVGEYNE"
FT   sig_peptide     30598..30645
FT                   /locus_tag="Saut_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            31766..32899
FT                   /locus_tag="Saut_0034"
FT   CDS_pept        31766..32899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0034"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="InterPro IPR006143; KEGG: sun:SUN_0772 CzcB family
FT                   heavy metal efflux protein; SPTR: A3T2H7 Cation efflux
FT                   family protein; TIGRFAM: efflux transporter, RND family,
FT                   MFP subunit; TIGRFAM: RND family efflux transporter, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08083"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP50"
FT                   /protein_id="ADN08083.1"
FT                   /translation="MNKILIALLGLGSVLLAAEVPIAKTQMHSFKKSVELNAKVIQLSN
FT                   AQQSISSLVSGHLEKYFVKPAQDVKKGDRIALIESIQVSKMSADYIALKKQYEAAQKNY
FT                   EAIKKLYKKGLTSMQSLNAEAIKTSEIAADLTALQSQLETLNIDIKKLKKATANFILYA
FT                   HSSGRVSALLKPLHSSVSSNEPIVSIVKNQAYYVKSYLPLEYATKARIGDTIVVDYAGK
FT                   EIITHATQIMPKVDETTQRVVVLSSVDQKVDDLFIDVYVKATIYFADARSYVAVKKSAL
FT                   SFFNNEWVVFVPSEEDQGELSKAQERDHLGGNEKKEEKGEEEEEISVPYAPQVVEIVAQ
FT                   DDKYVGVKGLELGQEYVSGESYYVKSALLKSSLGDGD"
FT   sig_peptide     31766..31816
FT                   /locus_tag="Saut_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            32909..35965
FT                   /locus_tag="Saut_0035"
FT   CDS_pept        32909..35965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0035"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="COGs: COG3696 Putative silver efflux pump; InterPro
FT                   IPR001036:IPR004763; KEGG: sun:SUN_0771 CzcA family heavy
FT                   metal efflux protein; PFAM: acriflavin resistance protein;
FT                   SPTR: A3VUQ7 Heavy metal efflux pump CzcA; TIGRFAM: heavy
FT                   metal efflux pump, CzcA family; PFAM: AcrB/AcrD/AcrF
FT                   family; TIGRFAM: heavy metal efflux pump
FT                   (cobalt-zinc-cadmium)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08084"
FT                   /db_xref="GOA:E0UP51"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP51"
FT                   /protein_id="ADN08084.1"
FT                   /translation="MLDKLIELSLKYKLLVLVAFIAIAVSGYRAYTQIPIDAFPDITPK
FT                   QVVIYTESPGNSAEDIEKLITYPIESAVSGMAGVKLIMSNSIFGLSYVSVFFEDDMDIY
FT                   FLRQLVAERLSNVDIPKGWGKPVLGPNTTGLGQVFWYEVKDTTGKYSLQKLKEMQEYIV
FT                   KPLFKSVSGVEEVIGWGGDEKQYNVLIDTKKLQDFGITYDDIVKALQKSNQAAGGQYLE
FT                   FNREQYLIRGAGLYKTLDDIRNTVVKPTQGQAITIGDVASVTPGVAPRFGAVSIDNKEA
FT                   VMGMVLQRTATNAAKVVERIKEKIATVNTALPEGVKISTIYDRTEITHKAVNTMTSALL
FT                   SGVILVAIVLFLFLFELRSAFIVIISLPLSLLIAFLLMDYYNLSANLMSLSGLAIAVGM
FT                   IVDGTIVIVENSFRLLHDEPEKDKLTVVSEAAKGVAKPVTFAVLIIAAVFIPLLSLDGL
FT                   AGKLYTPMALNIVFVMLGSLLVALVLVPVLILMLLKPTKSAENIVMKSIKKFYTPALIF
FT                   ALDNAKKILAVVSVVFIVLAYILTQQGREFLPTLNEESIMYRVIAIPGTALSQSLDVSK
FT                   EVESYILKKYPDDVSSVLAMIGRSEKGETAQPNYMEILLTLKPNIKDLPLLTKEMSEDL
FT                   EHKFPFVQFVPTQPIAMRIEELLEGVKAELAIKIYGNDQKVLDKISKDIQSAIKHVDGL
FT                   ERMEVETQLGQAQIQIIPNYLSLARYGISVAEVMQIIRNGIGEEGITQKLEGIKRFPIV
FT                   AKVQGAKKDIDSIKNVTLRSKNGNIVRLKDVCDIKIVQGASFIKRENLSRYMVVSMDVE
FT                   GRDMASFVAEADKIIKEKVKMPAGYYIGWAGDFKNMQEATQKLMIIIPITIFLVILLLY
FT                   TAFNSLTKSMIILLNVPFGFIGGIIALLIGGIYLSVSAIVGFLAIFAIAILNGIVLVSF
FT                   IDELRAKYPDVDLKILLKDATLLRLRPVLMTAFTTLFGILPLLYATGVGSEIQYPLAVV
FT                   ITGGIISSTLLTLLILPSTYLLFYEKEKS"
FT   sig_peptide     32909..32998
FT                   /locus_tag="Saut_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            36066..37736
FT                   /locus_tag="Saut_0036"
FT   CDS_pept        36066..37736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0036"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COGs: COG0358 DNA primase; InterPro
FT                   IPR013264:IPR002694:IPR006171:IPR006154:IPR 006295; KEGG:
FT                   tdn:Suden_0023 DNA primase; PFAM: zinc finger CHC2-family
FT                   protein; DNA primase catalytic core domain; TOPRIM domain
FT                   protein; SMART: zinc finger CHC2-family protein; Toprim sub
FT                   domain protein; SPTR: P56064 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: Toprim domain; DNA primase catalytic core,
FT                   N-terminal domain; CHC2 zinc finger; TIGRFAM: DNA primase,
FT                   catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08085"
FT                   /db_xref="GOA:E0UP52"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR031988"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP52"
FT                   /protein_id="ADN08085.1"
FT                   /translation="MISQDSIEALKARLDIVDVVGNYIELKKAGGNFKAPCPFHDEKSP
FT                   SFVVSPQKQIYHCFGCGAGGDSVKFVMEYEKLNYPEALEKLADSYNFTLTYTDNKHNKP
FT                   RSQVMDKLNEWYQMLLSKNQTALNYIKERGIYESSIEKFGIGYAPESQATLNYIRSQQF
FT                   SIKEAIDMGVVGYNQERNQTYARFVERITFPIFSANGSIVGFGGRTITGHQAKYVNSPE
FT                   TAFFNKSRLLYAYHLAKQSLHKKQEIIITEGYLDVIMLHQAGFDNAVATLGTALTHEHL
FT                   PLLRKGSPRVVMAYDGDKAGRAAALKASKLLSASGFNGGVVVFSGGLDPADMVKEGRVE
FT                   ELSNMFREAKPFIEFVLDEILSLYNLKDPKAKESCMQEGIAYLKTLSPILQEEYKTYLA
FT                   SRLGGLGVSPSLLKLNTQTNTNRQNIPQQRNSAHRDMWELALIKTILEKPEYIEQVLDV
FT                   IDPSLLQFHSYEFSLVLQGKQDAPEVMAIMVDDTITSLKDEEALNAELITFLTKYYERE
FT                   LKKVNIASNISFEEKAFYIRKFRGKIAKLKRGELVTLSD"
FT   gene            37752..38159
FT                   /locus_tag="Saut_0037"
FT   CDS_pept        37752..38159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08086"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP53"
FT                   /protein_id="ADN08086.1"
FT                   /translation="MKILLLAFFTYTLIFAQTPFVLTKFKSAYPLVEIHTDKVPPEYKV
FT                   KITKILKSYTDELGINTKEYSQRAMAIVIDRVAVGKKLVLRTKLLVGEDVKRLDDGEEV
FT                   FALTYVKCDISEIENMDEDIIDTVEYLLHGG"
FT   sig_peptide     37752..37799
FT                   /locus_tag="Saut_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            38166..38561
FT                   /locus_tag="Saut_0038"
FT   CDS_pept        38166..38561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0166 hypothetical protein; PFAM:
FT                   Protein of unknown function, DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08087"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0USR0"
FT                   /protein_id="ADN08087.1"
FT                   /translation="MRKLLLIALLATLSFAQSYKDFARDYGYETVYSVAFAKAKKEKKP
FT                   ILMVQVTNYCPWCRKLEKKVLAKEKINTDIHKRFIPLIVNREEAVLPKRFTTPIVPVTY
FT                   IIDYKDDTKFTKIMGYKNKKDFAHLIK"
FT   sig_peptide     38166..38213
FT                   /locus_tag="Saut_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            38606..39025
FT                   /locus_tag="Saut_0039"
FT   CDS_pept        38606..39025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08088"
FT                   /db_xref="UniProtKB/TrEMBL:E0USR1"
FT                   /protein_id="ADN08088.1"
FT                   /translation="MAGVHFSFDNFKNLVDLNIGISDRLDENRAESFTLLYCDFLGIEQ
FT                   SVVDASLLEILRSSDSIANSGGDYFFVLPYTDKYGAEIVKKMFDDFFAKHLGSFLLSYP
FT                   VDGETSKSLLENMQDSVSTFFKKELHCLDRFTRDY"
FT   gene            39337..40839
FT                   /locus_tag="Saut_0040"
FT   CDS_pept        39337..40839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0040"
FT                   /product="flagellar hook-length control protein"
FT                   /note="KEGG: tdn:Suden_0029 flagellar hook-length control
FT                   protein; SPTR: C4LUC1 Putative uncharacterized protein;
FT                   PFAM: Flagellar hook-length control protein FliK"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08089"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:E0USR2"
FT                   /protein_id="ADN08089.1"
FT                   /translation="MISLDIKKETSSLLPPLNIAPTEQKEGALSFSALLKGTQELDDKI
FT                   IQNGSLILALKDEKAPANLLSTQNMQDMIELESLELDPKVSAAMTPEDLKVLIKQAKQF
FT                   LKDKIVQSEGFKKAEIDAIPKTLGGLVQVAKKIGIDISKITLEEVKAQIPKASIKSVEP
FT                   LHVKANSKTTKPQKEQKEPLHVNKEVKQDVVPENEELPVEIKVKTHKVHTVKTQEIDTT
FT                   EENLDMAKKETVKNTQQVKQEVKLTPLFKAQNTIAPEITTQQIVSTKVNNLTAQKNPKQ
FT                   KADETLQLLLRGEKVSKNDIGLTADFSVATAKVIAPQATKEVDKSLASLLKNDVSDDGD
FT                   IQTKTDGWNVSKADSFEVKLHEAKQMVKYLSQDVKSAIEDYKSPFTRVKVQLNPQRLGE
FT                   VDLTIVQRGKNLHINLSSNNTAINTLAMNANDLKAQLNNNGINNASLNFNSNAQSENSQ
FT                   AGQQEQQRQNQQRADEEYNYFESKESHEEVISSLEIIVPHYA"
FT   gene            40852..41514
FT                   /locus_tag="Saut_0041"
FT   CDS_pept        40852..41514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0041"
FT                   /product="flagellar hook capping protein"
FT                   /note="COGs: COG1843 Flagellar hook capping protein;
FT                   InterPro IPR005648; KEGG: tdn:Suden_0030 flagellar hook
FT                   capping protein; PFAM: flagellar hook capping protein;
FT                   SPTR: A3RUI7 FlgD; PFAM: Flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08090"
FT                   /db_xref="GOA:E0USR3"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:E0USR3"
FT                   /protein_id="ADN08090.1"
FT                   /translation="MAIDATSATSSALAAATSSESNPKGVLGKDDFMKLLLVQLQYQDP
FT                   TEPMDTEKILTQTSQLASLESADNTKTALEKLAASLGNAQQFSTISAIGKTADLGSDAI
FT                   AHDKGTQSTFEVYFPNAVEQGTVSITDADGKTVQTLNVGTNPAGVYQFTWDGTDSLGNQ
FT                   ADSAVYHVNAQYSDANGVAQQTRLGAYPIESVRFDQGNTLVKVGSNYVPLDNIKEVY"
FT   sig_peptide     40852..40914
FT                   /locus_tag="Saut_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            41525..42787
FT                   /locus_tag="Saut_0042"
FT   CDS_pept        41525..42787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0042"
FT                   /product="flagellar hook-basal body protein"
FT                   /note="COGs: COG1749 Flagellar hook protein FlgE; InterPro
FT                   IPR001444:IPR010930:IPR019776:IPR020013; KEGG:
FT                   tdn:Suden_0031 hypothetical protein; PFAM: protein of
FT                   unknown function DUF1078 domain protein; flagellar basal
FT                   body rod protein; SPTR: Q44767 Flagellar hook protein flgE;
FT                   TIGRFAM: flagellar hook-basal body protein; PFAM: Domain of
FT                   unknown function (DUF1078); Flagella basal body rod
FT                   protein; TIGRFAM: flagellar hook-basal body proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08091"
FT                   /db_xref="GOA:E0USR4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E0USR4"
FT                   /protein_id="ADN08091.1"
FT                   /translation="MMTQAFYTGISGIKTNSTGIDIVSDNMANIDTIGFRGNDYEFSSL
FT                   FENMLSTDTLGTPSNSSIGVGSQLQASPMVQQKGSFMISDKSTDLALFEDGWFGIKGNG
FT                   NTLYTRDGNFTFDKDDDLVTQDGFHVLGTMGNNISDNDVLIEQLPEVKLKDVVEQEPLR
FT                   FPKSLTFPPEATSNAKFIGNLGTEPFTRTMSASVVDPQNNKNDLRLEFSLSQIQTPPGT
FT                   QWDVVAKTQSLDGTKLYDTQTGQVSFDASGALISNTLTTIDNNGAPVSIDLGNNFDGVV
FT                   SISNVPISASSTADGTIGGDLQGYDINKNGEVIATFTNGMQSSVGKIAVYHFQNDQGLN
FT                   RISGTRFQESTNSGKALFFKDEKGENIIGTNMANFKLEGSNIEMSYGLTELIILQRAYD
FT                   ANSKSVTTADQMMQKALNMDA"
FT   gene            42980..45109
FT                   /locus_tag="Saut_0043"
FT   CDS_pept        42980..45109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0043"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="COGs: COG1749 Flagellar hook protein FlgE; InterPro
FT                   IPR011491:IPR001444:IPR010930:IPR012835:IPR 020013; KEGG:
FT                   tdn:Suden_0032 flagellar hook protein FlgE; PFAM: flagellar
FT                   basal body FlaE domain protein; flagellar basal body rod
FT                   protein; protein of unknown function DUF1078 domain
FT                   protein; SPTR: Q9ZKY0 Flagellar hook protein flgE; TIGRFAM:
FT                   flagellar hook protein FlgE; flagellar hook-basal body
FT                   protein; PFAM: Flagella basal body rod protein; Domain of
FT                   unknown function (DUF1078); Flagellar basal body protein
FT                   FlaE; TIGRFAM: flagellar hook protein FlgE, epsilon
FT                   proteobacterial; flagellar hook-basal body proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08092"
FT                   /db_xref="GOA:E0USR5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR012835"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E0USR5"
FT                   /protein_id="ADN08092.1"
FT                   /translation="MLKSLFSGVSGLQSHQVAMDVESNNIANVNTVGFKYSRANFSDLL
FT                   AQTKAIATAPQGQLGGKNPVQVGLGSTVSSMTRIFSQGSIQNSDKNTDVAIQGDGFFII
FT                   SPDGGNTYKYTRAGDFKFDAGGNFVDNNGFIAQGWLRDPVTGKVDSTAPIENINIAPGL
FT                   TTPAQPTQEVVLKANLNSGAIVESFSPAYQVPTGAPTDPALPAIDGNGNPIESGNVGVM
FT                   FNESGEAFSLQDGQGVWASFISSTSTSTNSAQGSDTALAADEAETIVFNLDPGSSPATA
FT                   TASYTILAANTAAQNASVTAAAINALTATTGITATIDSSNKIVLTNTNGNSSASHNIDI
FT                   ASVTGANNPFDASEDDTTAYKYSYNSASPTVVAGSNKEFTTIADLRQALENQANSEAGA
FT                   TGIKVIVNDQGKIELSNTDSGSIDLNFKVTGISGSGITENTRFTRNMEALNTVLAAGTT
FT                   GKAFSQAFNAATHSSSIDIFDSLGSKHTLRMEFRKTALDTTTGSTWSIVITVPEPATID
FT                   TIAPTYEKKGSIRFNNDGSLATYNPPNVSFSGNNGSAPDQQVNLSFGTANKFDGMTSFD
FT                   SRSATSGISQDGYTGGDLVGIRIDQSGTLVGSFSNGRSFGLAQIGMAKFTNNEGLSTEG
FT                   GNVYVQTANSGDPIIGTAATAGRGFIQSAALEASNVDLSRALTQLIIIQRGFQANGKTI
FT                   TTSDQLLQTLIGLKQ"
FT   sig_peptide     42980..43060
FT                   /locus_tag="Saut_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            45163..46326
FT                   /locus_tag="Saut_0044"
FT   CDS_pept        45163..46326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0044"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /note="COGs: COG0027 Formate-dependent
FT                   phosphoribosylglycinamide formyltransferase (GAR
FT                   transformylase); InterPro IPR003135:IPR011761:IPR005862;
FT                   KEGG: tdn:Suden_0033 phosphoribosylglycinamide
FT                   formyltransferase 2; PFAM: ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp; SPTR: Q30UL7
FT                   Phosphoribosylglycinamide formyltransferase 2; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase 2; PFAM:
FT                   ATP-grasp domain; Carbamoyl-phosphate synthase L chain,
FT                   N-terminal domain; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08093"
FT                   /db_xref="GOA:E0USR6"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E0USR6"
FT                   /protein_id="ADN08093.1"
FT                   /translation="MQFSAPLKSNSKKIMLLGSGELGKEVIIEAQRLGLETIAVDRYEN
FT                   APAHQVAHRSHVVNMLDKDALLEIIYREKPDYILPEIEAINIDALFAAEDRGYNVIPNA
FT                   NAVSKTMNRKNIRTFAAEVLGLKTGPYKFVTTQEGMLEAARELGFPCVMKPVMSSSGHG
FT                   QSIAKSEEDIPASWEEAKEARGDASELIVEAFVDFDYEITMLTARNGKETVFCEPIGHE
FT                   QRDGDYVFSWQPMQMSEAAKQNAQKIAKEITDGLGGQGLFGVELFVKGDEVYFSEVSPR
FT                   PHDTGMVTLITQSQSEFALHLRAVLGLPLGFTFYGDGASAAFKSEKHNFAPVVEVDESL
FT                   FSDNSFVRVFGKPEAHKGRRLAVALVFDKVDAALEKARELISKIKDI"
FT   gene            46343..47752
FT                   /locus_tag="Saut_0045"
FT   CDS_pept        46343..47752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0045"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR006674:IPR003607; KEGG: abu:Abu_2329 HD_GYP
FT                   domain-containing response regulator; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: A0Y6B1 Response
FT                   regulator; PFAM: HD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08094"
FT                   /db_xref="GOA:E0USR7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E0USR7"
FT                   /protein_id="ADN08094.1"
FT                   /translation="MEKENLKYITFKRLVKIFLLAIVIITSISFLSYREFFKHSVKNKA
FT                   FEVAKVVEAGLTSHMKAGIMDKRGYFLQEIKTLNDIKSIKIDRAASVVKQFGKSTLENE
FT                   RNYISDKNLLTSKQPSFVWNDIDGKITATIPYLAIIHDDVNCLQCHHVRENDLLGAIEI
FT                   TMDIKQYQNLVIHYGYIFIAILILFALVVIFNLFGFIDNFIIKPLLRIIDDGKKAYKYK
FT                   KEIDSEKYEVKEMEALAEKINDFTHMVISKEEALENKNKELAELNKEIEETLCETMFTM
FT                   GEMEEIRSKDTKNHTKRVATLSALIAKEYGLSDEDVKMIKMTSPLHDIGKVGISDSVLL
FT                   KPGKLTQDEYKIMKTHAELGYTVLKHSDRSIIKSAATIARYHHEKYDGTGYPAGLKGEE
FT                   IPIFARIVAIVDVFDALLSKRVYKEKWNDNKTKEFIAFQRGKQFDPKLVDIILKNFDKY
FT                   AKLVKEMSENK"
FT   gene            47761..48696
FT                   /locus_tag="Saut_0046"
FT   CDS_pept        47761..48696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0046"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG1052 Lactate dehydrogenase and related
FT                   dehydrogenase; InterPro IPR006139:IPR006140; KEGG:
FT                   tdn:Suden_0034 2-hydroxyacid dehydrogenase; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase catalytic region;
FT                   SPTR: C4M1N2 D-glycerate dehydrogenase, putative; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
FT                   domain; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08095"
FT                   /db_xref="GOA:E0USR8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0USR8"
FT                   /protein_id="ADN08095.1"
FT                   /translation="MKIVLLDAITFGNTDLSCFNEFGEVEVFDSTEASLTNVRVKEAEV
FT                   IVTNKVVITREHMQNAKKLKLICVAATGTNNVDLKAAKELGIAVKNVAGYSTDSVIQHT
FT                   FSMLFYLIGHSRYYDEVVKNGEYSKSGIFTDVSHPFFEIKGKKWGIIGLGEIGRGVANI
FT                   AKCFGAEVCYYSTSGVNRTEDFQRMNLDELLKSCDIISIHAPLNDKTKNLLDYEQLLIC
FT                   KEGAVVLNLGRGGIINEAAVAKVVDEKNIFFGLDVFEKEPLPLEGPLLHVKNKSRLYMT
FT                   PHIAWTSVEARDKLIAGVCENIKSSLTENK"
FT   gene            48693..50216
FT                   /locus_tag="Saut_0047"
FT   CDS_pept        48693..50216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0047"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro
FT                   IPR013027:IPR004112:IPR006076:IPR003953; KEGG:
FT                   tdn:Suden_0037 succinate dehydrogenase/fumarate reductase
FT                   flavoprotein subunit; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; FAD
FT                   dependent oxidoreductase; PRIAM: Succinate dehydrogenase
FT                   (ubiquinone); SPTR: O29576 Succinate dehydrogenase,
FT                   flavoprotein subunit A (SdhA); PFAM: domain; FAD binding
FT                   domain; TIGRFAM: flavocytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08096"
FT                   /db_xref="GOA:E0USR9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E0USR9"
FT                   /protein_id="ADN08096.1"
FT                   /translation="MKTDVLIIGSGGAGLTAALAAKDAGADVRVITKEYPTRSQTCMAQ
FT                   GGMNAALGNVSHDSIEDHIQNTLKSAHGEADEEAVRYMCSEAPNAVAWLDEIGVCFSRT
FT                   PEGKIAQRRLGGASAPRACYAQDYTGLKILHTLYERCLKKDVEMFSERYLVDLLTKEDG
FT                   SICGALILNMRSGELEHHFAKCVVLASGGYSRIYDKYSTNSTASTGDGIAAASRAGAKL
FT                   LGMEFVQFHPTGLKNSSILISESARGEGGYLLNSKGERFTNELAPRDEVSRAINEQIVA
FT                   GEEVFLDIRHLGERFIDENLPQERKLALLYENVDPVKDLIPIKAVAHYTMGGIEVDNKS
FT                   QTSVSGLFACGECANHKVHGANRLGGNSLLEIIVFGREAGKSAANFVFCDEKCQNDFDF
FT                   KKEKSFLDALIEYKNEIDFYQKRTELGELFYKKVGIIRKESQLQEAKQEIELLKKQLPL
FT                   MGVKDTSKVYNTNLMEFIEFRNMLDICERVVSSALARKKSCGAHFVVEE"
FT   sig_peptide     48693..48752
FT                   /locus_tag="Saut_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            50222..50929
FT                   /locus_tag="Saut_0048"
FT   CDS_pept        50222..50929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0048"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit; InterPro
FT                   IPR001041:IPR001450:IPR017900:IPR004489; KEGG:
FT                   tdn:Suden_0038 succinate dehydrogenase/fumarate reductase
FT                   iron-sulfur protein; PFAM: 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; ferredoxin; SPTR: A3IXM6 Succinate
FT                   dehydrogenase iron-sulfur subunit; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: 2Fe-2S iron-sulfur cluster binding domain; TIGRFAM:
FT                   succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08097"
FT                   /db_xref="GOA:E0USS0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E0USS0"
FT                   /protein_id="ADN08097.1"
FT                   /translation="MKVHVKRESDFVAYDVELPDATLLEVLSSIKTEQDNSLAFSSGCR
FT                   SSVCGSCSMRVNEKEVLACAYKVQDGDVIEPLKNIEVIRDLVVNMDKALETKKRAKTWL
FT                   QTYNKEAKLTHEDEKINALQSDCILCGSCYSACPVYAVNEEFLGPFALTGVWKYVSDKR
FT                   EAQPKEKIDTIQTNGVWDCTLCNECTLVCPQGISSKADIEKLRMKSTMAGYADPSFTQS
FT                   FDGGFGFDGSPSF"
FT   gene            complement(50935..52650)
FT                   /locus_tag="Saut_0049"
FT   CDS_pept        complement(50935..52650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0049"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /note="COGs: COG0155 Sulfite reductase beta subunit
FT                   (hemoprotein); InterPro IPR006067:IPR005117:IPR006066;
FT                   KEGG: tdn:Suden_1241 ferredoxin--nitrite reductase; PFAM:
FT                   nitrite and sulphite reductase 4Fe-4S region;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; SPTR: A0YL91 Nitrite reductase;
FT                   PFAM: Nitrite and sulphite reductase 4Fe-4S domain;
FT                   Nitrite/Sulfite reductase ferredoxin-like half domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08098"
FT                   /db_xref="GOA:E0USS1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:E0USS1"
FT                   /protein_id="ADN08098.1"
FT                   /translation="MQENDLEKKFNKRERYKARLKPYDYFIKEFDTIDFESLGEGDRYY
FT                   LQDFGIFNTDFLEDEFTIRVRVAGGRISTKQFNFLADIVNEYDLTLVVTARAGFQLHDV
FT                   QADDVHELFKLLNDNELITWQSFGDNIRNIVTDVYDGVNQYAKIEVYSLIEQMQNYIIK
FT                   NPKYVGMLPRRVSIGISGNSANVNSFFANDIYFALAKKNNIYGFNVYMGGKNTEIAQDA
FT                   DIFLLYEEVFDFFTAFVETFYTHGSRFSRSKTRLFYMIEELGLDKLKELMEDVYGKKFN
FT                   RAGELQLLHGEFNEFEVLNNNKYAFCYQTDFARLSPKEIRKISDYANKHNAEVRLGIDQ
FT                   NIYIIGIDEKVAPFASPVLSSTIVACAGNLCPYAVWSIKDESAEYLPLEKIYKHKIKVG
FT                   FSGCAKGCGRHRHTDIGLIGLKTNNFGDTDGGARVFIGAEHDSGESVARQLFSMVPFVH
FT                   LKETITLIVGLFEKSKCKNFQLYAHHILNKYSEDFLSLWHLYNLKNKTSLTLPKQDNAL
FT                   TCKEEEKLLFESFADVALVEDDFKKTVSALAKELWTVAGKDPHYKPPIKRVNVR"
FT   gene            52788..53285
FT                   /locus_tag="Saut_0050"
FT   CDS_pept        52788..53285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0050"
FT                   /product="protein of unknown function DUF520"
FT                   /note="COGs: COG1666 conserved hypothetical protein;
FT                   InterPro IPR007551; KEGG: tdn:Suden_0039 nucleotide-binding
FT                   protein; PFAM: protein of unknown function DUF520; SPTR:
FT                   Q30UL1 UPF0234 protein Suden_0039; PFAM: Protein of unknown
FT                   function (DUF520)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08099"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:E0USS2"
FT                   /protein_id="ADN08099.1"
FT                   /translation="MAKEHSFDITAKIDMQNLKNAINLVEREVSNRYDFKGTTYEVNLK
FT                   EKDKVLVLVASSDNKLDALKDIVVAKLLKQGLSSKVLDELRVEDASGSTRKATFKIVDY
FT                   IESKEAKKITADIKKMKLKVNAQIEGDSIRVKGAKLDDLQKVMKMVREGEWEAPLVFEN
FT                   MR"
FT   gene            53300..53977
FT                   /locus_tag="Saut_0051"
FT   CDS_pept        53300..53977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0040 hypothetical protein; SPTR:
FT                   A0CYB6 Chromosome undetermined scaffold_31, whole genome
FT                   shotgun sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08100"
FT                   /db_xref="UniProtKB/TrEMBL:E0USS3"
FT                   /protein_id="ADN08100.1"
FT                   /translation="MKKMSVNDAAEYFGVSKEAIHNRIRRGSLQSVLQEGVKMVMVDEK
FT                   QVKTGARKPAQPRRTAVNNDRYYKLLEEQNKKLQSRVDTLESETRSLRDQKEQMLIEER
FT                   EKIERIYKEKDEQLKNILSSISSQFMLNAPQKTALEEEMLEAEIEAEIEAEIEAEIESE
FT                   LVETSKVISLNKHLKKYDFSEKKIKKIKTRFKKSAKKDERIIVVGKKYYIDTKKYDYSD
FT                   IIG"
FT   gene            53999..55312
FT                   /locus_tag="Saut_0052"
FT   CDS_pept        53999..55312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0052"
FT                   /product="TrkA-N domain protein"
FT                   /note="COGs: COG0569 K+ transport systems NAD-binding
FT                   component; InterPro IPR006036:IPR006037:IPR003148; KEGG:
FT                   nis:NIS_1740 K+ transport system, NAD-binding component;
FT                   PFAM: TrkA-N domain protein; TrkA-C domain protein; SPTR:
FT                   A3XJE8 Putative potassium uptake protein; PFAM: TrkA-N
FT                   domain; TrkA-C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08101"
FT                   /db_xref="GOA:E0USS4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E0USS4"
FT                   /protein_id="ADN08101.1"
FT                   /translation="MNIIIAGAGKVGFNLAKTLSIGHNVTVIDKNSQALDRIQESLDIL
FT                   PLRGDVEDANTYKSFTGQEIDLFIAVTNIDNVNLVSAMMVDATLHVKRKFVRVQKYFFQ
FT                   EQIIQKKLDIDKVIFPLKLASRAVSSLLKYPKANNVKFFKYTPYKLISVMVSSITLPQT
FT                   IHSDVFKIVGIERKKDFFIPDENIEILPNDLVYFFGDEKEIKQVCQKLDLDNMLDIQKC
FT                   VVFGGGELGIEIARELLKVDKDVKLVEKDLKLCEIADEELRGKVSIINYKYGSHDIFED
FT                   EGLESADIFVAATNNDEYNIIKCLEAKESGIKKVVAINNEMEYYNLMHSLGIVVVRGPK
FT                   MSAYNTIMEEISSTGVVIQKSYCGAKAVVFMRKVFPSSKLIDKVIKPLHVKESGVFYIR
FT                   ENVMHSLKEKIKLQENDLIVAFSAVKISSKVKEWIYEL"
FT   gene            55302..56744
FT                   /locus_tag="Saut_0053"
FT   CDS_pept        55302..56744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0053"
FT                   /product="cation transporter"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445; KEGG: sun:SUN_0248 K+
FT                   transport system, membrane component; PFAM: cation
FT                   transporter; SPTR: A3UAH0 Putative potassium uptake
FT                   protein; PFAM: Cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08102"
FT                   /db_xref="GOA:E0USS5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:E0USS5"
FT                   /protein_id="ADN08102.1"
FT                   /translation="MNYKNVLKILSLIGITVSVIFLLDALIGIIYKEQYENFLLYDGLF
FT                   FLVNLAVWQWLRNHEFDLKIKESILVVNLLWVLLGVAGAIPLFLYTDISFASSFFEAIS
FT                   GFTTTGATVYTDIEALPHLILFHRSLMHWLGGLGVIVLGVGLLSVINPTGSLSLFKAES
FT                   TGVVLEKLTPKIKDTALSLWIVYTLLTLVDMMLLKFFGMSWFDAINHAFSTISTGGFST
FT                   KNDSLGYFTNDGIIWTTTIFMMLAGINFLAHLKLYYKDAGGYKTEEVKWYFIIFIVLSI
FT                   LLSLVHVDISGDSFYDALKHSSFTIASVMTTTGFATIDYGSWSHLAIAIIFIGLLMGGN
FT                   AGSTAGGIKIIRHVIIFKTLASELKRILHPNMIISVFIDGVKQKERILSSTFGFFTLFM
FT                   ITVAIVTVYIYARGYDAMTSISGAFAIVGNVGPGFSMVGPADNFSFFSDFDKIFLSVAM
FT                   IIGRLECYTVFVLLSSSFWKKF"
FT   gene            56802..58175
FT                   /locus_tag="Saut_0054"
FT   CDS_pept        56802..58175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0054"
FT                   /product="Cl-channel voltage-gated family protein"
FT                   /note="COGs: COG0038 Chloride channel protein EriC;
FT                   InterPro IPR001807; KEGG: sun:SUN_0265 voltage-gated
FT                   chloride channel; PFAM: Cl- channel voltage-gated family
FT                   protein; SPTR: A3RXI8 Chloride channel protein; PFAM:
FT                   Voltage gated chloride channel"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08103"
FT                   /db_xref="GOA:E0USS6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:E0USS6"
FT                   /protein_id="ADN08103.1"
FT                   /translation="MIQKHITEQTAILFSVTKWVFLSSIIGILIGATVTGFLKVLAYSE
FT                   SSRSLLPFEYYYTLPFALVLTVWLVKTFAPSAEGHGTEKVISAVHKYDGKINVSVIPVK
FT                   TLATVLTIFAGGSVGKEGPGAQIGAGVASYLSTLLKFHKQDRKKLVICGISAGFATVFG
FT                   TPIAGAIFGVEVLIIGVIMYDVLLPSFIAGFAAFTTAQFLGIEYTYYDLHFFQDVSLDF
FT                   WLIMKVVLAGLFFGFVSDIVITSVSYTHSLVKSIKVSTYIKAFVGGLLIVALTLVFGEQ
FT                   YIGLGLGTIADALNPHVAASQDIHWYTFLLKTVFTSLSLAAGGSGGVITPIFYIGATSG
FT                   HFFGSIISPEHITLFAALGFVSVVSATTNTPIASTIMAVELFGIDIAHYAALAAVISFL
FT                   ISGHRSIFSSQILAMRKSEMLSVKIGEEVENINISLEEHEMDKIEKFRRRLHKKNKKR"
FT   gene            complement(58190..60112)
FT                   /locus_tag="Saut_0055"
FT   CDS_pept        complement(58190..60112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0055"
FT                   /product="protein of unknown function DUF1538"
FT                   /note="InterPro IPR011435; KEGG: sun:SUN_1865 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1538; SPTR:
FT                   A3UYC0 Permease of the major facilitator superfamily; PFAM:
FT                   Protein of unknown function (DUF1538)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08104"
FT                   /db_xref="GOA:E0USS7"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR011435"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E0USS7"
FT                   /protein_id="ADN08104.1"
FT                   /translation="MLSISTFLQLLKESFRDLLPIILVIMFFQLAIIQSVPPNWLSTAI
FT                   GLAIVGVGLAVFLLGLEVGIFPVGEGLASEFAHKGSTFWILIFGFMIGFGTTIAEPALI
FT                   VIADKAASISSGRIDATILRTVVAFSVGFAIVLGVWRIIKGHPIQYYIIAGYILVVSAT
FT                   AFAPKEIVGLAYDLGGVTTSTVTVPLVAALGIGLASTIKGRNPVLDGFGLIAFASLTPM
FT                   IFVQFYGIAVYQLIDASTSVLPPVIEEIEAVKMHFDIISVLQGLLGVISDVIPILGVIL
FT                   FFQYIILKKPIDNIKNVIIGFGLVILGLDAFIVGLEMGLFSVGETMAAELTQYDSELII
FT                   YSFGFLIGFSTTMAEPALTAIARKAKEISDEKINDFVLRLFVALGVAIGIALGAYRIVV
FT                   GGEIVYYIMAGYMLVIVLTFLAPKYIVPIAYDSGGVTTSTVTVPLVAALGLGLATNIPG
FT                   RDPLIDGFGLIAFASLFPMITVMLYGIITEKMGVKGESEKEEIQLNELRHALEDVNNME
FT                   LSTVTVSDTNSRHSYLMSFSAVHVIVPQNKQEEALIAARDAGGRGVTIMSAHGMGLEHM
FT                   ENFYDRLHSDATDANLMFITQTKNVDKIIKEIITKLDITGDGRGLTFAYPVSHIKGLRL
FT                   KLGDL"
FT   gene            60182..60676
FT                   /locus_tag="Saut_0056"
FT   CDS_pept        60182..60676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0056"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.7.62"
FT                   /EC_number="2.7.1.156"
FT                   /note="COGs: COG2087 Adenosyl cobinamide kinase/adenosyl
FT                   cobinamide phosphate guanylyltransferase; InterPro
FT                   IPR003203; KEGG: tdn:Suden_0112 adenosylcobinamide kinase;
FT                   PFAM: cobalbumin biosynthesis protein; PRIAM:
FT                   Adenosylcobinamide-phosphate guanylyltransferase; SPTR:
FT                   A0NQI2 Adenosylcobinamide
FT                   kinase/adenosylcobinamide-phosphate guanylyltransferase;
FT                   PFAM: Cobinamide kinase / cobinamide phosphate
FT                   guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08105"
FT                   /db_xref="GOA:E0USS8"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0USS8"
FT                   /protein_id="ADN08105.1"
FT                   /translation="MKTLFIGGIKSGKSHNAENYIKKLSGAKPVYLATTEFIDDEMQER
FT                   IQQHQQQRADDFITVEEAINLKEKIALQEGAVLVECLSMWINNMLYHEKTYEEMEAEIA
FT                   TVMELKQDIVFVVNDVSCGIIPDNKLARQFVDISGKLSQMVAQKCDEVYHVVAGISTKI
FT                   K"
FT   gene            60673..61398
FT                   /locus_tag="Saut_0057"
FT   CDS_pept        60673..61398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0057"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="COGs: COG0368 Cobalamin-5-phosphate synthase;
FT                   InterPro IPR003805; KEGG: tdn:Suden_0111
FT                   cobalamin-5-phosphate synthase CobS; PFAM:
FT                   cobalamin-5-phosphate synthase CobS; SPTR: A3LC31 Cobalamin
FT                   (5'-phosphate) synthase; TIGRFAM: cobalamin 5'-phosphate
FT                   synthase; PFAM: Cobalamin-5-phosphate synthase; TIGRFAM:
FT                   cobalamin 5'-phosphate synthase/cobalamin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08106"
FT                   /db_xref="GOA:E0USS9"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:E0USS9"
FT                   /protein_id="ADN08106.1"
FT                   /translation="MNKLFKGFALALSMLSILPFFKVHDFYKGINGYAVMFYPLVGFLL
FT                   GLILYGAFILLTPYLPPLHVSIIIFSLWVVLTGALHLDGFADTVDGLFVDKKRALEVMK
FT                   DPHNGGMGITFSIVFLLLKASSLAALDAVYLLPVILMLSRLSAVLEIYLYPYISQNGMG
FT                   SLAKAEFNRWQLFVALAYSFMVLVLFESYILMFVSLLVMFVLKSFFIKRYDGFTGDIYG
FT                   FSIEMTELVLLNAVIVGLQ"
FT   gene            61395..61958
FT                   /locus_tag="Saut_0058"
FT   CDS_pept        61395..61958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0058"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="COGs: COG0406 Fructose-2 6-bisphosphatase; InterPro
FT                   IPR013078; KEGG: tdn:Suden_0110
FT                   phosphoglycerate/bisphosphoglycerate mutase; PFAM:
FT                   Phosphoglycerate mutase; SPTR: P52086 Alpha-ribazole
FT                   phosphatase; PFAM: Phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08107"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E0UST0"
FT                   /protein_id="ADN08107.1"
FT                   /translation="MKITLIRHGEVEVPYIGKYNGHNDIGLSKKGEKEAKKLAELFTCK
FT                   EFDLVYCSDLRRAKETLKPFTQAKNALYTPKLREKSWGKHEGFDFDEITAQGVVYKNFS
FT                   QWIEALDGENYKEYVQRVKKFFFEELAVQKADNVLVITHAGVIRVLMAIVQNLSLEEAF
FT                   TLALPYASYTLYDTDLKTFSTIKT"
FT   gene            61988..62075
FT                   /locus_tag="Saut_R0001"
FT   tRNA            61988..62075
FT                   /locus_tag="Saut_R0001"
FT                   /product="tRNA-Ser"
FT   gene            complement(62414..65107)
FT                   /locus_tag="Saut_0059"
FT   CDS_pept        complement(62414..65107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecm:EcSMS35_4003 hypothetical protein; SPTR:
FT                   B0EQD8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08108"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:E0UST1"
FT                   /protein_id="ADN08108.1"
FT                   /translation="MNKDIQHIIEANNDNRLAFFIGSGISKSSETENHKMPLWKDLISE
FT                   LEKDLEGVEETNYLKLAQLYYLEYGEYLYYAKLKKIFDINLEPSNIHKLIFEIKPDYVI
FT                   TTNWDKLLDNTVIDNAFIYDIVVSDTDLVKSTIQKKLIKIHGDFKHHNIVFKEDDYLNY
FT                   QTNFPLIENYIKSILSTHTIVFLGYSYSDYNLKQIMKWIQSFSNVKPPAYLVGFSNQSS
FT                   EIKYLENHGIKSLILETDSSLGNNKYNQAVEDFLLRIKNKNVLVSENLTYESVVDYFYK
FT                   KLVAFDPMNVLMPEQIKKIFKKVFYRYDSEFIILDLLQLDKSNSYYNKFVELLTKLDKN
FT                   ENSFKELEYRLNHIFSILSKAGIGGIMLNDKEYYKFQFPLYNALDLSNILSFKLDTNEN
FT                   ANEAFIFYLLENNEKAYKLYENNIKSSLKSKNYIDLFLSMFNRNQLLSFLKYDFSIDYS
FT                   KYETVEEYDIEEKYQDVPNNIKQTISPIISTFKDFNFIYSFAFTISSLLKEKEEQKKSI
FT                   ESGSIIFSNNSFEAELRHKNLIYFILGNGLAIDRYREFQTIIEYFINISLVRQVQEENI
FT                   VLNQLEIFSCIKFLKEKSLKRIFESYSNKESSKRLVLDTENQKYLLQVLANTVKHIRNN
FT                   DTNNFSIFENSWKKTMYLLSISKLEKEIMENILEGFTFILNTSNNSISTYQTINTFLGL
FT                   QYSLYKEQFDSSKLISLIELVLNKIIYQNYNGRELYAIKSNYINNIYAYLEMDTNFNYD
FT                   NLKLVQKLLFEFNSWELAQKVEISQYFLISLYHISNEKIKEEIKTFINNIEYKNIESLF
FT                   EQIDFQLFLLITEFQSVDIEDLSEKIKEEISQYEDGKSMSSGLYSLQSRLQYLVEKRQI
FT                   LEFESLLNELTTIIENFEQKRGKMLF"
FT   gene            complement(65120..65746)
FT                   /locus_tag="Saut_0060"
FT   CDS_pept        complement(65120..65746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08109"
FT                   /db_xref="GOA:E0UST2"
FT                   /db_xref="UniProtKB/TrEMBL:E0UST2"
FT                   /protein_id="ADN08109.1"
FT                   /translation="MSIKGLYFKYILFNNIKIINIFLTIFWIVGVILGIHIVIEYLSIE
FT                   NENKYLLLSSLGIIISAFIASISLVKSIYENKRTNENIFLLEKLTICQELTISEFNELL
FT                   LRLSNVSTALGGFINADDGEPTRLCDLGREVLNNFENRQSYVKLLWLLRSFFTHLSVDF
FT                   EDTMRNIKQAKNINEVQTNVSNFLSKIDYEQLKYIVNKNKIKFKS"
FT   gene            complement(65970..66398)
FT                   /locus_tag="Saut_0061"
FT   CDS_pept        complement(65970..66398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0061"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001867; KEGG: tdn:Suden_0616 two
FT                   component transcriptional regulator; PFAM: transcriptional
FT                   regulator domain protein; PFAM: Transcriptional regulatory
FT                   protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08110"
FT                   /db_xref="GOA:E0UST3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0UST3"
FT                   /protein_id="ADN08110.1"
FT                   /translation="MSKNVVLVFEADDTDILDIESYIASRGYEIKKINEKTKKSNKNII
FT                   DFGEYYQFNLKTKETFYKGEKVKLTKKESLFLKLLLLNMGHVVTFEQATNYIWNQEELI
FT                   TENNLRTLVWRLRGKLKTDLIKNNQGIGYYIDLLVVDS"
FT   gene            66503..66778
FT                   /locus_tag="Saut_0062"
FT   CDS_pept        66503..66778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_0763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08111"
FT                   /db_xref="GOA:E0UST4"
FT                   /db_xref="UniProtKB/TrEMBL:E0UST4"
FT                   /protein_id="ADN08111.1"
FT                   /translation="MINRFFRKYLSIIFILATFMGVFHHHNDLKQHNDCKICTVQSSLA
FT                   HADTPVEIHYLTDLEIVNESIITLLASLHVKKIDNQLNARAPPQIS"
FT   gene            66832..68100
FT                   /locus_tag="Saut_0063"
FT   CDS_pept        66832..68100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR020003; KEGG: nis:NIS_0025 hypothetical
FT                   protein; SPTR: O67918 Uncharacterized protein aq_2168"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08112"
FT                   /db_xref="UniProtKB/TrEMBL:E0UST5"
FT                   /protein_id="ADN08112.1"
FT                   /translation="MKKTIYLSLFACASLFADADLDALKEQIAQQKLVMQKLEAKLDAL
FT                   SKKQTQMQQAQKSAQASAPAVNTSASFSQKAYLPDIALILNMSAVGRDVKNSDYENFAI
FT                   PGFINSGDAELPFNKDRGFNFNYGELALASTVDPYFDAFAILHLHPDSLEIEEAFVRTR
FT                   ALPYGLRVKAGKFKSAFGRINAKHQHSWHFDSQPIIYKALFGPDSISDAGIQLQWVAPT
FT                   DTYVMAGLEAMQGTNDRSFGDTEENNLYVGYVKSSVDVGDDLSILGGVSLAHGKNSENN
FT                   ATNPTNVYGIDLTLREQLGSYSALTWQSEYLYRNKDIGPRNDKQAGLYSELIYQYNNNY
FT                   SAGFRYDAITKNDTDLSSYAGIDTNNLDRYTAMLEYKPFPMSRLRLSYTYDRTKIIAGE
FT                   RKNMSEVMMSLNIAAGAHGAHDY"
FT   sig_peptide     66832..66888
FT                   /locus_tag="Saut_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            68110..68988
FT                   /locus_tag="Saut_0064"
FT   CDS_pept        68110..68988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0064"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro
FT                   IPR006129:IPR006128:IPR006127; KEGG: sun:SUN_0761 metal ion
FT                   ABC transporter, substrate-binding protein; PFAM:
FT                   periplasmic solute binding protein; SPTR: A2UUS9
FT                   Periplasmic solute binding protein; PFAM: Periplasmic
FT                   solute binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08113"
FT                   /db_xref="GOA:E0UST6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:E0UST6"
FT                   /protein_id="ADN08113.1"
FT                   /translation="MRRIILLTVLLTNLAFASVKVDTTYSTAGAVAQKIGGDLVHVTVL
FT                   GSPKYDPHFIVPKPSLISKLRRADLLIINGGGLELGWLPPLLRAANNAKIQNGAKGFLD
FT                   MSHFVHMIDVPASISRAFGDVHAQGNPHYTTDPYVIVPMAKAIAQKLSQIDPQHQKSYE
FT                   ANLKKFTNEWQTYLNKLDAKMLTCKDKKVVQYHELFNYFLKRYNYKIYGTIEPLPGIAP
FT                   SSKHTIELINIMRENGVKKILQDVYHERKTAQFIAAKTGAKVLIIPHDLGADGSKTLQE
FT                   FYNKIANRICQ"
FT   sig_peptide     68110..68160
FT                   /locus_tag="Saut_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            68979..69755
FT                   /locus_tag="Saut_0065"
FT   CDS_pept        68979..69755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0065"
FT                   /product="ABC-3 protein"
FT                   /note="InterPro IPR001626; KEGG: nis:NIS_0023 metal ion ABC
FT                   transporter, permease; PFAM: ABC-3 protein; SPTR: A2UUS8
FT                   ABC-3; PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08114"
FT                   /db_xref="GOA:E0UST7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E0UST7"
FT                   /protein_id="ADN08114.1"
FT                   /translation="MSIVELLWPAFVLAIALVFIHSIFGLEIIKRGVIFTDLAIGQIAA
FT                   IGMALSVAFMDSQYQNIMTLLFALLAAAIITWATKKVQKIEAFIGLLYALGISSIMLIL
FT                   AQSAEGTELFSKLSAADILFTSSDDLLKSLLLYGGVAFVMFIVYPRLSGVKKEFLFFVM
FT                   LALTVTSSVQSAGVLVVFALLIAPSYAGLAQMKMNALLFACLFGSLSIILALFGSYYLD
FT                   LPTGYAIIFVTVLFSLVFVIVSSIIKETQAKVNNEE"
FT   gene            69745..70176
FT                   /locus_tag="Saut_0066"
FT   CDS_pept        69745..70176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0066"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="COGs: COG2020 Putative protein-S-isoprenylcysteine
FT                   methyltransferase; InterPro IPR007269; KEGG: sun:SUN_1174
FT                   hypothetical protein; PFAM: Isoprenylcysteine carboxyl
FT                   methyltransferase; SPTR: A3XIW2 Putative uncharacterized
FT                   protein; PFAM: Isoprenylcysteine carboxyl methyltransferase
FT                   (ICMT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08115"
FT                   /db_xref="GOA:E0UST8"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:E0UST8"
FT                   /protein_id="ADN08115.1"
FT                   /translation="MKSKILVGLQFFIIFLMILPLGTKTQHLYLGSLILIFGIIIGLLA
FT                   LKEHKSGNFNIRPDIKENCELVTSGIYTYVRHPMYLSVLLSMFGLAVIYFTYYEFALLV
FT                   ILLITLLVKLFYEESLWKCHNPAYIEYLQKTKRLLPFVF"
FT   gene            70192..70620
FT                   /locus_tag="Saut_0067"
FT   CDS_pept        70192..70620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08116"
FT                   /db_xref="GOA:E0UST9"
FT                   /db_xref="UniProtKB/TrEMBL:E0UST9"
FT                   /protein_id="ADN08116.1"
FT                   /translation="MDITLLIKSIAALIGAFAILIILYFYLSHTKKFAKKIQNIPEEQP
FT                   DLSTLLEVIKDKKSTTQELKEAVDLILKYYWKIPKKLGMRVNPKFEIYSELLLRICQHP
FT                   NTNKDIILKLDKELERFNPQYKLELDDSLTKGLNTRAI"
FT   gene            complement(70637..74962)
FT                   /locus_tag="Saut_0068"
FT   CDS_pept        complement(70637..74962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0068"
FT                   /product="signal transduction histidine kinase with CheB
FT                   and CheR activity"
FT                   /note="COGs: COG1352 Methylase of chemotaxis
FT                   methyl-accepting protein; InterPro
FT                   IPR004358:IPR000780:IPR013655:IPR000673:IPR
FT                   013656:IPR003594:IPR013767:IPR003661:IPR001610:IPR000014:I
FT                   PR000700:IPR002052:IPR005467; KEGG: nis:NIS_1076
FT                   two-component sensor histidine kinase; PFAM: MCP
FT                   methyltransferase CheR-type; PAS fold-3 domain protein;
FT                   CheB methylesterase; PAS fold-4 domain protein; ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein;
FT                   histidine kinase A domain protein; SMART: MCP
FT                   methyltransferase CheR-type; PAC repeat-containing protein;
FT                   histidine kinase A domain protein; ATP-binding region
FT                   ATPase domain protein; PAS domain containing protein; SPTR:
FT                   A0YI05 Sensor protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   CheB methylesterase; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; CheR methyltransferase, SAM binding
FT                   domain; His Kinase A (phosphoacceptor) domain; CheR
FT                   methyltransferase, all-alpha domain; PAS fold; TIGRFAM: PAS
FT                   domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08117"
FT                   /db_xref="GOA:E0USU0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0USU0"
FT                   /protein_id="ADN08117.1"
FT                   /translation="MKDSVFIGIGASAGGLEALKELLPLLPQDEGYVYIIAQHLDPHKK
FT                   SALGEILTAYTAMPVVTISQKYTFLPNSVNIVPPGYNLTYAKHKLLLEKISKTPHTPTP
FT                   SVDELFKALSSYKKENCVGIVLSGAGHDATAGVKTIKENGGITVAQSPDEAQYADMPKN
FT                   AIQSGYIDYVLKVAQIGENLESIIHIMPEPLMKITKLLEEKECLDIDKYKKETIMRRLN
FT                   KRMMLTKCADLDEYFDYIQTHPDELYLLYQNILIGVTEFFRDKESFEVFKQHLEHYLLD
FT                   KPDHYDLRIWSIACSTGEEAYSLAIIIDQIKKKLKKNFSVHIFATDIDEKALEIAKKGI
FT                   YTKKLLEKIDKKIIKTYFSALDEGYKIKEFIRSQIVFTKHNILSDPPFIKQDIISCRNF
FT                   LIYILPEVQQELFVLFHYALKDKGLLFLGSSESTLMSVDYFKALNQEHKVYVKEALQNP
FT                   PRISSHYFSSHINTKQNQTGIKTSTLKDINIKEEITNTVFELFSHECIIVDTNFTIVYK
FT                   QGSNPFLELGDGFVTLNIVENLKKELRYSVKKILKRTLKTATLHSTKFIEVKLDNKEQT
FT                   FVKVIAAPFANKQNTPFILLYFQELNAHGLEFDTREIVLPNESYVVENLTNRVKELQED
FT                   YHALLDELSISKENMQLLNEELQRSNEELQSANEELETSNEELQSSNEELQVSIINEQK
FT                   LQRQLALILNSTHDGIMGLDLEGRHTFVNAAALEMLGYTKDELLGKNAHRIWHHTKPDG
FT                   SHYLFSECTLHTHLVDGLSVRKEDFFFKKDSTGFNVEVLQNPIIEEGKVKGAVLSFRDI
FT                   TEKKKLQQEAEYEHRLANLYVNTTGTLVMVLDLAGSVNMINNSGCELLGLPKEKIIGKN
FT                   FIHNFIPKARQPENQNVFDSLISEKTDILKEYKNIIIDAQGKEHIISWRNNYIKDDNGT
FT                   LTSLLSSGIDITDKEALTEKLFEQEHLYKLTFEEADIGIAHVSLDGRWIDTNEYLSKLL
FT                   GYTKEEFQNMHVFDITFPQDRDTDMHMIEQLHKGEKKSYHIEKRYVHKNGNIIWVSLAV
FT                   VLLLDEQKKPLYLLKIIRDISQLKLLMYQIEIEKNRFQRIIEFTPIPTMLYNTDGDILI
FT                   LNKIFQDNTGYTLEEIPTIDKMVEKLFVNEDADSIKSIKQYYKEPTKLPKQQQCITTKS
FT                   KERRVGILDAVKLDEEGNSSEILYLIAIVDITDIQKKDELMVAQSRQAAMGDMLSMIAH
FT                   QWRQPLSVISMVANNIQAQIELQRSVDAKSLHDLIHTLNEQTQYLSHTIDDFRNFFKPD
FT                   KNREFIKIDVILEKLTHLIEKSLQNNAISLTLPKKSDIELCTYQNQLLQVLINIINNAK
FT                   DAIKEHRAQDGNISIDVIKKKKEILLKICDNGGGIKPEILKKLGEPYVTSKSKNGTGLG
FT                   IYMSRIIVEKHLGGRLSWESNSKGSCFYISLPKDTICES"
FT   gene            75014..76510
FT                   /locus_tag="Saut_0069"
FT   CDS_pept        75014..76510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0069"
FT                   /product="diguanylate cyclase and metal dependent
FT                   phosphohydrolase"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR000160:IPR006674:IPR001789:IPR013976:IPR
FT                   003607:IPR006675; KEGG: sse:Ssed_3269 response regulator;
FT                   PFAM: response regulator receiver; metal-dependent
FT                   phosphohydrolase HD sub domain; GGDEF domain containing
FT                   protein; Metal-dependent hydrolase HDOD; SMART: response
FT                   regulator receiver; metal-dependent phosphohydrolase HD
FT                   region; SPTR: O67821 Uncharacterized protein aq_2027;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM: HD domain;
FT                   GGDEF domain; Response regulator receiver domain; TIGRFAM:
FT                   uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08118"
FT                   /db_xref="GOA:E0USU1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E0USU1"
FT                   /protein_id="ADN08118.1"
FT                   /translation="MINLKELQALAKKFKVLYVEDDISVQNALAEYLKNLFSQVTTAND
FT                   GEEGLQTYKKGQYDIVITDLSMPKMNGIEMLQKIREINPSQAVLITTAHSGSDYMSQAI
FT                   KIGVDGYIVKPFDYEQLNYELYKTSEKLEVMQENEAYKKTLQRMVEQKTAELSSMIHFQ
FT                   HDNYEKTLLAMVKLIEERDTYTAGHSQRVANYSKMIAKEMDCSEEECDQIYRAGILHDI
FT                   GKIVTPDVVLLKPKKLNALEYKLIQEHPQVGYRLLANIPMYKDLADTVRDHHERCDGSG
FT                   YPRGIEANEIDKLAKVMMIADTFDAMTTNRIYKGRKTCQEALDEIQSLGTSQYDSDAVK
FT                   AALRVLKDVVIAEDINQLPHTEIEKERFAYFYKDSLTDLYNQSYLDVILSQNSYDIKYT
FT                   KLHLLRLKNFSRYNKDSGWKKGDAVLEKIAKSLQRCFDLSMVFRIFGDDFAILDNGECN
FT                   MTEIEQQIKEILAETIIESDMLELSLVAKKTITVDDLEKL"
FT   gene            complement(76511..78010)
FT                   /locus_tag="Saut_0070"
FT   CDS_pept        complement(76511..78010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0070"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR006158:IPR007197:IPR006638:IPR006025; KEGG:
FT                   tdn:Suden_0042 radical SAM family protein; PFAM: Radical
FT                   SAM domain protein; cobalamin B12-binding domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: A1HS42 Radical
FT                   SAM domain protein; PFAM: Radical SAM superfamily; B12
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08119"
FT                   /db_xref="GOA:E0USU2"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025288"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:E0USU2"
FT                   /protein_id="ADN08119.1"
FT                   /translation="MKIILTTLNSRFTHSAIGLRYLYANMQELKNNTNILEFSINDAIQ
FT                   TIAEKLLINKPDIIGIGVYIWNASEVHELIHIIKKVSPQTRIILGGPEVTYQPFRVNFD
FT                   DADYIIQGEGDLAFYELCKKIINEEKVDKIIKMSAPNLKEIQLPYMYYTDDDIKNRYIY
FT                   VEISRGCPFECEFCLSSMDEKVRAFELDEVLAEFEKLWERGARNFKFVDRTFNLNMKAA
FT                   NKILDFFLEKEPPYFAHFEVIPDHFPASLREKIKRFAPGALQLEIGIQTLNPVIANNIS
FT                   RQLKLDKIKDNIRFLENETTAHIHLDLIVGLPGESLESFGRNLDELMSMSSCEIQIGIL
FT                   KKLSGTQINRHDIEEGMVYSDIPPYDILKNNQLSFLDIQIMKRFARFWDLYYNSGNFKT
FT                   SLLLLWQETSIYENFYAFGLWIYEQTDSTWKISLQRQGELLFSYLSEVKKLDRQNVADA
FT                   MLEDMMKLKGRAVPAYLKPFADDFQTNAKLGTSGFNKRQQA"
FT   gene            complement(78191..79627)
FT                   /locus_tag="Saut_0071"
FT   CDS_pept        complement(78191..79627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0071"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089; KEGG: tdn:Suden_0043 methyl-accepting
FT                   chemotaxis sensory transducer; PFAM: chemotaxis sensory
FT                   transducer; SMART: chemotaxis sensory transducer; SPTR:
FT                   A3EQ69 Methyl-accepting chemotaxis protein; PFAM:
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08120"
FT                   /db_xref="GOA:E0USU3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:E0USU3"
FT                   /protein_id="ADN08120.1"
FT                   /translation="MMNTSSLFKNNQALVLFASLIGVGIYALFSASYILGALVFIIVIA
FT                   TLFIPSAATAKNSTILDNAEKILTDAAQGKLEGRITHIPNDDSRDAKIAWAVNNMLDQI
FT                   EAFMRDTETTIEAASVGKTYRHTYPQGLHGLFHNTSEKVKKAIKSIANGYRTKMLGELS
FT                   HEFTNLGGGIGEGLAIIQTDLTSSSNEAKEIVDVSQQTAEQATGSLNSVLEIGQRLNTL
FT                   VELISSSHEGIVNLEGRSRDISEVVGLIKDIADQTNLLALNAAIEAARAGEHGRGFAVV
FT                   ADEVRKLAERTQKATTEIEINISTLQQEANDMRGNSDEISTIAQESNEVIHEFENTFSE
FT                   LNEQANSAHTTAIGIQNRLFTTLVKVDHILFKSNAYSTVLNEDADKEFPDHKHCRMGKW
FT                   YLGIGQERFGNTSAFRKMDVPHATVHDNVAKNMAYVKEGSILKANHPQIITDNFRVMEN
FT                   ASHELFKDLDLMLEEYEQKG"
FT   sig_peptide     complement(79520..79627)
FT                   /locus_tag="Saut_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(79596..80081)
FT                   /locus_tag="Saut_0072"
FT   CDS_pept        complement(79596..80081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0072"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="InterPro IPR013655:IPR013767:IPR000014; KEGG:
FT                   tdn:Suden_0044 putative PAS/PAC sensor protein; PFAM: PAS
FT                   fold-3 domain protein; PAS fold domain protein; SPTR:
FT                   A0NPS9 Putative sensor (PAS) domain for methyl-accepting
FT                   chemotaxis sensory transducer; TIGRFAM: PAS sensor protein;
FT                   PFAM: PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08121"
FT                   /db_xref="GOA:E0USU4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E0USU4"
FT                   /protein_id="ADN08121.1"
FT                   /translation="MVRELGENDFIVSKTDTKGRITYVNKNFMNLAEYTEEELLGKPHS
FT                   IIRHPDMPKAVFKLLWDRIQAKEEIFAFVVNKTKNNNSYWVYANVTPSLDERGNIIGYY
FT                   SVRRKPNAQALEAIKPIYSKMLQAEKSGGVESGMKILTDLLDQEGVSYDEYIISLQK"
FT   gene            80164..81297
FT                   /locus_tag="Saut_0073"
FT   CDS_pept        80164..81297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0073"
FT                   /product="putative MFS metabolite transporter"
FT                   /note="KEGG: tdn:Suden_0045 putative MFS metabolite
FT                   transporter; SPTR: A2V1B9 Major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08122"
FT                   /db_xref="GOA:E0USU5"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0USU5"
FT                   /protein_id="ADN08122.1"
FT                   /translation="MFVLLSVFYYFYFSIVGIYIIFLPKVLSGVGYDASEIGIIFAASP
FT                   LVRFILPFLFMRGLTLNATIFKSSLFIVVASALSFYFSLEHFYALLLSNVFLGLGMSLM
FT                   LPFVEVISLHSIGKERYGKVRLFGSLGFIAVALVLVKFLSSAYVALDFLLVLTLLTAFV
FT                   AYKVLHRAPDTTYAKEEHVKNDINIFKDWRLWGGLILVQMSFGSFYNFFTIYETDHGIS
FT                   LDMTVYLWSFGVLIEVLMFFFQGGLLRGNLLNLLRFTALATVLRWFLVFLFPQNLAILF
FT                   FSQALHALSFALFHTAAISYLFHLYKHKSLSQQLFSGLTYGFGGLGGALIAGYVYEYYP
FT                   KYLFLTSSLMAFGAFLLFMAVNDKKIENLRCSISRES"
FT   gene            complement(81177..81563)
FT                   /locus_tag="Saut_0074"
FT   CDS_pept        complement(81177..81563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0048 hypothetical protein; PFAM:
FT                   Domain of unknown function (DUF309)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08123"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:E0USU6"
FT                   /protein_id="ADN08123.1"
FT                   /translation="MHKHIQKFTKCLNEERFYDAHEALEEAWFPRRFEDDKEVKLLKGF
FT                   INASVSFELLKRGREQQSKKVWANYLKYRPYIFEIDSAYQNSYYQLSRLIEQRRFSIFL
FT                   SFTAIKSKNAPNAIRLDVKNKYFG"
FT   gene            complement(81556..81876)
FT                   /locus_tag="Saut_0075"
FT   CDS_pept        complement(81556..81876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08124"
FT                   /db_xref="UniProtKB/TrEMBL:E0USU7"
FT                   /protein_id="ADN08124.1"
FT                   /translation="MNYPNEWTQKEFLQNKKKLAQKDVDVLLVDTILSPIEKADTITYN
FT                   PYELKQYPQGSVFVFYCDTGKATLDRLGEYKQKFPQYTCISLKGGRGYWRKNMMLLEED
FT                   DA"
FT   gene            82002..84797
FT                   /locus_tag="Saut_0076"
FT   CDS_pept        82002..84797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0076"
FT                   /product="helicase domain protein"
FT                   /note="COGs: COG1202 Superfamily II helicase; InterPro
FT                   IPR001650:IPR014001:IPR014021:IPR008162; KEGG:
FT                   tdn:Suden_1967 helicase-like; PFAM: helicase domain
FT                   protein; SMART: helicase domain protein; DEAD-like
FT                   helicase; SPTR: A5DUK7 Putative uncharacterized protein;
FT                   PFAM: Helicase conserved C-terminal domain; Mitochondrial
FT                   degradasome RNA helicase subunit C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08125"
FT                   /db_xref="GOA:E0USU8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0USU8"
FT                   /protein_id="ADN08125.1"
FT                   /translation="MARKNKKNSKINQRIKKYFDDDPFDVGIERVEAKTLSELFATLGI
FT                   YDIDHNKTLMVKTLRMIWSEADSGMRHDILNFFESDGRVYKSEKPKEHVGFDREDKINA
FT                   ILEELDVNQEEAVRLHEAYANVRSKKITIEKMESSLRHIRFEMKKEKLERELEGLFDLD
FT                   DCFEFNASLKYELYEQSFHKILTLKTKPYSYEYIETAPFEAIVEKIGQDKVTTLKQKQQ
FT                   SINKFLSSLKHPHSYLSTKEILDSLRASPPKSKVNYPLISHKVLKNIIKAKIDAEGVEL
FT                   HDEEVLIRLNEQVNLPYSDKKFSYKLELHVELDGLLEEIWNSKRFNFDTILAEVKKEHE
FT                   DDFLLSLDALVKECAEYAQLLHFTPEELHERVYEFLFELLPMTLTITPKIHRKITRRFL
FT                   HSIHDELIKKQRQELLARTIRDFKNLFPIARSMQRKLVLHIGPTNSGKTYEAMQALKEA
FT                   DTGYYLAPLRLLALEGYETLKAEGIESSLITGEEQILDDEATHISSTIEMMNYDVDVDV
FT                   CVIDEVQMIDDRDRGWAWANAIIGAPAKEVIMTGSPNVKEAIIALAEYLGEELEIREFE
FT                   RKNPLELLEKPTHPKDVEAATAIIAFSRKDVLRLKQNFSKDFEVSVVYGNLSPEVRREE
FT                   ARRFREGETQILVATDAIAMGMNLPIKTVLFSKAEKFDGIIQRNLFPSEIHQIAGRAGR
FT                   YGLHENGYVGALHADALNIVKKNFNKRAKEINVPFKVMANLEHIKLVSTILEENSLEEI
FT                   LRFFIKNMVFDGPFYAASLDDMLEASRIVDSYDLDIATKYHLACAPLTLKSAYIISAYE
FT                   RYINALEKKEPVYYHAPKLTGSYAQTSEELLRAEDMVKEISLYLWLSYRFNEYFVDENK
FT                   ARAYRGVLNKYIEETLRQTQLAQTCKLCGTALPTNSKYSICQSCFKKNYVHKRGHRRSP
FT                   R"
FT   gene            complement(84810..86399)
FT                   /locus_tag="Saut_0077"
FT   CDS_pept        complement(84810..86399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0077"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004090:IPR004089:IPR003660; KEGG:
FT                   tdn:Suden_1178 methyl-accepting chemotaxis sensory
FT                   transducer; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; SPTR: A3UW61 Methyl-accepting chemotaxis protein;
FT                   PFAM: HAMP domain; Methyl-accepting chemotaxis protein
FT                   (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08126"
FT                   /db_xref="GOA:E0USU9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E0USU9"
FT                   /protein_id="ADN08126.1"
FT                   /translation="MLASVKSKVILSIVSLSILGLIGMSYYLSSTLHSLSNTTAKKSLK
FT                   MLSESIFQTMTTSMMMGDPEVVETAFKSAKGIDGIADLKITKSKAVIEVYAPNEKYTTD
FT                   PLLSDVLQNKTTKIIESDENGNHIIRMIKPMIAEQRCLQCHYNAQVGYALGAMDLTISL
FT                   DKNDDAITQTNTTLIISLIIGGIAFSIVALIFFGREIFTPLNNLKERIADLVSGDKDLT
FT                   KRLAHKKGNEFGETANEVNHFIQMIQSTVNEVKSLGEQNNEIASEIEISSHVIRKGVQQ
FT                   EREIVSQTSQKSEDIQNILDETIQAATTTQETIIEAEKELAKAHNSLANLNNEVETFVE
FT                   SENELSNELLVLKNDADQVKDVLNVIKEIAEQTNLLALNAAIEAARAGEHGRGFAVVAD
FT                   EVRKLAERTQKSLAEIDISVSTIVQAINDVSDKMTINAQNIEALVNISDDVEQKISLTS
FT                   NAMQTSTQMANKSKNDSEKMSQNIQEIISYIGKIETLSTANGTSVMSIESDLQKLVHVA
FT                   SSLQETIDEFKS"
FT   sig_peptide     complement(86298..86399)
FT                   /locus_tag="Saut_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(86461..87516)
FT                   /locus_tag="Saut_0078"
FT   CDS_pept        complement(86461..87516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0078"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazolephosp
FT                   horibosyltransferase"
FT                   /note="COGs: COG2038 NaMN:DMB phosphoribosyltransferase;
FT                   InterPro IPR003200; KEGG: tdn:Suden_0107 hypothetical
FT                   protein; PFAM: Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; SPTR: Q0W8R5 Putative
FT                   uncharacterized protein; PFAM: Phosphoribosyltransferase;
FT                   TIGRFAM: conserved hypothetical protein TIGR00303"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08127"
FT                   /db_xref="GOA:E0USV0"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:E0USV0"
FT                   /protein_id="ADN08127.1"
FT                   /translation="MQTYNILTNDLDSLPEGKADFLLAASVTKTCEIEGITQAGIPGMI
FT                   PLTPTLDAEFITNEKVFSLGELAETPTGVPTPALITRAVHNLTPFSTIEILNLGLTAEP
FT                   QNCTVHHFDIKPSQAINEGADINAKEVFVKGMEFGKSYELKGNYLILGESTPAGTTTAT
FT                   ASALALGYDCADDFSSSFLHVPNNIKTQTINQALSLINKDMTSFEKLGIVSDNMLIFCA
FT                   GFLLEASKRFQIVLAGGTQMAACLLIADKLREDVLMRVKHDNITLATTQWVTQDKNSNI
FT                   AHILEQLSYKPHAIYATFNFKNTAIPILKKYDEGEAKEGVGAGSCLAYANKNTITNQTL
FT                   LEQIEYLIYSM"
FT   gene            complement(87540..88349)
FT                   /locus_tag="Saut_0079"
FT   CDS_pept        complement(87540..88349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0079"
FT                   /product="formylmethionine deformylase"
FT                   /note="COGs: COG0242 N-formylmethionyl-tRNA deformylase;
FT                   InterPro IPR000181:IPR018195; KEGG: tdn:Suden_0618
FT                   formylmethionine deformylase; PFAM: formylmethionine
FT                   deformylase; SPTR: B2UT38 Peptide deformylase; PFAM:
FT                   Polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08128"
FT                   /db_xref="GOA:E0USV1"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:E0USV1"
FT                   /protein_id="ADN08128.1"
FT                   /translation="MVKEIIKYPTTPSLEFGANVRHFNQELFDLIKDLKDTIEANNLDA
FT                   LSAFQIGSPYAVIVIKKDDGEFLELINPRIIKREGTITPVESTAYFPGLSAKTKRYEKI
FT                   KLMYEDRDANQQFLEAEGDLAVTIQRKLDYVFGSNFRVRLDDNERKLLDSKLEFGTDAI
FT                   TDNGCPTTFKRDKLLHLIKFVFVASLLALITKFFLSEENLSILKSAENYAMLSILILTV
FT                   IYFFYAIHEGKQYKNCSSCQIGNIIGVTGITLAKLLVLFGANYFLLW"
FT   gene            complement(88365..88928)
FT                   /locus_tag="Saut_0080"
FT   CDS_pept        complement(88365..88928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0080"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: tdn:Suden_1996 putative lipoprotein; SPTR:
FT                   A0Y742 Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08129"
FT                   /db_xref="UniProtKB/TrEMBL:E0USV2"
FT                   /protein_id="ADN08129.1"
FT                   /translation="MKKLKITALLFTFILLFSGFWSGNSNADKKQARIKQSKKTLALLY
FT                   KHAPEAKKLLAKSYGYATFSSAGVNLIFVSAEGGTGMAHNNKTGKNIYMNMASAGVGLG
FT                   LGVKDFRIVFLFANKKIFDNFVNKGWEANAQADAAAKASEHGGAVNASVTVAPGMRIYK
FT                   LTKNGLALQATIQGTKYWKDSDLN"
FT   sig_peptide     complement(88848..88928)
FT                   /locus_tag="Saut_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(88939..89148)
FT                   /locus_tag="Saut_0081"
FT   CDS_pept        complement(88939..89148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_0898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08130"
FT                   /db_xref="UniProtKB/TrEMBL:E0USV3"
FT                   /protein_id="ADN08130.1"
FT                   /translation="MQITINDYNLQNLETFTQILKKDESTLINEALELFFQEQQKKLLE
FT                   KNIEDENALTNLDYDEFWNGVDID"
FT   gene            complement(89186..89317)
FT                   /locus_tag="Saut_0082"
FT   CDS_pept        complement(89186..89317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_0492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08131"
FT                   /db_xref="UniProtKB/TrEMBL:E0USV4"
FT                   /protein_id="ADN08131.1"
FT                   /translation="MTVQGTKVIVTRGFVRPLDLDMYPMRYVELDGNSVHEKLIYTA"
FT   gene            89404..89520
FT                   /locus_tag="Saut_0083"
FT   CDS_pept        89404..89520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08132"
FT                   /db_xref="GOA:E0USV5"
FT                   /db_xref="UniProtKB/TrEMBL:E0USV5"
FT                   /protein_id="ADN08132.1"
FT                   /translation="MELRATALFKKFLLDIFDIMFPLFTMILSYISNICDKL"
FT   gene            89560..91254
FT                   /locus_tag="Saut_0084"
FT   CDS_pept        89560..91254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0084"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro
FT                   IPR001633:IPR000160:IPR001789; KEGG: wsu:WS0806
FT                   hypothetical protein; PFAM: EAL domain protein; GGDEF
FT                   domain containing protein; response regulator receiver;
FT                   SMART: EAL domain protein; response regulator receiver;
FT                   GGDEF domain containing protein; SPTR: A0YU61 Putative
FT                   diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains)
FT                   with Response Regulator Receiver modulation; TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain; Response regulator
FT                   receiver domain; GGDEF domain; TIGRFAM: diguanylate cyclase
FT                   (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08133"
FT                   /db_xref="GOA:E0USV6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E0USV6"
FT                   /protein_id="ADN08133.1"
FT                   /translation="MDKVALRSIINSTKTLKVLFVEDDDTSREALTQFMSVFFDVIIEA
FT                   YNGEDGWNKFNDDDFDLVITDINMPKINGLELAAMIREVKPYLPILIVSAHRETSFFLE
FT                   SIKLNVDGYILKPFEMDQFLSVLSKVVHRIDTERELAEYQQNLENMVHEKTKELEHKCL
FT                   HEYYTDLPNEIMLRDDLMAQEYAYMLLLDISHFSVLNKEYGKDFATHIIIRTARILEKH
FT                   IHNDAKLYKVESDRFAILVKSTEVKKVNEYCDQIVSFFDMKNVKVDDTELNVTFNIGVD
FT                   KVRADVSETLINCEYALDKSKELGSRHYEIYSENHAVFVDEKDAIKWLRLTRELIVEEK
FT                   IVPHFQPIMNTKTGEIYKYEALARGFHNNEIIAPYYFIASAEKLGLSTAITRLMINKSF
FT                   AFFEDKTVQFSINLTERDLLEGYLIKFLNEKLKQYNITPNRVTFEILENITVAKSSQRI
FT                   TKKLNKLRGMGFKIAVDDFGIENSNFSRLLEIQLDFIKIDGLFIKDLKTNPRNRTITKA
FT                   IVNLAKTLGIKTVAEYVEDEEIYELIKGCGIDYAQGYHIGKAEEYLI"
FT   gene            complement(91258..92100)
FT                   /locus_tag="Saut_0085"
FT   CDS_pept        complement(91258..92100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0085"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: gem:GM21_3604
FT                   cobalamin biosynthesis protein CobD; PFAM: cobalamin
FT                   biosynthesis protein CbiB; SPTR: Q9KCI3 Cobalamin
FT                   biosynthesis protein cobD; TIGRFAM: cobalamin biosynthesis
FT                   protein CobD; PFAM: CobD/Cbib protein; TIGRFAM: cobalamin
FT                   biosynthesis protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08134"
FT                   /db_xref="GOA:E0USV7"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:E0USV7"
FT                   /protein_id="ADN08134.1"
FT                   /translation="MNNLLIAIFAYLIDKKFGEFSFIKHPVIIIGELISFFEKKFYKNS
FT                   ITRGCLLVVFVLSVISFFSISLYLYLQFFNSFLNILISSFIASMFIAHKMLRDSVADIL
FT                   HVKNKKEALSMLVSRDTQHMSESDIYKAAIETYAENLSDGVIAPLFYLLLFNLPGIIIY
FT                   KAINTMDSMVGYRNEKYENFGKCAAKLDDIANYIPSRLTALLITALAKQKNIFAFYKDG
FT                   KKHESPNAGHPITAMALALHVKLGGDTSYFGKIKHKPYFGKGTDEITKEDVQNALKLL"
FT   gene            complement(92093..93481)
FT                   /locus_tag="Saut_0086"
FT   CDS_pept        complement(92093..93481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0086"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="COGs: COG1492 Cobyric acid synthase; InterPro
FT                   IPR011698:IPR002586:IPR018253:IPR004459; KEGG:
FT                   aci:ACIAD1071 cobyric acid synthase; PFAM: Cobyrinic acid
FT                   ac-diamide synthase; CobB/CobQ domain protein glutamine
FT                   amidotransferase; SPTR: Q43989 Cobyric acid synthase;
FT                   TIGRFAM: cobyric acid synthase CobQ; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08135"
FT                   /db_xref="GOA:E0USV8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E0USV8"
FT                   /protein_id="ADN08135.1"
FT                   /translation="MHSLSIFGTSSDAGKSTLSFALTYLLHHRGLHVAPFKAQNVSNNS
FT                   LVTDIDKGEIAIPQAFAAEAIGLQTTSLFNPILLKSGEANRAHMIINGKSVGDTDVWAY
FT                   YKDMKRLKPIVKEAFVGLQKEYECIVAEGAGSPVELNLMDKDLSNIYVAEEFNTKIVLV
FT                   ADIQRGGVFASIYGVYNLLPNKLRKNVIGVIVNKFQGDISLFDEGIKIIEEDFGIKVLG
FT                   VVPFKPFNLGFEDSASLMGYTQDTSKAIIKVGVIKLPHISNFTDFEPLVVDEEIELNFI
FT                   TSPSQAAVCDLLIVPGSKRVVDDLLWLRKRGFEPILTDKNRHIIVICGGYEMMFERIID
FT                   EQMIESPNKLVKGFGRFKGNVHFQKEKIVQKGCYNQQGIMVAGYEIHNAVAKKRSKKKK
FT                   NLYGTFLHGIFENDAFRYKVFHTINKNYKGYNFKHFKQNAIADFAKHIDLHVDVDFIQK
FT                   RLSE"
FT   gene            complement(93485..93916)
FT                   /locus_tag="Saut_0087"
FT   CDS_pept        complement(93485..93916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_1328 hypothetical protein; PFAM:
FT                   Protein of unknown function, DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08136"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0USV9"
FT                   /protein_id="ADN08136.1"
FT                   /translation="MKIILSLLFIALSLFGRADLDEYAQKMGFERDYYTALAKAKKLHR
FT                   PLMLTVTKAECPWCDRLEDRTLTDTTVHARLKKEAVVVLVYKNFDEGEYPAQMFPAPFS
FT                   PRTFFIDPFTQKTLLIINGYVEKDNFLKKLDALKKLWTK"
FT   sig_peptide     complement(93863..93916)
FT                   /locus_tag="Saut_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(93913..94923)
FT                   /locus_tag="Saut_0088"
FT   CDS_pept        complement(93913..94923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0088"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR004839; KEGG: gme:Gmet_0487 L-threonine O-3-phosphate
FT                   decarboxylase; PFAM: aminotransferase class I and II; SPTR:
FT                   O58115 328aa long hypothetical histidinol-phosphate
FT                   aminotransferase; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08137"
FT                   /db_xref="GOA:E0USW0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E0USW0"
FT                   /protein_id="ADN08137.1"
FT                   /translation="MKHGANIYKYAEQLGCNSDEIIDFSSNINLYRPQTALHVNNAALT
FT                   KYADSSYKELKTVIAKKYALKKSQIALYNGATAAIYALLDSLKQKKVTLYAPLYGEYEK
FT                   AALQSKKDIYKINRIENIDNEVSKNSIIIFVNPSTPEGSFYELEALFTQWKKKKCTIIL
FT                   DESFLEFEKHPSFRNMIEKYKKLYIIQSFSKFYSCAGLRIGAVFSNKKNIKKLKAPLWN
FT                   ISSLDVEFLQERLGDEAFVEKSLELHTIQKQELLNILKNSGLFEQIVHSDANFILAQSS
FT                   KAQEIFTHLLEYKILVRTCQSFDYLDENWLRFALKDTDSHKQLQEAFTTFLGDLP"
FT   gene            complement(94933..95733)
FT                   /locus_tag="Saut_0089"
FT   CDS_pept        complement(94933..95733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0089"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG2334 Putative homoserine kinase type II
FT                   (protein kinase fold); InterPro IPR002575; KEGG:
FT                   csa:Csal_0546 homoserine kinase; PFAM: aminoglycoside
FT                   phosphotransferase; PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08138"
FT                   /db_xref="GOA:E0USW1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E0USW1"
FT                   /protein_id="ADN08138.1"
FT                   /translation="MGVKTPITLQEANLLFPAYDFTQITPTKNGIIDTTYIINNATSAY
FT                   ILKKYERDISKKIQIDKTLLNLLSAHNLNVPKYLQENQEWYLYTKLSGEIPKNVQLYHI
FT                   HALARFMAKFHNISKKITYTAPFLVSYEINKLLASVKKSHYAYYKKLSCLHNLDQKHDG
FT                   FIHGDIFTDNTLFDKEKIAVFDFIDGGLGEFSFDTAIALLSFNPSNKRLHVNAFLRAYN
FT                   QTSKKKISYDELQKQLKIAAKFYALLRISHDKKTKRAQELANFW"
FT   gene            complement(95733..96158)
FT                   /locus_tag="Saut_0090"
FT   CDS_pept        complement(95733..96158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08139"
FT                   /db_xref="UniProtKB/TrEMBL:E0USW2"
FT                   /protein_id="ADN08139.1"
FT                   /translation="MGYETWVQEHATAHKKIIDKLLQQGYDKEQIIDYFDFENMKEKES
FT                   DFCPLYAKNKKCHDMEELNCYLCSCPNFRFNDKGIKKIDNKTQFSYCSIESKDGRQGIY
FT                   GEKIHQDCSGCTVPHHRAYVQKHFDLDWAKIMQVCKV"
FT   gene            complement(96434..97402)
FT                   /locus_tag="Saut_0091"
FT   CDS_pept        complement(96434..97402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0091"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522:IPR001626;
FT                   KEGG: tdn:Suden_0115 transport system permease protein;
FT                   PFAM: transport system permease protein; ABC-3 protein;
FT                   SPTR: A7I6Z3 Transport system permease protein; PFAM: FecCD
FT                   transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08140"
FT                   /db_xref="GOA:E0USW3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E0USW3"
FT                   /protein_id="ADN08140.1"
FT                   /translation="MIRKLIWLLLVGVFLLSAFVGSVDLSPKNIFHVNSLDAKIFFDLR
FT                   LPRVLFTFFAGAVLAISGLLFQTLFRNALMTPYTLGISSGAVLGAGIAIKLSLGTLLFG
FT                   FAAISIFGFLGALFTVFLLLYLAQFLRQSHAESLLLLGIALSLFYSAVLMVIFYLGSAI
FT                   QNDMLIRFTMGSLSVIGWQYPLIISIAAIILFVFIYMYRFELQLLSVSSEQAQLKGVNT
FT                   KKVTLILLIVSSFAIGILVSISGPIGFVGLIVPHIVHKLYPVNISKRIIKTTLFGGLFL
FT                   VLCDTISRTMQTQSELPIGIITAIIGGPFFIYLIMGTSKKP"
FT   sig_peptide     complement(97337..97402)
FT                   /locus_tag="Saut_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(97395..98120)
FT                   /locus_tag="Saut_0092"
FT   CDS_pept        complement(97395..98120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0092"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003395:IPR003439:IPR003593:IPR017871; KEGG:
FT                   tdn:Suden_0116 ABC transporter-related protein; PFAM: ABC
FT                   transporter related; SMC domain protein; SMART: AAA ATPase;
FT                   SPTR: Q8U2D0 Ferric enterobactin transport ATP-binding
FT                   protein homolog; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08141"
FT                   /db_xref="GOA:E0USW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0USW4"
FT                   /protein_id="ADN08141.1"
FT                   /translation="MIKLHNLTCKYENNTVFENISLDINTHLSILGANGSGKSTLAKAI
FT                   CSLIDYEGEIFLEHKNTKALSLNEKAKLIAYIPAKLEIYDPDISVSEFVLLGRFAYKKS
FT                   FFDYSEEDKNITKEMLEFLNIIHLSEHLVSQLSSGEQQLVLIAQALTQQSKIIIFDEPT
FT                   ANLDPHNSKIIASHIKELKARHTVILITHDLHLAASVNTPVLFIKNKSATYYEKDFFND
FT                   ASLGQLYGVAFESLAVKYD"
FT   gene            complement(98113..98931)
FT                   /locus_tag="Saut_0093"
FT   CDS_pept        complement(98113..98931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0093"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG4558 ABC-type hemin transport system
FT                   periplasmic component; InterPro IPR002491; KEGG:
FT                   tdn:Suden_0117 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Q6D1Z3 Vitamin
FT                   B12-binding protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08142"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E0USW5"
FT                   /protein_id="ADN08142.1"
FT                   /translation="MSIKTLLLISLFILNLWANERVVSLSPSITEIIYGLHHGNALVAT
FT                   SSYSLYPKEAQKLPVIGGYQTPNIEKIIALCPTLVVGQTFNQNTLEQLKKFHIKTVMLT
FT                   LKTLPDIQNSIKKLGEILHALKEAKKLNTNITNAITNTPKAKHPHSVMIVYGLKEDLRN
FT                   GIYIAGHGIFFDDIIKVCGNTNAYTSHTTNQPVLNYENVIALNPQQIIILHSHATEPNV
FT                   NIKQALQNWYALPTKAAKNKKISIIDEDYLHIPSQRVALTIKRLCGEMND"
FT   sig_peptide     complement(98878..98931)
FT                   /locus_tag="Saut_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(98943..100865)
FT                   /locus_tag="Saut_0094"
FT   CDS_pept        complement(98943..100865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0094"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG4206 Outer membrane cobalamin receptor
FT                   protein; InterPro IPR012910; KEGG: tdn:Suden_0118
FT                   TonB-dependent receptor; PFAM: TonB-dependent receptor
FT                   plug; SPTR: A2UUF0 TonB-dependent siderophore receptor;
FT                   PFAM: TonB-dependent Receptor Plug Domain; TonB dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08143"
FT                   /db_xref="GOA:E0USW6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E0USW6"
FT                   /protein_id="ADN08143.1"
FT                   /translation="MQKTIQLSLLLGALLSQLHAQEITLTPLEITSTAIKTDELKSTDA
FT                   VEVYTQKDIEAAHVQNVYEFLNQQTSVITMPSYGNPFSQKIDMRGFGIGDGYENIVIKV
FT                   NGRRLNNIDGVPQLLASISPDAIEKIEIIKASGIVEAGDGANAGVINIITKKSNNAQVG
FT                   FYTGSYNTFDGTFNIGHIDDKLSYNLNGEAQKHGGIRYIDSNGNKDENKFSNFGFDVAY
FT                   KALENLELRANGLTSDINVWYASSLTLDQYNEDPTQKSNSFYSGVHQKASSDVIGAGIT
FT                   YDINDALSLDIDYNHEYKTSNYITYSSEYKYSYNSADMALKYIKENFEVIAGGYLFDGD
FT                   RKGATNITGKKNQAAFVKTNIYLGASTLKAGYRYENVSYKYAPTAGITLKQDDSLHGIE
FT                   LGYNYMLNKEQSLFLNYAKSYQAPNIDRFFNYGGTFNQFIKPSKSDSYTLGYNIITKTN
FT                   KLKISAYYINMHNEIYYYADPTFLNSKNTNLDKSHKYGFDVYDKYLLSQEISMVLNYNY
FT                   VKAIIDDEIENGNNYSGNELPGVSNHNVKATLNYLPNKFATLALTEVYRSNAYAANDFN
FT                   NNLTQKQEAYTSTDVSATYAKDNWEVFAKINNLFNQKNGLWIRDNAIYPVNFTTTAIIG
FT                   FKLKY"
FT   sig_peptide     complement(100806..100865)
FT                   /locus_tag="Saut_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(100914..101069)
FT                   /locus_tag="Saut_0095"
FT   CDS_pept        complement(100914..101069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08144"
FT                   /db_xref="UniProtKB/TrEMBL:E0USW7"
FT                   /protein_id="ADN08144.1"
FT                   /translation="MHTPKGFGKNYFTLAAIQAYISLKKIVALSSSVCTLDGKPLKIKI
FT                   NSPPAA"
FT   gene            101114..102442
FT                   /locus_tag="Saut_0096"
FT   CDS_pept        101114..102442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0096"
FT                   /product="protein of unknown function DUF814"
FT                   /note="COGs: COG1293 RNA-binding protein homologous to
FT                   eukaryotic snRNP; InterPro IPR008616:IPR008532; KEGG:
FT                   tdn:Suden_0123 hypothetical protein; PFAM: protein of
FT                   unknown function DUF814; Fibronectin-binding A domain
FT                   protein; SPTR: A1ZZ84 Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF814);
FT                   Fibronectin-binding protein A N-terminus (FbpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08145"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:E0USW8"
FT                   /protein_id="ADN08145.1"
FT                   /translation="MKLSHLKQIINYLQNFTKISAVHRVSDSIIKIVFDKNDALYFNMQ
FT                   RSNSSIFRCQEYPRSKVYNAPFDVILAKRFNRANVLHVKLLNNDKIIRMKTSLSSAYKE
FT                   ETTYLQIEFTGKYTNVIILDEDNVVLEALRHVDLFSSFREVRVGQKLLDVPPAPFVAKE
FT                   YPLEDVEQFLYEVYAKEQNSKLESLKKQKIAFLSKKLKKLKKLYEKLDSKESLEQEAQK
FT                   SEHLGNLVLSNVQNIKPYATEVELDDYDGSKVKVTLSKPYATPFMISEMFFSKSKKAKQ
FT                   RAKHLHIEEKSLHSKIEHLELFINVVKEAKDVAKIEMLFPKRVQNKKIKQNDSIEVFWV
FT                   EGYKVQLGKNEKGNVELLKNARAKDIWLHMKDRPSAHVIITTDKQNLPQNIIMAAAKLC
FT                   VEFSTTSKDRFLVDYTPRREVTIQNGANVLYNKYKTIEVDTRE"
FT   gene            102511..102831
FT                   /locus_tag="Saut_0097"
FT   CDS_pept        102511..102831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08146"
FT                   /db_xref="UniProtKB/TrEMBL:E0USW9"
FT                   /protein_id="ADN08146.1"
FT                   /translation="MSVGAIGNVVLVNQMTPAVTPVQGNQYTRFDLQNVAAQTAVQEKE
FT                   KEIEEVRPTEESHKIDPDREHQREEADEETQNLPKKKNHKIVEEESEEESDKPLHLLDI
FT                   KV"
FT   gene            102872..103627
FT                   /locus_tag="Saut_0098"
FT   CDS_pept        102872..103627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0098"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="COGs: COG4589 CDP-diglyceride
FT                   synthetase/phosphatidate cytidylyltransferase; InterPro
FT                   IPR000374; KEGG: tdn:Suden_0125 phosphatidate
FT                   cytidylyltransferase; PFAM: phosphatidate
FT                   cytidylyltransferase; SPTR: Q9ZML7 Phosphatidate
FT                   cytidylyltransferase; PFAM: Cytidylyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08147"
FT                   /db_xref="GOA:E0USX0"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:E0USX0"
FT                   /protein_id="ADN08147.1"
FT                   /translation="MSILRDSKERIITGIVLLAVVAVVGLIDNFFVMWLFLGAVYLLAF
FT                   KEAVVLFGVEKDNLLPYAAALWLIAAIYPYGDDLFVLAGVAYAGAVAYDKNLKWVDFLP
FT                   FIYPTAGLLFILTMYEEYGVLSLVWLLGVVALTDIGAYFVGKSIGKTKFCETSPNKTLE
FT                   GVIGGVALATFVGAYLGVFVVDFWIALVISFMVALSSIFGDLFESSLKRSAGVKDSGDL
FT                   LPGHGGILDRIDGYLFGAIVMLVLLRGLV"
FT   gene            103628..104701
FT                   /locus_tag="Saut_0099"
FT   CDS_pept        103628..104701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0099"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="COGs: COG0743 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; InterPro IPR013644:IPR013512:IPR003821;
FT                   KEGG: tdn:Suden_0126 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase domain protein; PRIAM:
FT                   1-deoxy-D-xylulose-5-phosphate reductoisomerase; SPTR:
FT                   B9L7Q2 1-deoxy-D-xylulose 5-phosphate reductoisomerase;
FT                   TIGRFAM: 1-deoxy-D-xylulose 5-phosphate reductoisomerase;
FT                   PFAM: 1-deoxy-D-xylulose 5-phosphate reductoisomerase;
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal;
FT                   TIGRFAM: 1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08148"
FT                   /db_xref="GOA:E0USX1"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0USX1"
FT                   /protein_id="ADN08148.1"
FT                   /translation="MVLLGSTGSIGVNALIVAKRFGIEVEVLACGKNIKLLNEQIKEHN
FT                   PKVVVVANKEDVYKVNHSHVYSGEEAILQVIEDSTSKLVVNAFVGFLGLRPTLKAIECD
FT                   KKVALANKESLVACGSFIDTSKIQPIDSEHFGLWYLLQNRPVSKMIITASGGAFRDWDI
FT                   KRLATATLEDTQNHPNWSMGQKITIDSATMVNKMFELLEARWLFGEGEYDAIIETQSLI
FT                   HAMIDFKDGSTTAHLANASMQLPIAYALDEKMDEAILPHVDLLKVGSLEFREINQERYP
FT                   IWQIKEDLLKNPQRGVVINAANEAAIEMFIAKKIGFMDISKTIINAYENFSDALPLHVN
FT                   DIFLIDKEVRKFVGINR"
FT   gene            104698..105675
FT                   /locus_tag="Saut_0100"
FT   CDS_pept        104698..105675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0100"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="COGs: COG0533 Metal-dependent protease with possible
FT                   chaperone activity; InterPro IPR017861:IPR000905:IPR017860;
FT                   KEGG: tdn:Suden_0131 O-sialoglycoprotein endopeptidase;
FT                   PFAM: peptidase M22 glycoprotease; PRIAM:
FT                   O-sialoglycoprotein endopeptidase; SPTR: Q30UB9 Probable
FT                   O-sialoglycoprotein endopeptidase; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM:
FT                   Glycoprotease family; TIGRFAM: metalloendopeptidase,
FT                   putative, glycoprotease family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08149"
FT                   /db_xref="GOA:E0USX2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:E0USX2"
FT                   /protein_id="ADN08149.1"
FT                   /translation="MILSIESSCDDSAISITEIATNKLVFHKKISQELEHSVYGGVVPE
FT                   LAARLHAEALPKILQQCEPYFQDLKAVAVTSSPGLAVTLIEGVTLAKAVSVALDIPLIS
FT                   VNHLIGHIYSLFIEKETTFPLTVLLVSGGHTQVMEVQSLTDIKTIAKSMDDSFGESFDK
FT                   VAKMMGLGYPGGPAIQELAKEGDRKRYDFTVPLLRTPKLAFSYSGLKNAVRLAVEKSQE
FT                   KDYKDIAASFEHIATKHLVHKLKKYFQTHPPKNFAIVGGASANLYLRKQIEELLAPYNA
FT                   KLLLSDLQYCSDNAAMIGRVAVDMYKQGMFSSLEALDITPKSII"
FT   gene            105959..106465
FT                   /locus_tag="Saut_0101"
FT   CDS_pept        105959..106465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0101"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.5"
FT                   /note="COGs: COG2077 Peroxiredoxin; InterPro
FT                   IPR000866:IPR013740:IPR018219; KEGG: tdn:Suden_0132 thiol
FT                   peroxidase; PFAM: Redoxin domain protein; alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; SPTR: O66780 Probable thiol peroxidase; PFAM:
FT                   Redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08150"
FT                   /db_xref="GOA:E0USX3"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0USX3"
FT                   /protein_id="ADN08150.1"
FT                   /translation="MATTKFKGTDVELLGNEVNVGDKAPEVNVVNSEGLGDVKVGGAQG
FT                   EKQLIIVVPSLDTGVCATETRNFNAKASELDGVKTVVVSMDLPFAAGRFCSAEGIDKLT
FT                   VASDFRNKDFANAYGVLLGGSPLAGVTARAIFVIDANGVVTYKEIVPEITEEPQYDAAI
FT                   EAAKK"
FT   gene            106646..107398
FT                   /locus_tag="Saut_0102"
FT   CDS_pept        106646..107398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0133 hypothetical protein; SPTR:
FT                   A0XZB8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08151"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:E0USX4"
FT                   /protein_id="ADN08151.1"
FT                   /translation="MKKILSTIAMSTFLSVSLCADITKVEIGAGAWGQTPSGTANYDRG
FT                   LGITGTNTFDETKDTSPYVWMLIKHPIPVVPNIRLEYTSIHATGKASGSWNGLNAPANT
FT                   KSVLDIKEYDIIPYYNLVDNTFWTTLDLGLDIKVLDLDYKVEPNGLFTGYEDTYTAPIP
FT                   LVYARVRVEIPTTNIGLEGDAKYVTTGSSTIYDARVKVDYTFNISPVVQPALEIGYRKQ
FT                   KIKIDENNLDVKTDMDFSGFFAGLMLRF"
FT   sig_peptide     106646..106705
FT                   /locus_tag="Saut_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(107399..108199)
FT                   /locus_tag="Saut_0103"
FT   CDS_pept        complement(107399..108199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0103"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="COGs: COG0812 UDP-N-acetylmuramate dehydrogenase;
FT                   InterPro IPR011601:IPR003170; KEGG: tdn:Suden_2006
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; PRIAM: UDP-N-acetylmuramate dehydrogenase; SPTR:
FT                   Q7VJ12 UDP-N-acetylenolpyruvoylglucosamine reductase;
FT                   TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine reductase;
FT                   PFAM: UDP-N-acetylenolpyruvoylglucosamine reductase,
FT                   C-terminal domain; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08152"
FT                   /db_xref="GOA:E0USX5"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:E0USX5"
FT                   /protein_id="ADN08152.1"
FT                   /translation="MQFKTIDFSKYSSFKIGGIVDVALLQNNFENINDYYLIGSCNNTL
FT                   IGPNPPKLMMLDKQYDYIKIENDLLKIGGATPSGKIASFCKKHNITNFEFVSHLPGKLG
FT                   GLVYMNAGLKEFEIFNHLEYITTPNGLKRKKEINFGYRFTNIHEPILEAAFELEYGFSR
FT                   EKVAMFKTMRVNQPSTPSAGSCFKNPEGDYAGRLIEAVGLKGKKVGNMEFSTEHANFLV
FT                   NHGGGTFEDAVYLINEAQKRVFEEFGIKLELEIIILDTQTKTLF"
FT   gene            complement(108199..108465)
FT                   /locus_tag="Saut_0104"
FT   CDS_pept        complement(108199..108465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0104"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="COGs: COG1987 Flagellar biosynthesis pathway
FT                   component FliQ; InterPro IPR002191:IPR006305; KEGG:
FT                   tdn:Suden_2005 flagellar biosynthesis protein FliQ; PFAM:
FT                   export protein FliQ family 3; SPTR: P0A0S3 Flagellar
FT                   biosynthetic protein fliQ; TIGRFAM: flagellar biosynthetic
FT                   protein FliQ; PFAM: Bacterial export proteins, family 3;
FT                   TIGRFAM: flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08153"
FT                   /db_xref="GOA:E0USX6"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:E0USX6"
FT                   /protein_id="ADN08153.1"
FT                   /translation="MEAKLIGLGVQTFQIALYLALPALLTGMLAGLAISIFQATTQINE
FT                   MTLSFIPKIIGVVIVIVLTMPWMLNEMTDFSIGVFNMIPTFVE"
FT   gene            complement(108465..109328)
FT                   /locus_tag="Saut_0105"
FT   CDS_pept        complement(108465..109328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0105"
FT                   /product="protein of unknown function DUF191"
FT                   /note="COGs: COG2107 periplasmic solute-binding protein;
FT                   InterPro IPR003794; KEGG: tdn:Suden_2004 hypothetical
FT                   protein; PFAM: protein of unknown function DUF191; SPTR:
FT                   A8AAV5 Putative uncharacterized protein; PFAM: Putative
FT                   periplasminc binding protein (DUF178)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08154"
FT                   /db_xref="GOA:E0USX7"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:E0USX7"
FT                   /protein_id="ADN08154.1"
FT                   /translation="MKKTLIAHSPDADDIFMYYAIKFGWVDMKDTHFDNIAKDIQTLNE
FT                   DALNGVYDIVAISFALYPHIKEEYAPLRTAVSFGEGYGPKVIKRKGQKLKRNFKVALSG
FT                   EHTTNAMLFRIAYPDARITYMNFLEIEDAVKEGKVDAGVLIHESILTFADELEVEREMW
FT                   DIWQELAGKELPLPLGGMAIRRSLPLNRAIDYENTLTKAVQVARDHKERLSQMLLERDL
FT                   VRIDGATLEKYLELYANDDSITLSPVQYEAINKLFEIGYEHGFYDRPVNVHDYLIPTQY
FT                   TELRES"
FT   gene            109431..109913
FT                   /locus_tag="Saut_0106"
FT   CDS_pept        109431..109913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_0798 hypothetical protein; SPTR:
FT                   A0YN66 Signal Transduction Histidine Kinase (STHK), LytS"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08155"
FT                   /db_xref="GOA:E0USX8"
FT                   /db_xref="UniProtKB/TrEMBL:E0USX8"
FT                   /protein_id="ADN08155.1"
FT                   /translation="MSKKVLVKVYDTYDEAAEVVNKLLENGVLKKYISVIAKGEQEEKN
FT                   EFEYNKNSENMIFWGEQGAFWGGLWGLLSGGILFWTPGVGPIVATGRILTAIAGMAGAA
FT                   VMFGATGAMTAWLIDLGIEKSLAKEYGDMIQDNKILVIVHGDEDAIEIAKKTLGEE"
FT   gene            110074..111111
FT                   /locus_tag="Saut_0107"
FT   CDS_pept        110074..111111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0107"
FT                   /product="RecA protein"
FT                   /note="COGs: COG0468 RecA/RadA recombinase; InterPro
FT                   IPR001553:IPR013765:IPR003593:IPR006162:IPR
FT                   020584:IPR020588:IPR020587; KEGG: tdn:Suden_2002
FT                   recombinase A; PFAM: RecA domain protein; SMART: AAA
FT                   ATPase; SPTR: Q30P05 Protein recA; TIGRFAM: recA protein;
FT                   PFAM: recA bacterial DNA recombination protein; TIGRFAM:
FT                   protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08156"
FT                   /db_xref="GOA:E0USX9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0USX9"
FT                   /protein_id="ADN08156.1"
FT                   /translation="MDANKQKSLDLAMKQIDKAFGKGALMRLGDKDIVPIQSISTGSLG
FT                   LDLALGIGGVPQGRVVEIYGPESSGKTTLALQITAECQKNGGVCAFIDAEHALDVVYAK
FT                   NLGVDIDNLLVSQPDYGEQALDIVETIARSGAIDLIVIDSVAALTPKVELEGEMNDQQV
FT                   GVQARLMSKALRKLTGVLSKMNCTVIFINQIRMKIGMMGYGSPETTTGGNALKFYASVR
FT                   IDVRRIASLKQGESQIGNRVKAKVIKNKVAPPFRQAEFDIMFGEGISKEGELVDYGVKL
FT                   DIVDKSGAWFSYGETKLGQGRENVKAKFKDEPELASEIEEKIKQAMGMSSLMTMDTSEI
FT                   AEADA"
FT   gene            111152..112417
FT                   /locus_tag="Saut_0108"
FT   CDS_pept        111152..112417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0108"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COGs: COG0148 Enolase; InterPro IPR000941; KEGG:
FT                   tdn:Suden_2001 phosphopyruvate hydratase; PFAM: enolase;
FT                   PRIAM: Phosphopyruvate hydratase; SPTR: Q30P06 Enolase;
FT                   TIGRFAM: enolase; PFAM: Enolase, N-terminal domain;
FT                   Enolase, C-terminal TIM barrel domain; TIGRFAM:
FT                   phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08157"
FT                   /db_xref="GOA:E0USY0"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E0USY0"
FT                   /protein_id="ADN08157.1"
FT                   /translation="MFIDDISAIEVMDSRGNPTVKATVRLSDGTTAGAIVPSGASTGKR
FT                   EALELRDGGERYMGKGVLQAVENVNSQISDVLIGMSPFNQAVIDATMKELDGTQNYGNL
FT                   GANAVLGVSMAVARAAAQSLGIPLYRYLGGANAMVMSTPMLNIINGGSHADNNVDFQEY
FT                   MIMPVGFEDFATSLRAASEVYHNLKSILSAKGHSTSLGDEGGFAPNLSSNEEPIQVIME
FT                   AIEKAGYVPGEQIGIALDVAASEIVTDGGYRLESEGRTLGSEELVAYYENLCAKYPIVS
FT                   IEDGLSEDDWDGFKLMTEKLGDKIQIVGDDLFVTNASILNEGIERGIANSILIKPNQIG
FT                   SVSETMLTVRLAQRNGYTCVMSHRSGESEDAFIADFAVALNCGQIKTGSTARGERTAKY
FT                   NRLLEIENEIVYSEYLGSALFT"
FT   gene            112425..112703
FT                   /locus_tag="Saut_0109"
FT   CDS_pept        112425..112703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_2000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08158"
FT                   /db_xref="GOA:E0USY1"
FT                   /db_xref="UniProtKB/TrEMBL:E0USY1"
FT                   /protein_id="ADN08158.1"
FT                   /translation="MNKEELFEEIDTSQTITQKYLGLSLKKFFLLFALVIALGIYLGVL
FT                   LYGTNSLQVLFGLQDYENYLQEEVVHLKKENAQLQREYFELKEISAQ"
FT   gene            112769..113419
FT                   /locus_tag="Saut_0110"
FT   CDS_pept        112769..113419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08159"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT56"
FT                   /protein_id="ADN08159.1"
FT                   /translation="MIRVLLLICLCSLLLQARENPFFPIDTAQDIPFTSNQANTLPMLK
FT                   RATATLPSTARTIESVTVEYKNLDGSIAHKKVLIQNTIDWHLPIFISQNYNESNGETVV
FT                   KKQVIKQAKKVNYKKIASLKFISFYAKKNKLKILTKDKILRNFLLVKPHRIVCDFKRDT
FT                   DIGSFIKSINEKSLFTKIRVGTHKDYYRVVIELDGYYSYKLDHIPGGYMIKLL"
FT   sig_peptide     112769..112819
FT                   /locus_tag="Saut_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            113435..114178
FT                   /locus_tag="Saut_0111"
FT   CDS_pept        113435..114178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0111"
FT                   /product="protein of unknown function DUF481"
FT                   /note="InterPro IPR007433; KEGG: sun:SUN_1914 hypothetical
FT                   protein; PFAM: protein of unknown function DUF481; SPTR:
FT                   A3J774 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function, DUF481"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08160"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT57"
FT                   /protein_id="ADN08160.1"
FT                   /translation="MKFLILFIMSIMSAQAVITIAPVDIGAQPGLSGSVKGSFVTKRGN
FT                   TDSDEYSAGARVQYDNNNTYIIWGDIAFSYAKASGQTNTNKTYAHIRYIHTFYKKDLNW
FT                   EAFVQSQTDKFTKIQKRLLAGIGLRYHAAMQSYGNIYLGFGGFAEHIDYTTNIDPSEDN
FT                   VRLNMYIAYKNKFTKSVKFSYIGYYQPRVDIFSDYILSNSAELKVKIYKQLSINFELTY
FT                   NQDTKPAIGVQKYDFVQKTSFVYDF"
FT   sig_peptide     113435..113482
FT                   /locus_tag="Saut_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            114197..115525
FT                   /locus_tag="Saut_0112"
FT   CDS_pept        114197..115525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0112"
FT                   /product="magnesium transporter"
FT                   /note="COGs: COG2239 Mg/Co/Ni transporter MgtE (contains
FT                   CBS domain); InterPro
FT                   IPR006668:IPR000644:IPR006667:IPR006669; KEGG:
FT                   tdn:Suden_1994 divalent cation transporter; PFAM: MgtE
FT                   integral membrane region; MgtE intracellular region; CBS
FT                   domain containing protein; SPTR: A3JK81 Magnesium
FT                   transporter; TIGRFAM: magnesium transporter; PFAM: MgtE
FT                   intracellular N domain; Divalent cation transporter; CBS
FT                   domain; TIGRFAM: Mg2+ transporter (mgtE)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08161"
FT                   /db_xref="GOA:E0UT58"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT58"
FT                   /protein_id="ADN08161.1"
FT                   /translation="MKELSKYLKSHNASEIHPAEIAKILKGLNDKDFSKAIKLVPKDLV
FT                   GDVALALPDRYFDDVVENLSVDELSHAVSELESDDQLEFMQELEDVDENVASKVFNTLD
FT                   AEDKKEISKLKKYDEDQAGAYMQLEVFTAREDEIVQDVIKRFARLRKENELENVQNLFI
FT                   VDKNNRLLYTVGLDDLLIFDFSKTIKENIEQSEDSFEPKIATDTEDIKEVVNYFKEYDL
FT                   SVMPVVNEKGILVGRITSDDIYDIINEHATEQMYNLAGVDDEAEEDEDILKASKKRATW
FT                   LGINLLTAIAASLVIGLFQDTINLMVALAVLMPIVASMGGNAGTQSLTVVVRQLALGEI
FT                   SHTDAFRTIKKEVVISLMNGLLFAVVMAIIAWMWFHIPLLGVVIGLSMIINLLMAGFFG
FT                   AMIPLMLKTLGIDPAIGSTVILTTITDIVGFFSFLALAKYILL"
FT   gene            115540..116583
FT                   /locus_tag="Saut_0113"
FT   CDS_pept        115540..116583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0113"
FT                   /product="protein of unknown function DUF21"
FT                   /note="COGs: COG1253 Hemolysins and related protein
FT                   containing CBS domains; InterPro IPR000644:IPR002550; KEGG:
FT                   sun:SUN_0712 hypothetical protein; PFAM: protein of unknown
FT                   function DUF21; CBS domain containing protein; SPTR: B3T6V6
FT                   Putative uncharacterized protein; PFAM: CBS domain; Domain
FT                   of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08162"
FT                   /db_xref="GOA:E0UT59"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT59"
FT                   /protein_id="ADN08162.1"
FT                   /translation="MELLILFFVLSVGISFLCSVLESVLLSINMSYVAVLEKEKPSVGK
FT                   LIRHHKENINKSIAAVLILNTIANTLGAAAVGAQASKIFGNDAVVYVSVVLTFAILFIS
FT                   EIIPKTIGAIYWKQLAPISAYFIQAFIWLTYPIILSTLAVTNRISKGKTDAHSLTKEEL
FT                   LESMLMSEDEGIIDEKESDVIENILNLDNIKASEVLTPRSVVFALDESMKIKDVIKSQP
FT                   AIFKFSRIPIYRGSLEDVTGLVLTKKIFKQALEDDSVPLSAIKKEMFSINENIPVSKAL
FT                   DLLISKKDHMFLVTDNYDQTEGIITLEDCVETILGVEIMDESDTTEDMRELAKRKMKLR
FT                   RKAKESE"
FT   gene            complement(116597..117778)
FT                   /locus_tag="Saut_0114"
FT   CDS_pept        complement(116597..117778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0114"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1252 NADH dehydrogenase FAD-containing
FT                   subunit; InterPro IPR013027:IPR000103:IPR001327:IPR018253;
FT                   KEGG: sun:SUN_0073 sulfide-quinone reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: A3EQ84 Uncharacterized
FT                   NAD(FAD)-dependent dehydrogenase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08163"
FT                   /db_xref="GOA:E0UT60"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT60"
FT                   /protein_id="ADN08163.1"
FT                   /translation="MKKVLILGAGFAGVDAASYLRKMDYDVTLVSNRDYFYIYPTSIWI
FT                   PTHENEFKDVCVDLKELQRAHGFKLIIDDVAAISQAENSVTLAGGEIINDYDYLIIAMG
FT                   ASKMKAPGIENTLSICGAPEQSLKIRDALDALVEKGSGKICMGFGGNPKDSSAVRGGPG
FT                   FELLFNVHNMLKDKGIRDNYELTFFAPMAEPGKRMGPQALKMMDTMFGKLGIKQHFGKK
FT                   IKQFEKDGIVFEDTSKLESDFTMFIPAGDGHDVIKKSDLSTNDAGFIKTDDYSCVLNDD
FT                   GSMSNIYAIGDVAALEGYDWRAKQGHVAEVMAKNTAHNIEQRDNGGSDFKGYHEHLNIL
FT                   CVMDTGNGAAFVYRDEKRAFMLPLPVIGHWLKKGWGLYCRNSKLGKIPRIPGM"
FT   sig_peptide     complement(117731..117778)
FT                   /locus_tag="Saut_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(117890..118762)
FT                   /locus_tag="Saut_0115"
FT   CDS_pept        complement(117890..118762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0115"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: cju:C8J_1443 integral
FT                   membrane protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: A3IBS3 Putative uncharacterized
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08164"
FT                   /db_xref="GOA:E0UT61"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT61"
FT                   /protein_id="ADN08164.1"
FT                   /translation="MNLKNDDKHYEYLLLFAMLLWGGGWTALKILTLTMPMDVVIFWRF
FT                   FLMSLSFLPILYFFKTPITLTRGSLKYIALSSLLNIAFMVFAFLGIKYGLAGAGSVIIT
FT                   TFSPIMTFLLVAIFFKSRLSTRQYLGLLLGLIGGYILLQLNNFSLFLNGSNIYFLLCAI
FT                   IWAGVTLLSQYSQKHIHPVHYSFFISVIATFFSFLYAYNSDLGAVFTQGAKFWIALIYL
FT                   AVLGQTVATTIFFIASGKLGSQKTSSFMFLVPFFALICAWLILDEPLQPHIIVGGLISM
FT                   LAVYFINKK"
FT   gene            complement(118740..119951)
FT                   /locus_tag="Saut_0116"
FT   CDS_pept        complement(118740..119951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0116"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="COGs: COG1301 Na+/H+-dicarboxylate symporter;
FT                   InterPro IPR001991; KEGG: tdn:Suden_1993
FT                   sodium:dicarboxylate symporter; PFAM: sodium:dicarboxylate
FT                   symporter; SPTR: A3HVG1 Proton/glutamate symporter; PFAM:
FT                   Sodium:dicarboxylate symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08165"
FT                   /db_xref="GOA:E0UT62"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT62"
FT                   /protein_id="ADN08165.1"
FT                   /translation="MIRKIKKYATTNTLVVFGIILGLVFGILFPELALKQKMIGTAFVY
FT                   FLKMLVVPLVFASIFVAILGLGSIEHLKRMGLKTIGLYILTTALAVVTAIIAMNIFHIG
FT                   EHVSNVGLEYTKAATLAPFSFESMLLSFIPTNIFNALSEGKMMQIIVFAILFGVASLYL
FT                   IPKQKEVLGSFFTAVSEAMLKMAEWVILLTPIGVFSLISYVIAEQGIDVVFGLYKYVLL
FT                   VVGVILFHALITLPGVLRFFTKVNPYSYLSDVREAPIMAFSTASSAATLPVSMRVVEEI
FT                   GEVDKKTASFVLPLGATVSMDGTAAYLSIAVLYIANLAGVALSLGDQLLLGITVVALSV
FT                   GVAALPSASLVMMVIILNQLGLPIEYMALIVAVDRILDMCRTSLNVTSDLIVTKIVDEF
FT                   EKRR"
FT   sig_peptide     complement(119853..119951)
FT                   /locus_tag="Saut_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(119963..121762)
FT                   /locus_tag="Saut_0117"
FT   CDS_pept        complement(119963..121762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0117"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="COGs: COG0367 Asparagine synthase
FT                   (glutamine-hydrolyzing); InterPro
FT                   IPR001962:IPR000583:IPR006426; KEGG: tdn:Suden_0163
FT                   asparagine synthase, glutamine-hydrolyzing; PFAM:
FT                   asparagine synthase; glutamine amidotransferase class-II;
FT                   PRIAM: Asparagine synthase (glutamine-hydrolyzing); SPTR:
FT                   A3I8W6 Asparagine synthetase; TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: Asparagine synthase;
FT                   TIGRFAM: asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08166"
FT                   /db_xref="GOA:E0UT63"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT63"
FT                   /protein_id="ADN08166.1"
FT                   /translation="MCAIFGIIGEYNDNQAKSALSLLSHRGPDYCGITQKKNLFFAHQR
FT                   LSILDTHHRSHQPLKHKNILLSFNGEIYNFQELKSELYFDFQTQSDSEVIIAAYLKWGI
FT                   DFVKHLRGMFAIALMDGDTLYLFRDRLGKKPLFYLEGSSFVFASEIKALKPFLSTCKLD
FT                   NDALLSYLSFLAPTPPHTFYEGIKKLAAGEYLAYKEGQVTCKRYFDLLDAPSVLITTKE
FT                   EALKKIETLLEESIELRLSADVPVASLLSGGIDSATINYFAKLKAMPLQTYTLGYKEFA
FT                   KYDERENARQSAEFLGLSNTQIEIDENDFIRASDKVMDTLDEPLNDPAAVPLYLLFEQI
FT                   KKDGYKVVMSGEGADELFLGYRQYFEYLDIQGAATLAHKNWLKKYFRANFSMNREWEWY
FT                   KRIFDDTLLFRSSGEKFTDLQKNQLMRRNVKDNESLKYLKSYRQRFEGSQHKDESIWYS
FT                   YIDLNIFQAEHFLTKLDRVSMAHSIESRTPFLDHKLASALFSIDPKLRYGDGITKSLLK
FT                   EVMRNKLDTKILTRKKKGFSNPYMEYLINSKKINLIQEVNTQTGMFHKKKLDEYINTAS
FT                   RGSFKQHVWGLYVLSYWIKKNLL"
FT   gene            complement(121762..122343)
FT                   /locus_tag="Saut_0118"
FT   CDS_pept        complement(121762..122343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0164 hypothetical protein; SPTR:
FT                   A3XTH6 Putative cyclopropane fatty acid synthase; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08167"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT64"
FT                   /protein_id="ADN08167.1"
FT                   /translation="MPRIDSEKFYLASLKKHGATSRGLNWSSDVHQSIRFEKIAALLGD
FT                   ALNESVIGDAGCGFGDFYHYLQANNLHVKKYLGIDSLKEMCEIATQKTECEIIHADIIK
FT                   EALPMADYYICSGALNILTPFETQLFIRSCYQSSTQGFVFNALYGDKKSDIYNYINMDT
FT                   IQSLAKSLHVKSVSFIEGYIEHDITVGFFK"
FT   gene            122394..123251
FT                   /locus_tag="Saut_0119"
FT   CDS_pept        122394..123251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0119"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="COGs: COG1893 Ketopantoate reductase; InterPro
FT                   IPR011128:IPR004455:IPR013332:IPR013752:IPR 003710; KEGG:
FT                   nam:NAMH_1158 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein; NADP
FT                   oxidoreductase coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; PRIAM:
FT                   2-dehydropantoate 2-reductase; SPTR: O31717 Uncharacterized
FT                   oxidoreductase ykpB; TIGRFAM: 2-dehydropantoate
FT                   2-reductase; PFAM: Ketopantoate reductase PanE/ApbA;
FT                   Ketopantoate reductase PanE/ApbA C terminal; TIGRFAM:
FT                   2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08168"
FT                   /db_xref="GOA:E0UT65"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT65"
FT                   /protein_id="ADN08168.1"
FT                   /translation="MKIAIVGLGGVGGYLAASFTKSGLDVVGFARGAHLKAIKKTGIRI
FT                   IEDETEWSTPLHVKNLDEAEGYFDVVMFCTKSYDLPDACKALQNHIDANSILLSFSNGV
FT                   NNGDMLREFCDAKVLDACIYILAHIESPGVIRKKGKVFAALFGPQSEAAQTVAELFEKV
FT                   SLRYKIPQNIKEALYKKYIFIAAFATLTAYYNTSIGAVYEKHYDEAKKLLTEIAEFAKE
FT                   TQDIDIFDEVQKSLDTAAKVPYDSSTSMYLDFKNGKKTELENLSGYVQKPFMQKLYNEL
FT                   KKRA"
FT   gene            123265..123792
FT                   /locus_tag="Saut_0120"
FT   CDS_pept        123265..123792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0120"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COGs: COG0225 Peptide methionine sulfoxide
FT                   reductase; InterPro IPR002569; KEGG: pnu:Pnuc_0662 peptide
FT                   methionine sulfoxide reductase; PFAM: Methionine sulfoxide
FT                   reductase A; PRIAM: Peptide-methionine (S)-S-oxide
FT                   reductase; SPTR: A4SWL6 Peptide methionine sulfoxide
FT                   reductase msrA; TIGRFAM: peptide methionine sulfoxide
FT                   reductase; PFAM: Peptide methionine sulfoxide reductase;
FT                   TIGRFAM: methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08169"
FT                   /db_xref="GOA:E0UT66"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT66"
FT                   /protein_id="ADN08169.1"
FT                   /translation="MKKERIVLGGGCFWCIEAVYRNVKGVISAVSGYAGGARANPSYEN
FT                   VCSGATGHAEIVDITYDVDVITLSEILDIFFEIHNPTTLNAQGADKGTQYRSVIYYADE
FT                   EQKKVIEDSIAKHQQKFSDKIVTEVSPLPEVYPAEHYHQNYYNLNSSQGYCQVVIAPKL
FT                   QKFMTKFPDKLA"
FT   gene            123832..124797
FT                   /locus_tag="Saut_0121"
FT   CDS_pept        123832..124797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0121"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR000759:IPR013027:IPR000103:IPR001327; KEGG:
FT                   tdn:Suden_0165 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: A1ZRW5
FT                   Thioredoxin reductase; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08170"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT67"
FT                   /protein_id="ADN08170.1"
FT                   /translation="MEKIYNLAIVGAGPAGLAAAVESYLQDIDDIVVLEKNVNHNSTIR
FT                   KYYKDNKRVDLEWKGQKVELNGRIVFVDGTKESTLDLFDELIENHNIELKIQVEVTSIE
FT                   KEDDYFNIHMAGSTIMAKRVVVTIGRMGKPNKPSYKIPPSIRKKVNYTLDECQDGEKVL
FT                   IVGGGDSAVEYAVDLVGRNEVAICYRRETFRRANPLNQRNIANAIAHNEVRPILGVNID
FT                   GLEDDNGRVKVLFTEIEPETFDRVIYAIGGTTPSAFLASSGIEEEDGKPKYDEHYETNI
FT                   KGLFVAGDITQESGGSIALGLNQGYEIACYIKGGCKNCKD"
FT   sig_peptide     123832..123891
FT                   /locus_tag="Saut_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(124794..125153)
FT                   /locus_tag="Saut_0122"
FT   CDS_pept        complement(124794..125153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nam:NAMH_1747 hypothetical protein; PFAM:
FT                   AMMECR1"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08171"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT68"
FT                   /protein_id="ADN08171.1"
FT                   /translation="MSRSVLLQLSRDSIQEVLQAQNSIDKKSLLGEHPLLHQVVKTTTN
FT                   LYLNDELRGSYESDKNLSLADAVIIGAKKAAFEDPAFVPLSTSEYLHCEIELILDTPEG
FT                   IISEKDPAILSETKT"
FT   gene            complement(125256..126425)
FT                   /locus_tag="Saut_0123"
FT   CDS_pept        complement(125256..126425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0123"
FT                   /product="transporter, CPA2 family (2.A.37)"
FT                   /note="COGs: COG0475 Kef-type K+ transport systems membrane
FT                   components; InterPro IPR006153; KEGG: tdn:Suden_0168
FT                   sodium/hydrogen exchanger; PFAM: sodium/hydrogen exchanger;
FT                   SPTR: O30022 Na+/H+ antiporter (NapA-1); PFAM:
FT                   Sodium/hydrogen exchanger family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08172"
FT                   /db_xref="GOA:E0UT69"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT69"
FT                   /protein_id="ADN08172.1"
FT                   /translation="MSDNTVLIITISLIIIFSPFIARFLRLPTTPIEIILGSLLGYVGF
FT                   LHDEHLFDLVAEFGFLYLMFIAGTEINLKNVLKTPSSIMKKAVVYLVLLYAFSIAFSMQ
FT                   FDLGKIFMVLLPLISVGLVASLSKEYGKTPWLTLSMTVGGIGEVVSIVILTITSAALKS
FT                   GFGLGLFQTIMALLAFLLFMFILFRSMQLIFWWFPKVAIALMPHNDNKEQDIRLSMGIF
FT                   FLLIGAMLFLHLELAFGAFLAGIFIPTFFEHKHQLPEKLASFGFGFLIPIFFIHIGSSF
FT                   NLDALLINGLIKEAVIITVVMILMRLFASLVFVKELGFVDTILFGLSHSMPLTLLIAMA
FT                   TLAYTANSIDKFHYYAFILAALFQVISVMIVIKLVNIYKSRKSLNSQKL"
FT   gene            complement(126452..127294)
FT                   /locus_tag="Saut_0124"
FT   CDS_pept        complement(126452..127294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0124"
FT                   /product="Biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="COGs: COG0502 Biotin synthase; InterPro
FT                   IPR007197:IPR010722:IPR006638; KEGG: tdn:Suden_0169 biotin
FT                   synthase; PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; PRIAM: Biotin synthase; SMART:
FT                   Elongator protein 3/MiaB/NifB; SPTR: Q30U81 Biotin
FT                   synthase; PFAM: Radical SAM superfamily; Biotin and Thiamin
FT                   Synthesis associated domain; TIGRFAM: biotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08173"
FT                   /db_xref="GOA:E0UT70"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT70"
FT                   /protein_id="ADN08173.1"
FT                   /translation="MSEKIFLCSICNINSGTCKEDCKFCSQSVRYKADIERYKQKPMDI
FT                   ICQEAVQARDNGALGFCLVTADKGLTDKTLAFVCNVAKEVQKVAPQLRLIACNGTASVE
FT                   QLLVLKEAGIKAYNHNLETSEAFYPQICTTHPWSERYETCQNVNEAGLVLISGGIFGLG
FT                   ESQEDRISMLSSLKSLNPTSVPINFYHHNVALELEPNPLTTDEALALIRLTKKTLCDAD
FT                   RIMVAGGRELMFGSRQAEIFENGTNSIVIGNYLTTKGRVMSQDLEMLKALGLDVAKRV"
FT   gene            complement(127291..127815)
FT                   /locus_tag="Saut_0125"
FT   CDS_pept        complement(127291..127815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0125"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro
FT                   IPR004843:IPR000979; KEGG: tdn:Suden_0170 hypothetical
FT                   protein; PFAM: metallophosphoesterase; SPTR: A6US05
FT                   Phosphodiesterase, MJ0936 family; TIGRFAM:
FT                   phosphodiesterase, MJ0936 family; PFAM: Calcineurin-like
FT                   phosphoesterase; TIGRFAM: phosphoesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08174"
FT                   /db_xref="GOA:E0UT71"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT71"
FT                   /protein_id="ADN08174.1"
FT                   /translation="MKIGILSDTHKKVKKAKAALDMLLQNGAEFIIHAGDIVEKEILDL
FT                   LKECEKKYIAVYGNNDAHLVEYHNKYHLVQEPYYFKLANTKFKLMHLPFYMSNDAQVII
FT                   FGHTHKFEVEFIKGVLFLNPGEVCARNKPTSECAMLEVLEDEFIVNYYTQNKKEESYSV
FT                   NKTFSYKRQKQ"
FT   gene            complement(127812..130046)
FT                   /locus_tag="Saut_0126"
FT   CDS_pept        complement(127812..130046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0126"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="COGs: COG0550 Topoisomerase IA; InterPro
FT                   IPR000380:IPR013497:IPR006171:IPR013498:IPR
FT                   003601:IPR006154:IPR003602:IPR005733; KEGG: tdn:Suden_0171
FT                   DNA topoisomerase I; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase type IA zn finger domain protein; PRIAM: DNA
FT                   topoisomerase; SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain protein;
FT                   SPTR: P55991 DNA topoisomerase 1; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: Toprim domain; Topoisomerase DNA
FT                   binding C4 zinc finger; DNA topoisomerase; TIGRFAM: DNA
FT                   topoisomerase I, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08175"
FT                   /db_xref="GOA:E0UT72"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT72"
FT                   /protein_id="ADN08175.1"
FT                   /translation="MNLIIVESPAKAKTIKNFLGKDYDVIASKGHIRDLPKSRFGITLD
FT                   EETHELVPKYSVAKENAPTVKEIKEKAKKADTIYIATDEDREGEAIGWHIAHAIKKDPL
FT                   ELPRIVFHEITKTAIKHALESARKIDMDMVNAQQARRLLDRIVGYKLSPLLASKIQKGL
FT                   SGGRVQSSTLKLVVDREREIKAFVPQEYWSIDTVFKTNIDANLIKHKDKKLSKLSIENK
FT                   EQAETITQSVKNDNFTIAKIETKQRKSSTPPPFMTSTLQQTASSKLGFTPKKTMMIAQT
FT                   LYEGVKTPDGTSGVITYMRTDSLNLAQEAVGAVRGIIENRYGKKYLPKEPKIYTKKAKG
FT                   AQEAHEAIRPTMLQFTPEVAQSFLKADEIKLYRLIYERFMACQMEDAIFEQQSIIFKGN
FT                   ENEFRASGRKLIFDGFYAVTGTEDKDKLLPTLKEGEKAEIQSVKPEQHFTEPPSRYSEA
FT                   SLIKKLEAEGVGRPSTYAPTIATLSNRTYVTIEKKQIIPTEIAFTVTEILEKNFPNIVD
FT                   INFTAEMEEELDEIAEGKVDWQKLLLEFYEKFMKQIEEGKENIVSLKLAKPLGRTCPKC
FT                   GEHELLLRSGRFGNFIACSGFPKCKYTEQCDEEGNAVEKKETTADEKCDKCGADMIVKN
FT                   GRNGEFLACSNYPECKNTKSINVEEKVSETPCPDCGGKISLKNSRRGPFWGCENYPDCK
FT                   FISKFEPTTIKCKEEGCSGVLAPRTYRNKEVYECVKCKARTPKEEIDTKK"
FT   gene            complement(130124..130468)
FT                   /locus_tag="Saut_0127"
FT   CDS_pept        complement(130124..130468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0127"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="COGs: COG2337 Growth inhibitor; InterPro IPR003477;
FT                   KEGG: nis:NIS_1763 PemK family transcriptional regulator;
FT                   PFAM: PemK family protein; SPTR: A3HZY0 Putative
FT                   uncharacterized protein; PFAM: PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08176"
FT                   /db_xref="GOA:E0UT73"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT73"
FT                   /protein_id="ADN08176.1"
FT                   /translation="MFKRGNIYLAKLYPSKGHKVCKTRPVLVLQTNLLNDIGHTTCIIL
FT                   PLTTSLVENSFPLRLRVQLRDKLLKTSEILCDQIRTIDNTRLQSEVITSLSQQELLEIE
FT                   QRVQIILDFA"
FT   gene            complement(130461..130703)
FT                   /locus_tag="Saut_0128"
FT   CDS_pept        complement(130461..130703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0128"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="InterPro IPR002145; KEGG: nis:NIS_1762 hypothetical
FT                   protein; PFAM: CopG domain protein DNA-binding domain
FT                   protein; PFAM: Ribbon-helix-helix protein, copG family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08177"
FT                   /db_xref="GOA:E0UT74"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT74"
FT                   /protein_id="ADN08177.1"
FT                   /translation="MKTITLKTEDTFFEHVTELAKSLHLSKSELIRKAIREYEKHIKKE
FT                   ALRKQIEQASFNVRVSNSEVTLDMDNTITDGLEHV"
FT   gene            complement(130766..131086)
FT                   /locus_tag="Saut_0129"
FT   CDS_pept        complement(130766..131086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvu:DVU1509 hypothetical protein; SPTR: A1HNP0
FT                   Transcriptional modulator of MazE/toxin, MazF; PFAM:
FT                   PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08178"
FT                   /db_xref="GOA:E0UT75"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT75"
FT                   /protein_id="ADN08178.1"
FT                   /translation="MVGDIYYINMPYSDFTKSKGRPVLVFQSISKDDFLILPLTSNLSR
FT                   EGIKITTEDIADGSLKKDSVIIVPKLTAVDSSLIKGSKFIASLKEKSFLHVKKTLCEKL
FT                   EC"
FT   gene            complement(131080..131337)
FT                   /locus_tag="Saut_0130"
FT   CDS_pept        complement(131080..131337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0130"
FT                   /product="prevent-host-death family protein"
FT                   /note="InterPro IPR006442; TIGRFAM: prevent-host-death
FT                   family protein; PFAM: Phd_YefM; TIGRFAM: prevent-host-death
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08179"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT76"
FT                   /protein_id="ADN08179.1"
FT                   /translation="MHKISASELKQNSMRLQEALRDDLLITKRDKPFVVVMDYEKYKKI
FT                   QNTQDEWSFWSDNEIDNFGKIAIGLSKNNFDDEDEDYSQW"
FT   gene            131529..133565
FT                   /locus_tag="Saut_0131"
FT   CDS_pept        131529..133565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0131"
FT                   /product="flagellin domain protein"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492:IPR001029:IPR010810; KEGG:
FT                   dat:HRM2_36880 putative flagellin; PFAM: flagellin domain
FT                   protein; flagellin hook IN repeat protein; SPTR: P22252
FT                   Flagellin B; PFAM: Bacterial flagellin N-terminal helical
FT                   region; Flagellin hook IN motif; Bacterial flagellin
FT                   C-terminal helical region"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08180"
FT                   /db_xref="GOA:E0UT77"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT77"
FT                   /protein_id="ADN08180.1"
FT                   /translation="MGFRINTNIAAMNAHRNSVNTNLGLDKSLNRLSSGLRINTAADDA
FT                   SGMTIADSLRSQAQGLGQAINNANDGVAITQTADGALDEYVKIINSVRTKAIQAASDGQ
FT                   NTDSRGAIQKDIDRLLEEANSIANTTQFNGQKLLDGTFSNKSFHIGAYAGETVNLSVGN
FT                   VQTDSVGDIKSTTGSETRAALDSTNLAEGASGQALKAGELKINDTDISSTINSLSPTKL
FT                   TDAASVAAAITNATDLVAEGHNSLTAAAAVSAGTIDSTNFLKINGVAIADTTVVANDSN
FT                   GALVRAINDISDQTGVTASLNTENKLVLESNDGSNISIATRDNDVDTVTFTASTGGGDV
FT                   SVTNANGFSVTYAASSGDTATAIAAAITTLINASSDFGAVATDTADSGTLSIEQSVLQG
FT                   AQTITVAEANADGAGVTTTDGTNEASTTYTGLTADNETNGSGAITATINSTATAAVVIE
FT                   AGQLVINGVDLAGTYGDGSTAGSARSDLQSAIKDIDGMSQSYIAKDGKMELSVNNGDDL
FT                   NIAGTTANSTYGLTKGVTNQSKMGSVEIYSDSAVKVGGNDPDSFGFTSGTKNVIAQGAS
FT                   LESIDVTSRNSAEVGILITDSALKQLDGTRSDLGSVQNQLESTIRNISVTQVNVTAAES
FT                   QIRDVDFAAESANFAKLNILAQSGSYAMSQANAVQQNVMRLLQ"
FT   gene            complement(133695..135710)
FT                   /locus_tag="Saut_0132"
FT   CDS_pept        complement(133695..135710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0132"
FT                   /product="protein of unknown function DUF115"
FT                   /note="COGs: COG2604 conserved hypothetical protein;
FT                   InterPro IPR002826; KEGG: tdn:Suden_0174 hypothetical
FT                   protein; PFAM: protein of unknown function DUF115; PFAM:
FT                   Protein of unknown function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08181"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT78"
FT                   /protein_id="ADN08181.1"
FT                   /translation="MNSIQDQAIRLFESNLRYLQENHQELYLKIKIFNQAINDNSYKER
FT                   YALEFKDNYFDIFELSSNRYLYNTNIFEHAKNLANNVNFKKSDHVIEGYYNTRELSEKD
FT                   IEIFDTSKNLRSSLWATAKIIQYNKNITSKNDEMEKIFKFVFCGVGLGVHITEIQNKIN
FT                   AKMLFIKENNLEIFRLSLFVTDYTSLASTARLFFSIMEDSHEMSSFTQFFMQIYMYNHY
FT                   IKYSVLFEENIQDIKDIQSNIVKSMHHIRPYVKSLREFLKAPEYLVEKHPFINFDISSH
FT                   YDNPFKHKPVLLIASGPSLDRNALWLQKNKDKFFIISVLSSIKTLHKLGVAPNMVAHMD
FT                   SEPDDVTFFYGIDVKTFFKNTIFLLSSVVARSVVDKIPVNQLYFFETASHYKLNSRIPT
FT                   CPSIGEATYFLTLIFGNQQLYLLGLDLALDAQTKSNHTVGHKEARTVEETTKENEQFTS
FT                   LHGTLLYTKGNFLDEVPTTPLYEMSIEALKIISNQYLYDKCKVYNLSNGAYLQGTIPLY
FT                   ASNIETKKYETIVAKIEFQMMQEFLNNISNISFNKKELNNFTAQIKEAKRLIKVIKKYQ
FT                   DSILNTTEEQFIFRFHELYKELVNTNENGVYDINNILFLYLQSISSYIFDIFNTKNLKN
FT                   KKIHQREIQQIFTQQLLKILNLYISVMKVYEEWSEK"
FT   gene            complement(135766..137076)
FT                   /locus_tag="Saut_0133"
FT   CDS_pept        complement(135766..137076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0133"
FT                   /product="aminotransferase class-III"
FT                   /note="COGs: COG0001 Glutamate-1-semialdehyde
FT                   aminotransferase; InterPro IPR005814; KEGG: har:HEAR1123
FT                   putative bifunctionnal protein: glutamate-1-semialdehyde
FT                   2,1-aminomutase, 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase; PFAM: aminotransferase class-III;
FT                   SPTR: A0Y151 Acylneuraminate
FT                   cytidylyltransferase:Aminotransferase class-III; PFAM:
FT                   Aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08182"
FT                   /db_xref="GOA:E0UT79"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT79"
FT                   /protein_id="ADN08182.1"
FT                   /translation="MGKSQDLYKKAKKLIPGGTQLLSKRPEMFLPDLWPAYYSKAKGCQ
FT                   VWDLDGNKYTDMSYMGIGSCILGYANEIVNDSVKNAVDNGNMTTLNAPEEVELAELLCK
FT                   IHPWADEVRYTRTGGESMAVAVRIARAKTQKDIVLFCGYHGWHDWYLAANLADTEALDG
FT                   HLLPGLSPRGVPRGLKGTSFPFKYNDIESFTKLYNEHKGNIAAIVMEPLRNTYPEQDFI
FT                   NIIHEKTQCDNIVLVVDEITAGWRLNHGGAHLILGIKPDIAVFGKAISNGYPMGAIIGK
FT                   KDVMDAAQDTFISSTYWTDRIGLVSSIATINTLKKDNVSQHLKQIGKTIQDGWTDIALS
FT                   HDIEIEVGGIYPLGHFSFKHKEALKLKTLFTKLMMEKGFLATTAFYASYAQKDKDINAY
FT                   LHAVDEVFSLLSKYIKENTIKEHLNTPVCHSGFSRLT"
FT   gene            complement(137076..137849)
FT                   /locus_tag="Saut_0134"
FT   CDS_pept        complement(137076..137849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0134"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="COGs: COG1861 Spore coat polysaccharide biosynthesis
FT                   protein F CMP-KDO synthetase homolog; InterPro IPR003329;
FT                   KEGG: dal:Dalk_0629 aminotransferase class-III; PFAM:
FT                   acylneuraminate cytidylyltransferase; SPTR: A9A1R4
FT                   Acylneuraminate cytidylyltransferase; PFAM:
FT                   Cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08183"
FT                   /db_xref="GOA:E0UT80"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT80"
FT                   /protein_id="ADN08183.1"
FT                   /translation="MAKQIVALLQARTDSTRLPGKVLKKLLDTPMIIHELHRISKSKYI
FT                   TELILATSDEASDDDLSQVIIHHGFNIYRGSKNNVLKRFIDALKKLNLNDDDIVVRLTG
FT                   DCPVHDSKIIDETISAFLETDCDYLTNSVKPIYPDGLDVEVFTYASLKMANKLTKKPSQ
FT                   VEHATPFIRDSGLFKTVNLLKKEVYPQWRLTVDEPEDFIVIEKIYNHFGNNNFSLTDII
FT                   SYLEKNPDIININSHINRNEGYLKSVEEDLRQKDT"
FT   gene            complement(137834..138751)
FT                   /locus_tag="Saut_0135"
FT   CDS_pept        complement(137834..138751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0135"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR020471:IPR001395;
FT                   KEGG: har:HEAR1122 putative oxidoreductases; PFAM:
FT                   aldo/keto reductase; SPTR: A0Y160 Aldo/keto reductase;
FT                   PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08184"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT81"
FT                   /protein_id="ADN08184.1"
FT                   /translation="MKYITFKNDKISKLSLGTVQFGLDYGIANTSGKPSQKDVTEIINY
FT                   VTNNGINCFDTAQGYGDAEKVLGNSLPNNKNLFIVSKVESSLFRTNIQANISTSLKNLN
FT                   IDSLYALLLHDSKILHDWKENDSLIVDNLIKNSKIKHFGISIYTSEDFNLAIENDKINF
FT                   IQIPFNIFDQRAIKEDWFHRAKEKNKLISIRSIYLQGLLLMEKDKIPPQLQSVKKHLDT
FT                   LNAFAKELHITKNELALSFVDTVAQNSLILFGCDNINQAKENIQNYKNIKKLDHDMITK
FT                   IIANFENIEEEIYNPIRWSKWQNK"
FT   gene            complement(138748..139782)
FT                   /locus_tag="Saut_0136"
FT   CDS_pept        complement(138748..139782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0136"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /EC_number="2.5.1.57"
FT                   /note="COGs: COG2089 Sialic acid synthase; InterPro
FT                   IPR013132:IPR006190:IPR020030; KEGG: abu:Abu_2246
FT                   N-acetylneuraminic acid synthetase; PFAM:
FT                   N-acetylneuraminic acid synthase domain; PRIAM:
FT                   N-acylneuraminate-9-phosphate synthase; SPTR: A3UAY1 Sialic
FT                   acid synthase; TIGRFAM: pseudaminic acid synthase; PFAM:
FT                   NeuB family; TIGRFAM: pseudaminic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08185"
FT                   /db_xref="GOA:E0UT82"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT82"
FT                   /protein_id="ADN08185.1"
FT                   /translation="MKIGNFNLQKDGVYIIAELSANHGGKIEIAKKTIKAAKEIGANCI
FT                   KLQTYTADTMTLDCKKDDFIVKGGTLWDGKSLYELYQEAYTPWEWHEELFNYAREIGID
FT                   IFSSPFDKTAVDFLEQFNPSAYKIASFEITDYELIRYTASKMKPMIISTGIATIDEIQD
FT                   AVEICHSVDNNEIVLLKCTSAYPAALEDANLLTIKNLAETFDVVSGFSDHTMGATAPIV
FT                   AVTLGAKVIEKHFILDKSIGGADADFSMDKEEFKAMIQAVRDTEKLLGKVDYIMTEQKK
FT                   KNRQFSRSLYVSKDIKKGEIFTTENIKSVRPGYGLHPKYLNKFLGKCADKDYEYGTPLS
FT                   IDTI"
FT   gene            complement(139769..140266)
FT                   /locus_tag="Saut_0137"
FT   CDS_pept        complement(139769..140266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0137"
FT                   /product="pseudaminic acid biosynthesis N-acetyl
FT                   transferase"
FT                   /note="InterPro IPR000182:IPR020036; KEGG: par:Psyc_0658
FT                   hypothetical protein; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: A3UAY3 Flagellin modification
FT                   protein FlmH; TIGRFAM: pseudaminic acid biosynthesis
FT                   N-acetyl transferase; PFAM: Acetyltransferase (GNAT)
FT                   family; TIGRFAM: pseudaminic acid biosynthesis N-acetyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08186"
FT                   /db_xref="GOA:E0UT83"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020036"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT83"
FT                   /protein_id="ADN08186.1"
FT                   /translation="MKINGATLINFIELNEDTQLKILTWRNHPTIKKWMYTDDNILLDN
FT                   HLNFISSLKSTKDKQYFVVDKDEQQIGVIYFTNIDTNKKECEFGLYANPFEKIAGVGSI
FT                   LEKLCIEYAFDILKLKKLKLEVFSNNKKALNLYKKFNFKEIGKKIVNNKDVICMELKNE
FT                   NR"
FT   gene            complement(140263..140943)
FT                   /locus_tag="Saut_0138"
FT   CDS_pept        complement(140263..140943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0138"
FT                   /product="LmbE family protein"
FT                   /note="COGs: COG2120 conserved hypothetical protein LmbE
FT                   homologs; InterPro IPR003737; KEGG: cla:Cla_1324 LmbE-like
FT                   protein; PFAM: LmbE family protein; SPTR: A3W9N6 Putative
FT                   LmbE-like protein; PFAM: GlcNAc-PI de-N-acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08187"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT84"
FT                   /protein_id="ADN08187.1"
FT                   /translation="MSKKILIVAAHPDDEVLGCFGTVSRLIKDGYQAYTLILGEGKTSR
FT                   DAQRVVKNKRNEIALLNTEIQKANNIIGIKKVFIESFPDNRFDSVDLLDIVKVISQVKE
FT                   EVKPNIIFTHYEHDLNIDHQLTYKAVITATRPMKDECVKEIYSFEILSSTEWNYPLSFS
FT                   PDTFFDISETIDMKIQAMQEYKSELCDYPHPRSLEGIELNAKYQGMRVGKKYVEAFKSV
FT                   RVIK"
FT   gene            complement(140936..141631)
FT                   /locus_tag="Saut_0139"
FT   CDS_pept        complement(140936..141631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0139"
FT                   /product="conserved hypothetical protein, putative
FT                   formyltransferase"
FT                   /note="COGs: COG0223 Methionyl-tRNA formyltransferase;
FT                   KEGG: cla:Cla_1323 conserved hypothetical protein, putative
FT                   formyltransferase; SPTR: A3W9N7 GCN5-related
FT                   N-acetyltransferase; PFAM: Formyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08188"
FT                   /db_xref="GOA:E0UT85"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT85"
FT                   /protein_id="ADN08188.1"
FT                   /translation="MNNIVIATIKEWNIQNYFTLKEKYSALYKFHLISNKDELTIDYLL
FT                   ELRPKYIFFPHWSWIIPKEVYLNFECIIFHMTDLPFGRGGSPLQNLIVREIYDTKISAL
FT                   KVESGLDTGDIYLKEDFNISLGSAEENFIKLSNIVFSKMIPKFLNSSLLPLAQNGKSII
FT                   FQRRKPHESNMNSINEISITKLYDFIRMLDAEDYPKAYIDLDNLKIEFSEVHMKNKKLV
FT                   GRFEVIENV"
FT   gene            complement(141624..142568)
FT                   /locus_tag="Saut_0140"
FT   CDS_pept        complement(141624..142568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0140"
FT                   /product="pseudaminic acid biosynthesis-associated protein
FT                   PseG"
FT                   /note="COGs: COG3980 Spore coat polysaccharide biosynthesis
FT                   protein predicted glycosyltransferase; InterPro IPR020023;
FT                   KEGG: ccv:CCV52592_0563 putative flagellar protein; SPTR:
FT                   Q58462 Uncharacterized protein MJ1062; TIGRFAM: pseudaminic
FT                   acid biosynthesis-associated protein PseG; PFAM:
FT                   Glycosyltransferase family 28 C-terminal domain; TIGRFAM:
FT                   pseudaminic acid biosynthesis-associated protein PseG"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08189"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT86"
FT                   /protein_id="ADN08189.1"
FT                   /translation="MKDKTKSILFRADSSSKIGTGHIMRDLVLATQYKDSNIIFATQNL
FT                   SGNINHKIFEAGYKLEILQSNQLKELNQLIQKYNADMLVIDHYEIDYKFEKKLKENNPQ
FT                   LILLSFDDTYEKHYCDILLNHNISADKKRYKDLVPKNCELRCGSQYTLLRDEFYKQKKK
FT                   RKQRFKTKNSKFKIFLAMGGADHSNITRKILNVLESFDNIKTHVVTTSANKNLHELRQY
FT                   IENKKWVKLYIDSDKIAKLMKKSDFAIISPSVTANEASFMNLPFIAVKTADNQNDMYQY
FT                   LKRKKYLVLEQFNIKNLNTTIKNIIQKLDKHNE"
FT   gene            complement(142558..142944)
FT                   /locus_tag="Saut_0141"
FT   CDS_pept        complement(142558..142944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ott:OTT_1762 RelA/SpoT-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08190"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT87"
FT                   /protein_id="ADN08190.1"
FT                   /translation="MIRNIQEERLKRLIVRKHFNKKYNDELIDFLQNNVENKRKIVKTI
FT                   DYINQITFTHPGLNSLEYIVHPLRVAVILYQIDNNIDVDILITALLHNIFEVSKITEKD
FT                   FLFHYEIDLMNALKILAIDRSNER"
FT   gene            complement(142947..144074)
FT                   /locus_tag="Saut_0142"
FT   CDS_pept        complement(142947..144074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0142"
FT                   /product="UDP-4-keto-6-deoxy-N-acetylglucosamine4-aminotra
FT                   nsferase"
FT                   /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis;
FT                   InterPro IPR000653:IPR001597:IPR000277:IPR020026; KEGG:
FT                   ccv:CCV52592_0561 spore coat polysaccharide biosynthesis
FT                   protein SpsC; PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein; SPTR: Q2FTQ4 DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; TIGRFAM:
FT                   UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase family;
FT                   TIGRFAM: UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08191"
FT                   /db_xref="GOA:E0UT88"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT88"
FT                   /protein_id="ADN08191.1"
FT                   /translation="MLSYSTQLIDDADITAVVDTLKGDLLAQGPKVAQFENDLCQYAGA
FT                   KYAVAFNSATSALSATYSVCGIKEGDEIITTPISFVATSNMFVTLGATPIWCDIKLDGN
FT                   IDEKQIEKLITPRTKAIVVVDFAGKPVEIQQIKEIAKKYNLLLIDDASHALGSSIDGKK
FT                   IGSFTDMNIFSFHAIKPITTSEGGAVLTDNEEYATALKLYRSHGMVKKEFWNSDMVSMG
FT                   YNFRMTEVAAALGSSQLNKLDAFIRKRNAIANYFDERFKSEKLFITQKIPKNSISSRHL
FT                   YPIILNPELQCPKEDIFQELQKRGLGVQVHYKPIYQNSFYKEKFGETSLLVANDFYRSE
FT                   ISIPCNQTMSMDDAKYVADTFLDVIHKYAHRGCSF"
FT   gene            complement(144075..145082)
FT                   /locus_tag="Saut_0143"
FT   CDS_pept        complement(144075..145082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0143"
FT                   /product="UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /note="COGs: COG1086 nucleoside-diphosphate sugar
FT                   epimerase; InterPro
FT                   IPR013120:IPR002225:IPR003869:IPR002198:IPR
FT                   001509:IPR020025; KEGG: abu:Abu_2243 UDP GlcNAc
FT                   dehydratase/reductase PseB, putative; PFAM: polysaccharide
FT                   biosynthesis protein CapD; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain; short-chain
FT                   dehydrogenase/reductase SDR; NAD-dependent
FT                   epimerase/dehydratase; SPTR: A0Y162 Polysaccharide
FT                   biosynthesis protein; TIGRFAM: UDP-N-acetylglucosamine
FT                   4,6-dehydratase; PFAM: Polysaccharide biosynthesis protein;
FT                   TIGRFAM: UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08192"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT89"
FT                   /protein_id="ADN08192.1"
FT                   /translation="MLNGKNILITGGTGSFGKQFVRTILNRYEPNKIIIYSRDELKQFE
FT                   MAQKYNHDCMRYFIGDVRDLPRLQKAMKDVHFVVHAAALKHVPIAEYNPMECIKTNVMG
FT                   AQNIIDACIDNEVPYTIALSTDKAASPANLYGASKLVSDKLFVAANNLRGNHDIKFSVV
FT                   RYGNVLGSRGSVIPFFEKLIKEGATSLPITEPNMTRFWITLQEGVDFVLKNFARMQGGE
FT                   IFIPKIPSMKMTDMAKAIAPNLPQNIIGIRPGEKLHEVMCPLDDSHLTLEFHDHFVIKP
FT                   SITFSAPIDYTKNTLEEYGKSVKQGFEYNSKENTIWLSHEELLQKLQIAKEEEK"
FT   gene            complement(145142..146515)
FT                   /locus_tag="Saut_0144"
FT   CDS_pept        complement(145142..146515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0144"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="COGs: COG1345 Flagellar capping protein; InterPro
FT                   IPR010809:IPR010810:IPR003481; KEGG: tdn:Suden_0202
FT                   flagellar hook-associated protein 2-like; PFAM: flagellar
FT                   hook-associated 2 domain protein; flagellin hook IN repeat
FT                   protein; flagellar hook-associated protein 2 domain
FT                   protein; SPTR: P24216 Flagellar hook-associated protein 2;
FT                   PFAM: Flagellar hook-associated protein 2 C-terminus;
FT                   Flagellin hook IN motif"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08193"
FT                   /db_xref="GOA:E0UT90"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT90"
FT                   /protein_id="ADN08193.1"
FT                   /translation="MAGINSLGIGSQVLTADVLDKLRAADEASIIKPLENKITLSNQKD
FT                   DAYKLLDSLMTTFKSSASTLSSENTYLGRAVSGNTDAVTITAESGSDVSNFNITNVSIA
FT                   QKDVWNAATVTDKTKAITDLGSGTFSLTTDGNTFDVDYTSADTLETVRDKINEAAGDKV
FT                   TASILQTGESSYELTITSDTTNQAITFSDTNDDSDANAKSLKTSLNLNNIQPAKEATFD
FT                   YNGITITRSTNEISDLLNGVKITLNQDQAATDNANISIAQNTTAISSEMSLFVSSYNAL
FT                   ISNLDDMTKSDRETGAVGIFNGESFVKSISREISSVVTEVAGSNGNSLIDYGIDIDRHG
FT                   VMSLNTSTLNAKIASDPSGMELFFRGDSTTDGVFTTLNDKMNDYLGYKKLMSNFSDQLK
FT                   SEKDSLVEQHTRQTDSLDNRYEILQKKFIAYDAMISRINSQFSSLQMMIDAEANSKNN"
FT   gene            146667..147038
FT                   /locus_tag="Saut_0145"
FT   CDS_pept        146667..147038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0145"
FT                   /product="flagellar protein FliS"
FT                   /note="COGs: COG1516 Flagellin-specific chaperone FliS;
FT                   InterPro IPR003713; KEGG: tdn:Suden_0203 flagellar protein
FT                   FliS; PFAM: flagellar protein FliS; SPTR: A3IC42 Flagellar
FT                   protein FliS; TIGRFAM: flagellar protein FliS; PFAM:
FT                   Flagellar protein FliS; TIGRFAM: flagellar biosynthetic
FT                   protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08194"
FT                   /db_xref="GOA:E0UT91"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT91"
FT                   /protein_id="ADN08194.1"
FT                   /translation="MYAGTAYNTYAQNNVGIESPKKLIEMLYEGVLRFNAQTKKAINDG
FT                   NTEKKVYWVNRSISIISELISILDMKEGQISEYLEGLYSYEIKLLGAASLENDVSKIDE
FT                   CTNVFKGLLEAWRESTDVD"
FT   gene            147028..147282
FT                   /locus_tag="Saut_0146"
FT   CDS_pept        147028..147282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08195"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT92"
FT                   /protein_id="ADN08195.1"
FT                   /translation="MWIKQLKIALVQQDLKQVNDLLDNIPLFKKKQEMLEASCLLKEAA
FT                   NIFTILKNETALSMKQIQKNKDFLNSTQADATAKFDITS"
FT   gene            complement(147279..147971)
FT                   /locus_tag="Saut_0147"
FT   CDS_pept        complement(147279..147971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0147"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro
FT                   IPR002347:IPR002424:IPR002198:IPR006162; KEGG:
FT                   nam:NAMH_0527 short-chain dehydrogenase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: A3HXN0 NAD-binding
FT                   domain 4, putative; PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08196"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT93"
FT                   /protein_id="ADN08196.1"
FT                   /translation="MKTAIVTGASSGIGKAITNKLLTFGFEVIGVSRSIKDDDFNHAYF
FT                   RAVTCNLAEEKDTIKLCEKLKKEDIFILINCAGFGRFEPHEELHVNIISSMTFVNLTAP
FT                   MLLTNALLRSLKENEGYLININSIEALRASKFAAVYSATKAGLKAFGDALFEETRKSAL
FT                   SITNINPDMTESHFYDELRFETSQKEDEKLFASDIADTVEHILNMRKGAVVSEYTIRSL
FT                   KFGISKKV"
FT   gene            148004..148831
FT                   /locus_tag="Saut_0148"
FT   CDS_pept        148004..148831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0148"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR006380:IPR013200:IPR006379; KEGG:
FT                   tdn:Suden_2078 HAD superfamily hydrolase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase type 3;
FT                   sucrose-6F-phosphate phosphohydrolase; SPTR: A1HSX6
FT                   Cof-like hydrolase; TIGRFAM: HAD-superfamily hydrolase,
FT                   subfamily IIB; PFAM: haloacid dehalogenase-like hydrolase;
FT                   TIGRFAM: Cof subfamily of IIB subfamily of haloacid
FT                   dehalogenase superfamily; HAD-superfamily hydrolase,
FT                   subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08197"
FT                   /db_xref="GOA:E0UT94"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT94"
FT                   /protein_id="ADN08197.1"
FT                   /translation="MKNIYITDLDHTFLRTDLSLSDYTKKIWNSYASESILSIATARTY
FT                   KKTVQFLEGVSVNAPMILLDGALIATMDKKIIDTKFIAKDTADEIIDEGAKLGIYPFVL
FT                   SLVDNELNEAFSYSTALNNYQSEIIKRYVNDDHTQSFKDLRAMQNNFKIVYMGDETLLR
FT                   ELESNLKVIYEDNLKFILAPEAYVGCYFLTILHKDADKSHGIQSVSEAAGFDLKKLTVF
FT                   GDNFNDIGMFELANTSVAVANAQEGVKRRADIVLKHTNDEDGVAKYLAEVKNA"
FT   gene            148824..150059
FT                   /locus_tag="Saut_0149"
FT   CDS_pept        148824..150059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0149"
FT                   /product="glucose/galactose transporter"
FT                   /note="COGs: COG0738 Fucose permease; InterPro
FT                   IPR011701:IPR005964; KEGG: tdn:Suden_2077 glucose/galactose
FT                   transporter; PFAM: major facilitator superfamily MFS_1;
FT                   SPTR: A2V019 Glucose/galactose transporter; TIGRFAM:
FT                   glucose/galactose transporter; PFAM: Major Facilitator
FT                   Superfamily; TIGRFAM: glucose/galactose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08198"
FT                   /db_xref="GOA:E0UT95"
FT                   /db_xref="InterPro:IPR005964"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT95"
FT                   /protein_id="ADN08198.1"
FT                   /translation="MHKQSSFLAMIIIGVLFFIFGFVTWLNGSLIPYLKVICDLNEFEA
FT                   LFVTFAFYIAYTVMALPMAVILEKTGYKKGMALGLFVMSLGSLLFIPAALSGEFLVFLA
FT                   ALFTLGTGLTILQTASNPYIVLLGPIESAAMRISIMGLINKSAGVLAPLLFTALILSDI
FT                   GSSSQLVSTNTQELAYKLIKPYIIMSIMLLVLTLFVWFSSLPELEFEDDPYDDENIFGF
FT                   PRVVLGALALFFYVGIEVIAGDTIGLYGQSLGIANATALTAYTMSFMVAGYLVGVFFIP
FT                   KFLSQEKALVSSALLGIFFLFGVAFSSTTESHIITGLPDSVAFVAMLGLANALVWPTIW
FT                   PLALQDLGKHTAKGSALLIMAIAGGAVLPLVFGKVAQITADMQMSYLVGIVCYVMILFY
FT                   GLKWHKMTGWRA"
FT   sig_peptide     148824..148901
FT                   /locus_tag="Saut_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            150061..150894
FT                   /locus_tag="Saut_0150"
FT   CDS_pept        150061..150894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0150"
FT                   /product="Aldose 1-epimerase"
FT                   /note="COGs: COG0676 protein related to aldose 1-epimerase;
FT                   InterPro IPR008183; KEGG: tdn:Suden_2076 aldose
FT                   1-epimerase; PFAM: Aldose 1-epimerase; SPTR: B9TGM5 Aldose
FT                   1-epimerase, putative (Fragment); PFAM: Aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08199"
FT                   /db_xref="GOA:E0UT96"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT96"
FT                   /protein_id="ADN08199.1"
FT                   /translation="MYALKQFDNGFEYLEVKNESAYAKIALQGAHIFSYKVKEQEEFLW
FT                   LSASSKFENGSAIRGGIPICWPRFGNLDDTLPQHGFVRVFLFELEKVQELSLEQTKVYL
FT                   RLQESEKSRKIWDFKFELQIIFTITNRLKIEMITTNTDTKAFFLTQAFHTYFQVSDIHN
FT                   IIIEGLKGKTYLDILDNEKKVQKENLRINQEVDRVYENVSNEIILHDLKKKTSIKSENS
FT                   SSVIIWNPWIDKCKTMSAMDAQGYKKFVCIESANAFDDFQIIKPKETYSLEVIYT"
FT   gene            150953..151342
FT                   /locus_tag="Saut_0151"
FT   CDS_pept        150953..151342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08200"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT97"
FT                   /protein_id="ADN08200.1"
FT                   /translation="MKKSILFICGVIMSMQLHATDDTLSSEGSHFLGGTALGAGATAVV
FT                   NQFDEYKQNRKIIGFGISAVYGVVDQTIQYIEDGNAGGQLLDLGAHLLGSALGAWVADE
FT                   YILSPIVQESETEGKYLGLAMNYSF"
FT   sig_peptide     150953..151009
FT                   /locus_tag="Saut_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            151379..152002
FT                   /locus_tag="Saut_0152"
FT   CDS_pept        151379..152002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0152"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro
FT                   IPR000415:IPR012825; KEGG: shl:Shal_0741 cob(II)yrinic acid
FT                   a,c-diamide reductase; PFAM: nitroreductase; SPTR: A3UL48
FT                   Nitroreductase family protein; TIGRFAM: cob(II)yrinic acid
FT                   a,c-diamide reductase; PFAM: Nitroreductase family;
FT                   TIGRFAM: cob(II)yrinic acid a,c-diamide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08201"
FT                   /db_xref="GOA:E0UT98"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT98"
FT                   /protein_id="ADN08201.1"
FT                   /translation="MEFNTNDTKILLNIMKNRRDVRGNHFLNTEIEDKNLQLILEAALT
FT                   APSVGYSQPWKFIVIKDENIKEEILNNFQNENEKAKEIFKNKNLYQKLKLEGIKEAPIN
FT                   IVVLYDESAEDILGMTSMKSMGEYSVVCVIQNMWLMARALNIGLGWVSILNEQEVLKSI
FT                   NAPKETKLIAYLCVGYVDEFFKSPELKMLGWEEEKKFDECVSFI"
FT   gene            152283..153452
FT                   /locus_tag="Saut_0153"
FT   CDS_pept        152283..153452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0153"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: nam:NAMH_1173 phage integrase;
FT                   PFAM: integrase family protein; SPTR: A3XEU0 Phage
FT                   integrase; PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08202"
FT                   /db_xref="GOA:E0UT99"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E0UT99"
FT                   /protein_id="ADN08202.1"
FT                   /translation="MALNDSLKKINISRLDTTGLYLKDDSNIFSKKEINKDDLKKLDYE
FT                   SISIVLKFYFRNKQKKETVSYNNITGLQAIKKAIATRAELKVEIEETGIIKKKDFKTLS
FT                   EYWDEYVFYKSSIWSPDTKVTNTTFYDKWIREQIGEINFEKVTTRDLQDIVNLILRSSN
FT                   PKTKKPYATRTAQSVKQQIRALYNYFIKSNITKINPAINIEIPKFDNTIDFELSDDERK
FT                   KLFEAINNYELAKFKGVMLFLYSGRRLNEVLTLDWRNIHFHKKTYTIDSIYAKNRRTLE
FT                   FPIPPVLEDFLLSYHPKKTGLIFVAQKDPNKPLSQETFRRHWKIVIDRLDIDKMRIHDT
FT                   RHLLGNTMINKGFSLEAVGKTMGHSSVHVTTRYAKTNLNTVNNVLNDYF"
FT   gene            153675..154151
FT                   /locus_tag="Saut_0154"
FT   CDS_pept        153675..154151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eum:ECUMN_0587 conserved hypothetical protein
FT                   from bacteriophage origin"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08203"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTA0"
FT                   /protein_id="ADN08203.1"
FT                   /translation="MSKITFDHIGNPSPYKIVPLLKSECEEYFVTNFEDSQTRPLNWKK
FT                   YNIYSHSLKNLLMKPLIQWLAGSFTTTKLNPEDIDLVNFIEYIDFKSELANFDMNRSNH
FT                   FPKKQYNIDGYNVLVFPEEHPYYVKMVERKAYWKKQFGSDRDNNPKALIEVTYT"
FT   gene            154148..154906
FT                   /locus_tag="Saut_0155"
FT   CDS_pept        154148..154906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0155"
FT                   /product="protein of unknown function DUF955"
FT                   /note="InterPro IPR010359:IPR006025; KEGG: gur:Gura_2215
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF955; SPTR: B6SBW2 Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF955)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08204"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTA1"
FT                   /protein_id="ADN08204.1"
FT                   /translation="MKLEEQLNDIKKMITTTKQLLVDHPSDEMLLYMLAQDEELYALSI
FT                   AKAYSRIMPSFDNAEDVIKAIYSEKHSSAVDPFHIADFLGIKIKKDFHLSEGIGKCDFY
FT                   EDQIIITYKPSNHFRDKFTIAHELGHVFLHFSKGLSLEFTDYESVVDEPIIANNTSYKP
FT                   VISAARLSAQTDDFEKEQEANNFAGELLVPRFILDKILNKLPSGKAINASLLKDLFQVS
FT                   RPVIRISLVDYGLLNSGKVLDDINIQNRGW"
FT   gene            154908..156284
FT                   /locus_tag="Saut_0156"
FT   CDS_pept        154908..156284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08205"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTA2"
FT                   /protein_id="ADN08205.1"
FT                   /translation="MELIDSDKIDILSFGDSDISVLKDSTMIFSTKIPAFDITATTVKE
FT                   SIVENEHSFEDEQETSYKLHISSSLNGVEYQLLCDDLIDDAVVVQIVEMGDSIPSSTSN
FT                   VIATYVPLVKYTNRTIDLLSCIIPQANKQILPLIDIRKEKQIVKYEKDNFYFPHILDLC
FT                   DLHTVANHQEREDIKLLRKTNKTNPPEIPDEIEIRSTPESIISQYIRLKNKILFMPVCR
FT                   IDTEESPTLEFGKYADALLENFDKITLRVMGTNNFENNIQSYLMKFSKILHCSCIIIEF
FT                   NGIKPNREREIIEYVSNLDTDIQIIYAKETTNYKEHSITINHLNIFPNTSLSGYYDRLQ
FT                   DSDSSLWYADYCGYDRDTATEFVIGMKPNASLYLIANDDAMDIIILKVKHPTERGTAKW
FT                   TLSAQMLINNYVKTGLVNSRFLDATHCNSCNTILRTSSLTLASAKYLSMLHNATTLAVL
FT                   "
FT   gene            complement(156270..156980)
FT                   /locus_tag="Saut_0157"
FT   CDS_pept        complement(156270..156980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_1385 hypothetical protein;
FT                   SPTR: P13059 Protein cII"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08206"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTA3"
FT                   /protein_id="ADN08206.1"
FT                   /translation="MKYTNFKKEDIFLQENNRYNSTMKRADAPTITYSLIEWLDNRYDN
FT                   KTITTEISVNTTFGTKIADVVVSNGHSIAYEVKSAFDTTKRLNAQVNGFSEMFEYVYLV
FT                   YWDGKYNLKGLNLPSNIGLIKAYWKDDKVCFGIVQDARINRLATSFNIAPFLWKKELRY
FT                   FLGLKQQKFKMSDDKDTLVELFSKNYGKRDSVRIFRYVLKNRFELGFSVFQKLKDLKAF
FT                   RSNKSDINYPLQYS"
FT   gene            complement(157101..157352)
FT                   /locus_tag="Saut_0158"
FT   CDS_pept        complement(157101..157352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08207"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTA4"
FT                   /protein_id="ADN08207.1"
FT                   /translation="MAKIKDLDDLDTSEKTNKFIAAADMSKGKKNKGGRPKKEASERAS
FT                   EQIFINVTSGEKAKIEAYAKELGISVSALCKISLAKFI"
FT   gene            complement(157396..158049)
FT                   /locus_tag="Saut_0159"
FT   CDS_pept        complement(157396..158049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0159"
FT                   /product="plasmid partitioning protein"
FT                   /note="COGs: COG1192 ATPase involved in chromosome
FT                   partitioning; KEGG: cla:Cla_a005 plasmid partitioning
FT                   protein; SPTR: B3SE06 Putative uncharacterized protein;
FT                   PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08208"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTA5"
FT                   /protein_id="ADN08208.1"
FT                   /translation="MIVLFGHQKGGVGKSTVSINVAYQLQKKYKDLVLLDLDSQNSAIL
FT                   FNQLRISENLPTIKCVKESDIDFSNFINEYSGNKENLLIIDSGGYDSDVNRAALIKADI
FT                   IITPVGISQIEIFGLQKFRKILKEASEALDVKIKTNVLLNNVDSRSKNKLRDLREYIKE
FT                   NNKYFNLLDSVIHTRADYKNSYGDGLTVKELNKKGTAAQEIKQLTKEILKLVNN"
FT   gene            complement(158257..158859)
FT                   /locus_tag="Saut_0160"
FT   CDS_pept        complement(158257..158859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08209"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTA6"
FT                   /protein_id="ADN08209.1"
FT                   /translation="MLKKIISTGVVAASILLSGCGVTTSYMTDLHVPDKNKPVVVILVD
FT                   QDSTSLGGVMVGSVVRTNYMYSFAVAAQTTTDAGYKYFTIIEPVQLTKQFTNRKVTNIQ
FT                   EAYDACDDGEGSFIAGFNPKYNFTLGHGKYNCDVMTNQYTDATLTGGSVVHKSVRYVIE
FT                   MHNEPRANSNATFNAQEVLDSKLVSSLNREYFVKSTR"
FT   sig_peptide     complement(158785..158859)
FT                   /locus_tag="Saut_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            158988..159230
FT                   /locus_tag="Saut_0161"
FT   CDS_pept        158988..159230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0161"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: abu:Abu_0599 hypothetical
FT                   protein; SMART: helix-turn-helix domain protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08210"
FT                   /db_xref="GOA:E0UTA7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTA7"
FT                   /protein_id="ADN08210.1"
FT                   /translation="MLESNPDLFLDKIVENVKIERKKRDISQLKLAEILDFSSPNYIAK
FT                   IETRKHDVSYNLLHLCKIAAYFEMEVVDFLPKKSN"
FT   gene            complement(159235..159990)
FT                   /locus_tag="Saut_0162"
FT   CDS_pept        complement(159235..159990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: maq:Maqu_0412 restriction modification system
FT                   DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08211"
FT                   /db_xref="GOA:E0UTA8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTA8"
FT                   /protein_id="ADN08211.1"
FT                   /translation="MNLEVKLKALFPNTEIVKLEDITTKIAGISKVRVGKDRTYTDYDE
FT                   ISLNNINKYGVVYIPKNPKEVGPANYAAMRSQILQPGDIVMTQRGKVGKVGLIGNNYKR
FT                   VIVGNNSMIRIQFPHNRCNETPLFVQAYLQLPYIREYLDNHITCGSKDRKILSAASLSK
FT                   LPIPMFKEGDGQFTEFLHTRKELSIEAARVEKELQELIELYTKIKDDCVVLGINKCDEL
FT                   QAMNIKDKGVLSKLSRLREDLRKIKAKHS"
FT   gene            160125..160367
FT                   /locus_tag="Saut_0163"
FT   CDS_pept        160125..160367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08212"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTA9"
FT                   /protein_id="ADN08212.1"
FT                   /translation="MKNINTYLIYKAYNIAIALDTDNNSLLSYSYQDEEVNISSQGILT
FT                   TVNAELGAIIESYFKINLSDYGVALYDEVLQLETA"
FT   gene            160368..160541
FT                   /locus_tag="Saut_0164"
FT   CDS_pept        160368..160541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08213"
FT                   /db_xref="GOA:E0UTB0"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTB0"
FT                   /protein_id="ADN08213.1"
FT                   /translation="MSFDYFCNSIEYIPDADGCINTLVFFILLIGFAFIVLFSKKYKYL
FT                   MDYFEEKFGHWF"
FT   gene            160583..160933
FT                   /locus_tag="Saut_0165"
FT   CDS_pept        160583..160933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08214"
FT                   /db_xref="GOA:E0UTB1"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTB1"
FT                   /protein_id="ADN08214.1"
FT                   /translation="MLEYLNYGGLGIFVFIAIIMIIMGHMEKRTPVGSYIFLLTSISAF
FT                   LFMANNEYTTALQNINDFKNQNATLKCVSGGGLYTSADTYRVSLNDGWSLDKNYFIKES
FT                   FMVDADKCEKFR"
FT   gene            160943..161050
FT                   /locus_tag="Saut_0166"
FT   CDS_pept        160943..161050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08215"
FT                   /db_xref="GOA:E0UTB2"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTB2"
FT                   /protein_id="ADN08215.1"
FT                   /translation="MEDGIVTFMGSLALGVVIFAVVLGLGKKYKDEDQQ"
FT   gene            161125..163083
FT                   /locus_tag="Saut_0167"
FT   CDS_pept        161125..163083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0167"
FT                   /product="N-6 DNA methylase"
FT                   /note="COGs: COG0286 Type I restriction-modification system
FT                   methyltransferase subunit; InterPro
FT                   IPR002296:IPR003356:IPR002052; KEGG: pha:PSHAa2094 type I
FT                   restriction-modification system M subunit; PFAM: N-6 DNA
FT                   methylase; SPTR: A3J918 N-6 DNA methylase; PFAM: N-6 DNA
FT                   Methylase; HsdM N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08216"
FT                   /db_xref="GOA:E0UTB3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTB3"
FT                   /protein_id="ADN08216.1"
FT                   /translation="MAEQSISALIWSTADLLRGDYKQSDYGKIILPFTLLRRLECVLEP
FT                   TRDDVLTENEARKNLGIPMEQFLTRKSGHSFYNTSKYTLTKLMSDPSNISQNLESYIND
FT                   FSPNAREIFEKYEFTAQIDKLNEANLLYLIIEKFATVDLHPDTISNHAMGIVFEELIRK
FT                   FAEQSNETAGEHFTPRDIVRLTTSLLFSTDDDVLTKKGIVRSLYDPTAGTGGFLSSGSE
FT                   YVHELNPDATLVTFGQELNGESYAICKADMMIKGVQVENIKHGNTLSDDQLGENKFDYM
FT                   LSNPPFGVEWKKVEKVVKAENAEQGYNGRFGPGLPRVSDGSLLFLLHLVSKMRPKREGG
FT                   SRIGIILNGSPLFTGGAGSGESEIRRYILENDYLEAIVAMPNDMFFNTGIATYIWILSN
FT                   NKPEHRQGEVQLINASSMGNAMRKSLGSKRKFLDETQISDIVRIYGENAAAKISKIFNI
FT                   TDFGYRRITVERSLQLSYFPHDADKLESLQNDKVFVKMKELGAEILTALGAIESDKIMS
FT                   RTEFKNELSKKMTSKLSATQFKLVQKHISMHDDEAELCKDSKGKLEANADLRDYENIPL
FT                   SEDINEYFAREVTPHVPLAWIDEKKRDAKDGEVGIVGYEIPFNRHFYEYAPPRPLEEID
FT                   AELETLNAEIMEMLREI"
FT   gene            163073..164401
FT                   /locus_tag="Saut_0168"
FT   CDS_pept        163073..164401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0168"
FT                   /product="Restriction endonuclease S subunit"
FT                   /note="COGs: COG0732 Restriction endonuclease S subunits;
FT                   KEGG: lhk:LHK_01517 type I restriction-modification system,
FT                   S subunit; SPTR: Q8PSU8 Type I restriction-modification
FT                   system specificity subunit; PFAM: Type I restriction
FT                   modification DNA specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08217"
FT                   /db_xref="GOA:E0UTB4"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTB4"
FT                   /protein_id="ADN08217.1"
FT                   /translation="MKSKYKPYPSYKDSGIAWLGEVPIGWDVRRLKTILQERREKNSPV
FT                   KTKDILSLCMYRGVIPYSEKGNSGNKAKDDLTAYKLAYPNDIVLNSMNVVAGSVGLSKY
FT                   FGAVSPVYYMLYPRKSTDDISYFNAIFQSESFQKSLIGLGNGILVKQSEKTGKLNTIRM
FT                   KISMDSLNDVLMPIPPFQEQQTIANYLDNATAKIDTLIEKQTKLIALLKEKRQAVISTA
FT                   VTRGLDSSVPMKDSGVEWLGEIPEHWEVKKFKYLFEIRKRISGKLGYDILSITQKGIKV
FT                   KDIESGKGQLSSDYSKYQHVYKGDYAMNHMDLLTGFVDLSKYDGVTSPDYRVFSIIEKN
FT                   ADANYYLFLLQMGYINKIFYPLGQGSSQFGRWRLPSDAFKEFQAPFPPQEEQKKIAKYI
FT                   DDSLTKFTKLTTKATKAIELLKERRTALISAIVTGKIDVREIA"
FT   gene            164398..165114
FT                   /locus_tag="Saut_0169"
FT   CDS_pept        164398..165114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_1161 hypothetical protein; SPTR:
FT                   Q71TB8 RlfA"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08218"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTB5"
FT                   /protein_id="ADN08218.1"
FT                   /translation="MSNKLKINIYCDESRHTSGGDRYMVIGAIKCERELKREIVHQIHS
FT                   MKKKHNAQGEFGWKRLSPNKKEFYFELLELFINNDLSFRCIVVDKEKLDHDLYNDGDKE
FT                   LGFYKFYYLMLKDTLEHDKEYYLYLDWQQNRDQHRFRNLKYFLQKKLQGKAKISCLEPV
FT                   TSTNQPLIELADLFMGAVGYQYNDRNSSDIKIEFCQTLAEKLNALNNKNFKMGNLKTFT
FT                   AKNEKKFNIFKWESYQ"
FT   gene            165114..165623
FT                   /locus_tag="Saut_0170"
FT   CDS_pept        165114..165623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08219"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTB6"
FT                   /protein_id="ADN08219.1"
FT                   /translation="MSEKVWPLLRFKADNDDELKEMYKKVYIDEYVNQEIYDFNGKRVI
FT                   FPYSQFEHAFSESSNYKTSNGYHDIPFSKKRARYLLWIKKVIMKDTGNIDYKLEYRSEM
FT                   KTKKGKKVTVRIYAVIDERYIVVLDQKENKLYFVTGIPHDKNSYKRMVERSALLKQEKV
FT                   PSSLGD"
FT   gene            165779..168892
FT                   /locus_tag="Saut_0171"
FT   CDS_pept        165779..168892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0171"
FT                   /product="type III restriction protein res subunit"
FT                   /note="COGs: COG0610 Type I site-specific
FT                   restriction-modification system R (restriction) subunit and
FT                   related helicase; InterPro
FT                   IPR007409:IPR006935:IPR014001:IPR014021; KEGG:
FT                   tgr:Tgr7_0598 type I site-specific restriction-modification
FT                   system, R subunit; PFAM: type III restriction protein res
FT                   subunit; protein of unknown function DUF450; SMART:
FT                   DEAD-like helicase; SPTR: A3J915 Putative uncharacterized
FT                   protein; PFAM: Type I restriction enzyme R protein N
FT                   terminus (HSDR_N); Type III restriction enzyme, res
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08220"
FT                   /db_xref="GOA:E0UTB7"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTB7"
FT                   /protein_id="ADN08220.1"
FT                   /translation="MSKHKERQFQIEIVEHLKANKYVEGDATHYDRELALYPSDLINYI
FT                   KSTQPQAYEKMQKREGSKTDEVLCKHVAKEMDKHGSLHYLRNDLKYIGSKFKLCQFKPE
FT                   LHNPDTQAKYDANILRVVQEVTTKSGNERIDLVLFLNGIPIVTCELKTDFTQNVQDAVN
FT                   QYKYERPAKGEALLEFKRRALVHFAVSNDEVYMTTKLAGDKTFFLPFNKGQLDGSAGNP
FT                   PNPNGYATSYLWEEVLQRDSILNIIARYIHLEVKTKEDHQGKKSKSETLIFPRYHQLDV
FT                   VRKLLADTREKGAGNHYLIQHSAGSGKSNSIAWLSHQLSSLHNDQEESVFSSVIVITDR
FT                   TVLDNQLQETISSFEHKDGVVVGISRDGSNESKSAQLADALERGAKIIITTIQTFPFVL
FT                   KAIQKRTSLKNNSYAIIADEAHSSQTGSTAKQLREVLTAEQIEEGVELSAEDIITASIE
FT                   SRSASTNLSFYAFTATPKTKTLEMFGVLPKPDEAPSETNKPQAFHLYTMKQAIQEGFIL
FT                   DVLQGYTTYKLFYKLEHANMKHDQEVESKRAKVKVAKWLNIHPHNIAQKIEIICEHFKT
FT                   TVAPLLDGQAKAMVVTSSRNAAVRYKLAFDKYIQEHDIEKMQAMVAFSGKIEDDIEGTT
FT                   KEYTETSMNPNLKGREMRKAFDSNDYQVMLVANKFQTGFDQPKLCAMYVDKKLGGVDCV
FT                   QTLSRLNRTYAGKEQTFILDFYNEAEDIKEAFEPYYNTTEIEDVTDPNIVYDMQHKLDE
FT                   SDIFTTMDVENYAKAFFNPKGTQAAMSSAVKPAVDRYKNRYKLALENINSVKVNLAEAK
FT                   KNKDDAGIHNYELDLKVANEDKNALDIFKKDLISFLRMYEFLSQIVDYADEDLLKLSAF
FT                   VKALIPNLKTYDPKDPIDISEVQLSHYKLHKQKNQNIDLVGDEVELGAIGEVGSAVAKD
FT                   PEKELLSAVLGHMNALFEGNLTDEDMINYANTIKDKVLENDKVVEQVTNNTKEQAMMGG
FT                   FADAINSAVIDSLEVHQDLATQVLGKDRIRAGFADIVYELIAKGLKAS"
FT   gene            168935..170818
FT                   /locus_tag="Saut_0172"
FT   CDS_pept        168935..170818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvu:VV2_0907 ankyrin repeateat-containing
FT                   protein; SPTR: Q8I525 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08221"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTB8"
FT                   /protein_id="ADN08221.1"
FT                   /translation="MLNTEQILIKVAQYFDLDLTRLGIKQSTEKSRLYKHQLTKETIEH
FT                   IVNNIYKEIDSLDINSSVKEIIEEFMKHYAYITKEIYSAYDAKKEKEIDWLLLKHFIIP
FT                   FFAIRLSQNTSFYDDRIDKGLPGGDFWYFPSFDSNSSKICFPVNKIMKWLIDLHGGSNQ
FT                   DFYCMKKYDFNENAYLNISDSTLKDWHDNLVLPQVKNIKELASYKFIYEGVFNNNHANS
FT                   IEAQFNSAIEFIKSKSLSVDELKLEIPNLNNLLDRLYSDNLSNEEKERFVLYIEQRWAK
FT                   PTPEQIEYLLTVSRVSQACYRALCDYFNIDEESTTIDENKTIQLVGLFSSIYNTELDLR
FT                   LNGTSKTLGLFESYIYNIHKIEEHTKEALDQIIASIYNEMRLTTHNYNIDEILILFSHN
FT                   KKNKKQAIMNFESKRLYSNLKKTQNQQVYQAIKHLNEIVDEDKILKYIYSITNNEVLHN
FT                   IGDYFQGNNYLTNEIVEPNLAVALTIHVRYSLVAHDLLNKQIAYSKVLNLLTFSYYPRM
FT                   LNKDDVEEWLFELEKISDINDFRSNLINLSYHGYHLINQQDEIKIITLIEQYKRSIKKM
FT                   KPEEYNPQFLFVAQDYMLNIGNKKLYNKLKKINEKHSLYSAHHSNEFYFYK"
FT   gene            170914..171006
FT                   /locus_tag="Saut_0173"
FT   CDS_pept        170914..171006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08222"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTB9"
FT                   /protein_id="ADN08222.1"
FT                   /translation="MAKSSGCTPPNGPSTTGNPSGGGRGNCPSK"
FT   gene            171105..171269
FT                   /locus_tag="Saut_0174"
FT   CDS_pept        171105..171269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hypothetical protein CBG21616"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08223"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTC0"
FT                   /protein_id="ADN08223.1"
FT                   /translation="MAYYHYQCEHCLQTTYMHDDGKDDDVIVNAFDDCGCTDYDDEYDN
FT                   YDDDDYDDD"
FT   gene            complement(171515..172183)
FT                   /locus_tag="Saut_0175"
FT   CDS_pept        complement(171515..172183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0175"
FT                   /product="Resolvase domain protein"
FT                   /note="COGs: COG1961 Site-specific recombinase DNA
FT                   invertase Pin homologs; InterPro IPR006119:IPR006118; KEGG:
FT                   cla:Cla_a003 site-specific recombinase/resolvase; PFAM:
FT                   Resolvase domain; SPTR: A0YRR0 Site-specific recombinase,
FT                   resolvase family protein; PFAM: Resolvase, N terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08224"
FT                   /db_xref="GOA:E0UTC1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTC1"
FT                   /protein_id="ADN08224.1"
FT                   /translation="MILGYIRVSTDKQDNQKQKHLILEYAHSNSLKINDFIEVEISSRK
FT                   SEKLRKITELKDRLQKDDTLIVAELSRLGRNMMDVMNLIQELSDKGIKLIFIRQPELST
FT                   FNSAHNKLLLAIYSYFAESEREFISMRTKQGLAAAKASGKKLGRKPGQKVKSKYDPYLE
FT                   KIKEMLLKDVSITSIHKIIEFGTYVGLRSYILNNSELNKILTQNKDKTVSLLAINYLDN
FT                   "
FT   gene            complement(172303..173658)
FT                   /locus_tag="Saut_0176"
FT   CDS_pept        complement(172303..173658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecz:ECS88_2837 hypothetical protein; SPTR:
FT                   A3XIZ9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08225"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTC2"
FT                   /protein_id="ADN08225.1"
FT                   /translation="MRILDKKRFNALVNHSKSPFLEGFGEEFGWYSNEDESLLGVFVLD
FT                   LIDHDYSCAILGKDEVGKYRAIEITVSNTTLEELFVWMIEIFTTYSDSGQKIFPQGDNE
FT                   NILDFFKLIVSEEKQHPFFKKLNEDIGQSAAKEIIQKLMLHFIDIDGNYIEQFQSNGFD
FT                   ARLWELYLNTYFYEENLYMNRDYHAPDFLVEKFGYKVAIEAVIVGRKEDTPIENFEERL
FT                   RESSFEEDMERLKDEIPIKFGSPLFSKLKKEYWKLSHVANNPLVFAIADFHDNMAMTWT
FT                   GSALHRYLYAVHHEHTYNDDGELIITPLKIETHKFGDKEIPSGFFFQEDAENISAILFS
FT                   ASGTLSKFNRMGHQAGLGDKKVKLIRSGFYHKHDENASMPDFISYEVGIDSNESWAEGI
FT                   SMFHNPNAKFPVPEGLFPSIAHHHFKDGQIVSILPDIHPYSTTTMIVSTDNK"
FT   gene            complement(173683..174696)
FT                   /locus_tag="Saut_0177"
FT   CDS_pept        complement(173683..174696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3342 hypothetical protein; SPTR:
FT                   A3UT16 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08226"
FT                   /db_xref="InterPro:IPR032557"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTC3"
FT                   /protein_id="ADN08226.1"
FT                   /translation="MSKNIIMIDTCVWIDLAKNPALKPLTLAIKQLIDSNELKIITTKI
FT                   IKEEFLNNKDKLVEIGRKKISQNIKNLKSLIHEHSTVSNKEDALKGLDDINHKLPTMVD
FT                   SISEHTNLIWEVLESSEELELTDEIKLISAQKAYKKEAPFHNGKNNMADSMLIELFFSH
FT                   LNETDSFYFISHNKNEFSSKADTRKAHEGFNEYFFKENVHYSLDLYNTINEIFPGTLEE
FT                   IEIEESWFDEGRGFFDIIEYTNEFCDRIWYNRHLNLRYKIESGMHEVVDEKGYDSYNPN
FT                   QTVKYIWEGALESAARMEALYGDKLEPMDDFEWGMLNGKLSALRWVLGDEWDMLDT"
FT   gene            complement(174693..175223)
FT                   /locus_tag="Saut_0178"
FT   CDS_pept        complement(174693..175223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08227"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTC4"
FT                   /protein_id="ADN08227.1"
FT                   /translation="MSNYLTEKSLGKYLKQIFPKHEFIRDRVVPNSDIQKRPDYRNDDL
FT                   MLIIEFDGYGHYSNPDNILTDGFKDDIYKDMGYDIVRIPYFIQMSKDIVELLFDRDVDI
FT                   EQVYPHGFIDIKAMLPAYFCELGIIRFKKDLDKFKIVKDEIILSLGQKYDEYGNINYVL
FT                   PPSLYNLLIEGIG"
FT   gene            complement(175220..175681)
FT                   /locus_tag="Saut_0179"
FT   CDS_pept        complement(175220..175681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0179"
FT                   /product="RDD domain containing protein"
FT                   /note="InterPro IPR010432; KEGG: vsa:VSAL_II0628
FT                   hypothetical protein; PFAM: RDD domain containing protein;
FT                   SPTR: A3J7N5 Predicted membrane protein/domain; PFAM: RDD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08228"
FT                   /db_xref="GOA:E0UTC5"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTC5"
FT                   /protein_id="ADN08228.1"
FT                   /translation="MSNSDNLEYAGFWIRVGASLLDTVMILLITVPVMLMIYGDAIWEN
FT                   ESMFMGPADFLVNYIFPAIVVIVFWLYKSATPGKMILGLTVVDATTGNPLSVGQAIGRY
FT                   LGYFVSMFPLMLGIFWVGWDKKKQGWHDKLANTVVIRQLDRVEAVDFSE"
FT   gene            complement(175743..175850)
FT                   /locus_tag="Saut_0180"
FT   CDS_pept        complement(175743..175850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08229"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTC6"
FT                   /protein_id="ADN08229.1"
FT                   /translation="MLEMIVAVIFAVVAYYVAEKDNKESDLYQILHQQK"
FT   gene            complement(177194..177592)
FT                   /locus_tag="Saut_0181"
FT   CDS_pept        complement(177194..177592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08230"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTC7"
FT                   /protein_id="ADN08230.1"
FT                   /translation="MKIKKAIEVLYNRISDKTELEAQEEIMIILNSFELQIKYGCDNKL
FT                   TAFSNSIYTPTLKQNEQKEAALKEQRKKLKFKKYRTALAQEELIKTMRNNGSSYSKIAL
FT                   YLNQYIVHKRNYFNRKYIERFCKTKNID"
FT   gene            complement(177603..178502)
FT                   /locus_tag="Saut_0182"
FT   CDS_pept        complement(177603..178502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_3695 hypothetical protein; SPTR:
FT                   A3X878 Putative integrase; PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08231"
FT                   /db_xref="GOA:E0UTC8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTC8"
FT                   /protein_id="ADN08231.1"
FT                   /translation="MRGSVNNQVNQLWSKIDGLYTSKGETRANSDYRGHNGHKVSENVH
FT                   GYSWKDETKRIAKELLTYSKKNFKIKDMQAITGEVVLAYVNDKIEDGLVRNSISSYISN
FT                   IAKIKVGLSKIPNKLKSHNNQFTHEDLKQARKNINQFAVRSKHINRAYINPASFKSDMS
FT                   IKSRIGYQLQLKHGLRVSEATLIRPSQLLNNNTIRIQGKGGYERDVKLSSVLFNQITQE
FT                   IKAHGSYYQGYNTYLKDLKNSVAKAGEKWTGTHGLRYNYAQSQMSRYQEKMSYKEALAR
FT                   VSFELGHHRIEITKHYLK"
FT   gene            complement(178492..178890)
FT                   /locus_tag="Saut_0183"
FT   CDS_pept        complement(178492..178890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08232"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTC9"
FT                   /protein_id="ADN08232.1"
FT                   /translation="MKIKIYKDLSAEVLPTPGNSKHSTLFVFETLKNGDSKITDGTQIY
FT                   NFVELLSAFVSNQLHIDKEYQLDYKDARGSKGGYAAKIVSQQDQHFLRVIVDDKKYFFE
FT                   KYECRIITKILNKILSKCTFNELTGYER"
FT   gene            complement(178892..179281)
FT                   /locus_tag="Saut_0184"
FT   CDS_pept        complement(178892..179281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08233"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTD0"
FT                   /protein_id="ADN08233.1"
FT                   /translation="MKIVVATMEYNLPNGYDIDVKLEEIEFDGKLENLAKILDVTKYKE
FT                   AEKYEDGSGGGCSSTSINISKNYTTVSICDAHICPTAFIVDGVEFFGDRKVAFIGIENL
FT                   IGIAPVYTLAEIKNKIEYPDYTKEV"
FT   gene            complement(179284..179379)
FT                   /locus_tag="Saut_0185"
FT   CDS_pept        complement(179284..179379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08234"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTD1"
FT                   /protein_id="ADN08234.1"
FT                   /translation="MSLNDKNQEYELVGAIFTPGIRNIFKLKKGK"
FT   gene            complement(179499..184487)
FT                   /locus_tag="Saut_0186"
FT   CDS_pept        complement(179499..184487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hhe:HH0275 hypothetical protein; SPTR: Q2FDK5
FT                   Serine-rich adhesin for platelets; PFAM: TraG-like protein,
FT                   N-terminal region; TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08235"
FT                   /db_xref="GOA:E0UTK4"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTK4"
FT                   /protein_id="ADN08235.1"
FT                   /translation="MKNKLFILMLLLCGVNLNAAEITWVNAFPIYVYGDVTAIAKIYEF
FT                   INTIVNSPTPQIIISIGVTMAIVISGWKVKDGDYNEIIKALFAPITLYALFFVPTVNVH
FT                   ITDLRVDKGLINYSVPDGGYRKVDNVPYMIAFIPASSSMLVSLFIDLTDNSWDATSTGS
FT                   KFSTLGFQEMSHISQEALILGTFNNLDVNSSSDVYNMQQYVHQCLVIEALKVPSNHQKL
FT                   IKPSKTFPEMYDPANFDGNIGNVRVTFTDATGVTEVSDTCANLYTTYVSGVASTLESDF
FT                   GDVLQGNFPNVDTSSATFNEAWRENAGVQQTVVGNIRKAMITGAATRALAKDLSTDGIG
FT                   VDGVAMATEIAIEKTIANLRTEGLAKYEWMARMLPNAVFIIMMLMLGIFPLMIIVMTFM
FT                   GFNAFKGVANFFMGYIAMNFNLVSLALVSNIISYYTAQNAQQAIVSYAGMPFGSTQISE
FT                   FMYQQADMAGLAGIIGVISVPFVTAAIFYGETKGLAAGISGVTGAFRGNVAADAKDTLV
FT                   DRDAQQEIDKQMLDDAKNERDASSWLTNEGFTKPSNMSAVEAKNQMMKNLSSIGNANAA
FT                   SEIFHSGNAQNFIHGSAVQSSQGFNKTAGLGGSGVSMETAGSVSFEDGEVMGSMIQKTS
FT                   DLRSESESYDTSKVGEGQAIGMFGKDMGSAALSDLDSSASATVANATNAVANQVGAGRG
FT                   LLETGAFNSDGTLAGNAATEALIKGAALTSAQKANNQIGAGEVGNMDDYLSTALQDGHI
FT                   AAKTVSKVADRRDDLSDMDNKNTQWNEDSIASGNAIASVHKETQAQGAHNALDIEKGTL
FT                   NDAFKKASSGSEEAGRKSENSLLGVGEEWDKRTATGDDIKTMSKLQDNAAVQEFGGIDS
FT                   THAEIMKHGSLDGAIKDMVTAAQEKGISSATHADNLRDDYGSNLDSKKMMQMSSKDRSD
FT                   LFDAALNEKDPQKKQAMLDMLDEANQTGGVSRSLSDVTDSIDQSKLDAQLGQAIGIDQN
FT                   KIAGVNYSQNAMYGEMSSQQSTQSKLGAQGGVEGAVKVDATESSVKAKTQEEVLDSQLK
FT                   QAGAKDGLDSSIKDLASATDKLAKTAGTLAGGKTAADIATTGKFDSPEQFAESQAKTAS
FT                   QQASKDKAKMLLDEDQEANNGLVKKALMMSRKGYEGEQADEKEAQALDQMERAGLVKTM
FT                   EDGSIKVATGTKFSDAMAVLNSGDMGRDKQVQIAGTSMNIDRDMDGNTRITGTSLDSTE
FT                   RGSKLDYSVSGFAGAVGVGLAMGAAGLATANQYSKHIASEKIPMKMEDMHGAKPDGNGG
FT                   FIDSNGKGFGVNENGEVTRNGKVAMKDNPNYKKGFIKAGWDNAKNSLNEKGKNLRSGFT
FT                   SESLDETISTEKNQTSNENANSSSNSNQNDVSHKKSPDINSNTIIPKSEQGIKPSISEQ
FT                   IGAQFKKEQILNQDTKYNSDMDKLKATHAQQNALNPDNPNVASRQAMEINAMQDAHMKR
FT                   IEANTKPNLQVPSEKGFFEKRMSALSNVWDGGGSWKTKIAMSAGAMALGSVSATASDIM
FT                   DAVDPIAHASGTSLGDSSYGGDELKQMQAQFKSNSNGFTTPSWVKGVQPVSTVPQHVQT
FT                   AFSTPSGFNTQQAISTSTGFSTNAAGQEIYGANKNDTLFRNDTSAESLRIQEDIALGTE
FT                   FNQETSEGIQAAVERLMDADRNEK"
FT   sig_peptide     complement(184431..184487)
FT                   /locus_tag="Saut_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(184477..184710)
FT                   /locus_tag="Saut_0187"
FT   CDS_pept        complement(184477..184710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08236"
FT                   /db_xref="GOA:E0UTK5"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTK5"
FT                   /protein_id="ADN08236.1"
FT                   /translation="MKKFLKIYIVYVVLLLSILYILPPNIGTQFKKFEQWLLIILQKPE
FT                   TLQYTVNFSILIIAIAIITNLYIKIKEHKNEK"
FT   gene            complement(184707..186221)
FT                   /locus_tag="Saut_0188"
FT   CDS_pept        complement(184707..186221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hhe:HH0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08237"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTK6"
FT                   /protein_id="ADN08237.1"
FT                   /translation="MHKKIITIIISFALVLNAKESCRIVSSQPFGYTGDVSGKRVYTKE
FT                   EFTFECTDTTTKIGSCKTWKEEYQDYNVSGLKHDIYYESENFQGTIGEVLGVAQAYDKI
FT                   NGLWSGWHGLCMDGSDDGNWDWMSDPYVLAGFALSAVSGGAGGGLATTGTQAASETAKQ
FT                   IARYAVCAARAGLDTGKMMEEYQDDGEPCDPVDEICEGNDVADDDTNIFTIPEDEYNEM
FT                   VNNNPDIVDNMVIIDGVGTGVLTLKVIAGDVNKIGLSSAEAQKAAKDAKEKALKIKAAM
FT                   TTLQLAACVNGMDSGSGSSSSSDDASSLLSAKNLALMALGAINPLVGLAAQVLSKMYDS
FT                   FSSSIDTCNNLDDAKEKGSRHEATYHAKKYDMCHLIEVIEEGDKTWNTYQRRFRYCCYD
FT                   DKTTRIIVEQSKAQFAKDWEHCTDITLKELEVISFSACDPDELDSSVNGVNLPADATLS
FT                   ERMGAYQFTHKCIDTREYIDVLLEKFGGEDMLIDSSDAERILEEMR"
FT   sig_peptide     complement(186168..186221)
FT                   /locus_tag="Saut_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(186228..186479)
FT                   /locus_tag="Saut_0189"
FT   CDS_pept        complement(186228..186479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08238"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTK7"
FT                   /protein_id="ADN08238.1"
FT                   /translation="MQNAIIVDSNILNEILLVQRKIEKKLNENTLNENTPNDELVTVKQ
FT                   AHIITKISEQKIRQMMIDGELETNDKYGTAKRIYRRSL"
FT   gene            186617..187186
FT                   /locus_tag="Saut_0190"
FT   CDS_pept        186617..187186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_2449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08239"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTK8"
FT                   /protein_id="ADN08239.1"
FT                   /translation="MKLEEIIMKLFGFSRPTYFKKKREQLPIMVLLEQYFSKQELEEFV
FT                   KNNQIKKFELIKNMNFEELKNKINQPNRDFTQAVHINRLLNSTFNTKALAYLYFLLEKY
FT                   DIKDSADLYKFNIKKDQEHFFIRFMSDWFHDEKANVLSFARNRKEFNEYSELYLMKEEI
FT                   NFIFQNKEVFISSVHKILQQKLKKGV"
FT   gene            complement(187205..188335)
FT                   /locus_tag="Saut_0191"
FT   CDS_pept        complement(187205..188335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0191"
FT                   /product="plasmid replicase"
FT                   /note="InterPro IPR004322; KEGG: mmb:Mmol_0237 plasmid
FT                   replicase; PFAM: plasmid replicase; SPTR: A3RSG2 Putative
FT                   uncharacterized protein; PFAM: Replicase family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08240"
FT                   /db_xref="InterPro:IPR004322"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTK9"
FT                   /protein_id="ADN08240.1"
FT                   /translation="MRDFQQQNQLNKTLNRFNKIRLYHNYGYMNILPVKYLKKNPHKYK
FT                   QVQLNTDTHFNAIIMDIDDEDLLTEWNAVGLPTPSIQTLNKDNDKAHLVWLLNIPVSKR
FT                   NRKAVKYYKTIVDSIKLLIGADKAYQNHQTKNFLNNELYRITYNDLGYDLEDFKNFIIK
FT                   EEKYKVSQHTDLAEYESTGSRHIDLFNQLRLYGYKVAKHSNLLEKLQKRAELLNEQFDE
FT                   PIKQKAIIKSVLAFCEENKNNFKAAHKYRTGAMKFKKITNMSPINYIKEVSRRQSKSAT
FT                   RTKDIKRIKTAAKIKVAFELLLRHKTKLTYSNIAKQAKVSPRTVKRYSKIIKILVQKVD
FT                   GVISSIRVIVLEAEERSIYPLKYWNAVLFRYPEVPT"
FT   gene            complement(188804..188888)
FT                   /locus_tag="Saut_R0002"
FT   tRNA            complement(188804..188888)
FT                   /locus_tag="Saut_R0002"
FT                   /product="tRNA-Leu"
FT   gene            complement(188939..189015)
FT                   /locus_tag="Saut_R0003"
FT   tRNA            complement(188939..189015)
FT                   /locus_tag="Saut_R0003"
FT                   /product="tRNA-Arg"
FT   gene            complement(189028..189104)
FT                   /locus_tag="Saut_R0004"
FT   tRNA            complement(189028..189104)
FT                   /locus_tag="Saut_R0004"
FT                   /product="tRNA-Arg"
FT   gene            complement(189147..189223)
FT                   /locus_tag="Saut_R0005"
FT   tRNA            complement(189147..189223)
FT                   /locus_tag="Saut_R0005"
FT                   /product="tRNA-His"
FT   gene            complement(189262..189339)
FT                   /locus_tag="Saut_R0006"
FT   tRNA            complement(189262..189339)
FT                   /locus_tag="Saut_R0006"
FT                   /product="tRNA-Pro"
FT   gene            189487..190824
FT                   /locus_tag="Saut_0192"
FT   CDS_pept        189487..190824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0192"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="COGs: COG0733 Na+-dependent transporter of the SNF
FT                   family; InterPro IPR000175; KEGG: nis:NIS_0177 NSS family
FT                   neurotransmitter:Na(+) symporter; PFAM:
FT                   sodium:neurotransmitter symporter; SPTR: A3JC69
FT                   Transporter; PFAM: Sodium:neurotransmitter symporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08241"
FT                   /db_xref="GOA:E0UTL0"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTL0"
FT                   /protein_id="ADN08241.1"
FT                   /translation="MKIARFSRIGFIMAAAGSAVGLGNIWKFPYITGEYGGGAFVLVYL
FT                   ITVLLIGFSIMIAEMLIGYLGRRDTVTSFEELAPKHKNLWKLAGFQGLAGLFIMIFYSV
FT                   VIGWIFNYIVTSLTYLPSTVTEAENTFTTMLHSDFWTQLFYHTASFVIITYVLHKGLKG
FT                   GIEKLNMFLMPALMLILALMFAYAVTLEGFSKAVTFMFSPDWSKINGDAFVTAVGHAFF
FT                   TLSLGMGAIMTYAASLEKKANIVKSAFWVVFLDTTIAIVAGLMLFTFLYQYGSGPAKGP
FT                   GLVFISLPAAFYEMGIVGNIFAVLFFIALAFAGLTSSVSLVEPMVQYFIDRFGWSRLKA
FT                   TISMGTFFWFLGIFAILSNIDGAKEYLTWGSKNFFDWVDYVTAAIMLPLGGLLMAVFVG
FT                   FVIPRSEVEATMKPQLKWAFSLWYFSLRYITPVAMFVVMLSLMGVL"
FT   sig_peptide     189487..189549
FT                   /locus_tag="Saut_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            190824..191096
FT                   /locus_tag="Saut_0193"
FT   CDS_pept        190824..191096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08242"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTL1"
FT                   /protein_id="ADN08242.1"
FT                   /translation="MDAVREKCMKTLQNESINPVSSIDFDVNGKVHSLSFEYIIDTYMQ
FT                   ASEESRLVFLSALQKAVDAKEMGIEKFFEGMGQLLLMSHLSDKFQ"
FT   gene            191107..191307
FT                   /locus_tag="Saut_0194"
FT   CDS_pept        191107..191307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_3802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08243"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTL2"
FT                   /protein_id="ADN08243.1"
FT                   /translation="MGWTCQHDFQGHCKLLHVNCMPGTKGCILNKGKHEYIFSTGSYEE
FT                   DKKQQESKQETIDFAALAKSN"
FT   gene            complement(191312..192091)
FT                   /locus_tag="Saut_0195"
FT   CDS_pept        complement(191312..192091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0195"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="COGs: COG2022 Uncharacterized protein of thiazole
FT                   biosynthesis; InterPro IPR008867; KEGG: tdn:Suden_0217
FT                   thiazole synthase; PFAM: thiazole biosynthesis family
FT                   protein; SPTR: Q30U33 Thiazole biosynthesis protein thiG;
FT                   PFAM: Thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08244"
FT                   /db_xref="GOA:E0UTL3"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTL3"
FT                   /protein_id="ADN08244.1"
FT                   /translation="MDNKLKIGKYELGSRLIVGSGKYDSFETTKEATLASGSELITVAV
FT                   RRLNITDPSKENLRDTFAGTNVKFLPNSAGCVTAEEAITTFRLTREATGIDLIKLEVIG
FT                   DTQKTLYPDVLETIKACEVLAKEGFTIMAYTSDDPIMAKRLEDAGADAVMPLAAPIGSG
FT                   LGIQNPYNVVFIRDAINVPVIVDAGIGCASDAAYAMELGADGILTNTAIAQAQNPMVMA
FT                   EAMKHAVQAGRMSYLAGRIPKRPYATASSPVDGMIQF"
FT   gene            complement(192139..193539)
FT                   /locus_tag="Saut_0196"
FT   CDS_pept        complement(192139..193539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0196"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="COGs: COG0063 sugar kinase; InterPro
FT                   IPR000631:IPR004443:IPR017953; KEGG: tdn:Suden_0216
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   UPF0031; YjeF-family domain protein; SPTR: P56176
FT                   Uncharacterized protein HP_1363; TIGRFAM: carbohydrate
FT                   kinase, YjeF related protein; PFAM: YjeF-related protein
FT                   N-terminus; Carbohydrate kinase; TIGRFAM: yjeF C-terminal
FT                   region, hydroxyethylthiazole kinase-related; yjeF
FT                   N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08245"
FT                   /db_xref="GOA:E0UTL4"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTL4"
FT                   /protein_id="ADN08245.1"
FT                   /translation="MQKLFEEVGSLDARCYEEFFLSEDILMEHAAQGMASYIKNNFSNN
FT                   EKIIIAVGSGNNGADGIALARLLHGDYNVSLFFVKEPKSHMALLQEKRAQAINVPIIPK
FT                   LQECNIFVDAIVGTGFDGEFNEKITTVLEKMNTLEAFKIACDVPSGLKKSGECAQTTFH
FT                   ADTTLTMGALKKSLFLDEAKDYIGKIEVLDLGISRKLYETQTNWHLLDLDDLQLPLRAQ
FT                   QNSYKGSFGHLAVLCGEKPGACVMSALAGLRFGAGLVTLVGYENHQMLNIPHSLMYAHA
FT                   LPSNTTAIACGMGLGVEFSDNELRNFLDNDLALIIDADLFSMEVILELLERKNIVLTPH
FT                   PKEFVSLLKITELADISVEELQKKRFFYVELFCKAYPNTTLLLKGANVIIGSDNDFFIN
FT                   PHGSSKLAKGGSGDVLSGLIGSLLAQGKSPLDATIHGSLAHTKLAQNYTGADFSLTPED
FT                   LIQGIGNL"
FT   gene            complement(193542..194276)
FT                   /locus_tag="Saut_0197"
FT   CDS_pept        complement(193542..194276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08246"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTL5"
FT                   /protein_id="ADN08246.1"
FT                   /translation="MRNVIGKYLDTIDALKLEDRMLTHNTLILGEEGSGKTNLACRIRN
FT                   FVIDSNVPTLYMDFANSHEDEVELRYKDEHFNYIRFDESEAFDKAFAKLVADKKHIYMA
FT                   VDPKFFSNKREKKSKLSKVISQQALLDDYYYFFHDIENLNGFYTKFEDFLLYMLSFANL
FT                   QKHGLTFLAQPHQTFENPHLKLLFSFLYVGKCSNANYFNTAILKTLKKNKFYYQCRTAY
FT                   PTLLFNDIKSSMVKIDEYVPEL"
FT   gene            194348..195310
FT                   /locus_tag="Saut_0198"
FT   CDS_pept        194348..195310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0198"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="COGs: COG0794 sugar phosphate isomerase involved in
FT                   capsule formation; InterPro IPR001347:IPR000644:IPR004800;
FT                   KEGG: tdn:Suden_0213 KpsF/GutQ; PFAM: sugar isomerase
FT                   (SIS); CBS domain containing protein; PRIAM:
FT                   Arabinose-5-phosphate isomerase; SMART: CBS domain
FT                   containing protein; SPTR: P45313 Probable phosphosugar
FT                   isomerase HI1678; TIGRFAM: KpsF/GutQ family protein; PFAM:
FT                   CBS domain; SIS domain; TIGRFAM: KpsF/GutQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08247"
FT                   /db_xref="GOA:E0UTL6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTL6"
FT                   /protein_id="ADN08247.1"
FT                   /translation="MNYKIIAQETLNIEAETLINAAKNIGDEFDKAVEIILTCKGKLVI
FT                   SGVGKSGLIGAKMAATFASTGTPSFFLHPTEALHGDLGMIGKDDVVIAISYSGESEELS
FT                   SILPHIKRFGIPLIGMTRDKNSTLGQYSDVVIDVIVEKEACPLNIAPTSSTTLTLALGD
FT                   ALAVCLMRARDFKKSDFASFHPGGALGKKLFVKVKNLMKTDDLPIIKEDAKVKDAILKI
FT                   SEGRVGTALIADDEDKLVGLMSDGDVRRALMRQDFSLDDNVMKYATKNPMSIDDEEMLA
FT                   SDALVLIEEKKIQLLVITNKEKKIEGVLHIHTLIEKGIA"
FT   gene            195315..196118
FT                   /locus_tag="Saut_0199"
FT   CDS_pept        195315..196118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0199"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG1187 16S rRNA uridine-516 pseudouridylate
FT                   synthase and related pseudouridylate synthase; InterPro
FT                   IPR002942:IPR006145:IPR018496:IPR000748; KEGG:
FT                   tdn:Suden_0212 pseudouridine synthase, Rsu; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   SMART: RNA-binding S4 domain protein; SPTR: P55986
FT                   Uncharacterized RNA pseudouridine synthase HP_1459; PFAM:
FT                   RNA pseudouridylate synthase; S4 domain; TIGRFAM:
FT                   pseudouridine synthase family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08248"
FT                   /db_xref="GOA:E0UTL7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTL7"
FT                   /protein_id="ADN08248.1"
FT                   /translation="MMRLNKYIAHYSTYSRREADKAVQDGYVRVNSEIETNPATQVQEG
FT                   VDIVYISGKQVSPQEKYTVIVYNKPKGELVTKNDPKGRKTIYDSLSKEFRHFIPVGRLD
FT                   FASEGLLLLTDASHVATSLMESDLERIYKLKIKGEVTPDMEDAMLNGIYLDDASAGAHS
FT                   HSKITSMDIKPFIGYKIQKNQPNYSILKVALKEGKNRELRRFFAHFGAEVADLKRVSFA
FT                   EIELNNLPTGKTRYLSRSEYSALYKFLKEEKKRARDNKRKEDKEQ"
FT   gene            196119..197294
FT                   /locus_tag="Saut_0200"
FT   CDS_pept        196119..197294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0200"
FT                   /product="Recombination protein MgsA"
FT                   /note="COGs: COG2256 ATPase related to the helicase subunit
FT                   of the Holliday junction resolvase; InterPro
FT                   IPR003959:IPR011704:IPR003593; KEGG: tdn:Suden_0211
FT                   recombination factor protein RarA; PFAM: AAA ATPase central
FT                   domain protein; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; SPTR: A3HX00 Putative
FT                   AAA family ATPase protein; PFAM: MgsA AAA+ ATPase C
FT                   terminal; Holliday junction DNA helicase ruvB N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08249"
FT                   /db_xref="GOA:E0UTL8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTL8"
FT                   /protein_id="ADN08249.1"
FT                   /translation="MDFTQLLRPSSFDEIIGQEHLSAEDAPLRILCEKEALGHSFFYGP
FT                   AGVGKTSLARVIAKTMQLPFYEFNATSLKIEQLRKIFEQYKNALQKPLIFIDEVHRLSK
FT                   NQQEVLLPVMENNSVLIIGASTENPFYSLTSAIRSRSMLFELKSILHASLEKLLQKALQ
FT                   RGEIMLERDAQEYLIASSGGDARAMLKLLEFASNIQSKITLDTLKSLRPNALQAGSSEA
FT                   GVHYDLASALIKSIRGSDADAAIYYLARLIDGGESADFIARRLVILASEDIGNANPQAL
FT                   TLTTSCLTSVSKIGYPEARIILAQAVIYLCASPKSNSAYLAISKALTSVKNGNIAEIPK
FT                   NITNSNENYLYPHDYGGYVAQEYLSKPMHFVDLKDVGYEKKMIEWIKIIKH"
FT   gene            197351..197638
FT                   /locus_tag="Saut_0201"
FT   CDS_pept        197351..197638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08250"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTL9"
FT                   /protein_id="ADN08250.1"
FT                   /translation="MDISVSSNTITLNGNIKSIGDYQQIKEIMDDLIKTNKHVIFNIKD
FT                   SISITSSVIGYFNKLILKDNVDLQINVGDEQLMELFEDLSLVSLFKVKKV"
FT   gene            197641..199617
FT                   /locus_tag="Saut_0202"
FT   CDS_pept        197641..199617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0202"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089:IPR003660:IPR013587; KEGG:
FT                   tdn:Suden_0209 methyl-accepting chemotaxis sensory
FT                   transducer; PFAM: Nitrate and nitrite sensing domain
FT                   protein; chemotaxis sensory transducer; histidine kinase
FT                   HAMP region domain protein; SMART: chemotaxis sensory
FT                   transducer; SPTR: A3XRX8 Methyl-accepting chemotaxis
FT                   protein; PFAM: Nitrate and nitrite sensing;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08251"
FT                   /db_xref="GOA:E0UTM0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTM0"
FT                   /protein_id="ADN08251.1"
FT                   /translation="MTIKAKLNLITAIVVSFALVIIALTINSAVKEDTVVQESKELNVM
FT                   SQKLSLLIHETQKERGASAGYLGSKGKKFADILPKQRKLTDERNQQFEKYLQTLDLEGF
FT                   SQELRDEIHGLKQDMGRINEIRNSVDSFGIGVKEEVSYYTNMNKKILYIVALSAKLANT
FT                   PELVKALDAYTNFLKSKERAGIERAVMSATFAADKFAPGMYAKFITLTAEQNAYIDAFL
FT                   SMATDKAKQLYKTTMNAPVIDEVNKMRHIAQTKANEGGFGVDSVVWFKTITKKINLLKK
FT                   VDDALAKNNDAILAKIESDYKTSTAITLVSYIAFAIIIFIIIMLISRGVNKSVRSSLEK
FT                   IECVSSELDLTCNIVVEGDDEISQISRALQGMISAFKETVYNVRDVSMRTQEESEKLSS
FT                   VVQALKENSEVEEGRISSVNELVADVGTRSNSVEEATVNVTEDLDTTFNVLDGFIIKLG
FT                   AVVNSIEDGSQQQQELVEKVASLTEQAKNIKDVLEIISDIADQTNLLALNAAIEAARAG
FT                   EHGRGFAVVADEVRKLAERTQKSLSEISANVNLITQNVVEIAEETDVTSKSMKNISESA
FT                   QVLITSSSETKDKLLETKDRSTQVMHQSVYIATKTKDLVSIMNEIIEISMKNNELRTSV
FT                   DMVVISLSEESDVLQAELNKFKI"
FT   sig_peptide     197641..197733
FT                   /locus_tag="Saut_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            199632..200867
FT                   /locus_tag="Saut_0203"
FT   CDS_pept        199632..200867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0203"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG2208 Serine phosphatase RsbU regulator of
FT                   sigma subunit; InterPro IPR010822:IPR001932; KEGG:
FT                   tdn:Suden_0208 response regulator receiver
FT                   domain-containing protein; PFAM: Stage II sporulation E
FT                   family protein; SMART: protein phosphatase 2C domain
FT                   protein; SPTR: O07014 Phosphoserine phosphatase rsbP; PFAM:
FT                   Stage II sporulation protein E (SpoIIE)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08252"
FT                   /db_xref="GOA:E0UTM1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTM1"
FT                   /protein_id="ADN08252.1"
FT                   /translation="MQNSQKFRTPQEKEDYSAYQEDLAFQKELNILRNDFYYKMIDSKD
FT                   ISLVDFFYQPLDTLSGDAYTARVIDGHRTFYLLVDGMGKGLSASLTAMSVTIFINHIID
FT                   KMIEHDSFSLDILVKESMDFMRPILLDEEALSIDYILFDTYFSQLDYAKFSMPPFLLED
FT                   NKHQVIKIKSNNPPMSKWSKTYNIDKCSVENIHKFLFYSDGIVENSTIDGLVYNNFIEN
FT                   DFTESFTREEMKEHILEKIATQEDDLTFIFINRLELNTMTLISEKIFETTLDAIEEANS
FT                   WYENICQNHCSTLAFNELFMNAYEHGNLDLDSETKHQLLQDDVYFQTLVSLEKECAKKI
FT                   TVKIYKIKNLSSQYRVTQIIDEGHGFDTNLLTTIFRNSKQFNGRGVFVSRKNSMGIYYN
FT                   SKGNSVLFLNKI"
FT   gene            200935..202239
FT                   /locus_tag="Saut_0204"
FT   CDS_pept        200935..202239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0204"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="COGs: COG0281 Malic enzyme; InterPro
FT                   IPR012302:IPR012301:IPR015884; KEGG: sun:SUN_0515 malate
FT                   oxidoreductase; PFAM: malic protein NAD-binding; malic
FT                   protein domain protein; PRIAM: Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating); SPTR: A3LJ82 Malic enzyme;
FT                   PFAM: Malic enzyme, NAD binding domain; Malic enzyme,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08253"
FT                   /db_xref="GOA:E0UTM2"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTM2"
FT                   /protein_id="ADN08253.1"
FT                   /translation="MSDKLSFQKESLEYHRAKSEFDTNGKTATLLTKPCTTQEELSMAY
FT                   SPGVAYPCLEIQKDAELAYEYTNKGNLVAVVSDGTAVLGLGDIGPLAGKPVMEGKGVLF
FT                   KSFANVDAVDIELNTKDTDEIIKIVAAMADSFGGINLEDISAPRCFEIEERLKEICNVP
FT                   VFHDDQHGTAVITTAGLMNVIEMSGKKAEDLKVVVIGAGAAGIACGNMYKELGVKNITM
FT                   LDSKGVIHSGRDDLNKYKKLFALDTDDRTLEDAMKNADMVLGLSQADLITPEMVQSMSD
FT                   TNPIIFACANPNPEITPPVAKEARPDIIIGTGRSDYANQVNNVLGFPQIFRGALDVRAT
FT                   KITENMKLAASRALAALAKEPVPQNVKKAHHREDMEFGHEYIIPSPFDRRVLVYVASAV
FT                   AQAAIEDGVARVKDFDMDAYKIKLQRLADHLDGKI"
FT   gene            complement(202261..202911)
FT                   /locus_tag="Saut_0205"
FT   CDS_pept        complement(202261..202911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0205"
FT                   /product="protein of unknown function DUF178"
FT                   /note="COGs: COG1427 periplasmic solute-binding protein;
FT                   InterPro IPR003773; KEGG: tdn:Suden_0252 hypothetical
FT                   protein; PFAM: protein of unknown function DUF178; SPTR:
FT                   A9A207 Putative uncharacterized protein; PFAM: Putative
FT                   periplasminc binding protein (DUF178)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08254"
FT                   /db_xref="GOA:E0UTM3"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTM3"
FT                   /protein_id="ADN08254.1"
FT                   /translation="MIFGKIEYLNLLPFHVFIKRFTRSTQQKLLMEYKKNVPAKINDAF
FT                   LNRRVDAAFISSIAAKKSYHVNLGIIAKKEVKSVIVIPGNADKKDVESASSNILANLLH
FT                   VKGEVLIGDKALRYALANNDYIDLAKLWNEKYNLPFVFALLCYHKDKKLYKKVEKEFLK
FT                   KEVKIPQYLLQKASKKTDISPHDLAEYLKLISYGLDYKAKKGVKKFYTEAKRV"
FT   gene            202977..203198
FT                   /locus_tag="Saut_0206"
FT   CDS_pept        202977..203198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0206"
FT                   /product="thiamineS protein"
FT                   /note="InterPro IPR003749; KEGG: tdn:Suden_0253 thiamine S;
FT                   PFAM: thiamineS protein; PFAM: ThiS family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08255"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTM4"
FT                   /protein_id="ADN08255.1"
FT                   /translation="MVRVEFLGPIQKDALELEIVNLNELAAILQKDEEVKDWLENCAVA
FT                   VNDNLVTSLECELKNGDKISLLPPVCGG"
FT   gene            203202..203648
FT                   /locus_tag="Saut_0207"
FT   CDS_pept        203202..203648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0207"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="COGs: COG0314 Molybdopterin converting factor large
FT                   subunit; InterPro IPR003448; KEGG: tdn:Suden_0254
FT                   molybdopterin converting factor, subunit 2; PFAM:
FT                   molybdopterin biosynthesis MoaE protein; SPTR: P56422
FT                   Molybdopterin-converting factor subunit 2; PFAM: MoaE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08256"
FT                   /db_xref="GOA:E0UTM5"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTM5"
FT                   /protein_id="ADN08256.1"
FT                   /translation="MLSLYDGALDVPEILKEWYEAEATSNYGAYIPFVGTVRSEDGIDG
FT                   LSFDIYEPILESWFTSWQQKAKEKGAVIKMAHSRGDVLLHESSYIAAVFSPKRRVALEF
FT                   IDEFVEDFKASAPIWKYDLKNGERVYAKDRSTAIKGSGILGVKQ"
FT   gene            203645..204871
FT                   /locus_tag="Saut_0208"
FT   CDS_pept        203645..204871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0208"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterPro IPR005111:IPR005110:IPR001453; KEGG:
FT                   tdn:Suden_0255 molybdopterin binding domain-containing
FT                   protein; PFAM: molybdopterin binding domain; MoeA domain
FT                   protein domain I and II; MoeA domain protein domain IV;
FT                   SPTR: A0NSY5 MoeA-like, domain I and II; TIGRFAM:
FT                   molybdenum cofactor synthesis domain protein; PFAM:
FT                   Probable molybdopterin binding domain; MoeA N-terminal
FT                   region (domain I and II); MoeA C-terminal region (domain
FT                   IV); TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08257"
FT                   /db_xref="GOA:E0UTM6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTM6"
FT                   /protein_id="ADN08257.1"
FT                   /translation="MSITGTDFISFETSQNMLELLQVNNHRYERVPLSDALGRVLAQDI
FT                   VAEFNDPQFPTASMDGYAVRHEDLQKGELIVLGDNPAGHDETRVLSEGESIKTFTGSMM
FT                   PAGSDTLIQIENVTYNNGKITINEPVERANAVRPVGEGYAAGDVLIKKGTKIGFAEIGV
FT                   MAGLNQVMVKVALRPRVAVIATGSEILDLGENSDNLAQIRSSNNYTLAALFEQAGAEVI
FT                   QLGTAPDDRDAIMRTFENALESADILVSTGGVSVGDYDFVKDIIPRLGAEVVYKGVGIK
FT                   PGRHILVAQRANKFILALPGFAYSSTVTAILYALPLIAKMLGKKAPFKTVAAKLQEDFT
FT                   KRSRFTEFTACNIVVEDGEYFVNFTGKKVGSSAILTNMLDNSALMIAGEDDKFLEAGTY
FT                   VNVILLESF"
FT   gene            204871..205416
FT                   /locus_tag="Saut_0209"
FT   CDS_pept        204871..205416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08258"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTM7"
FT                   /protein_id="ADN08258.1"
FT                   /translation="MQALNINHKTQEVKELDITMAANTVYTFFSSILIDELSSLKEHII
FT                   YTDANALSEKKMPFFIGEQLILGDALILGREDFDDVDVEITKEELRSLINPNVNEFYKE
FT                   ILDLIADTDVNLYRTFTVEKNGEKIALNIEWVLYTFNIADERTKEYFINELKKTLEAKE
FT                   NVADYMQKMAQLAMNAAG"
FT   gene            complement(205660..207003)
FT                   /locus_tag="Saut_0210"
FT   CDS_pept        complement(205660..207003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0210"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="InterPro IPR005625; KEGG: sun:SUN_0916 hypothetical
FT                   protein; PFAM: PepSY-associated TM helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08259"
FT                   /db_xref="GOA:E0UTM8"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTM8"
FT                   /protein_id="ADN08259.1"
FT                   /translation="MVKIYKLHKISGISAGIILLILSVSGFFLDHDKWSFLYTTTFSSV
FT                   PSQIKSSEKRLFNAYYKDKENAQHILVGGYRGLFESFNGGKKFSNISNLQILSIIPDKS
FT                   ILYLATSDGIYSYNFKHLKRVALQGEYITALSVSKKQLVAVLDKEKLVTIDKNNLQISN
FT                   ETIVKITKEALKEDIKLSRLVRDLHYGRGLFDGGISLLINDYGALVLAFLSLSGYMIWF
FT                   LIKRKKYPQISRKLIKTHANIFAIIAIIPLFILSVTGIFLDHSSGLAKFMNSVKIPHST
FT                   LPPIYNSLRSDIWSVDFDGKTYRIGNRYGIYKSTNLKNWRLENRGLAYKMIRRDGILYV
FT                   SGMGAPNRIYKDNKFYLLPDTPHMFRDILVKDKEVRYFSSMQKGFYLPQFHDITLYTLL
FT                   LTLHDGTFFSSWWGWINDFAAIALILLGITGTMRWSIKKRKNLNKVHK"
FT   gene            complement(206997..209048)
FT                   /locus_tag="Saut_0211"
FT   CDS_pept        complement(206997..209048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0211"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR012910:IPR000531; KEGG:
FT                   nis:NIS_0951 TonB-dependent receptor; PFAM: TonB-dependent
FT                   receptor; TonB-dependent receptor plug; SPTR: A0Y3Y0
FT                   Putative TonB-dependent receptor protein; PFAM:
FT                   TonB-dependent Receptor Plug Domain; TonB dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08260"
FT                   /db_xref="GOA:E0UTM9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTM9"
FT                   /protein_id="ADN08260.1"
FT                   /translation="MKKSILGLSLIVSALLADSVVEIAPISVTATGIDENVIEQPLSIA
FT                   TKDEKEIKLDQVIFQKDLLNSLSGVRIEQTGSVIGHMTSIRMPMGTEPYYLFMQDGIPV
FT                   QSSGFFNHNGLAYTTFQSASSVEVLKGAGTALYGSDAVAAVINVESTKTPSKTKEVSVK
FT                   GMAGSYGYGSGSVEISNTIDKDNAYRANASYMHSNGWRDHTKSNRAEANIRYDHTINDD
FT                   NEVKILFNFSKTEAEQADSFNDYTNIENSSTSASDDSNYFTALEKTDVKRKFDYAKISA
FT                   EFNNYSYNALEITMTPYVRYNRNRYVATWEKNLPSNDNELYTLGFLQRNTYEQKWGKVV
FT                   FGFDSEYTKSSLKYNQDFDVTTSGWGAKTYMAGALYDYGVNYLAIAPYVHIDYMITKQL
FT                   KLSPGLRYDYNSYDYTNNLAPNSTDSSNTYYRPASRKDSYNHLSPKLALSYMPQQDLNL
FT                   YVRYANGFRIPQATRLYSVKVGYENINLDAEKSNTYEIGLKKNFSKKSFLELAAYYMTI
FT                   DDTIVRDATTGGYRNGGASIHKGIEASLKSEITKEFESSVSYSYSKHNYDNDPSLGNNE
FT                   ISGAPNTLANARLFYIPAYLKGLKVMAEWQYVGSYWMDDAHTVDKYNGYSIGNLKADYV
FT                   YSKKLRIFTKITNITDKKYATNARYAYGKEDYTPADPRSFYAGLEYKW"
FT   sig_peptide     complement(208998..209048)
FT                   /locus_tag="Saut_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(209457..210005)
FT                   /locus_tag="Saut_0212"
FT   CDS_pept        complement(209457..210005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0212"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="COGs: COG0164 Ribonuclease HII; InterPro IPR001352;
FT                   KEGG: tdn:Suden_0280 ribonuclease HII; PFAM: ribonuclease
FT                   HII/HIII; PRIAM: Ribonuclease H; SPTR: A6QCJ3 Ribonuclease
FT                   HII; PFAM: Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08261"
FT                   /db_xref="GOA:E0UTN0"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTN0"
FT                   /protein_id="ADN08261.1"
FT                   /translation="MGVLCGIDEAGRGPLAGDLVMAGCILHVSVDGLNDSKKLTAKKRE
FT                   ALYELIVENASYHIVKFSAHDIDNNGISACLKKGLIDILNNLKADKYLFDGNQTYGVKN
FT                   LATMVQADRKIAEVSAASILAKVTHDVDILEAAKKYPEYQFEKHKGYGTKLHVAMIKKY
FT                   GYCEIHRKTYKIKALERAL"
FT   gene            complement(210007..211071)
FT                   /locus_tag="Saut_0213"
FT   CDS_pept        complement(210007..211071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0213"
FT                   /product="uncharacterized ATPase"
FT                   /note="COGs: COG1373 ATPase (AAA+ superfamily); KEGG:
FT                   tdn:Suden_0284 uncharacterized ATPase; SPTR: A6UTZ7
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08262"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTN1"
FT                   /protein_id="ADN08262.1"
FT                   /translation="MEILLEEFYKTDLHVEKYIQRKVFIDDKSYQINGISKSGKSRLVK
FT                   NYLLSLKKSSYLYINCRDIRIDTDKLNTSLASFCNLNKIDTLVLDNYNPEIKFVNVSQL
FT                   IITSEIPYDIDVLEHLTLYPLDYEEFLAYEHKYDSSALNHFFQLGGFASMHTVPPDERI
FT                   VYLQNVLKFALSEIEFDILCLCAKFMSQKLSAFTLYERLKLTRKISKDKLYASFALLAE
FT                   KKYIHLLPKYNHARATKKVYLCDTSLKSALSIEKNFAKLFENMVYLELLKSSTECYYEE
FT                   GVDFYLPESDEIILCKPFVDERRLFKKLESIEAFLFTYGITKITVITMNKEGNISHPLS
FT                   SVDIIPFDIWALGD"
FT   gene            211249..211560
FT                   /locus_tag="Saut_0214"
FT   CDS_pept        211249..211560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0214"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="COGs: COG0051 Ribosomal protein S10; InterPro
FT                   IPR001848:IPR018268:IPR005731; KEGG: tdn:Suden_0285 30S
FT                   ribosomal protein S10; PFAM: ribosomal protein S10; SPTR:
FT                   Q30TW5 30S ribosomal protein S10; TIGRFAM: ribosomal
FT                   protein S10; PFAM: Ribosomal protein S10p/S20e; TIGRFAM:
FT                   ribosomal protein S10, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08263"
FT                   /db_xref="GOA:E0UTN2"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTN2"
FT                   /protein_id="ADN08263.1"
FT                   /translation="MEKIRLKLKAYDHRVLDRSVASIVEAVKRTGAVIRGPIPLPTKIR
FT                   KYTVLKSVHVNKKAREQFEIRMHARMIDIVSATPETVDSLMKLDLAPEVDVEVRSMDK"
FT   gene            211569..212144
FT                   /locus_tag="Saut_0215"
FT   CDS_pept        211569..212144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0215"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="COGs: COG0087 Ribosomal protein L3; InterPro
FT                   IPR000597:IPR019927; KEGG: tdn:Suden_0286 50S ribosomal
FT                   protein L3; PFAM: ribosomal protein L3; SPTR: Q7M8D4 50S
FT                   ribosomal protein L3; TIGRFAM: 50S ribosomal protein L3;
FT                   PFAM: Ribosomal protein L3; TIGRFAM: 50S ribosomal protein
FT                   L3, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08264"
FT                   /db_xref="GOA:E0UTN3"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTN3"
FT                   /protein_id="ADN08264.1"
FT                   /translation="MEYIVEKIGMSRTITVPSKPVTLLRVLDAKVCEVNEGTAIVAYNS
FT                   GKKMNKAIEGQQKKYNLPTEFNRFVTLEVANAEAGDLDLAPLADASAVKTTFNTKGRGF
FT                   SGAMKRWNFGGGPASHGHRFGRRTGSIGNAEWPGRVMKGKKMPGQYGNTQNSVKNEIVS
FT                   FDAENKIIAVLGSVSGANGALGRVKVAK"
FT   gene            212144..212758
FT                   /locus_tag="Saut_0216"
FT   CDS_pept        212144..212758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0216"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="COGs: COG0088 Ribosomal protein L4; InterPro
FT                   IPR002136; KEGG: tdn:Suden_0287 50S ribosomal protein L4;
FT                   PFAM: ribosomal protein L4/L1e; SPTR: Q30TW3 50S ribosomal
FT                   protein L4; PFAM: Ribosomal protein L4/L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08265"
FT                   /db_xref="GOA:E0UTN4"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTN4"
FT                   /protein_id="ADN08265.1"
FT                   /translation="MSAIVLNEKMEKASELALPEAFSGINPHNLYLYVKSAQAAQRANT
FT                   ATTKGRSEVRGGGKKPWAQKGGGRARAGSRRSPIFVGGGKAFGSKNNHNYDLKVNKKQK
FT                   KLALNFALNEHAQNGTLFIVDSISVESGKTKDAAAMFKALGQRDTLFVKSLLDEPTFLA
FT                   FENLHQTYVVESNELNAYLAANYRSIVIEKAVWETLTSEAK"
FT   sig_peptide     212144..212260
FT                   /locus_tag="Saut_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            212758..213039
FT                   /locus_tag="Saut_0217"
FT   CDS_pept        212758..213039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0217"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="COGs: COG0089 Ribosomal protein L23; InterPro
FT                   IPR013025; KEGG: tdn:Suden_0288 50S ribosomal protein L23;
FT                   PFAM: Ribosomal protein L25/L23; SPTR: A8ESU5 50S ribosomal
FT                   protein L23; PFAM: Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08266"
FT                   /db_xref="GOA:E0UTN5"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTN5"
FT                   /protein_id="ADN08266.1"
FT                   /translation="MADITDIKSILYTEKTLGLQEDGVIVVQTSPRMSKTGLKEVFREY
FT                   FGIIPTKINSLNQSGKVKRFRGVQGKQNDFKKFYVTLPEGAQIESLAV"
FT   gene            213041..213886
FT                   /locus_tag="Saut_0218"
FT   CDS_pept        213041..213886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0218"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="COGs: COG0090 Ribosomal protein L2; InterPro
FT                   IPR002171:IPR005880; KEGG: tdn:Suden_0289 50S ribosomal
FT                   protein L2; PFAM: ribosomal protein L2; SPTR: Q30TW1 50S
FT                   ribosomal protein L2; TIGRFAM: ribosomal protein L2; PFAM:
FT                   Ribosomal Proteins L2, RNA binding domain; Ribosomal
FT                   Proteins L2, C-terminal domain; TIGRFAM: ribosomal protein
FT                   L2, bacterial/organellar"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08267"
FT                   /db_xref="GOA:E0UTN6"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTN6"
FT                   /protein_id="ADN08267.1"
FT                   /translation="MAIKTYRPITPSRRFYTNVDSSDITAKASVRSLLVKLPTTAGRNN
FT                   NGRITSRHRQAGAKKLYRIVDFKRNKFGVSGTVSAIEYDPYRNCRIALITYADGEKRYI
FT                   LQPKGLNVGDTVESAESGLDVKPGNTMKLQNIPVGTLVHNVELKVGKGGQMVRSAGTSA
FT                   QIMGRDGKYVSLRMPSSEMRLVLGECLATVGSVGNEEFANIVIAKAGRQRHLGIRPQTR
FT                   GSAMNPIDHPHGGGEGKTNSGRHPVTPWGKPTKGAKTRRKKASDKLIITRRKPNAKRVG
FT                   "
FT   gene            213889..214164
FT                   /locus_tag="Saut_0219"
FT   CDS_pept        213889..214164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0219"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="COGs: COG0185 Ribosomal protein S19; InterPro
FT                   IPR002222:IPR005732; KEGG: tdn:Suden_0290 30S ribosomal
FT                   protein S19; PFAM: ribosomal protein S19/S15; SPTR: Q30TW0
FT                   30S ribosomal protein S19; TIGRFAM: ribosomal protein S19;
FT                   PFAM: Ribosomal protein S19; TIGRFAM: ribosomal protein
FT                   S19, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08268"
FT                   /db_xref="GOA:E0UTN7"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTN7"
FT                   /protein_id="ADN08268.1"
FT                   /translation="MARSVKKGPFVDDHLMKKVEAMKAEAKKKPIKTWSRRSMVLPDMV
FT                   GLTINVHNGRQFVPVYVTENHIGYKLGEFAPTRTFKGHKGSVQKKG"
FT   gene            214167..214484
FT                   /locus_tag="Saut_0220"
FT   CDS_pept        214167..214484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0220"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="COGs: COG0091 Ribosomal protein L22; InterPro
FT                   IPR001063:IPR005727; KEGG: tdn:Suden_0291 50S ribosomal
FT                   protein L22; PFAM: ribosomal protein L22/L17; SPTR: Q30TV9
FT                   50S ribosomal protein L22; TIGRFAM: ribosomal protein L22;
FT                   PFAM: Ribosomal protein L22p/L17e; TIGRFAM: ribosomal
FT                   protein L22, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08269"
FT                   /db_xref="GOA:E0UTN8"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTN8"
FT                   /protein_id="ADN08269.1"
FT                   /translation="MARALLKFIRVSPIKSRLIAREVQGMNAEEAMAALEFTPNKAAKI
FT                   ISKVIASAVANSGSEAEDCVITSCRVDNGPVLKRFRPRARGMASGIRKPTAHILVEVEG
FT                   K"
FT   gene            214486..215202
FT                   /locus_tag="Saut_0221"
FT   CDS_pept        214486..215202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0221"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="COGs: COG0092 Ribosomal protein S3; InterPro
FT                   IPR004044:IPR001351:IPR008282:IPR018280:IPR 005704; KEGG:
FT                   tdn:Suden_0292 30S ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; KH type 2 domain protein;
FT                   Ribosomal protein S3 domain; SPTR: Q30TV8 30S ribosomal
FT                   protein S3; TIGRFAM: ribosomal protein S3; PFAM: KH domain;
FT                   Ribosomal protein S3, C-terminal domain; Ribosomal protein
FT                   S3, N-terminal domain; TIGRFAM: ribosomal protein S3,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08270"
FT                   /db_xref="GOA:E0UTN9"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTN9"
FT                   /protein_id="ADN08270.1"
FT                   /translation="MGQKVNPIGLRLGINRNWESRWFPNFKTAPAALGEDHKIRTFLKK
FT                   ELYYAGVSNIIIERTVKRLRVTIVAARPGIIIGKKGADIEKLKTAVQKLVGKTVSINIK
FT                   EEKKAQTSAQLVAENVATQLERRVAFRRAMKKVMQGAQRSGAKGIKVAVAGRLGGAEMA
FT                   RTEWYLEGRVPLHTLRAKIDYGFAEAHTTYGIIGVKVWIFKGEVLTKGIPAEAKEEKKE
FT                   RRGRKPVRRENSEKAE"
FT   gene            215205..215630
FT                   /locus_tag="Saut_0222"
FT   CDS_pept        215205..215630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0222"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="COGs: COG0197 Ribosomal protein L16/L10E; InterPro
FT                   IPR000114:IPR016180; KEGG: tdn:Suden_0293 50S ribosomal
FT                   protein L16; PFAM: Ribosomal protein L10e/L16; SPTR: Q30TV7
FT                   50S ribosomal protein L16; TIGRFAM: ribosomal protein L16;
FT                   PFAM: Ribosomal protein L16p/L10e; TIGRFAM: ribosomal
FT                   protein L16, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08271"
FT                   /db_xref="GOA:E0UTP0"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTP0"
FT                   /protein_id="ADN08271.1"
FT                   /translation="MLMPKRTKYRKVMKGRNRGYARSGYKLSFGDIAFKAVEAGRINSR
FT                   QIESARISATRHIKRQGKIWIRVFPAKPLTAKPLETRMGKGKGAVDQWVMNIKPGRIIF
FT                   EMGGVPEEIAREALTLAMHKLPFKCKIVTAEMNNEIF"
FT   gene            215617..215805
FT                   /locus_tag="Saut_0223"
FT   CDS_pept        215617..215805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0223"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="InterPro IPR001854:IPR018254; KEGG: tdn:Suden_0294
FT                   50S ribosomal protein L29; PFAM: ribosomal protein L29;
FT                   SPTR: A6QCQ6 50S ribosomal protein L29; TIGRFAM: ribosomal
FT                   protein L29; PFAM: Ribosomal L29 protein; TIGRFAM:
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08272"
FT                   /db_xref="GOA:E0UTP1"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTP1"
FT                   /protein_id="ADN08272.1"
FT                   /translation="MKYSDLAEKSSAELQAMLKEKKTELFTLKIKQKMMQLQNTSELRV
FT                   AKKDIARMNTALAAVAK"
FT   gene            215815..216060
FT                   /locus_tag="Saut_0224"
FT   CDS_pept        215815..216060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0224"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="COGs: COG0186 Ribosomal protein S17; InterPro
FT                   IPR000266:IPR019979:IPR019984; KEGG: tdn:Suden_0295 30S
FT                   ribosomal protein S17; PFAM: ribosomal protein S17; SPTR:
FT                   Q30TV5 30S ribosomal protein S17; TIGRFAM: 30S ribosomal
FT                   protein S17; PFAM: Ribosomal protein S17; TIGRFAM: 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08273"
FT                   /db_xref="GOA:E0UTP2"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTP2"
FT                   /protein_id="ADN08273.1"
FT                   /translation="MANKREIQGNVIKIAGDKTVTIVVERRVMHPRYHKVVKRFKKYLV
FT                   HDERNEVKVGDEIIAIECRPLSKTKSFRLKSVVKGA"
FT   gene            216063..216431
FT                   /locus_tag="Saut_0225"
FT   CDS_pept        216063..216431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0225"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="COGs: COG0093 Ribosomal protein L14; InterPro
FT                   IPR000218:IPR019972:IPR005745; KEGG: sun:SUN_2331 50S
FT                   ribosomal protein L14; PFAM: ribosomal protein L14b/L23e;
FT                   SPTR: A6QCQ8 50S ribosomal protein L14; TIGRFAM: ribosomal
FT                   protein L14; PFAM: Ribosomal protein L14p/L23e; TIGRFAM:
FT                   ribosomal protein L14, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08274"
FT                   /db_xref="GOA:E0UTP3"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTP3"
FT                   /protein_id="ADN08274.1"
FT                   /translation="MIQGFTRLNVADNTGAKEIMCIKVLGGSKRRYASVGDVIVASVKK
FT                   AIPTAKVKKGKVVKAVVVRTHKEVQRENGSLIRFDDNAAVILDDKREPIGTRIFGPIGR
FT                   EVRYAGFMKIVSLAPEVV"
FT   gene            216431..216661
FT                   /locus_tag="Saut_0226"
FT   CDS_pept        216431..216661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0226"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="COGs: COG0198 Ribosomal protein L24; InterPro
FT                   IPR005824:IPR005825:IPR003256; KEGG: tdn:Suden_0297 50S
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   domain protein; SPTR: Q30TV3 50S ribosomal protein L24;
FT                   TIGRFAM: ribosomal protein L24; PFAM: KOW motif; TIGRFAM:
FT                   ribosomal protein L24, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08275"
FT                   /db_xref="GOA:E0UTP4"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTP4"
FT                   /protein_id="ADN08275.1"
FT                   /translation="MAKFNFKKGDMVEIIAGDDKGTKAAVVAVFPKKNKVIVEGCKIAK
FT                   KAVKPTEENAKGGHINKEMPIDVSNVRKVEA"
FT   gene            216666..217211
FT                   /locus_tag="Saut_0227"
FT   CDS_pept        216666..217211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0227"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="COGs: COG0094 Ribosomal protein L5; InterPro
FT                   IPR002132; KEGG: tdn:Suden_0298 50S ribosomal protein L5;
FT                   PFAM: ribosomal protein L5; SPTR: Q30TV2 50S ribosomal
FT                   protein L5; PFAM: ribosomal L5P family C-terminus;
FT                   Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08276"
FT                   /db_xref="GOA:E0UTP5"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTP5"
FT                   /protein_id="ADN08276.1"
FT                   /translation="MARLKEKYLALKPEIQAALDIKNVMQIPAFDKIVISVGAGFAMKD
FT                   NKLIQNIEDTITTIAGQKASTVIAKKSVAGFKVREGMPVGIRVTLRGENMYNFFDRLVA
FT                   IALPRVKDFRGVPRNGFDGRGNYNFGLQEQLIFPEISYDSIMQIHGMNITVVTTADSDK
FT                   AAFTLLEKMGMPFTKGSN"
FT   gene            217211..217396
FT                   /locus_tag="Saut_0228"
FT   CDS_pept        217211..217396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0228"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="COGs: COG0199 Ribosomal protein S14; InterPro
FT                   IPR001209:IPR018271; KEGG: tdn:Suden_0299 30S ribosomal
FT                   protein S14; PFAM: ribosomal protein S14; SPTR: Q30TV1 30S
FT                   ribosomal protein S14 type Z; PFAM: Ribosomal protein
FT                   S14p/S29e"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08277"
FT                   /db_xref="GOA:E0UTP6"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTP6"
FT                   /protein_id="ADN08277.1"
FT                   /translation="MAKKSMIAKAARTPKFKVRAYTRCQICGRPHSVLRDFGICRICFR
FT                   KMANEGLIPGVRKSSW"
FT   gene            217460..217858
FT                   /locus_tag="Saut_0229"
FT   CDS_pept        217460..217858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0229"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="COGs: COG0096 Ribosomal protein S8; InterPro
FT                   IPR000630; KEGG: tdn:Suden_0300 30S ribosomal protein S8;
FT                   PFAM: ribosomal protein S8; SPTR: Q30TV0 30S ribosomal
FT                   protein S8; PFAM: Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08278"
FT                   /db_xref="GOA:E0UTP7"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTP7"
FT                   /protein_id="ADN08278.1"
FT                   /translation="MAINDLVSDALTRIRNAGMRRLPVTTLVHSKSVEAVANILVDKGY
FT                   IESCNVIEDGVKKTVKVVLKYGEDGKTVINEMKRISKPGRRVYQGKEDIKRFKNGYGTI
FT                   IVSTSHGVLPNDKAYELGIGGEVMCTVW"
FT   gene            217868..218404
FT                   /locus_tag="Saut_0230"
FT   CDS_pept        217868..218404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0230"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="COGs: COG0097 Ribosomal protein L6P/L9E; InterPro
FT                   IPR019906:IPR020040:IPR002358; KEGG: tdn:Suden_0301 50S
FT                   ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain; SPTR: A0RM26 50S ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08279"
FT                   /db_xref="GOA:E0UTP8"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTP8"
FT                   /protein_id="ADN08279.1"
FT                   /translation="MSRIGKNPVEFASDISVTTNGNVITFAKGKNSVDLDTKGYVTFEV
FT                   EGNTLTFKNLSDSREHRAFWGTFRALAQNIVTGLTTGYSKQLEINGVGYRAAVKGKVLN
FT                   LQLGFSHDINYELPEGLEASVEKNVITLKSHDKQMLGQAAAEIRSFRPPEPYKGKGVKY
FT                   IDEHIVRKAGKTAKK"
FT   gene            218418..218774
FT                   /locus_tag="Saut_0231"
FT   CDS_pept        218418..218774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0231"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="COGs: COG0256 Ribosomal protein L18; InterPro
FT                   IPR005484:IPR004389; KEGG: tdn:Suden_0302 50S ribosomal
FT                   protein L18; PFAM: ribosomal protein L18P/L5E; SPTR: Q30TU8
FT                   50S ribosomal protein L18; TIGRFAM: ribosomal protein L18;
FT                   PFAM: Ribosomal L18p/L5e family; TIGRFAM: ribosomal protein
FT                   L18, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08280"
FT                   /db_xref="GOA:E0UTP9"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTP9"
FT                   /protein_id="ADN08280.1"
FT                   /translation="MNAKVLKNKIANRLKRKRRIRAKIHGSATLPRVSVFKSNRYLSVQ
FT                   AIDDATATTICSLHSKATGHKANKEGAAALGEAFAAKLKEANISEIVFDRNGYQYHGVI
FT                   AAFGDAVRANEIKF"
FT   gene            218787..219230
FT                   /locus_tag="Saut_0232"
FT   CDS_pept        218787..219230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0232"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="COGs: COG0098 Ribosomal protein S5; InterPro
FT                   IPR013810:IPR005324:IPR018192:IPR005712; KEGG:
FT                   tdn:Suden_0303 30S ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5; ribosomal protein S5 domain protein; SPTR:
FT                   Q30TU7 30S ribosomal protein S5; TIGRFAM: ribosomal protein
FT                   S5; PFAM: Ribosomal protein S5, N-terminal domain;
FT                   Ribosomal protein S5, C-terminal domain; TIGRFAM: ribosomal
FT                   protein S5, bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08281"
FT                   /db_xref="GOA:E0UTQ0"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTQ0"
FT                   /protein_id="ADN08281.1"
FT                   /translation="MTEINRDEFEESIVNIGRVTKVVKGGRRFRFTALIVVGNKNGTVG
FT                   YGVGKAKEVPDAIRKAVDNAFKNLTTVKIKGSTIAHDIEHKYNASRVLLKPASEGTGVI
FT                   AGGAARPVLELAGVQDILTKSIGSNNPNTLVRATIEALSRIKG"
FT   gene            219234..219632
FT                   /locus_tag="Saut_0233"
FT   CDS_pept        219234..219632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0233"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="COGs: COG0200 Ribosomal protein L15; InterPro
FT                   IPR001196:IPR005749; KEGG: tdn:Suden_0304 50S ribosomal
FT                   protein L15; PFAM: ribosomal protein L15; SPTR: A7H0Z4 50S
FT                   ribosomal protein L15; TIGRFAM: ribosomal protein L15;
FT                   PFAM: Ribosomal protein L18e/L15; TIGRFAM: ribosomal
FT                   protein L15, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08282"
FT                   /db_xref="GOA:E0UTQ1"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTQ1"
FT                   /protein_id="ADN08282.1"
FT                   /translation="MGIENLTPAEGSTANRKRVGRGQGSGTGKTAARGQKGQKSRSGYK
FT                   RKRNFEGGQQPLAKRLPKIGFHSTVIKPYVINVEKIKAVAELGEITMETIRSVHKVASS
FT                   VTKIKLVGASAKDLASKIKDENVTTTGN"
FT   gene            219635..220897
FT                   /locus_tag="Saut_0234"
FT   CDS_pept        219635..220897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0234"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="COGs: COG0201 Preprotein translocase subunit SecY;
FT                   InterPro IPR002208; KEGG: tdn:Suden_0305 preprotein
FT                   translocase subunit SecY; PFAM: SecY protein; SPTR: O25879
FT                   Preprotein translocase subunit secY; TIGRFAM: preprotein
FT                   translocase, SecY subunit; PFAM: eubacterial secY protein;
FT                   TIGRFAM: preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08283"
FT                   /db_xref="GOA:E0UTQ2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTQ2"
FT                   /protein_id="ADN08283.1"
FT                   /translation="MNKNLVNKILITIGFLFIYRLLAYVPVPGVDTAVIASFFDSHQSD
FT                   ALGLFNMFSGNAVQRLSIISLGIMPYITASIIMELLAATFPTLGQMKKERDGMVKYMQI
FT                   IRYATIVITLIQAVGVSVGLQSLTGPTGNSAILADHTTFIMLSAVSMLAGTMLLMWIGE
FT                   QITQSGIGNGISLIIFAGIVSAIPRAIGQTIEMVNTGAMSFITVIAILLLVLTTVGIII
FT                   YVELGERRVPITYAKKTMMQNQNKRVMNYIPIKVNLAGVIPVIFASAILMFPMTVLSSS
FT                   TNPAIQAIADYLNPNSYFFNFLTFVFVVFFAFFYASITFNAKDIADNLKRQGGFIPGIR
FT                   TGEATKNFLNETASRLTFTGALYLGLVATLPFMIIKGMGVPFFFGGTAVLIVVQVALDT
FT                   MRKIEAQIYMSKYETLSAVGL"
FT   sig_peptide     219635..219703
FT                   /locus_tag="Saut_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            220900..221658
FT                   /locus_tag="Saut_0235"
FT   CDS_pept        220900..221658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0235"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="COGs: COG0024 Methionine aminopeptidase; InterPro
FT                   IPR001714:IPR000994:IPR002467; KEGG: tdn:Suden_0306
FT                   methionine aminopeptidase; PFAM: peptidase M24; PRIAM:
FT                   Methionyl aminopeptidase; SPTR: P56102 Methionine
FT                   aminopeptidase; TIGRFAM: methionine aminopeptidase, type I;
FT                   PFAM: Metallopeptidase family M24; TIGRFAM: methionine
FT                   aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08284"
FT                   /db_xref="GOA:E0UTQ3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTQ3"
FT                   /protein_id="ADN08284.1"
FT                   /translation="MAIALRKPAEIEKLRAANKIVGGALDLLRENTKVGMSLKEMDAMA
FT                   EDYIRSHGARPSFKGLYGFPNAVCTSPNEVIIHGIPSDYKLQEGDVIGYDIGTELDGWF
FT                   GDAAISVGVGEITKADEDLIACSKDTLMHAIENIKEGMRFKELSFLMENFIRDRGFVPL
FT                   KNFCGHGIGKKPHEEPEIPNYLEGGSPKSGPKIKNGMVFCLEPMICQKDSKPIILENGW
FT                   DVVSADGLRGSHYEHTVAVINGKAEILSLA"
FT   gene            221678..221896
FT                   /locus_tag="Saut_0236"
FT   CDS_pept        221678..221896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0236"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="COGs: COG0361 Translation initiation factor 1
FT                   (IF-1); InterPro IPR006196:IPR004368; KEGG: tdn:Suden_0307
FT                   translation initiation factor IF-1; PFAM: S1 IF1 family
FT                   protein; SPTR: Q30TU3 Translation initiation factor IF-1;
FT                   TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   Translation initiation factor 1A / IF-1; TIGRFAM:
FT                   translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08285"
FT                   /db_xref="GOA:E0UTQ4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTQ4"
FT                   /protein_id="ADN08285.1"
FT                   /translation="MAKADVIEVDGKIIEALPNATFRVELENGHIILCHIAGKMRMHYI
FT                   KILPGDKVKLELTPYSLDKGRITYRYK"
FT   gene            complement(221924..222217)
FT                   /locus_tag="Saut_0237"
FT   CDS_pept        complement(221924..222217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0237"
FT                   /product="Chorismate mutase"
FT                   /note="InterPro IPR002701; KEGG: tdn:Suden_0309 chorismate
FT                   mutase; PFAM: Chorismate mutase; SPTR: Q64EM5 Putative
FT                   uncharacterized protein; PFAM: Chorismate mutase type II"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08286"
FT                   /db_xref="GOA:E0UTQ5"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTQ5"
FT                   /protein_id="ADN08286.1"
FT                   /translation="MKKCNSLQEVRNEIDKIDTQLVELISERSHLIRQAAGFKESVEEV
FT                   KAQDRIDDIMQRVRKKAIELNVNPNMISELFKIMIDEMVETEISELRNAGNF"
FT   gene            complement(222364..222570)
FT                   /locus_tag="Saut_0238"
FT   CDS_pept        complement(222364..222570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08287"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTQ6"
FT                   /protein_id="ADN08287.1"
FT                   /translation="MAKKKKICDLSKENIEYIQDNINYKILRFNPEYMTVHVIKFEGNE
FT                   KQEIVDMPFAHLPKAIKKIIKPN"
FT   gene            complement(222574..223428)
FT                   /locus_tag="Saut_0239"
FT   CDS_pept        complement(222574..223428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG2996 conserved hypothetical protein; KEGG:
FT                   tdn:Suden_0312 hypothetical protein; SPTR: A3HSD0 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08288"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTQ7"
FT                   /protein_id="ADN08288.1"
FT                   /translation="MEKTISPYLELGKMNTLRVDRDTTPGLYLMAQDGNDVLLPGQYVT
FT                   DDMIENSLVDVFLYTDSEDRLVANTNKPLAMLDEFALLEVVDVAPFGAFMNWGLPKDLL
FT                   VPKMFQKTPFEIGEKRFIKIIYDERTHRLVGTEKLGDFFDRKPKGLTANKEAEILVISK
FT                   TPLGFKCIVNGKYEGLIYHNEIFEDIKLGDKKTAYVKTVRKDGNIDLTLRRPGSKKDGS
FT                   SAQKVLELLQQSKGIMPYNYKSDAELIKSVFGLSKKEFKRSLTQLQDDGKIEVKDTGIY
FT                   LKA"
FT   gene            complement(223533..224699)
FT                   /locus_tag="Saut_0240"
FT   CDS_pept        complement(223533..224699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0240"
FT                   /product="NnrS family protein"
FT                   /note="COGs: COG3213 Uncharacterized protein involved in
FT                   response to NO; InterPro IPR010266; KEGG: sun:SUN_1235
FT                   hypothetical protein; PFAM: NnrS family protein; SPTR:
FT                   B9TDA1 Putative uncharacterized protein; PFAM: NnrS
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08289"
FT                   /db_xref="GOA:E0UTQ8"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTQ8"
FT                   /protein_id="ADN08289.1"
FT                   /translation="MQTKENYFLSQPHQPFFLLGIINAIVMMLIFALGYKGVLSLHGDS
FT                   LTFHSYSLIFLVFTNFFTGFIFTTFPRFNQTQVIEKKYYTNIFYANTLASLLFLVGAFS
FT                   SELLTLGAMLLSLIAQIFIVLKLKNIYETGMAPDKSDSFWILNANYFGLFGNALFILSF
FT                   FVPAILPIAITISFYMYLIFFAFSVGQRMIPFFSHSFAQKNESFIKIIFILFVLKSIFA
FT                   SADIKSVQILVDLLLAGYMFLEFKRWDLHPFQSPPILWILHLALFWLPVSFFLSALSLG
FT                   AEIFLDTSFYFLNIHLLAIGFLTTLLIGFGTRVTLGHSGQPPQADTLATKIFLSIQMVV
FT                   LLRALFSINVAFGWGLNFLFDISFTAWLLLFLVWGGRYFKVLVFGSKL"
FT   gene            complement(224709..225968)
FT                   /locus_tag="Saut_0241"
FT   CDS_pept        complement(224709..225968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1533 DNA repair photolyase; KEGG:
FT                   nis:NIS_0569 hypothetical protein; SPTR: A1HRP5 Radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08290"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTQ9"
FT                   /protein_id="ADN08290.1"
FT                   /translation="MNSYAEKFNKATQNTFFQNLPLHEQEFIKEKAFEYKFSYQEIKQI
FT                   INFARDLGMWDEKRITAIFPEHPQRKVVFSRLTKAYEAIRNAPNSYENFTLKNIPQEQK
FT                   YTFKTAPKEGFGLGLCPVASEKTRCCNLLTLDAVESCGFDCSYCSIQSFYNQNTITFDS
FT                   NFADKLLNLQLEVNKTYHIGTGQASDSLMFGNREGILDALFEFARKNPNVILEFKTKSD
FT                   NIKYLLENEVPKNILCTWSLNTQTIIDNEEHLTASLSKRINAARKMADKGVKVGFHFHP
FT                   IIEYKGYLDEYQKVYEELILQFDPQEVALVSFGTLTFIKPVIKQLREREFRTKITQIPH
FT                   EDASGKTSYPDATKIEMFKHAYESFKPWRETKEKVFFYLCMEEHLMWAKTFGYQYATNN
FT                   DFEHAMLGAYCEKLGQDFLL"
FT   gene            complement(225996..226493)
FT                   /locus_tag="Saut_0242"
FT   CDS_pept        complement(225996..226493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0242"
FT                   /product="heat shock protein Hsp20"
FT                   /note="COGs: COG0071 Molecular chaperone (small heat shock
FT                   protein); InterPro IPR002068; KEGG: rfe:RF_1004 small heat
FT                   shock protein; PFAM: heat shock protein Hsp20; SPTR: Q4UKR8
FT                   Small heat shock protein C2; PFAM: Hsp20/alpha crystallin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08291"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTR0"
FT                   /protein_id="ADN08291.1"
FT                   /translation="MKKILSSVLLSSLLAGSAFAVSVNEMNPYDADFAKMNQYFSSLLE
FT                   SHLSASALNNFSYPRTDIQDLKDTIILKFDLAGVEKKNIKLSIDDNKILTLEGEKKESK
FT                   EQKSKEFVKKEIFYGSFKKAIQLPENIDENKLQTKFENGILTVTIPKTEIKKQKAKLIP
FT                   IK"
FT   sig_peptide     complement(226434..226493)
FT                   /locus_tag="Saut_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(226524..226949)
FT                   /locus_tag="Saut_0243"
FT   CDS_pept        complement(226524..226949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0243"
FT                   /product="heat shock protein Hsp20"
FT                   /note="COGs: COG0071 Molecular chaperone (small heat shock
FT                   protein); InterPro IPR002068; KEGG: sun:SUN_0379 heat shock
FT                   protein HSP20; PFAM: heat shock protein Hsp20; SPTR: A1HQE7
FT                   Heat shock protein Hsp20; PFAM: Hsp20/alpha crystallin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08292"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTR1"
FT                   /protein_id="ADN08292.1"
FT                   /translation="MDIIKTSKDLVEKAEEEVEKGLEVVKDTFHNVASHLPLANLAKHH
FT                   NDTFTIEVDLPGVKKEDIELKVEDDYLTATAVRKFKNEVNEDDYYLCESDFGVISRSFI
FT                   LPENIDRDKIQAKFEDGRLYLTLEKLESKKTKNISIN"
FT   gene            complement(226961..227410)
FT                   /locus_tag="Saut_0244"
FT   CDS_pept        complement(226961..227410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0244"
FT                   /product="heat shock protein Hsp20"
FT                   /note="COGs: COG0071 Molecular chaperone (small heat shock
FT                   protein); InterPro IPR017447:IPR002068:IPR007052; KEGG:
FT                   tdn:Suden_0513 heat shock protein HSP20; PFAM: heat shock
FT                   protein Hsp20; CS; SPTR: Q4UKR8 Small heat shock protein
FT                   C2; PFAM: Hsp20/alpha crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08293"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTR2"
FT                   /protein_id="ADN08293.1"
FT                   /translation="MLVTRHRNPTNTNNTKRFDLINEFFNALETQNSEEPREVFDFIPA
FT                   VNTRESDDAYYIELDLPGIKKEDVEISIDKNILTIKGKREVKREEKKDDYYRVESAYGT
FT                   FARSFTLPEKVDTENIRASSEDGVVEITIPKLKVEKDTTKKIEIE"
FT   gene            complement(227470..228153)
FT                   /locus_tag="Saut_0245"
FT   CDS_pept        complement(227470..228153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0245"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR000595; KEGG: tdn:Suden_0512 cyclic
FT                   nucleotide-binding domain-containing protein; PFAM: cyclic
FT                   nucleotide-binding; SMART: cyclic nucleotide-binding; SPTR:
FT                   A0YJJ4 Transcriptional Regulator, Crp/Fnr family protein;
FT                   PFAM: Cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08294"
FT                   /db_xref="GOA:E0UTR3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTR3"
FT                   /protein_id="ADN08294.1"
FT                   /translation="MQNNSKHLELLDNTNKTFEEEFYKYAKPFEYEKGSSPFYPDDLLK
FT                   YFYVVMDGRVKTYQINFQTNKEQTLFIYKRGDMFDVISLLDGKPHEVIYEVIEDANILR
FT                   LPIERVRYWLENDLTFNKKFFPYLAAHMRYTEELATELALHDTKERFLNLLVQNLNPNN
FT                   RFRYQLLQNLSNSEIAKLLGTVRHVIERSIKQLKADDIIETGRRNIKVKNLQKLLDKTS
FT                   QMLLK"
FT   gene            complement(228166..229266)
FT                   /locus_tag="Saut_0246"
FT   CDS_pept        complement(228166..229266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0246"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="COGs: COG2603 ATPase; InterPro IPR001763:IPR017582;
FT                   KEGG: tdn:Suden_1161 tRNA 2-selenouridine synthase; SMART:
FT                   Rhodanese domain protein; SPTR: Q30RE2 tRNA 2-selenouridine
FT                   synthase; TIGRFAM: tRNA 2-selenouridine synthase; PFAM:
FT                   Rhodanese-like domain; TIGRFAM: tRNA 2-selenouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08295"
FT                   /db_xref="GOA:E0UTR4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTR4"
FT                   /protein_id="ADN08295.1"
FT                   /translation="MHLPLSDDFLSIVLNETPLLDVRAPIEFNKGKFINAVNIPILDDE
FT                   ERRLVGTKYKEAGNAAAIELAESLIKNEGKEKRVALWQEYLKENPDAKLYCFRGGQRSG
FT                   ISQEWLKEANIDITRLKGGYKAFRNFLIQQTEEISAVTPTLILGGPTGSGKTILLNKLQ
FT                   NAIDLEGIANHRGSSFGSFTNAQPSQIDFENNLAYKLIQFHHKDFNKLVLEHESHNIGR
FT                   TFIPKPVYDNFMQGELVLLQTPLDVRARITYEEYVVSALREYEMLYNDAGLQKWAENVK
FT                   AGLKRIQKRLGNQLYTQLTYLFDEAYFIHTQSEAKALYIEWITLLLERYYDPMYDYQIQ
FT                   KSPIPIVFQGDEQSVLDFIKKQETKI"
FT   gene            complement(229267..230298)
FT                   /locus_tag="Saut_0247"
FT   CDS_pept        complement(229267..230298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0247"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /note="COGs: COG0709 Selenophosphate synthase; InterPro
FT                   IPR010918:IPR000728:IPR004536; KEGG: sun:SUN_1829
FT                   selenide,water dikinase; PFAM: AIR synthase related
FT                   protein; AIR synthase related protein domain protein; SPTR:
FT                   A6QBB7 Selenide, water dikinase; TIGRFAM: selenide, water
FT                   dikinase; PFAM: AIR synthase related protein, N-terminal
FT                   domain; AIR synthase related protein, C-terminal domain;
FT                   TIGRFAM: selenium donor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08296"
FT                   /db_xref="GOA:E0UTR5"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTR5"
FT                   /protein_id="ADN08296.1"
FT                   /translation="MKDIKLTQYSHGAGCGCKISPKLLDSILKSSRETIQYPELLVGNS
FT                   SKDDAAAFDLGNGTSVLSTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGKPLMAISIF
FT                   GWPINKLDANVAREVIDGGRSVCEEAGIPLAGGHSIDSPEPIFGLAVTGIANNEHIKRN
FT                   NTAEADCELFLTKPLGIGILTTAQKQGKISEGDIDIAIEAMCTLNKIGAEISQLEGVTA
FT                   LTDVTGFGLLGHLSEICEGSGISAVVEFEKVPTLKNVKKYLEMGCVPGGTRRNFESYGE
FT                   KISPMTTEQQDILCDAQTSGGLLCAVRKDALDDFLSITKNAGLTLESIGKTTAPSKYLV
FT                   EVL"
FT   gene            230371..230814
FT                   /locus_tag="Saut_0248"
FT   CDS_pept        230371..230814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4087 Soluble P-type ATPase; KEGG:
FT                   sun:SUN_1830 hypothetical protein; SPTR: A6UUY6 Putative
FT                   HAD family hydrolase; PFAM: haloacid dehalogenase-like
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08297"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTR6"
FT                   /protein_id="ADN08297.1"
FT                   /translation="MHTNIKYIVLDYNGTIAKDGVLKEELRSLLPLLAQKYTLHVITAD
FT                   TFGSVKNELKDFDLHVKVLQSENHTLEKEAYISGLDASECAAIGNGNNDMKMLQKAAIG
FT                   ICVMGDEGCSTKSLFASDIVCKSISEALELFIYPKRLRATLRV"
FT   gene            complement(230804..231433)
FT                   /locus_tag="Saut_0249"
FT   CDS_pept        complement(230804..231433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0249"
FT                   /product="nitroreductase"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro IPR000415;
FT                   KEGG: abu:Abu_1062 NAD(P)H-flavin nitroreductase; PFAM:
FT                   nitroreductase; SPTR: O34475 Putative NAD(P)H
FT                   nitroreductase yfkO; PFAM: Nitroreductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08298"
FT                   /db_xref="GOA:E0UTR7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTR7"
FT                   /protein_id="ADN08298.1"
FT                   /translation="MQNQFIQAMDFRHACKIFDKNKKISDENMHFILECARKSPSSFGM
FT                   EAWKFLVITNEALKAKLRPACWNQVQITSCSHLVIVLAGIESVKVESGKVKKRFARREM
FT                   PKEALDMYMDLYAKHLATTLSSNENIYCWSAKQTYIAAANMMTGAAFIGIDSCPIEGFE
FT                   KEKVEEILALDTKKFQVAMLLPFGYRLNPQPEQIRLSFDEVVEFIL"
FT   gene            231526..231870
FT                   /locus_tag="Saut_0250"
FT   CDS_pept        231526..231870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08299"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTR8"
FT                   /protein_id="ADN08299.1"
FT                   /translation="MTLGKCPYCDDGEIEVRDKEVSGKKVKLYACTNAQWTTEDGEMFE
FT                   VTQESTCSFRIWQNSLAKYGKWLNYKEVRELLSEGELEVELLSKKYGKKFYYTKTVVLN
FT                   EEYGVSVLWD"
FT   gene            231889..233109
FT                   /locus_tag="Saut_0251"
FT   CDS_pept        231889..233109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0251"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR004358:IPR013655:IPR013767:IPR003594:IPR
FT                   001610:IPR000014:IPR000700:IPR005467; KEGG: tdn:Suden_1243
FT                   PAS/PAC sensor signal transduction histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold-3 domain
FT                   protein; PAS fold domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; PAC repeat-containing protein; SPTR:
FT                   A9A1L6 Sensor protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08300"
FT                   /db_xref="GOA:E0UTR9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTR9"
FT                   /protein_id="ADN08300.1"
FT                   /translation="MLEQYKEAIEKSNIISKTDVNGIITFVNDEFCKISGYSKEELIGK
FT                   NHNIVRHPDVPASQFKALWETIKAKKTYKATVKNRAKNGSTFYVNTTVIPILDEKNNIE
FT                   EFIAIRYDVTKEVFYKQSLEQKEKELEELNENLEKRVQEKTKELKELNETLELRVYEEI
FT                   AKNEQKQKVMFWQSRLASLGEMLANIAHQWRQPLTELSLTLFSLKKAALQNNEKEVQSL
FT                   YDESKLIIQNMSTTIDDFTNFFKPTKHKHYFKIAQSINESLSILEKIITKEMITIRTDF
FT                   EDVEVLGISNELTQVMINLIQNSKDAFLQSGVLLKEINIRVKKEKEFAIIEFEDNAGGI
FT                   KEKEIYKIFEPYFTTKHSSSGTGLGLFMSKMICEQGLNGSIDVKSKKGFTTFSIKIPLQ
FT                   DRDKANA"
FT   gene            233102..233767
FT                   /locus_tag="Saut_0252"
FT   CDS_pept        233102..233767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0252"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR001867; KEGG: tdn:Suden_1242
FT                   two component transcriptional regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator domain
FT                   protein; SMART: response regulator receiver; SPTR: A3I701
FT                   Transcriptional activator protein; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08301"
FT                   /db_xref="GOA:E0UTS0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTS0"
FT                   /protein_id="ADN08301.1"
FT                   /translation="MRNKFLKSLKILLVEDEEKLSSLLKNAIGDSFHSFLLAKDGNEGL
FT                   EIYKKVLPDIVITDIMMPNKTGLEMAKEIKKINPESKIIILSAFSDVEKLLSAIDIGVV
FT                   KYFIKPFDPDEVLTYILSLEEVIGEKSIPLAEGFVFNKTTKSLYRNNRYIALSKKEIAF
FT                   LEVLLEENIVAYQKIKKLVWNEMVSDARLRTFIRRLREKTSKELLINIKGEGYQIALS"
FT   gene            complement(233787..233930)
FT                   /locus_tag="Saut_0253"
FT   CDS_pept        complement(233787..233930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08302"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTS1"
FT                   /protein_id="ADN08302.1"
FT                   /translation="MIKIILAFTLAIVALQAQETVHYDKKEVKKAAISKPNHPGENLYI
FT                   NR"
FT   sig_peptide     complement(233880..233930)
FT                   /locus_tag="Saut_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(234062..234763)
FT                   /locus_tag="Saut_0254"
FT   CDS_pept        complement(234062..234763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0254"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR007197:IPR012840; KEGG: tdn:Suden_1240
FT                   putative radical-activating enzyme; PFAM: Radical SAM
FT                   domain protein; SPTR: Q64EG4 Pyruvate-formate
FT                   lyase-activating enzyme; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   PFAM: Radical SAM superfamily; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08303"
FT                   /db_xref="GOA:E0UTS2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTS2"
FT                   /protein_id="ADN08303.1"
FT                   /translation="MNTDSANSLKSEKCIYDITKFTHLDYPDQLACIFWFSGCNMRCDF
FT                   CYNKDIVFAKKGSYTLEDALAFLRTREHLLDAVVLSGGEASSYDLTAFCRQIKKLGFLI
FT                   KLDTNGTNYLHVKQLIDLELLDYVALDYKAPQYKFTQITHSNKYEEFNKTLDLLINSNI
FT                   DFEVRTTLHADLLNSDDINLIIEDLKLKGYNKTYYIQEFLDTQSNIGGLEKPSKSFEKS
FT                   QLSNNLPIIWR"
FT   gene            complement(234729..234878)
FT                   /locus_tag="Saut_0255"
FT   CDS_pept        complement(234729..234878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0255"
FT                   /product="oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase"
FT                   /note="KEGG: nam:NAMH_1784 oxygen-sensitive
FT                   ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08304"
FT                   /db_xref="GOA:E0UTS3"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTS3"
FT                   /protein_id="ADN08304.1"
FT                   /translation="MSKNEILELVKENRQKCIVYTRVMGYHRPVESFNIGKTGEHRQRK
FT                   QFKE"
FT   gene            complement(234875..236983)
FT                   /locus_tag="Saut_0256"
FT   CDS_pept        complement(234875..236983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0256"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="COGs: COG1328 Oxygen-sensitive
FT                   ribonucleoside-triphosphate reductase; InterPro
FT                   IPR005144:IPR012833; KEGG: tdn:Suden_1239 anaerobic
FT                   ribonucleoside triphosphate reductase; PFAM: ATP-cone
FT                   domain protein; SPTR: A3KTC3 Putative uncharacterized
FT                   protein; TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; PFAM: ATP cone domain; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08305"
FT                   /db_xref="GOA:E0UTS4"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTS4"
FT                   /protein_id="ADN08305.1"
FT                   /translation="MVEYILKRDGSYKQFFSYKIEDAIKKAFLSEHVDFDETVYIKVIQ
FT                   RLDAKRVVAVEDIQDIIEQELFKAKYFDVMRSFMLYRHLHKLQRDNLLEDDTTYINSTQ
FT                   TIEEYISGSDWRIKANSNTGYSNAGLVNNTAGKVIANYWLDKIYSKEEGYAHRNGDYHI
FT                   HDLDCLTGYCAGWSLRVLLDEGFNGVRGRVESNAPKHFREALGQMANFLGILQSEWAGA
FT                   QAFSSFDTYLAPYLFKDQLSYKEVKKSIRSFIYNLNVPARWGQSPFTNITIDWNVPDDL
FT                   KDQIPTSKQRHLFENIDDANLRFKAQERGVTSLTDMTYKDFQEEMHMINKAYYEVMTEG
FT                   DKTGQPFTFPIPTVNITEDFDWYGENTDLLFENTAKIGSSYFQNFIGSQYKRDKNGELI
FT                   ANDEAYKPGHVRSMCCRLQLDLRELLKRGGGLFGSAEMTGSIGVVTINMARLGFLHKGN
FT                   MASLLERLDELMEYAKSTLEKKRVFIQEMYDRGLFPYTKRYLPGFKNHFSTIGVNGINE
FT                   MILNFSGGAYDISSTQGIDFATEILNHIRERMVVFQEETGNLYNLEATPAEGTTYRFAK
FT                   EDKKRYSDKIIQAGMDENIYYTNSSQIPVGLTDDPFEALTLQDDLQTKYTGGTVLHLYM
FT                   QERLSSTEACRKLVKNVITNFRLPYITVTPLFSVCPKHGYISGEHEYCPKCDEELINEY
FT                   ENQKKEAS"
FT   gene            237217..238101
FT                   /locus_tag="Saut_0257"
FT   CDS_pept        237217..238101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0257"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="COGs: COG1209 dTDP-glucose pyrophosphorylase;
FT                   InterPro IPR005835:IPR005907; KEGG: fph:Fphi_1250 putative
FT                   glucose-1-phosphate thymidyl transferase; PFAM: Nucleotidyl
FT                   transferase; SPTR: A3XR70 Glucose-1-phosphate
FT                   thymidylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   thymidylyltransferase; PFAM: Nucleotidyl transferase;
FT                   TIGRFAM: glucose-1-phosphate thymidylyltransferase, short
FT                   form"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08306"
FT                   /db_xref="GOA:E0UTZ7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTZ7"
FT                   /protein_id="ADN08306.1"
FT                   /translation="MKGIILAGGSGTRLYPITKGVSKQLVPIYDKPMIYYPLSVLMLAG
FT                   ITEVLIISTPNDLPRFEELLGHGSDIGMKFSYKVQPSPDGLAQAFILGKEFIGNSDVCL
FT                   VLGDNIFYGHGLTNLLAKSVINAKDKNQATVYGYYVNDPERYGVAEFNEKGEVISIEEK
FT                   PANPKSNYAVVGLYFYPNDVVKKAKDVKPSDRGELEITTLNEDYLREKRLRVKLMGRGY
FT                   AWLDTGTHESLLEASLFIQTIEKRQGLKVACIEEIAYEMGYISNEKLIELAQPLKKNEY
FT                   GQYLLSRVREGIV"
FT   gene            238104..238682
FT                   /locus_tag="Saut_0258"
FT   CDS_pept        238104..238682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0258"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="COGs: COG1898 dTDP-4-dehydrorhamnose 3 5-epimerase;
FT                   InterPro IPR000888; KEGG: fph:Fphi_1251
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 35-epimerase related; PRIAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; SPTR: Q12TY0
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; TIGRFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase; TIGRFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08307"
FT                   /db_xref="GOA:E0UTZ8"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTZ8"
FT                   /protein_id="ADN08307.1"
FT                   /translation="MKFVRTEIPDVVLIEPVVHGDERGYFVETFRADKLEEFLGYKINF
FT                   CQDNESKSSRGVLRGLHYQLHPAAQTKLVRVIQGRVLDVAVDIRKESLTFGKHVAVELN
FT                   AENKHQLLVPRGFAHGFVVLEDDTIFAYKVDNYYSPENDRGILFSDEALNIDWTIPYSE
FT                   LKLSAKDKVQPKLTETNDIFDYKVNYYND"
FT   gene            238675..239544
FT                   /locus_tag="Saut_0259"
FT   CDS_pept        238675..239544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0259"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="COGs: COG1091 dTDP-4-dehydrorhamnose reductase;
FT                   InterPro IPR013120:IPR003869:IPR005913:IPR001509; KEGG:
FT                   fph:Fphi_1252 dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   polysaccharide biosynthesis protein CapD; NAD-dependent
FT                   epimerase/dehydratase; PRIAM: dTDP-4-dehydrorhamnose
FT                   reductase; SPTR: A3XR71 Putative dTDP-4-dehydrorhamnose
FT                   reductase; TIGRFAM: dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   RmlD substrate binding domain; TIGRFAM:
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08308"
FT                   /db_xref="GOA:E0UTZ9"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0UTZ9"
FT                   /protein_id="ADN08308.1"
FT                   /translation="MISILITGANGQVGSELKELSCKYNAYNFFFTDRETLDITDNKAV
FT                   KKFIEDNHINTIINTAAYTAVDKAEDDVTNADKINHLAVKNLAQISKEKDIKLIHISTD
FT                   YVFDGKNYKPYTEIDETNPNGVYGKTKLDGEKVLQEIKPKNSIIIRTSWVYSSFGNNFV
FT                   KTMLRLGKERDGVGVIFDQVGTPTYARDLAKTILDIIPKIQNSKLEIYHYSNEGVLSWY
FT                   DFAKEIIRMAKLDCKINPIETKEYPTPAARPYYSLLNKAKIKQTFNVIIPYWKDSLDTC
FT                   LKIMGERK"
FT   gene            239548..240612
FT                   /locus_tag="Saut_0260"
FT   CDS_pept        239548..240612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0260"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="COGs: COG1088 dTDP-D-glucose 4 6-dehydratase;
FT                   InterPro IPR013120:IPR002225:IPR003869:IPR001509:IPR
FT                   002198:IPR005888; KEGG: abu:Abu_1816 dTDP-glucose
FT                   4,6-dehydratase; PFAM: NAD-dependent epimerase/dehydratase;
FT                   Male sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; SPTR: A3J370 dTDP-glucose 4,6-dehydratase;
FT                   TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM: NAD dependent
FT                   epimerase/dehydratase family; TIGRFAM: dTDP-glucose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08309"
FT                   /db_xref="GOA:E0UU00"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU00"
FT                   /protein_id="ADN08309.1"
FT                   /translation="MFDNSNKTILVTGCAGFIGSNFVPYFLDKYNDYNIVNLDLLTYAG
FT                   NLGNLKEAQNNPRYKFIKGDICNRELVEFIFNEYDIRGVIHFAAESHVDNSIKNPGIFI
FT                   ETNVNGTFTLLDVAYKYWMDAPFKYKERFTTDASASAKPRFHHISTDEVYGTLNETDLF
FT                   TEETPYAPNSPYSASKASSDMIVRSYQETYGLNTVITNCSNNYGPKQHDEKLIPTIIRK
FT                   ALAGENIPIYGDGKNIRDWLYVLDHCKGIDLVYHSGKEANVYNIGGKNERTNLQIVNSI
FT                   TSILDEKVPPKEKIDKESYKELITFVEDRAGHDRRYAIDATKLENELGWKADENFDTGI
FT                   VKTVNWYLGKYNDN"
FT   gene            240602..241513
FT                   /locus_tag="Saut_0261"
FT   CDS_pept        240602..241513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0261"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="COGs: COG0175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase; InterPro
FT                   IPR002500:IPR011784; KEGG: sun:SUN_1722 sulfate
FT                   adenylyltransferase subunit 2; PFAM: phosphoadenosine
FT                   phosphosulfate reductase; SPTR: A6QB13 Sulfate
FT                   adenylyltransferase subunit 2; TIGRFAM: sulfate
FT                   adenylyltransferase, small subunit; PFAM: Phosphoadenosine
FT                   phosphosulfate reductase family; TIGRFAM: sulfate
FT                   adenylyltransferase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08310"
FT                   /db_xref="GOA:E0UU01"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU01"
FT                   /protein_id="ADN08310.1"
FT                   /translation="MITKEKLTHLKQLEAESIHILREVAAEFSNPVMMYSVGKDSSVML
FT                   HLAMKAFAPAKPPFKFLHVDTLWKFHEMIEFRDNRAKELGFDLVVHSNPEGIAMNISPF
FT                   EHGSKVHTDIMKTEALKQALDKGGYDAVIGGARRDEEKSRAKERIFSFRDKQHRWDPKN
FT                   QRPELWNIYNTAIAKGESVRVFPISNWTELDIWQYIYLEGIPIPSLYFAKKRPVVEYEG
FT                   TKILVDDERMPKELRERAKMEMVRFRTLGCYPLTGAINSTASTLPEIIKEMLLSTSSER
FT                   EGRLIDKDSEGAMERKKVEGYF"
FT   gene            241513..242952
FT                   /locus_tag="Saut_0262"
FT   CDS_pept        241513..242952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0262"
FT                   /product="sulfate adenylyltransferase subunit 1"
FT                   /EC_number="2.7.7.4"
FT                   /note="COGs: COG2895 GTPase - Sulfate adenylate transferase
FT                   subunit 1; InterPro IPR000795:IPR011779; KEGG: sun:SUN_1721
FT                   sulfate adenylyltransferase subunit 1; PFAM: protein
FT                   synthesis factor GTP-binding; PRIAM: Sulfate
FT                   adenylyltransferase; SPTR: A6QB12 Sulfate
FT                   adenylyltransferase subunit 1; TIGRFAM: sulfate
FT                   adenylyltransferase, large subunit; PFAM: Elongation factor
FT                   Tu domain 2; Elongation factor Tu GTP binding domain;
FT                   TIGRFAM: sulfate adenylyltransferase, large subunit; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08311"
FT                   /db_xref="GOA:E0UU02"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU02"
FT                   /protein_id="ADN08311.1"
FT                   /translation="MSSKNEKIALDIESYLKEHENKDMLRFLTCGSVDDGKSTLIGRML
FT                   YDSKMIFDDQLSAAQSESEKYGTTGEKLDMALLVDGLQSEREQGITIDVAYRFFATEKR
FT                   KFIIADTPGHEQYTRNMVTGASTADVAIILIDARKGILTQTRRHSFIVNLLGIEHVIVA
FT                   INKMDLVDFSEDVFNEIKQAYSDLANELGIKNTYYIPLSALDGDNVVDKSEKTPWYDGK
FT                   PLLNLLDTMDISKEIKEENFRLPVQYVNRPNLNFRGFCGTIASGNVKAGDEITVLPSGK
FT                   TTKVKNIINAGDITEANRSAICNEAYAPMAVTITTEDEIDISRGDMIVHTKNMPRVSNS
FT                   LKVMLVWMDESSMQVGKTYDIKRATSAMPGVFEHINYKVDVNTYERTQVKKLELNDIAS
FT                   CKMVLTRPIAADKYKENHETGSFIVVDRVTNNTVGAGMIVDVAKREEDSDVKAHREYTK
FT                   AEKELNRYIRENFPEWNCKTI"
FT   gene            242952..243677
FT                   /locus_tag="Saut_0263"
FT   CDS_pept        242952..243677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0263"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="COGs: COG0529 Adenylylsulfate kinase and related
FT                   kinase; InterPro IPR018638:IPR002891; KEGG: sun:SUN_1720
FT                   hypothetical protein; PFAM: adenylylsulfate kinase; Protein
FT                   of unknown function DUF2061, membrane; PRIAM:
FT                   Adenylyl-sulfate kinase; SPTR: B5IDW1 Adenylyl-sulfate
FT                   kinase; TIGRFAM: adenylylsulfate kinase; PFAM: Predicted
FT                   membrane protein (DUF2061); Adenylylsulphate kinase;
FT                   TIGRFAM: adenylylsulfate kinase (apsK)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08312"
FT                   /db_xref="GOA:E0UU03"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR018638"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU03"
FT                   /protein_id="ADN08312.1"
FT                   /translation="MYKETNRRSIVKGISWRIVATSTTIIIVYVFFGRLDLAIAAGVVE
FT                   TVLKVGLYWAHERVWMKIRWGKKKIEPFNLWFTGLPLSGKTTIADRVYKELEKLHIPIE
FT                   RLDSKDIRDVVPDIGFSREDRNRHMKRVGHLIKTLQNNSISTVASFVSPYTESRKAIRK
FT                   MVKNNVVVYVKADIESCKQRDYKGVYEKAMKGELQNFSGVNDVYEEPQYAEIVIDTNTI
FT                   SVDEASQTIVKYIKKNYVK"
FT   gene            243667..244269
FT                   /locus_tag="Saut_0264"
FT   CDS_pept        243667..244269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0264"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="COGs: COG0529 Adenylylsulfate kinase and related
FT                   kinase; InterPro IPR002891; KEGG: sun:SUN_1719
FT                   adenylylsulfate kinase; PFAM: adenylylsulfate kinase;
FT                   PRIAM: Adenylyl-sulfate kinase; SPTR: A1U3X8
FT                   Adenylyl-sulfate kinase; TIGRFAM: adenylylsulfate kinase;
FT                   PFAM: Adenylylsulphate kinase; TIGRFAM: adenylylsulfate
FT                   kinase (apsK)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08313"
FT                   /db_xref="GOA:E0UU04"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU04"
FT                   /protein_id="ADN08313.1"
FT                   /translation="MSNENIVWHEHHVSKKQRAKIKEQKSCILWFTGLSGSGKSTIANA
FT                   VEVKLNEMGKHTYLLDGDNIRLGLNAGLGFSEEERVENIRRIGEVSKLFVDAGMIVLSA
FT                   FISPFKQEREKVRKLVKKSEFIEVFIDTPLEVCQSRDPKGLYKKAQKGEIPNFTGISSP
FT                   YEAPKKAEIHIKTDKILVEESVQIIIEYLQERGYLEC"
FT   gene            244263..245018
FT                   /locus_tag="Saut_0265"
FT   CDS_pept        244263..245018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0265"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="COGs: COG1218 3'-Phosphoadenosine 5'-phosphosulfate
FT                   (PAPS) 3'-phosphatase; InterPro
FT                   IPR000760:IPR020583:IPR006240; KEGG: tdn:Suden_0646 3(2),5
FT                   -bisphosphate nucleotidase; PFAM: inositol monophosphatase;
FT                   PRIAM: 3'(2'),5'-bisphosphate nucleotidase; SPTR: A0XWZ4
FT                   Likely to be PAP (3',5' adenosine diphosphate) 3'
FT                   phosphatase; TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase;
FT                   PFAM: Inositol monophosphatase family; TIGRFAM:
FT                   3'(2'),5'-bisphosphate nucleotidase, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08314"
FT                   /db_xref="GOA:E0UU05"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU05"
FT                   /protein_id="ADN08314.1"
FT                   /translation="MLKDIDLEKIVLIAKEAGDAIMKIYEKDFTIEYKDDKSPLTEADT
FT                   KANEIICSSLQKLYPNIPIMSEENKQTEYEIRKEWQYYWCVDPIDGTKEFIKKNGEFTV
FT                   NIALIYKDIPVLGVVYAPAIDEMYKAKKGEGAYKNGKKLPLKTNQHPEKKLHVVASKSH
FT                   LSKETQEFIDNLKTKEIEQVSKGSSLKLCMVATGEADIYPRLGPTMEWDTAAADAIVRE
FT                   AGKMTFQFENMQPIVYNKENLLNPSFIVK"
FT   gene            245069..245494
FT                   /locus_tag="Saut_0266"
FT   CDS_pept        245069..245494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0266"
FT                   /product="general secretion pathway protein G"
FT                   /note="COGs: COG2165 Type II secretory pathway pseudopilin
FT                   PulG; InterPro IPR000983:IPR013545:IPR012902:IPR010054;
FT                   KEGG: mfa:Mfla_2421 general secretion pathway protein G;
FT                   PFAM: type II secretion system protein G; SPTR: A3JDP6
FT                   General secretion pathway protein G; TIGRFAM: general
FT                   secretion pathway protein G; PFAM: Prokaryotic N-terminal
FT                   methylation motif; Bacterial type II secretion system
FT                   protein G; TIGRFAM: general secretion pathway protein G;
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08315"
FT                   /db_xref="GOA:E0UU06"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU06"
FT                   /protein_id="ADN08315.1"
FT                   /translation="MRKKNQFRKAFTLVELLVVIVIIALLSSLVAPKFFGKLDTAKVKT
FT                   ANTQMQMLSQALDGFRLDVGRYPTTQEGLKILWAKDSSLKNWDGPYLPKAVKEDPWGYP
FT                   YHYKSPGKNSEPYDLYHLGSDGKEGGNDDAKDVSVWE"
FT   sig_peptide     245069..245158
FT                   /locus_tag="Saut_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            245495..247129
FT                   /locus_tag="Saut_0267"
FT   CDS_pept        245495..247129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0267"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG2804 Type II secretory pathway ATPase
FT                   PulE/Tfp pilus assembly pathway ATPase PilB; InterPro
FT                   IPR001482:IPR007831; KEGG: aav:Aave_4160 general secretory
FT                   pathway protein E; PFAM: type II secretion system protein
FT                   E; General secretory system II protein E domain protein;
FT                   SPTR: A0Z1L2 General secretion pathway protein E (Type II
FT                   traffic warden ATPase); PFAM: GSPII_E N-terminal domain;
FT                   Type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08316"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU07"
FT                   /protein_id="ADN08316.1"
FT                   /translation="MQKFEDILLAQNRCTKEDIEQAYSIRKEYGGQIGNILLNLGSISD
FT                   IVYVEVLAKQYGFELYKNFHDEKKIISIDGIVSEYFVINNIFPIKEDESSLCVITHDPL
FT                   QSSVLATIESAVKKQLTVYLATEEELRQVKELYERSDEEDDEDIFEDEVDKLKELASEA
FT                   PVIKLVNNIFSKAVNAYVSDIHFESYKHGIKVRFRIDGVLQTVDTISNKLKQAVTARLK
FT                   LISKMNISENRLPQDGRISIKISSQEIDIRSSSVPTAFGESFVLRFLGNDAIDLNIDNM
FT                   GFHQDNLKLLKEMLKKPNGILLTTGPTGSGKTSTLYAALDYINSDAIKIITVEDPVEYQ
FT                   LDGISQIQVKANIDYTFANALRSILRQDPDVILIGEIRDTETAKIAIQSALTGHLVLST
FT                   LHTNSAIGAISRLLDMGMEYFLLKSSIVGLMAQRLARRLCKHCKEPIEITQAQKNAYNI
FT                   EKLEQYIESAYHPCRAVGCKECNYTGYKGRMPIMEIIPFDDAVIKELDKNKDFKDIQKL
FT                   GYRTLQDDAIIKFLEGAISLDEVARLV"
FT   gene            247142..248341
FT                   /locus_tag="Saut_0268"
FT   CDS_pept        247142..248341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0268"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR003004:IPR018076; KEGG: sat:SYN_00457
FT                   general secretion pathway protein F; PFAM: Type II
FT                   secretion system F domain; SPTR: A0Z1L3 General secretion
FT                   pathway protein F; PFAM: Bacterial type II secretion system
FT                   protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08317"
FT                   /db_xref="GOA:E0UU08"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU08"
FT                   /protein_id="ADN08317.1"
FT                   /translation="MKSIFEYEAVIGSGEVIQGSFAGTKEDFELMLQKKKLLLTSVKET
FT                   KEKVDNSKFTQDDFLAFIEELYYLTKSGMPIDKAVKVLSQTTKKAAYKRILKTILEELK
FT                   AGEQLSTALKKALKNENITIDSLAISFISTAEEVGSVTTGLYQLFEYLTFQKKIRSDVK
FT                   QALAYPFFLIGMSIVVSFLIFFLIIPRFSTIFSADEFAQLPGISYAVLSTGKFLNAHMG
FT                   EAFAVIGIVIAGLIVFFKKVTISWMSFFYKVPKLSSIIIDLQLTIVYSALSTMLVGGLE
FT                   IDKALKQLQSVSLLPELKNLLKTALFEIKRGQKLSDVFAMSSIIPTSDIALLYVGESSA
FT                   SLAEVFKSLSIRHSDAFSANVKKILSILEPAVIVGLGVFIAIIVVAIMMAVMSMTDMVG
FT                   "
FT   gene            248334..248606
FT                   /locus_tag="Saut_0269"
FT   CDS_pept        248334..248606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0269"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08318"
FT                   /db_xref="GOA:E0UU09"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU09"
FT                   /protein_id="ADN08318.1"
FT                   /translation="MVSVREAFTLIELLVVLVILTLVMAVVIPQGAKMLSSYGHSLTKI
FT                   KTKQKLSKDKAKAFLQAKDINVTIDKKNYLILKKGVMLENGHDNH"
FT   sig_peptide     248334..248429
FT                   /locus_tag="Saut_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            248593..248988
FT                   /locus_tag="Saut_0270"
FT   CDS_pept        248593..248988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08319"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU10"
FT                   /protein_id="ADN08319.1"
FT                   /translation="MITIEVLVSLLILFMVVATSVTTIKHLNLVQTQQVRYEDVYRAII
FT                   NIKDYIDADICQKKRVMSGTLNDFEYKAECRQEIEKRKYVKAMDLGDPEGNIDNVVAIL
FT                   SKVVITLKKNNFKKEYSYQKLTTKKVF"
FT   sig_peptide     248593..248652
FT                   /locus_tag="Saut_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            248985..249605
FT                   /locus_tag="Saut_0271"
FT   CDS_pept        248985..249605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0271"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; PFAM: Protein of unknown
FT                   function (DUF1494); TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08320"
FT                   /db_xref="GOA:E0UU11"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU11"
FT                   /protein_id="ADN08320.1"
FT                   /translation="MKKAFTLVEMLVAIVLITLLIGVAIFSFRMQLLTIHKTKTEAIND
FT                   VLKYNQIKSALESIKYYVVQEYDMLHQPIRKLDYFFSADETHALFMTNNPVYTDKVSLV
FT                   ELSCLNHSLIYKEELLYGNMDYLQPSFSLKNTHKLKIYNDLDKCEFYYINNQGALVRQI
FT                   AKEIPKEIYLKIKKDEKDISVYSKIEEDDNQTAARTYNAIYEE"
FT   gene            249586..250515
FT                   /locus_tag="Saut_0272"
FT   CDS_pept        249586..250515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_00453 general secretion pathway
FT                   protein K; PFAM: General secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08321"
FT                   /db_xref="GOA:E0UU12"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU12"
FT                   /protein_id="ADN08321.1"
FT                   /translation="MPYMKSREGFALSIVMWIVAALLLGIVLILSLSKDSLTLTKGVQN
FT                   KLAARLMAQSYLDVLKYYVLTADFDSMKLINDVQSLSYKLPKQIMLDGREYNATKNLTF
FT                   SMQDASSMLNISYPNAQMIAALASADNQELYYTIQDSIKDWTDKDRETSLNGAEDAYYQ
FT                   KQKTSHYLPRNYPALQSVDELRLIRGVDTLSEKEFDNLKKYIYFSQNGAMTNMALVDAD
FT                   YLSKLLHIDMPTAQQIEKYKYDDYKKFINIIRKNIHYYDEQMGFSLSFHIKIKIEAKVG
FT                   DAIVYLETFMDFSKNQYRDITTDFYRIY"
FT   gene            250570..251589
FT                   /locus_tag="Saut_0273"
FT   CDS_pept        250570..251589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: RWD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08322"
FT                   /db_xref="GOA:E0UU13"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU13"
FT                   /protein_id="ADN08322.1"
FT                   /translation="MHKSIIQLLLKYDILKVIPMQESFFQVSTLTKKVRLSPELIQLNY
FT                   EKLSPIVNPAILSYKEENVIYLWFLKKQQLNEKILIPESFLIYKALRNKQDGIFIFKTV
FT                   PKQIYVIKEKRLQAAFVSYDAVDSMNISIIKDEYSLTNVVMLDEKEHDKALQSELQRLT
FT                   LQELLAFMQFKMDKENLKKFFVQKLTYPLVSLLFIYMFMSYTQGYFMQKKADILTQEYQ
FT                   TLKTKNSDVKNAIRKHNQEVDKLEQFVKTEFVPVEPFKVTYDLYKIIKSEDKATVSFFA
FT                   VTNGIVKIKIKTNDNAIKYLKRFNAIAYLKDVVIENTFKQRDGYKIHTYTMKIKATHE"
FT   gene            251582..252094
FT                   /locus_tag="Saut_0274"
FT   CDS_pept        251582..252094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08323"
FT                   /db_xref="GOA:E0UU14"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU14"
FT                   /protein_id="ADN08323.1"
FT                   /translation="MNNYKLLFLLFSFVVFVNYINYLMPQRDKLHKQIELLTYKIDKEK
FT                   RLNRQKPDIKQFQLPFDTLFYDGKKFNYSQAMGDFQESITNAAKDVCTVKRLKWAQVPL
FT                   STKWYDVLKIDTTLECTPKKMFHFINKLRKNTKIYNIKNFTIYRMRNKPMLQIHMQLIS
FT                   YRVHHEK"
FT   sig_peptide     251582..251632
FT                   /locus_tag="Saut_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            252084..252638
FT                   /locus_tag="Saut_0275"
FT   CDS_pept        252084..252638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08324"
FT                   /db_xref="GOA:E0UU15"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU15"
FT                   /protein_id="ADN08324.1"
FT                   /translation="MKNKITYLLYGFVCLVVVLLAFNQYGNSKRTTVGKSVKPFNTNIV
FT                   KMYQEQFDTNSSFGYLWGIKNEEKKSDTNTTENVKDENSTELVVTQEKSKICIDKNCYR
FT                   FLGFYYKAGVPYISFYSKTFKKGLQDFKLHQMLDKTLYIKEIKHNSLFLADKNSSREWQ
FT                   FQLFDVNVTKYKPKDSNETDI"
FT   sig_peptide     252084..252161
FT                   /locus_tag="Saut_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            252622..254751
FT                   /locus_tag="Saut_0276"
FT   CDS_pept        252622..254751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0276"
FT                   /product="type II and III secretion system protein"
FT                   /note="COGs: COG1450 Type II secretory pathway component
FT                   PulD; InterPro IPR001814:IPR001775:IPR004846; KEGG:
FT                   sat:SYN_00448 general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; SPTR: A3UH04
FT                   General (Type II) secretion pathway (GSP) D protein; PFAM:
FT                   Bacterial type II/III secretion system short domain;
FT                   Bacterial type II and III secretion system protein;
FT                   TIGRFAM: general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08325"
FT                   /db_xref="GOA:E0UU16"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU16"
FT                   /protein_id="ADN08325.1"
FT                   /translation="MKQIFSLVIIAFILSGCVSAKPKPKQEDLQNLQDVHYKLDKKGEL
FT                   TLQKKYALKDEAGKIVAQKTKEEPVVEKVPLFDKGYKKQLSLKGKAKKEIAIHGDRVKV
FT                   SVESIPLNEFVDLVFGSVLKLNYTVDESVKKMKTPITLNMQTTQKVSQFYKVVKKILLL
FT                   NGVKINDENNLLFIHKSGKSNANELSSDVYIGYGRSLPADLDADKEVLLFVPYNYIDPN
FT                   NIIKIFRQIGISGNDVKFYYYINGIQTMKGKAFVIRKALKLIDLLDRPYLKGKTPYLIN
FT                   FQDIEVEKFVSQMQKIFALNGINVVDSPSKGGIVMMPIKDLNMLYIITPKKEWLKMLLY
FT                   WKKKLDVPTDVKEEPRLYIYHVKNRKADELASALKEVLGLSKQTTKTTIKKKSDIAKQK
FT                   TEVKQGKGQSSFLLQSTGYTPTVTADLDTNMLMLKLTPKHYRVLLPFIEELDKLPLQTL
FT                   VEVTVADVDMTDTFSLGFEYAITNQNAGLVKNILNITGGGSGLGVVFKGNHLESTINAY
FT                   AEKKLLDIISKPKLLILNNKTGNINVGTQVPIITSQVSAADLGSSSQPSINQNISYKNT
FT                   GIILNITPTINSNGVLTMNISITLSDAQLNDTSTINSPLIINRSLQTTAVVQSGDSILL
FT                   GGLISQNKSKSKGGVPLLKDIPWIGNMFASNSIKTTKSELIILIRPVIIKTPQEINSET
FT                   YKFKKILNYINIDGL"
FT   sig_peptide     252622..252681
FT                   /locus_tag="Saut_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            254840..256195
FT                   /locus_tag="Saut_0277"
FT   CDS_pept        254840..256195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpr:GBP346_A2154 Hep_Hag family protein; SPTR:
FT                   A2U0R2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08326"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU17"
FT                   /protein_id="ADN08326.1"
FT                   /translation="MTIKKIGLSALAVAALYGTVYAGTVTGTNSGTFSLDKIADNNITA
FT                   AIDINATYTPALNAAISDGTLVVEYTNAYSQNCDANTSELVMYDGTKYVTKANPTCGGT
FT                   PTGTKLLFDVNNTIADGAHLTLVDKDTNTTSGDLNVSILKGADVASVKFSLVNVNDVTV
FT                   DPSSGSVTIATGKTEWSAAVGTSFDNQIDAAKSFALFTNSPATNDDNATITFTRTTVDF
FT                   GGATLDANIKLTTDYNVSSIGSLKFNNVVKTPNGSFVYDVNATGLLAASTDYPIDFDGN
FT                   TTTTSGTKIDATGFKVAVSAVKLGTAAYSKSYVSASDKNLGEWSVYGYNGYVPNATAST
FT                   ASNIETVLSFTNTSSTTVDAYFTLVAADGTETQVDSVNDGLAKLETKKTVKYNVSDLIT
FT                   TAGVAEGSYMIKVVFPTTPSKIIGFASFRNDNKNAFKDLPIHSNIDASTLQY"
FT   sig_peptide     254840..254905
FT                   /locus_tag="Saut_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            256252..256638
FT                   /locus_tag="Saut_0278"
FT   CDS_pept        256252..256638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08327"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU18"
FT                   /protein_id="ADN08327.1"
FT                   /translation="MKGKFMERIFFLFVCSISFSILMANDNYMIKYNGKSKKCFAYKNN
FT                   KEISLIDKKFKSDKVTTPYTCLAIQVENYRGCRIKNGSEHITAYAFSFGSYGEKTKFMV
FT                   GYKVAVPYVDAFLKLECSKEHFNF"
FT   sig_peptide     256252..256323
FT                   /locus_tag="Saut_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            256788..257612
FT                   /locus_tag="Saut_0279"
FT   CDS_pept        256788..257612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0279"
FT                   /product="ABC-2 type transporter"
FT                   /note="COGs: COG1682 ABC-type polysaccharide/polyol
FT                   phosphate export systems permease component; InterPro
FT                   IPR013525:IPR000412; KEGG: fph:Fphi_1254 ABC-2 type
FT                   transporter; PFAM: ABC-2 type transporter; SPTR: A2BD18
FT                   Wzm; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08328"
FT                   /db_xref="GOA:E0UU19"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU19"
FT                   /protein_id="ADN08328.1"
FT                   /translation="MLKLKENFFKEFYRFLKHILANRGLLRALIINDFKKNYLGTYLGL
FT                   VWAFIQPLTFMLVIWFVFTYGFRTASHGDTPYFLWLASGMIPWFFISNALTAGTSAITN
FT                   NSFLVKKVAFRVSILPLIQIGSALIIHIGLVLFLIMMFLLYGFSPSVYWVQLPYFILCT
FT                   VLLLLGISWMTSAIRVFVKDIGNIIGVLLQIGFWATPIFWNISMISPNHQWILKLNPAY
FT                   YIVQGYRDTFINHVWFWEMPKVTLYYLGITTVFFILGAIVFKRLRPHFGDVL"
FT   gene            257612..258937
FT                   /locus_tag="Saut_0280"
FT   CDS_pept        257612..258937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0280"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1134 ABC-type polysaccharide/polyol
FT                   phosphate transport system ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: hch:HCH_02231 ABC-type
FT                   polysaccharide/polyol phosphate transport system, ATPase
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: A0YLP0 ABC transporter, ATP-binding protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08329"
FT                   /db_xref="GOA:E0UU20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU20"
FT                   /protein_id="ADN08329.1"
FT                   /translation="MNKNIAIKVQNLTKIYKLYKEPIDRLKEALNPLGKAHHKNFHALK
FT                   DVSFEIKKGETVGIIGRNGSGKSTLLKIITGVLTPSAGRVNVHGKISAILELGAGFNPE
FT                   MSGLENIYLNTSINGMSKKDTDKKIKEILEFAELGEFIHQPIKTYSSGMKARLGFAVAI
FT                   NIEPDLLIVDEALAVGDAAFQRKCFAKMEQIREAGTTILFVSHSEGSIVSLCSRAIWLS
FT                   NGEKIIEGKPKLVTGLYMKNANKNMIDKAIIEAELQELEKKSEKKDKSKKKEVQKKAKH
FT                   AIEEFYDPSLKPKSTIYYEEKGAKISDIKVTTLDGREVNVLIHGYNYIYSYVVNVKNKT
FT                   EDVRFGFLIKNTLGVAIAGGSYSMREHQGIDIVPEGNYMIKFSFKCLFNEGEYFLNAGC
FT                   SSFKKHIHRIVDTYAFKVMHIEKMICTSSVNCIDNCEVIRSD"
FT   gene            258930..259673
FT                   /locus_tag="Saut_0281"
FT   CDS_pept        258930..259673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0281"
FT                   /product="sulfotransferase"
FT                   /note="InterPro IPR000863; KEGG: dat:HRM2_25330 putative
FT                   3-beta-hydroxysteroid sulfotransferase (phenol
FT                   sulfotransferase); PFAM: sulfotransferase; SPTR: A0YNK8
FT                   Putative deacetylase sulfotransferase; PFAM:
FT                   Sulfotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08330"
FT                   /db_xref="GOA:E0UU21"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU21"
FT                   /protein_id="ADN08330.1"
FT                   /translation="MIDFLCIGAQKSGTTLLYEHLKKIDDIFLPERKELHFFDDIKNYN
FT                   RGMNYYLEYFKDAKKDQIRGEITPAYIFFDEAPERIRESLGNKKIKFIVLLRNPVDRAY
FT                   SQYNMSFLTQGHESLSFEQALIYENYRLKEYSDYVNFTYLKRGFYSNQILNYFKYFNKE
FT                   QFKFIIYEEFVQEQKKYIYEILDFLEIDVSTKNLQIENQVVFQNKYNKMKTETRKVLNQ
FT                   IYKKEINILESILERNLSIWKEGNN"
FT   gene            259674..260984
FT                   /locus_tag="Saut_0282"
FT   CDS_pept        259674..260984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3551 conserved hypothetical protein;
FT                   InterPro IPR018054; KEGG: pla:Plav_3314 hypothetical
FT                   protein; SPTR: A0Z0H0 Glycosyl transferase, family
FT                   2:Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08331"
FT                   /db_xref="InterPro:IPR014556"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU22"
FT                   /protein_id="ADN08331.1"
FT                   /translation="MRQTAILVLGMHRSGTSALTGVLNMCDIYLGSELMAANHANEKGY
FT                   FENNELFKVNEKLLFECNSSWDDIFYNEEKLENIKNIDELKKIIKKEFEYSNIFAIKDP
FT                   RLAFLFPVYKKALEELHIDIKVILPYRNPVEVANSLHTRDGISMEKGMLLWGYYFLLAE
FT                   KQSRGYERVFVDFDNLINETTDTVKMIAKSLNIDLDEKYLKNRQEIEKFLEAGLKHHNI
FT                   SIDNLSSKIPTMVQKVLALKDCFNNKSVLKKFDELRNEFFSYQKLFYNREIINFLEELQ
FT                   KTKETLTQSQETIAQKDKELAQTKETLTQSQETIAQKDKELAQTKETLTQSQETIAQKD
FT                   KELTEVKENLAQKDKELTQAKESLTQKDKELTQAKESLTQKDKELIQVKEDLTQKDKMI
FT                   KSKNKEIESLKDELVLIYTSRSWKFTKILRRIKRFTK"
FT   gene            260981..262843
FT                   /locus_tag="Saut_0283"
FT   CDS_pept        260981..262843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0283"
FT                   /product="Lipopolysaccharide biosynthesis protein"
FT                   /note="COGs: COG3754 Lipopolysaccharide biosynthesis
FT                   protein; KEGG: nmu:Nmul_A1172 lipopolysaccharide
FT                   biosynthesis protein-like; SPTR: A3V3Z9 Possible
FT                   glycosyltransferase; PFAM: Rhamnan synthesis protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08332"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU23"
FT                   /protein_id="ADN08332.1"
FT                   /translation="MIKKLKQIKWYKAIKKSDLFDIKYYLFTYTDIRAMDIDPIWHYIK
FT                   YGADEGRNPSDKFDTSFYLSTYNDVKEKGVNPLAHYILHGKNEGRKTSKSNYSNKSSDA
FT                   VSIPKYKYVKVNNALKNDSVCIFAHYDKDNIIDDYVVNYIKELKKIDIDIIFVTVCEDM
FT                   KMNELEKLNQYVSINIVRENIGYDFASWKIGLDYIIENSINCKTLILANDSVYGPLYNL
FT                   KTIFNSMQKKNYDIWGLTDNFYSSYHLQSYFLVFNQQAIKSNIFIDFFKEMKVIEDKAQ
FT                   LIEAYEIGLSKLLAKHFKLGSYIAVQDVCTTLLKQNLSLPAGLKASIANYTINVTHIGW
FT                   KELIEKFKFPFIKVELLRDNPIKMNNLDYIKILAKKDDYIYDFNLISSHLKKVEKKTNK
FT                   ISGYNIINRATKKSERKTICALGSARGGTSMVSGLLRIMGVNMGDDLDPDTNEDKDFLH
FT                   ASNPIEDIYNIHSEGHEKVKKKLINLINKKNEQYKVWGWKDPQGMMYFDKIDSFLREPY
FT                   CIIIYRDPLAITQKEINDGIHKDIISTLEFVVNHRFKELVNVTKFIQQKNYPLLLISYE
FT                   RSLRDKENLIQTLADFLNLELSQEVVDKCKDYVKADRNTGLINI"
FT   gene            262859..263713
FT                   /locus_tag="Saut_0284"
FT   CDS_pept        262859..263713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0284"
FT                   /product="putative glycosyltransferase, fusion protein"
FT                   /note="COGs: COG3754 Lipopolysaccharide biosynthesis
FT                   protein; KEGG: sml:Smlt0623 putative glycosyltransferase,
FT                   fusion protein; SPTR: A2VSD5 Glycosyl transferase; PFAM:
FT                   Rhamnan synthesis protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08333"
FT                   /db_xref="GOA:E0UU24"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU24"
FT                   /protein_id="ADN08333.1"
FT                   /translation="MNRAVVFAHYDIDNVVDQYVYVYLKELSKISNYIVFVSTADLTQK
FT                   DIELLSRICAKVIIRDNIGYDFMSYKIGLESFDYIKYDEIIICNDSVYGPFYPLENVFN
FT                   AMKNKQCDVWGMTSGQEISLHLQSYFLVCKKTVLLSSYFSDFWKNVKVLDNKRKIIETY
FT                   EVGFSAKLLSLGFKLASYAEYKPVFMEKYTVKLRRVTFYKIFKKIISLFEGRSVFQNSL
FT                   SVNITHQYWKELLLVSKMPFLKVELLRDNPLKINILDFEDVIKKISDYDVSLIQKHLHR
FT                   TKK"
FT   gene            263746..264588
FT                   /locus_tag="Saut_0285"
FT   CDS_pept        263746..264588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0285"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterPro IPR001173; KEGG: sse:Ssed_2992
FT                   glycosyltransferase-like protein; PFAM: glycosyl
FT                   transferase family 2; SPTR: A0NKF0 Rhamnosyltransferase;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08334"
FT                   /db_xref="GOA:E0UU25"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU25"
FT                   /protein_id="ADN08334.1"
FT                   /translation="MKKTLNNIVILLAVYNGEKYLTQQIESLTNQSVKVDIIIRDDGST
FT                   DNSIKIIKDYVDNYDNIYFLEDDLLSTRAQSNFSILLEYAKKLNKYKYFMFCDQDDVWL
FT                   DNKVEYTLNKMLELEKKYSNFPLMVFSNLIVANNNLEIISTSMWKSEKLDIDIMKNLYD
FT                   ILSLNVVTGSTIMINEYALHKMSPMPLNYIYHDHWIAANIVKYGKYAYIEEPLTIYRQH
FT                   EHNVLGSSNKGIKYFIQKIIDLFIHFSNFKKKYSYFDFEISLSRVIFHKVILNIKRLK"
FT   gene            264588..265691
FT                   /locus_tag="Saut_0286"
FT   CDS_pept        264588..265691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0286"
FT                   /product="Protein of unknown function DUF1972"
FT                   /note="InterPro IPR015393; KEGG: mfa:Mfla_2013
FT                   glycosyltransferase, RfaG; PFAM: Protein of unknown
FT                   function DUF1972; SPTR: A3XR88 Glycosyltransferase-like;
FT                   PFAM: Domain of unknown function (DUF1972)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08335"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU26"
FT                   /protein_id="ADN08335.1"
FT                   /translation="MKIAILGTRGIPNNYGGFEQFAEHLAVALVKRKHEVTVYNSHNHS
FT                   YKEDYYNGVRIKHIYDPEDKIGTIGQLIYDFLSIIDTRKEKYDVILQLGYTSSSVFFKL
FT                   HPKDSIIVTNMDGLEWKRTKYSKKVQMFLKWAESLAVKRSDYLVSDSVGIQNYLKKKYN
FT                   IESTYIPYGSDVFKNPDDKVIKKFNLTQFNYNMLIARIEPENSIEMILEGVCLSQKNMK
FT                   FLVIGNINTSYGEYITNKFSKYLNIIFTGAIYDINILNNLRYYSNLYFHGHTVGGTNPS
FT                   LLEAMGSSALICANKNEFNESILDEDAFYFQNKKDVAIIINSIVKEKYLHKVENNLIKI
FT                   EKLYQWDKIIDSYERLFLDIKYSSRIK"
FT   gene            265706..267022
FT                   /locus_tag="Saut_0287"
FT   CDS_pept        265706..267022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0287"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase, WbaP"
FT                   /EC_number="2.7.8.6"
FT                   /note="COGs: COG2148 Sugar transferase involved in
FT                   lipopolysaccharide synthesis; InterPro
FT                   IPR003362:IPR017475:IPR017472; KEGG: tdn:Suden_1700
FT                   undecaprenyl-phosphate galactosephosphotransferase; PFAM:
FT                   sugar transferase; PRIAM: Undecaprenyl-phosphate galactose
FT                   phosphotransferase; SPTR: A3ET31 Sugar transferase involved
FT                   in lipopolysaccharide synthesis; TIGRFAM:
FT                   Undecaprenyl-phosphate galactose phosphotransferase, WbaP;
FT                   exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; PFAM: Bacterial sugar
FT                   transferase; TIGRFAM: Undecaprenyl-phosphate galactose
FT                   phosphotransferase, WbaP; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08336"
FT                   /db_xref="GOA:E0UU27"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU27"
FT                   /protein_id="ADN08336.1"
FT                   /translation="MKKHLLNIFILLLDILLLIGIFYLAIFLRTSIKTSGIAEFSPYTL
FT                   NEFAFVVFIIVALMYYEKIYTLQYDFWQETKKILKSLILAYFIVLALLTLTKTSFGYSR
FT                   LFISIYFLFAVFLMPIAKRFEKRIIYKFPFFKKKVLVMGDNNQVEVLKKELRDNWYIGM
FT                   ESDDKEYDTVIISSQGMSVEEVNHKITKYLEANTAVYIVPYVTNINFANSNIMEYSNIR
FT                   YSTIQVENKLLLKINIWIKNLFDLFVTLMIMPFFLLIHAVISLAIILDSKGAVFFKQDR
FT                   LGKDDNNFVCYKYRTMYKNADDILKNYLKSNPDEVKYYEEYHKYKNDPRVTKIGRLLRT
FT                   TSMDELPQIINVLKGEMSLVGPRPYMLNESDKLGEDKNFILKVKPGITGLWQVSGRNNL
FT                   TFKQRNELEVWYIKNWSLWADFVILIKTVKVVFSKIGAK"
FT   gene            267019..268242
FT                   /locus_tag="Saut_0288"
FT   CDS_pept        267019..268242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0288"
FT                   /product="O-antigen polymerase"
FT                   /note="InterPro IPR007016; KEGG: sun:SUN_1947 hypothetical
FT                   protein; PFAM: O-antigen polymerase; SPTR: A1ZI84 O-Antigen
FT                   Polymerase family; PFAM: O-Antigen ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08337"
FT                   /db_xref="GOA:E0UU28"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU28"
FT                   /protein_id="ADN08337.1"
FT                   /translation="MKNLFKKDINTYINYLIIAYAFSFPISKAAVNIIEVLMILLWIYQ
FT                   DNWNHKIKLLKSSKFIIFISLFILYNVISILWASDTIFALNYIGKYHHFLMIPIIYTAL
FT                   EKKYINYVLSAFVASVFISEIMSYGIYFKLFTYKHATPEFPTPFMHHITYSVILAFTST
FT                   ILLINFFMAKELRYKIFNILFFITLTINLFINGGRTGQLLFVILLFTLFFMFMKSKIKA
FT                   IILSTVIIITILLLAYNFSSNFNSRIHQLQSGLHKAIDKKDYTDQGGMRIVMIKIGTET
FT                   FLDNFIKGTGIGNVMKDANIYSAKNHYKTRDMHIFGDFHNVFINTAAQLGILGLIILLA
FT                   IFYSLLSLKFKTKQYYILNLMFVISFILFSCTHNTFHTMNPMVFFVVFTGLFNAISRIE
FT                   TQEVRIVK"
FT   sig_peptide     267019..267105
FT                   /locus_tag="Saut_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            268543..268905
FT                   /locus_tag="Saut_0289"
FT   CDS_pept        268543..268905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0289"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="COGs: COG0099 Ribosomal protein S13; InterPro
FT                   IPR001892:IPR018269:IPR019980; KEGG: tdn:Suden_0324 30S
FT                   ribosomal protein S13; PFAM: ribosomal protein S13; SPTR:
FT                   Q30TS6 30S ribosomal protein S13; TIGRFAM: 30S ribosomal
FT                   protein S13; PFAM: Ribosomal protein S13/S18; TIGRFAM: 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08338"
FT                   /db_xref="GOA:E0UU29"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU29"
FT                   /protein_id="ADN08338.1"
FT                   /translation="MARISGVDLPKKKRIEYGLTYIYGIGLHTARQILDATGIDYNKRV
FT                   FELNEEDVAAITKEIRENHMVEGDLRKKVAMDIKALMDLGSYRGLRHRRGLPCRGQKTK
FT                   TNARTRKGKRKTVGAA"
FT   gene            268917..269309
FT                   /locus_tag="Saut_0290"
FT   CDS_pept        268917..269309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0290"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="COGs: COG0100 Ribosomal protein S11; InterPro
FT                   IPR001971:IPR019981; KEGG: tdn:Suden_0325 30S ribosomal
FT                   protein S11; PFAM: ribosomal protein S11; SPTR: Q30TS5 30S
FT                   ribosomal protein S11; TIGRFAM: 30S ribosomal protein S11;
FT                   PFAM: Ribosomal protein S11; TIGRFAM: 30S ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08339"
FT                   /db_xref="GOA:E0UU30"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU30"
FT                   /protein_id="ADN08339.1"
FT                   /translation="MAKRKAVRKKVVKKNISRGIVHIAASFNNTLVTITDEMGNMIAWS
FT                   SAGSLGFKGSKKSTPFAAQAAVEDAVAKAQVHGIKELGIKVQGPGSGRETAVKAVGAIE
FT                   GIRVTFMKDVTPLPHNGCRAPKRRRV"
FT   gene            269321..269947
FT                   /locus_tag="Saut_0291"
FT   CDS_pept        269321..269947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0291"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="COGs: COG0522 Ribosomal protein S4 and related
FT                   protein; InterPro IPR001912:IPR002942:IPR018079:IPR005709;
FT                   KEGG: tdn:Suden_0326 30S ribosomal protein S4; PFAM:
FT                   ribosomal protein S4; RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; SPTR: Q30TS4 30S ribosomal
FT                   protein S4; TIGRFAM: ribosomal protein S4; PFAM: Ribosomal
FT                   protein S4/S9 N-terminal domain; S4 domain; TIGRFAM:
FT                   ribosomal protein S4, bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08340"
FT                   /db_xref="GOA:E0UU31"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU31"
FT                   /protein_id="ADN08340.1"
FT                   /translation="MARYRGPVEKIERRFGVSLNLKGERRLAGKSALEKRPYGPGQHGQ
FT                   RRKKVSEYGLQLNEKQKAKFMYGISEKQFRALFVEAKRRDGNTGTNLITLIEQRLDNVV
FT                   YRMGFASTRRFARQLVTHGHILVDGKKLDIPSYRVKPGQKIEVKEASKANNQVVRAIEL
FT                   TNQTGLAPWVDIDAEKVYGIFTRLPEREEVVIPVEERLIVELYSK"
FT   gene            269975..270976
FT                   /locus_tag="Saut_0292"
FT   CDS_pept        269975..270976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0292"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0202 DNA-directed RNA polymerase alpha
FT                   subunit/40 kD subunit; InterPro
FT                   IPR011260:IPR011262:IPR011261:IPR011263:IPR 011773; KEGG:
FT                   tdn:Suden_0327 DNA-directed RNA polymerase subunit alpha;
FT                   PFAM: RNA polymerase insert; RNA polymerase alpha subunit
FT                   domain protein; RNA polymerase dimerisation; SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type; SPTR: Q30TS3 DNA-directed RNA
FT                   polymerase subunit alpha; TIGRFAM: DNA-directed RNA
FT                   polymerase, alpha subunit; PFAM: RNA polymerase Rpb3/Rpb11
FT                   dimerisation domain; RNA polymerase Rpb3/RpoA insert
FT                   domain; Bacterial RNA polymerase, alpha chain C terminal
FT                   domain; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit, bacterial and chloroplast-type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08341"
FT                   /db_xref="GOA:E0UU32"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU32"
FT                   /protein_id="ADN08341.1"
FT                   /translation="MKKIKTTPLAPQEFEVEQISDNEANIMAYPFEVGYAISLAHPLRR
FT                   FLLSSSVGYAPIAIKIEGAKHEFDSVRGMLEDISDFILNLKEIRFKLNNDATQAEINYS
FT                   FAGPCTIKGADLSNDEVEVVTPDAPLATLNEDSTLNFTLKIAQGIGYVASEDTAVEVAD
FT                   DDYIALDAYFTPVRSATYKIDNVLVEDNPNFERVIMNIKTDGQISPIDAFRNSLEVMYA
FT                   QLAVFNSEISIKAPATIERVEESPDLKKLTTNIDSLGLSARSFNCLDRSSIKLIGEIVL
FT                   MSTNDLKNVKNLGKKSYDEIVEKIQEFGFEVGADLADDVVTALKKKIEAVQA"
FT   gene            270992..271342
FT                   /locus_tag="Saut_0293"
FT   CDS_pept        270992..271342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0293"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="COGs: COG0203 Ribosomal protein L17; InterPro
FT                   IPR000456; KEGG: tdn:Suden_0328 50S ribosomal protein L17;
FT                   PFAM: ribosomal protein L17; SPTR: Q30TS2 50S ribosomal
FT                   protein L17; TIGRFAM: ribosomal protein L17; PFAM:
FT                   Ribosomal protein L17; TIGRFAM: ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08342"
FT                   /db_xref="GOA:E0UU33"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU33"
FT                   /protein_id="ADN08342.1"
FT                   /translation="MRHRHGYRKLGRTSAHRAALLKNLSISLIEHGKIETTAVKAKELR
FT                   SYIEKLITTAGKNDSNAHRAVFAALQSKEATKTLVNELAPKYVDRAGGYTRITRTRIRR
FT                   GDATPMAFIELV"
FT   gene            271489..272721
FT                   /locus_tag="Saut_0294"
FT   CDS_pept        271489..272721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0294"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR020471:IPR001395;
FT                   KEGG: tdn:Suden_0329 oxidoreductase like protein; PFAM:
FT                   aldo/keto reductase; SPTR: B9LNV3 Aldo/keto reductase;
FT                   PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08343"
FT                   /db_xref="GOA:E0UU34"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU34"
FT                   /protein_id="ADN08343.1"
FT                   /translation="MSTFAFGTYRITDENPLHIEALKEAVDAGIDLIDTSTNYTDGGAE
FT                   RAIGKVLRNFPDAIRDKIKIVSKYGYIQGSNMLAHKEETFEDVVEFNQSCYHSIANSFM
FT                   KKQLDASLERLQMSKIDCYLIHNPEYFILDALNKGKKRDEILDSMYQRLYEAFIGLEEE
FT                   VKEGRINSYGISSNSFAKAKNDPKFLPYEDLLTLAQNAAQEAGNKKHSFSTVQLPVNIV
FT                   EKEGLKCAAWAKKQGLRVLANRPLNAQKENLMYRLAEYSESKEYYYYLNELLQACDNDL
FT                   LKSLYNLIEQMDTNKHKFGWVGEYDTFLHSQIIPHIKQALQNIQPDTLDELLRFVDLFL
FT                   QEYRIMVAYECSKRVRAELKEEFKGCHKKVQECALEFLCKQDAIDYILVGMRKPSYVQE
FT                   IMAMRENICLD"
FT   gene            272819..273094
FT                   /locus_tag="Saut_0295"
FT   CDS_pept        272819..273094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0295"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="COGs: COG0694 Thioredoxin-like protein and domains;
FT                   InterPro IPR001075; KEGG: tdn:Suden_0330 nitrogen-fixing
FT                   NifU-like protein; PFAM: nitrogen-fixing NifU domain
FT                   protein; SPTR: A3W469 NifU domain protein; PFAM: NifU-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08344"
FT                   /db_xref="GOA:E0UU35"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU35"
FT                   /protein_id="ADN08344.1"
FT                   /translation="MIPFSDEELLEPVKHVIDKVRPSLALDGGDIDFITVKNGNVYVQL
FT                   KGACIGCASSGSTLKYGVERQLRMDIHPEITVVNVPAGMENDIDNL"
FT   gene            273102..273695
FT                   /locus_tag="Saut_0296"
FT   CDS_pept        273102..273695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08345"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU36"
FT                   /protein_id="ADN08345.1"
FT                   /translation="MGTISKYKILSQAKESFSKEEYKSALEKFAQVLQNYPNSKEAFNG
FT                   VILSEMAMSGEEGAEALFDYYEILREEDKEEADSIMSEILEGMDGSLEKLSEVFAEPLR
FT                   NRLEFEEGILYSDFQKILQEGGDFVETFENIMFSTRVIITSKEDFLDFLDKLIEHDFAQ
FT                   MALTYLENALSVYPDDKLLRKLLKKLAQGKSIEN"
FT   gene            273685..274980
FT                   /locus_tag="Saut_0297"
FT   CDS_pept        273685..274980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0297"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="COGs: COG0769 UDP-N-acetylmuramyl tripeptide
FT                   synthase; InterPro IPR004101:IPR013221:IPR005761; KEGG:
FT                   tdn:Suden_0332 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-
FT                   diaminopimelate ligase; PFAM: Mur ligase middle domain
FT                   protein; cytoplasmic peptidoglycan synthetase domain
FT                   protein; SPTR: Q7M8F9
FT                   UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase; TIGRFAM:
FT                   UDP-N-acetylmuramyl-tripeptide synthetase; PFAM: Mur ligase
FT                   family, glutamate ligase domain; Mur ligase middle domain;
FT                   TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08346"
FT                   /db_xref="GOA:E0UU37"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU37"
FT                   /protein_id="ADN08346.1"
FT                   /translation="MKIELPDQAYKYVTENSGECDEETAFVLTHQNRAYLEDAKQHNAH
FT                   SIIKIEDIAELFGVNKIKIIGITGTNGKTTTASAIYSFLLDLGYKAALQGTRGLFMNDE
FT                   VCEGKTLTTPSVLNTYKHIYQAVCAGCEYFIMEVSSHALVQRRIEGLKFELKILTNITQ
FT                   DHLDYHKTIEEYIAVKNGFFQDESKKLINKDEPKAAFNFKNAYTYGIENPATYRLMAYS
FT                   LNEGSSGIIQHFQEIVPFTASLHGFFNLYNLMAAIAATHLITDKTLEEIADVVDNFAGV
FT                   SGRMEQVCAAPNVIVDFAHTPDGMQQVLNALKEKELIVVFGAGGDRDRLKRPIMGRVAA
FT                   SLAKKVIVTSDNPRHEDPEIIIDDILEGIQDKTNIIVELNRKKAIQMALDMQEDEEVVV
FT                   ILGKGDEAYQVIYDEKFAFDDREVVKELLNLS"
FT   gene            275080..275454
FT                   /locus_tag="Saut_0298"
FT   CDS_pept        275080..275454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0298"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="KEGG: tdn:Suden_0333 ferredoxin, 2Fe-2S; SPTR:
FT                   P82802 Ferredoxin, 2Fe-2s"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08347"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU38"
FT                   /protein_id="ADN08347.1"
FT                   /translation="MGIPQPAFYIFKCEQSAPPGMPKPSCVTPATQDLFQYLAQKLMQE
FT                   GIMGTVQPIRTSCMNRCSAGPVMLVEPGHTMYAGLTKEKIDKIISEHIIGGNVVEEYVI
FT                   DAEMWDEPISPADMQKQMGR"
FT   gene            275459..275824
FT                   /locus_tag="Saut_0299"
FT   CDS_pept        275459..275824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0299"
FT                   /product="L-aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="COGs: COG0853 Aspartate 1-decarboxylase; InterPro
FT                   IPR003190; KEGG: tdn:Suden_0334 aspartate
FT                   alpha-decarboxylase; PFAM: aspartate decarboxylase; PRIAM:
FT                   Aspartate 1-decarboxylase; SPTR: Q30TR6 Aspartate
FT                   1-decarboxylase; TIGRFAM: aspartate 1-decarboxylase; PFAM:
FT                   Aspartate decarboxylase; TIGRFAM:
FT                   L-aspartate-alpha-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08348"
FT                   /db_xref="GOA:E0UU39"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU39"
FT                   /protein_id="ADN08348.1"
FT                   /translation="MTIEMLYSKIHRATVTDANLNYVGSITIDEELLEASKMRVGQKVE
FT                   ILNINNGERFSTYIILGERGKRDICLNGAAARKVHKGDKIIVVAYATYDERELENYKPR
FT                   VVLLNDENNIDAIHEEI"
FT   gene            275840..276133
FT                   /locus_tag="Saut_0300"
FT   CDS_pept        275840..276133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0718 conserved hypothetical protein;
FT                   InterPro IPR004401; KEGG: tdn:Suden_0335 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: A6QCK9
FT                   UPF0133 protein SUN_2278; PFAM: Uncharacterised BCR, YbaB
FT                   family COG0718; TIGRFAM: conserved hypothetical protein
FT                   TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08349"
FT                   /db_xref="GOA:E0UU40"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU40"
FT                   /protein_id="ADN08349.1"
FT                   /translation="MFSNLGDMGKMLEGMQENAAKLQEELASKTFSVKSGGGLIELTLN
FT                   GNGEVIDLSIDDELLEDKEALQILLIGAINDANKMVQQNQQSSAMSMLGGLK"
FT   gene            276134..277114
FT                   /locus_tag="Saut_0301"
FT   CDS_pept        276134..277114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0301"
FT                   /product="Pdz/Dhr/GlgF"
FT                   /note="KEGG: tdn:Suden_0336 PDZ/DHR/GLGF"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08350"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU41"
FT                   /protein_id="ADN08350.1"
FT                   /translation="MLRLFIAFHLLFLNLYACKGGYTSCVQKAKDAKIMQQNSLYIPIK
FT                   YDQRIVYSHKKPKSKILKYDPFLSLYLIEDQKPFAYPYDINMRLQLGTAILNDKTAKES
FT                   RIVQHQIGLNFFGKYNQKLPAPAIISSSCCSLEAIVSYKGVIEKEYLQYFLKTKTALYS
FT                   DIGIRVHDENRLVLVNASDPFITNNPFKVQDCIVMYDNKKIKNAASLMRKILFSPLGSK
FT                   HTVKVKRGAKFLTFKVQSRQRYGGGFLSDTFLEQKGIYFDEGLHVSSLNKKFQSYGLKI
FT                   GDKLIQVNGVAVQNQNELRRYIENFKDYSSLLFERNKFQFFVNIK"
FT   gene            277134..277985
FT                   /locus_tag="Saut_0302"
FT   CDS_pept        277134..277985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0302"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="COGs: COG0142 Geranylgeranyl pyrophosphate synthase;
FT                   InterPro IPR000092; KEGG: tdn:Suden_0337 polyprenyl
FT                   synthetase; PFAM: Polyprenyl synthetase; SPTR: B9SYX2
FT                   Geranyl geranyl pyrophosphate synthase, putative; PFAM:
FT                   Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08351"
FT                   /db_xref="GOA:E0UU42"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU42"
FT                   /protein_id="ADN08351.1"
FT                   /translation="MQNFEQFLLDNLPTSKSIHPTYESALQNMLEAGGKRFRPALLLGV
FT                   VKAYNPLMLESARHAALAVEFLHTYSLIHDDLPAMDDSPLRRGKPTLHVSFDEVTAILV
FT                   GDALNTYSFEVLANAPFSDETRVKLIRELASNGGLNGMVLGQAIDCYFENKPLAVEDIK
FT                   TLHTNKTAKLIAASLKMGALIVGRDDAADKLYDFGIKLGLLFQIQDDILDVTQSSQEAG
FT                   KLTNNDEDKNSFVTILGLEEATNEANILADELNNEMCNFDESLQRELSPLLTKYINRHK
FT                   EQ"
FT   gene            277987..279909
FT                   /locus_tag="Saut_0303"
FT   CDS_pept        277987..279909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0303"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="COGs: COG0021 Transketolase; InterPro
FT                   IPR005476:IPR005475:IPR005474:IPR005478; KEGG:
FT                   tdn:Suden_0338 transketolase; PFAM: Transketolase central
FT                   region; Transketolase domain protein; SPTR: O67642
FT                   Transketolase; TIGRFAM: transketolase; PFAM: Transketolase,
FT                   thiamine diphosphate binding domain; Transketolase,
FT                   pyrimidine binding domain; TIGRFAM: transketolase,
FT                   bacterial and yeast"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08352"
FT                   /db_xref="GOA:E0UU43"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU43"
FT                   /protein_id="ADN08352.1"
FT                   /translation="MDTNKMRQKMANTIRFLAADMVQKANSGHPGAPMGLADVAVVLSE
FT                   HLNHNPKNPQWLNRDRLVFSGGHATGLIYSLYYLWGYGLEMEDLKQFRQLDSKTPGHPE
FT                   YGHTEGVEITTGPLGQGVANAVGFSMASKFVGAQVNSETAKLVDHHVYCLCGDGDLEEG
FT                   ISYEACSLAGHNKLDNLILIYDSNRITIEGNTDLSISEDIRARFEAQGWEVLECNGHDY
FT                   IEIDATITQAKKADRPVLIIANTIIAKGAGPLEGSHHAHGAPLGEDVIADGKRGAGFDP
FT                   EKKFFVPQDVMIRFRCAIEEGDLVEREWIHSLKTAPLMEQNEALKALLNHDYSRIQWPA
FT                   FEKADATRNTNGKILNAIAKAIPGFIGGSADLSPSNKTYLNDMGVYPKGKNIYFGIREH
FT                   AMAAIANAMALYGPLMPFTSTFFVFSDYMKPAARIAALSGIQQFFIWTHDSIGVGEDGP
FT                   THEPIEQLSQFRALPNFYVWRPADGAENIEAWKTALAMENSPSAFVCSRQSLAVVPAPV
FT                   KGEINRGGYLLASDENAVITLMASGSEVELALKTKEALNEKGVPANVVSVPCYDLFIEQ
FT                   DKAYIDEIIIPDTKKVAIEAARGLEWYRFADEVIGMDTFGASAPAKDLFEKFGFTVDAV
FT                   LSKIK"
FT   gene            complement(279910..281019)
FT                   /locus_tag="Saut_0304"
FT   CDS_pept        complement(279910..281019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0304"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG3706 Response regulator containing a
FT                   CheY-like receiver domain and a GGDEF domain; InterPro
FT                   IPR000160; KEGG: sun:SUN_1050 hypothetical protein; PFAM:
FT                   GGDEF domain containing protein; SMART: GGDEF domain
FT                   containing protein; SPTR: A0YNV2 Regulatory component of
FT                   sensory transduction system; TIGRFAM: diguanylate cyclase;
FT                   PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08353"
FT                   /db_xref="GOA:E0UU44"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU44"
FT                   /protein_id="ADN08353.1"
FT                   /translation="MNKILDFLTLERGDDFCNRRYIVIKFALLSSIVLFSLFIFINLFM
FT                   HQYKASVIDFISAFVAIFAYIYMQNSKNIILTIRIATFNIVIFFLIFAYISQAEHFSLI
FT                   WTIFVPIFAIITNGKRVGLYFSLLFYAILFVLSYHYINVWDSGQWLFTDWMRLVLASTV
FT                   LTLCMYIYEALLDKAQQDLQRARAKELQRTKELHLQSITDQLTGLYNRRYYDNMIVKLA
FT                   ALAKRQNLCITFFILDIDYFKLYNDNYGHIQGDEALIEVAQVLKKHIQRGDDFVFRLGG
FT                   EEFAGIILSKEKQKAQQWASQLTKIIEDLKIEHRTSKISEFLTVSIGIATLSHPQENNI
FT                   GLLYKDADKALYTAKYNGRNQSQISQESN"
FT   gene            complement(281099..281521)
FT                   /locus_tag="Saut_0305"
FT   CDS_pept        complement(281099..281521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08354"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU45"
FT                   /protein_id="ADN08354.1"
FT                   /translation="MDEKPDMLLIVSKAESSSNLNLAPLLEALPQTYEGIANRLSPSMH
FT                   GWPIITEVEKAISLIQLPKPKTNKCKVAREPSQESKEVVLKRRSIHVMDKEKSMITKEQ
FT                   FHTLLKSIDCSLDGKENAIHLAIFLHREKSILRGST"
FT   gene            complement(281673..282584)
FT                   /locus_tag="Saut_0306"
FT   CDS_pept        complement(281673..282584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0306"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="COGs: COG0679 permease; InterPro IPR004776; KEGG:
FT                   tdn:Suden_0341 auxin efflux carrier; PFAM: Auxin Efflux
FT                   Carrier; SPTR: Q0W0J5 Putative uncharacterized protein;
FT                   PFAM: Membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08355"
FT                   /db_xref="GOA:E0UU46"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU46"
FT                   /protein_id="ADN08355.1"
FT                   /translation="MSSIIFSILSIYVFILMGYISKMSFKDKIDERTITLLNVYFLQVF
FT                   LTFWGLLLHPVNITLLYAPGIYLFIVIFVLLISALFASKLFSQKKEYSIAMVASIIGNT
FT                   GNLGIPLNIAIFGEASIPYTTVVNLVNVFVVYTVGVYFYSRGNFNAKTSLKNIIKLPIL
FT                   WAAVIAIVLSVNHYTPSDAVMNMLMMGAYASMTMQLFLFGIYLYDIKIREINKKLITWV
FT                   MSLKFIFLPLIAFIILFNINLEPMIKGIIFIELLMPLAVANVNLASLYDCEPKLVTALV
FT                   FISSVLFLGVIFFAVKILSYLA"
FT   gene            282612..282932
FT                   /locus_tag="Saut_0307"
FT   CDS_pept        282612..282932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0307"
FT                   /product="Thioredoxin domain protein"
FT                   /note="InterPro IPR006662:IPR013766; KEGG: tdn:Suden_0342
FT                   thioredoxin-like; PFAM: Thioredoxin domain; SPTR: P96695
FT                   Thioredoxin-like protein ydfQ; PFAM: Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08356"
FT                   /db_xref="GOA:E0UU47"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU47"
FT                   /protein_id="ADN08356.1"
FT                   /translation="MNTIKNIEQTIKENLAVMLYFSAPTCNVCHALKPKLLEAIDKNFK
FT                   EFTVISIDTSIEQEIAAHFSVFAIPTILVFLDGKEFLRKSRHMSVDEVVREIKRPYEIM
FT                   MS"
FT   gene            complement(282919..283671)
FT                   /locus_tag="Saut_0308"
FT   CDS_pept        complement(282919..283671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0308"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro
FT                   IPR001537:IPR013123; KEGG: tdn:Suden_0343 tRNA/rRNA
FT                   methyltransferase (SpoU); PFAM: tRNA/rRNA methyltransferase
FT                   (SpoU); RNA 2-O ribose methyltransferase substrate binding;
FT                   SPTR: A0YBZ5 TRNA/rRNA methyltransferase (SpoU); PFAM: SpoU
FT                   rRNA Methylase family; RNA 2'-O ribose methyltransferase
FT                   substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08357"
FT                   /db_xref="GOA:E0UU48"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU48"
FT                   /protein_id="ADN08357.1"
FT                   /translation="MKDSQEYKDKKAFFEKIITLYGRNVIVEILQDKSIEIHKLHLADS
FT                   NKPDGAVKKILLLAKERDIEIVKHDKAALSRISKNAKQDQGVAIDIISKTYLHVNMLKE
FT                   LTKYRLIALDGIQNPQNLGMIIRSCAAGNIDGIILPKKNSAKISPLVVKASAGTLFKLP
FT                   IYFCNTLQEVLTEQQEAKIYTLSSYAKTTIYDIQESEKTIYVLGNENEGVSHEVAKLCN
FT                   NSVSIPMNRGVESLNVAVTASLIAFMTS"
FT   gene            complement(283683..284411)
FT                   /locus_tag="Saut_0309"
FT   CDS_pept        complement(283683..284411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0309"
FT                   /product="protein of unknown function DUF328"
FT                   /note="COGs: COG3022 conserved hypothetical protein;
FT                   InterPro IPR005583; KEGG: tdn:Suden_0344 hypothetical
FT                   protein; PFAM: protein of unknown function DUF328; SPTR:
FT                   P45491 Uncharacterized protein Cj0984; PFAM: Protein of
FT                   unknown function (DUF328)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08358"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU49"
FT                   /protein_id="ADN08358.1"
FT                   /translation="MLKILFSPSEGKKSGSDEKPKELFGALDARKEILDTYNNIVLSGD
FT                   EEKIKQLFGFKKFSECQPYINDLYNSPLMAAIQRYQGVAYDYLQYASLTPNAQTFLKSN
FT                   TLIFSNLYGPILGGDIIANYKVKQGNSVGDISPDKFYKERFSYQLDLYLTGHDVLDLRA
FT                   GYYDKFYKLSKPYTTLKFLKNGKTVSHWAKAYRGIVLREIAKAGVNTLEDYMKLEIENL
FT                   QIHEIIEQKLKREIVYNIVE"
FT   gene            284498..285280
FT                   /locus_tag="Saut_0310"
FT   CDS_pept        284498..285280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0310"
FT                   /product="cyclic-AMP phosphodiesterase"
FT                   /note="InterPro IPR000396:IPR001279; KEGG: tdn:Suden_0930
FT                   metal dependent phosphohydrolase; PFAM: beta-lactamase
FT                   domain protein; SPTR: A3WJH3 Possible cAMP
FT                   phosphodiesterase, metallo-beta-lactamase superfamily
FT                   protein; PFAM: cAMP phosphodiesterases class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08359"
FT                   /db_xref="GOA:E0UU50"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU50"
FT                   /protein_id="ADN08359.1"
FT                   /translation="MYKNSIKILGAYGTKAKGFGTTSFMLNRHTVIDAGNLLDALAEDS
FT                   LHIENIYLTHSHLDHISDIAYIIDNYFCKRSKTLNIIGLPQTIQALKEHFLNDIIWPDF
FT                   SKIPLENSDVIAVKYSELYLNEEYHLDKQTTLTPVRTDHTVPSCGYIYKVNNAGVLITA
FT                   DTFSLENIINTVNNDMQIKSLVVECSFSSNMQTLAEVSKHLTPKLLFQALKKLKRDDIT
FT                   LYINHIKPSCLEEISTEIEAFRGNFKPIILKDGDFITF"
FT   gene            285336..285412
FT                   /locus_tag="Saut_R0007"
FT   tRNA            285336..285412
FT                   /locus_tag="Saut_R0007"
FT                   /product="tRNA-Thr"
FT   gene            285472..285556
FT                   /locus_tag="Saut_R0008"
FT   tRNA            285472..285556
FT                   /locus_tag="Saut_R0008"
FT                   /product="tRNA-Tyr"
FT   gene            285564..285639
FT                   /locus_tag="Saut_R0009"
FT   tRNA            285564..285639
FT                   /locus_tag="Saut_R0009"
FT                   /product="tRNA-Gly"
FT   gene            285794..285868
FT                   /locus_tag="Saut_R0010"
FT   tRNA            285794..285868
FT                   /locus_tag="Saut_R0010"
FT                   /product="tRNA-Thr"
FT   gene            285960..287159
FT                   /locus_tag="Saut_0311"
FT   CDS_pept        285960..287159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0311"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="COGs: COG0050 GTPase - translation elongation
FT                   factors; InterPro
FT                   IPR000795:IPR004160:IPR004161:IPR005225:IPR 004541; KEGG:
FT                   tdn:Suden_0345 elongation factor Tu; PFAM: protein
FT                   synthesis factor GTP-binding; elongation factor Tu domain
FT                   protein; elongation factor Tu domain 2 protein; SPTR:
FT                   Q30TQ5 Elongation factor Tu; TIGRFAM: translation
FT                   elongation factor Tu; small GTP-binding protein; PFAM:
FT                   Elongation factor Tu domain 2; Elongation factor Tu
FT                   C-terminal domain; Elongation factor Tu GTP binding domain;
FT                   TIGRFAM: small GTP-binding protein domain; translation
FT                   elongation factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08360"
FT                   /db_xref="GOA:E0UU51"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU51"
FT                   /protein_id="ADN08360.1"
FT                   /translation="MAKEKFERNKPHVNIGTIGHVDHGKTTLTAAITAVLAVKNGAKFM
FT                   DYDAIDNAPEERERGITIATSHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSKQVGVPYIVVFMNKEDMVDDEELLELVEMEIRELLDMYEF
FT                   PGDDTPITAGSALKALEEAKTGTLGEWSEKIVALMDTVDEYIPEPVRETDKDFLMPVED
FT                   VFSISGRGTVVTGRIERGVVKVGEEVEIVGIKDTQKTTVTGVEMFRKEMEQGEAGDNCG
FT                   ILVRGIAKDEVERGQVLCKPGTITPHTKFTAEIYVLSKDEGGRHTPFFNGYRPQFYVRT
FT                   TDVTGAITLPEGTEMVMPGDNVSITAELIHPIAMEQGTKFAIREGGRTVGAGVVAEILA
FT                   "
FT   gene            287373..287448
FT                   /locus_tag="Saut_R0011"
FT   tRNA            287373..287448
FT                   /locus_tag="Saut_R0011"
FT                   /product="tRNA-Trp"
FT   gene            287521..287700
FT                   /locus_tag="Saut_0312"
FT   CDS_pept        287521..287700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0312"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="InterPro IPR001901:IPR005807; KEGG: tdn:Suden_0347
FT                   preprotein translocase subunit SecE; PFAM: protein
FT                   secE/sec61-gamma protein; TIGRFAM: preprotein translocase,
FT                   SecE subunit; PFAM: SecE/Sec61-gamma subunits of protein
FT                   translocation complex; TIGRFAM: preprotein translocase,
FT                   SecE subunit, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08361"
FT                   /db_xref="GOA:E0UU52"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU52"
FT                   /protein_id="ADN08361.1"
FT                   /translation="MNLSKVISNARLELSKVIFPTKGQVKQAYIAVVIVVSAVAAFLAL
FT                   VDLLMSSIMSVILG"
FT   gene            287711..288238
FT                   /locus_tag="Saut_0313"
FT   CDS_pept        287711..288238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0313"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="COGs: COG0250 Transcription antiterminator; InterPro
FT                   IPR001062:IPR005824:IPR006645:IPR018095:IPR 015869; KEGG:
FT                   tdn:Suden_0348 transcription antitermination protein NusG;
FT                   PFAM: NGN domain protein; KOW domain protein; SMART: NGN
FT                   domain protein; KOW domain protein; SPTR: Q9PI36
FT                   Transcription antitermination protein nusG; TIGRFAM:
FT                   transcription termination/antitermination factor NusG;
FT                   PFAM: Transcription termination factor nusG; KOW motif;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08362"
FT                   /db_xref="GOA:E0UU53"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU53"
FT                   /protein_id="ADN08362.1"
FT                   /translation="MAHQWYSIQTYGSDRTVRDAIFNMIEEHGLQDYITDVIVPTEDVI
FT                   EVKDGKKKVSERSLYSGYVFARIDLNTEIQHMIQSIPKVSGFIGEGNVPTPLSEHDINV
FT                   ILDRVNNRAAPKPKVFFDNGETVRIIDGPFANFTATVDEYDLEHGTLKLNVSIFGRATP
FT                   VDISYTQVEKII"
FT   gene            288259..288684
FT                   /locus_tag="Saut_0314"
FT   CDS_pept        288259..288684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0314"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="COGs: COG0080 Ribosomal protein L11; InterPro
FT                   IPR000911:IPR006519; KEGG: tdn:Suden_0349 ribosomal protein
FT                   L11; PFAM: ribosomal protein L11; SMART: ribosomal protein
FT                   L11; SPTR: Q30TQ1 50S ribosomal protein L11; TIGRFAM:
FT                   ribosomal protein L11; PFAM: Ribosomal protein L11, RNA
FT                   binding domain; Ribosomal protein L11, N-terminal domain;
FT                   TIGRFAM: 50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08363"
FT                   /db_xref="GOA:E0UU54"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU54"
FT                   /protein_id="ADN08363.1"
FT                   /translation="MAKKVMDYIKLQIEAGKANPAPPVGPALGQRGVNIMEFCKAFNEK
FT                   TKDKMGFKVPVVITVYNDRSFSFVTKQPPASELLMKAAGLKKGSDNPLKNKVGSLTRAQ
FT                   LMEVVEAKIEDLNTDDKDMAANTLAGSARSIGIEIKD"
FT   gene            288751..289443
FT                   /locus_tag="Saut_0315"
FT   CDS_pept        288751..289443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0315"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="COGs: COG0081 Ribosomal protein L1; InterPro
FT                   IPR002143:IPR005878; KEGG: tdn:Suden_0350 50S ribosomal
FT                   protein L1; PFAM: ribosomal protein L1; SPTR: Q30TQ0 50S
FT                   ribosomal protein L1; TIGRFAM: ribosomal protein L1; PFAM:
FT                   Ribosomal protein L1p/L10e family; TIGRFAM: ribosomal
FT                   protein L1, bacterial/chloroplast"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08364"
FT                   /db_xref="GOA:E0UU55"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU55"
FT                   /protein_id="ADN08364.1"
FT                   /translation="MSKRYKQLLEKIDNTKSYGVEEASATVKDLKSAKFDETVEIAMNL
FT                   NVDPRHADQMVRGAIVLPHGTGKTVRVAVFAKGAKADEAKAAGADIVGTDDLVAQIKEG
FT                   IFNFDVVVAAPDCMGLVGQIGRILGPKGLMPNPKTGTVTPDVATAVNNVKGGQVNFRVD
FT                   KKGNIHAGIGKASFDAKQIEENLTTFLVAINKQKPASAKGRYIKNAALSLTMSPAVKLD
FT                   VIELADIK"
FT   gene            289636..290118
FT                   /locus_tag="Saut_0316"
FT   CDS_pept        289636..290118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0316"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="COGs: COG0244 Ribosomal protein L10; InterPro
FT                   IPR001790:IPR002363; KEGG: tdn:Suden_0351 50S ribosomal
FT                   protein L10; PFAM: ribosomal protein L10; SPTR: Q30TP9 50S
FT                   ribosomal protein L10; PFAM: Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08365"
FT                   /db_xref="GOA:E0UU56"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU56"
FT                   /protein_id="ADN08365.1"
FT                   /translation="MLKSKKAEVIEQLTTSFANTTAVVICDYKGLTVSQLEELRKAARA
FT                   KDTSVQVVKNTLATIALNNAEMSGVEIKDTNIFIWSDDVINAAKIAADFAKDHDKFVIK
FT                   AGYLDKEPANVAKIEAFAKLPGRDELLGMLAATWMAPITNLAVGIDALRRKKEEEA"
FT   gene            290184..290555
FT                   /locus_tag="Saut_0317"
FT   CDS_pept        290184..290555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0317"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="COGs: COG0222 Ribosomal protein L7/L12; InterPro
FT                   IPR013823:IPR000206; KEGG: tdn:Suden_0352 50S ribosomal
FT                   protein L7/L12; PFAM: Ribosomal protein L7/L12; SPTR:
FT                   Q30TP8 50S ribosomal protein L7/L12; TIGRFAM: ribosomal
FT                   protein L7/L12; PFAM: Ribosomal protein L7/L12 C-terminal
FT                   domain; TIGRFAM: ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08366"
FT                   /db_xref="GOA:E0UU57"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU57"
FT                   /protein_id="ADN08366.1"
FT                   /translation="MAVTKEDVLEFISGLSVLELSELVKEFEEKFGVSAQPVAVAGVAG
FT                   EAGGAAAEQTEFNVILTDVGAKKIGVIKAVRALTGLGLKEAKEACESLPSTIKEGVDKE
FT                   TAEEAKAALEEAGAAVEVK"
FT   gene            290771..294916
FT                   /locus_tag="Saut_0318"
FT   CDS_pept        290771..294916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0318"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0085 DNA-directed RNA polymerase beta
FT                   subunit/140 kD subunit; InterPro
FT                   IPR007642:IPR007645:IPR007641:IPR007644:IPR
FT                   019462:IPR007120:IPR007121:IPR010243; KEGG: tdn:Suden_0353
FT                   DNA-directed RNA polymerase subunit beta; PFAM: RNA
FT                   polymerase Rpb2 domain 6; RNA polymerase Rpb2 domain 7; RNA
FT                   polymerase Rpb2 domain 3; RNA polymerase Rpb2 domain 2; RNA
FT                   polymerase beta subunit; DNA-directed RNA polymerase, beta
FT                   subunit, external 1 domain; PRIAM: DNA-directed RNA
FT                   polymerase; SPTR: Q30TP7 DNA-directed RNA polymerase
FT                   subunit beta; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2, domain 3; RNA
FT                   polymerase Rpb2, domain 6; RNA polymerase beta subunit
FT                   external 1 domain; RNA polymerase Rpb2, domain 2; RNA
FT                   polymerase beta subunit; RNA polymerase Rpb2, domain 7;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08367"
FT                   /db_xref="GOA:E0UU58"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU58"
FT                   /protein_id="ADN08367.1"
FT                   /translation="MLNTLYSGNRLRVDFSKTPQEIEVPNLLQLQQSSYDTFLMLHAKN
FT                   RSQSGIEKVFQSVFPIHDAQNRLTVEYIESEVTNPKYTVRECMERGLTYAVSLRMKTRL
FT                   ILWERDENTKEKLGVADIKEQSIFVRDIPLMTERTSFIINGVERVVVNQLHRSPGVIFK
FT                   EEESSTAGNKLIYTGQIIPDRGSWLYFEYDPKDILYMRINKRRKVPVTIMFRALGYSKQ
FT                   DILKLFYPIQTIKIHDNMFSIDFNPKDYASRISYDLIDMNDKVLVSSGKRLSSKKAQKL
FT                   LDDGVKEVQYPLEILLERYLAESIIDPETGEVLFDTMTHIDETKLKKMAEIGVTEFKIA
FT                   NDIAEGVDSSIINAFNADADSLKLLKQTEEIEDENDLAAIRIYKVMRPGEPVTKEAAKI
FT                   FVNQLFFDPERYDLTQVGRMKMNHKLGMNIPEYVTVLTHEDIIESVKYVIKVKNGQGHL
FT                   DDRDHLGNRRIRSIGELLGNELHNGLVKMQKAIRDKLSTMSGPMNELMPHDLINSKMIT
FT                   STIMEFFSGGQLSQFMDQTNPLSEVTHKRRLSALGEGGLVKERAGFEVRDVHPTHYGRI
FT                   CPVETPEGQNIGLINTLAMYAKVNEHGFIEAPYKVMKDGKVTHEIVYLTATQEEGKMIA
FT                   AASNKLDENGQFIEDLIAVRQDGEILLRDPKECEYADLSSQMVIGVAASLIPFLEHDDA
FT                   NRALMGSNMQRQAVPLLRANAPMVGTGIEKLVARDAWECVKAKRAGKIEKVDGKHIYVM
FT                   GEEDGEIFIDYYPLQKNLRTNQNTSFTQKPIVKIGEMVEKGQIIADGPNMDQGELALGV
FT                   NAMVAFMPWNGYNFEDAIVISERLIRQDAFTSVHIYEKEVEARELKHGVEEITRDIPNV
FT                   RDDELAHLDESGIVKIGTTVSGGMILVGKVSPKGEVKPTPEERLLRAIFGEKAGHVVNK
FT                   SLYCPPSMEGVVVDIKVFTKKGYDKDPRALELEKEERDYLEREHYDRLIMIDKEEMLRV
FT                   TKLLTREPLQSDIKIGDTEYKAGDTINGDDLKEVNRFAMNAIVKSFSQEIQDEYNKTKN
FT                   HFQKQKRIFRDEHEEKLTILEKDDILPNGVVKYVKIYIATKRHLKVGDKMAGRHGNKGI
FT                   VSNIVPEVDMPYMEDGRSVDVCLNPLGVPSRMNIGQILEMHLGMAGRELGNQIQEQFEA
FT                   KQKDFIDDLRAKMIEIADVAGMMHASKVIGEMDDETFLKYARDWSKGVKFATPIFEGTD
FT                   AKEFEKLYELAKMDSDGKRVLYDGKTGEKMKERVNVGYMYILKLHHLVDEKIHARSTGP
FT                   YSLVTQQPVGGKALFGGQRFGEMEVWALEAYGASAVLKEMLTIKSDDVDGRVRAYKALT
FT                   KGELVPESGIPETLFVLTKELQALALDVEIMDEVEDDE"
FT   gene            294909..299429
FT                   /locus_tag="Saut_0319"
FT   CDS_pept        294909..299429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0319"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0086 DNA-directed RNA polymerase beta'
FT                   subunit/160 kD subunit; InterPro
FT                   IPR007081:IPR007066:IPR000722:IPR007083:IPR
FT                   007080:IPR006592:IPR012754; KEGG: tdn:Suden_0354
FT                   DNA-directed RNA polymerase, subunit beta-prime; PFAM: RNA
FT                   polymerase Rpb1 domain 1; RNA polymerase alpha subunit; RNA
FT                   polymerase Rpb1 domain 5; RNA polymerase Rpb1 domain 3; RNA
FT                   polymerase Rpb1 domain 4; SMART: RNA polymerase I subunit A
FT                   domain protein; SPTR: Q30TP6 DNA-directed RNA polymerase
FT                   subunit beta'; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase Rpb1, domain 2; RNA
FT                   polymerase Rpb1, domain 4; RNA polymerase Rpb1, domain 1;
FT                   RNA polymerase Rpb1, domain 3; RNA polymerase Rpb1, domain
FT                   5; TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type; DNA-directed RNA polymerase, beta'
FT                   subunit, predominant form"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08368"
FT                   /db_xref="GOA:E0UU59"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU59"
FT                   /protein_id="ADN08368.1"
FT                   /translation="MSKLVPVEVTEECRPKDIKQLQFRLASPEKVMSWSHGEVKKPETI
FT                   NYRTLKPERDGLFCAKIFGPVRDYECLCGKYKKMRYKGVVCEKCGVEVTSTKVRRTRMG
FT                   HIELVTPVAHIWYVSSLPSRIGTLLGIKMKDLERVLYYEAYIVESGGEAYYDAEAKTPV
FT                   LKYDVLNEEQYRTLVQRFGELGFKARMGGEVIRDLLDSIDLVDLFTNLKEAIGETKSEA
FT                   KKKTINKRLKVIESFLNSGNNPAWMMLTVLPVLPPDLRPLVSLDGGKFAVSDVNDLYRR
FT                   VINRNQRLKRLVELEAPEIIVRNEKRMLQESVDALFDNGRRANAVKGANKRPLKSLSEI
FT                   IKGKQGRFRQNLLGKRVDFSGRSVIVVGPSLRMDECGLPKKMALELFKPHLIAKLEDKG
FT                   YATTVKAAKKMIEDKTNEVWECLAEIVDGYPIMLNRAPTLHKLSIQAFHPKLIDGKAIQ
FT                   LHPLVCAAFNADFDGDQMAVHVPLSSAAIAEAKVLMLASMNILLPASGKAIATPSQDMV
FT                   LGIYYISLEKTGVKGSNKLFANVDEIRIALEHNALDLHAKVRTRVDGRIIHTTAGRLLI
FT                   KAILPDFVPAELWNKVMKKKVINEIVDYVQKHGGIGVTASFLDRLKDLGFKHATEAGVS
FT                   ISADDIRVPDMKPAKIAESKARVIEIQKQFEAGLLTEQERYNKIIDVWTDTNNTLAAEM
FT                   MQLVQTDKDGFNSIHMMADSGARGSAAQIRQLAGMRGLMAKPSGDIIETPIISNFKEGL
FT                   NVIEYFISTHGARKGLADTALKTANAGYLTRKLVDVAQNVKIVEHDCHTHEGIEISDIQ
FT                   DQNTLIESLEDRLNGRVLADDVIDPISNEILYAEGTLLDEVSAKVIAESGIKTAVIRTP
FT                   TTCKSQEGVCALCYGVNLATGHIVRPGEAVGIVAAQSIGEPGTQLTLRTFHVGGTASST
FT                   AQERQVIAEKEGFIRYYNLKTYKNKEGKNIVANRRNAGVLLVEPKIKAPFAGTIEIQTI
FT                   HDEVIISVKSDEETVRYSLRKMEIAKPNELAGVSGQIEGKYYFPHKNGEHVESLDSIVE
FT                   TIKDGWNVPSRIPYASELLVDDGAPVTKKILAKEEGTVKYFLLKGDYLERFEGLKSGYE
FT                   VVEKGLFAAVIDANNREGVRHYIARGSVIVTDDNESVDRDIVIAKPSSDESVVIAEWDP
FT                   YSNPIISEANGVVKYEDIIVGTTASEQLDELTGKTRLMINDHISSEYKPAIVLATEDGE
FT                   LLRYAVEPKSSVFVADGAEVKIADILAKTPKALQKSSDITGGLPRVSELFEGRRPKATA
FT                   LISEIDGVVSFGKPLRGKVRIIVSNADNGIVKEYFVDKSHEPVVNPGDFVHAGERLTTG
FT                   ILSSHELLRIMGVKALYNYLVSEVQQVYRSQGVNIADKHIEVIFTQMLRQVKIVKSGDT
FT                   KFIEGDLVSKVKFAQENEKIIRLGGRPAIAEPFLVGITCAAVSADSIISAASFQDTTKV
FT                   LTEAAVSAKVDNLENLKENVIIGRTIPVGTGIYKDQELEFVSEEE"
FT   gene            299601..299975
FT                   /locus_tag="Saut_0320"
FT   CDS_pept        299601..299975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0320"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="COGs: COG0048 Ribosomal protein S12; InterPro
FT                   IPR005679:IPR006032; KEGG: cha:CHAB381_1660 30S ribosomal
FT                   protein S12; PFAM: ribosomal protein S12/S23; SPTR: Q30TP5
FT                   30S ribosomal protein S12; TIGRFAM: ribosomal protein S12;
FT                   PFAM: Ribosomal protein S12; TIGRFAM: ribosomal protein
FT                   S12, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08369"
FT                   /db_xref="GOA:E0UU60"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU60"
FT                   /protein_id="ADN08369.1"
FT                   /translation="MPTINQLIRKERKRVIKKSKSPALDSCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRIKDLPGVKYHIVRGALDT
FT                   AGVANRTVARSKYGTKKPKK"
FT   gene            300203..300670
FT                   /locus_tag="Saut_0321"
FT   CDS_pept        300203..300670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0321"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="COGs: COG0049 Ribosomal protein S7; InterPro
FT                   IPR000235:IPR005717; KEGG: tdn:Suden_0356 30S ribosomal
FT                   protein S7; PFAM: ribosomal protein S7; SPTR: Q30TP4 30S
FT                   ribosomal protein S7; TIGRFAM: ribosomal protein S7; PFAM:
FT                   Ribosomal protein S7p/S5e; TIGRFAM: ribosomal protein S7,
FT                   bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08370"
FT                   /db_xref="GOA:E0UU61"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU61"
FT                   /protein_id="ADN08370.1"
FT                   /translation="MRRRKAPVREIMPDPVYGSKILTKFINKIMLDGKKSTAEKIIYSA
FT                   MDIIGSRGEKSGIDTFNEAIENIKPIIEVKSRRVGGATYQVPVEVRPVRQQSLAIRWLV
FT                   DAARKRNERTMAERLANEFMDAASDKGSAFKKKEDTYKMAEANKAFAHYRW"
FT   gene            300682..302772
FT                   /locus_tag="Saut_0322"
FT   CDS_pept        300682..302772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0322"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="COGs: COG0480 Translation elongation factors
FT                   (GTPase); InterPro
FT                   IPR000795:IPR000640:IPR004161:IPR005517:IPR
FT                   005225:IPR004540; KEGG: tdn:Suden_0357 elongation factor G;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor G domain protein; elongation factor Tu domain 2
FT                   protein; elongation factor G domain IV; SPTR: Q30TP3
FT                   Elongation factor G; TIGRFAM: translation elongation factor
FT                   G; small GTP-binding protein; PFAM: Elongation factor Tu
FT                   domain 2; Elongation factor G C-terminus; Elongation factor
FT                   Tu GTP binding domain; Elongation factor G, domain IV;
FT                   TIGRFAM: translation elongation factor EF-G; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08371"
FT                   /db_xref="GOA:E0UU62"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU62"
FT                   /protein_id="ADN08371.1"
FT                   /translation="MPRSHKLEDVRNIGIAAHIDAGKTTTTERILFYTGVEHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCEWQGKQINIIDTPGHVDFTIEVERSMRVLDGAVS
FT                   VFCAVGGVQPQSETVWRQRNRYKVPSIVFVNKMDRTGADFYEVERQIRDRLKGNPMPFQ
FT                   LPIGAEDKFEGVVDLVQMKEIVWDEDAAMGSNYHVQEIRPELQEISDEYREKMLETLAE
FT                   VEGNDEFAEKFLDGEEISQEEIKAAIKSATIGMAIVPMTPGTAFKNKGVQTLLDAVVDY
FT                   LPSPVEAPPITGTMMDDEEVEVVVESTDNGPFASLAFKIMTDPFVGVLTFIRVYRGSLE
FT                   SGSYVHNSTKDKKERVGRILKMHAIKREEIKEIYAGEIGAVVGLKSTTTGDTLCDPAEK
FT                   VVLERMDFPEPVISVAVEPKTKADQEKMGIALGKLAAEDPSFRVHTDDETGQTIISGMG
FT                   ELHLEILVDRMKREFKVEAEVGAPQVSYRESIKKEVNQEYKYAKQSGGRGQFGHVFLKV
FT                   KPGEPDTGFVFHNEIKGGSVPREYIPAVEKGCEEAMSNGVLAGYPMEDVDVTLYDGSYH
FT                   DVDSNEMAFKLAASMGFKEACRKADAAILEPMMKVEVEVPEDYMGDVIGDLNRRRGQVN
FT                   NMGDRAGNKIVDAFVPLAEMFGYSTDLRSATQGRATYAMEFDHYEEVPRNVAEEIQKKR
FT                   NG"
FT   gene            302887..303555
FT                   /locus_tag="Saut_0323"
FT   CDS_pept        302887..303555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A0DDW1 Chromosome
FT                   undetermined scaffold_47, whole genome shotgun sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08372"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU63"
FT                   /protein_id="ADN08372.1"
FT                   /translation="MYKIFLFLLLNIALYAQNPKAFSTLGDIIYNNVDKIQKLENIDDY
FT                   EVYKKKIKEYVADVKKLKKEGFALDEGVNTNKMQYLNKLRKLSQTNDFFVRSAKRNLDL
FT                   AIENENSKLFTRLINTGLIDEKKSKNKIIDYYFAHSDEVSATGLIQKYLDNDKKLRAKK
FT                   EYKKSLLNSKKLRELEKIRRIRKNDKLEQEKLEQQLNQEVQKKKLEIRQEQKKELSKTI
FT                   "
FT   sig_peptide     302887..302934
FT                   /locus_tag="Saut_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(303542..304255)
FT                   /locus_tag="Saut_0324"
FT   CDS_pept        complement(303542..304255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0324"
FT                   /product="Arginyltransferase"
FT                   /EC_number="2.3.2.8"
FT                   /note="COGs: COG2935 Putative arginyl-tRNA:protein
FT                   arginylyltransferase; InterPro IPR007472:IPR007471; KEGG:
FT                   tdn:Suden_0358 arginyl-tRNA-protein transferase; PFAM:
FT                   Arginine-tRNA-protein transferase domain protein; PRIAM:
FT                   Arginyltransferase; SPTR: A1W023 Putative
FT                   arginyl-tRNA--protein transferase; PFAM:
FT                   Arginine-tRNA-protein transferase, C terminus;
FT                   Arginine-tRNA-protein transferase, N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08373"
FT                   /db_xref="GOA:E0UU64"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU64"
FT                   /protein_id="ADN08373.1"
FT                   /translation="MNLLKEFLLDDKCSYLEDKEQTTHYKVIDNCSAKSCENLIQRGYR
FT                   RFGKMYFRPICATCNECQSIKIDVENFIFSKSAKRVMNKAKNIRTFIRTPSVTQEHIDL
FT                   FEKYHLYMHEKKDWNYSKTTLQHYYNSFVTGHGDFGYEVLYYDEDRLIAVDLIDILENG
FT                   VSSIYFYYDHDYAKYSLGKLSLYHQIKFAKSANKKWIYLGYYVEGCPSLSYKSEYTPYV
FT                   TLQGRPNEHEKFIWS"
FT   gene            304308..304631
FT                   /locus_tag="Saut_0325"
FT   CDS_pept        304308..304631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08374"
FT                   /db_xref="GOA:E0UU65"
FT                   /db_xref="UniProtKB/TrEMBL:E0UU65"
FT                   /protein_id="ADN08374.1"
FT                   /translation="MEFFLKHKIIILRSLGIIMLLVGFAVHFWAAPKMGMSENEIAAAN
FT                   VARMEASVAGHSKSAKKAKPDMSHFSKSLTNAQQQRAKYITIFAMLLGILFLIFSFLKK
FT                   EES"
FT   sig_peptide     304308..304397
FT                   /locus_tag="Saut_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(304628..305725)
FT                   /locus_tag="Saut_0326"
FT   CDS_pept        complement(304628..305725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0326"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /note="COGs: COG1186 Protein chain release factor B;
FT                   InterPro IPR000352:IPR005139:IPR004374; KEGG:
FT                   tdn:Suden_0360 peptide chain release factor 2; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; SPTR:
FT                   Q30TP0 Peptide chain release factor 2; TIGRFAM: peptide
FT                   chain release factor 2; PFAM: PCRF domain; RF-1 domain;
FT                   TIGRFAM: peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08375"
FT                   /db_xref="GOA:E0UUD9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUD9"
FT                   /protein_id="ADN08375.1"
FT                   /translation="MDNYEYTELLKNIDMKMKNITGVVEPKKIQTRLQEIQELENDQDF
FT                   WNNADYAAKIQKEKTQLQRKLDKYNTAKNAVEDAKELYDMAKEEDDSESLEALYEDAPN
FT                   LEKQIRDMEIEVLLSGETDANNAILSIHPGAGGTESQDWAEMLLRMYKRWAERRGFKVE
FT                   VLDYQAGDEAGIKDVSVLIKGENAYGYLKVENGIHRLVRISPFDSNAKRHTSFASVMVS
FT                   PEIDDDIDITIEDKDIRIDTYRSSGAGGQHVNKTESAIRLTHIETGVVVQCQNDRSQHK
FT                   NKATAMKMLKSRLYELELEEQKAKEAGIAKSEIGWGHQIRSYVMQPYQQVKDTRSNEAY
FT                   SNVSGILDGDIDNMIEGVLIAMNRS"
FT   gene            305788..306609
FT                   /locus_tag="Saut_0327"
FT   CDS_pept        305788..306609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0327"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="COGs: COG0414 Panthothenate synthetase; InterPro
FT                   IPR003721; KEGG: tdn:Suden_0361 pantoate--beta-alanine
FT                   ligase; PFAM: Pantoate-beta-alanine ligase; PRIAM:
FT                   Pantoate--beta-alanine ligase; SPTR: Q30TN9 Pantothenate
FT                   synthetase; TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase; TIGRFAM:
FT                   pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08376"
FT                   /db_xref="GOA:E0UUE0"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUE0"
FT                   /protein_id="ADN08376.1"
FT                   /translation="MKIISNPLVLKQHLKDIDKTAGFVPTMGALHEGHIALIKHAKEEN
FT                   EVVVVSIFVNPTQFLAGEDLDKYPTKDEADKKICELAGVDILFFPNAQEIYSQDEVKIC
FT                   APNVRGYVLEGATRPGHFSGVLRVVMKLLNIVSPTRAYFGKKDAQQLNLISLMVKQFFM
FT                   SVEIVPVDIVRDSDGLALSSRNVYLSKEQRKEALKIPKSLYAASKLISKNILNTEKIKE
FT                   EIYAILAPLETEYVEVLSRDFEVIDEVQIGNSIILVEVIVGETRLLDNIWL"
FT   gene            complement(306586..308346)
FT                   /locus_tag="Saut_0328"
FT   CDS_pept        complement(306586..308346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0328"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro
FT                   IPR001460:IPR005311; KEGG: tdn:Suden_0362 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase; Penicillin-binding protein dimerisation
FT                   domain; PRIAM: Peptidoglycan glycosyltransferase; SPTR:
FT                   A0Z7D1 Peptidoglycan glycosyltransferase; PFAM: Penicillin
FT                   binding protein transpeptidase domain; Penicillin-binding
FT                   Protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08377"
FT                   /db_xref="GOA:E0UUE1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUE1"
FT                   /protein_id="ADN08377.1"
FT                   /translation="MVNRNKSKKILLLYVLIFLAFVVFLSVMLLTATKSRNMPSLYTVE
FT                   SSKAQRGSIISADGFHIATTKKLYKAVVNTRYIDPDKKELFIKLFSIYSGMSPTSIKKR
FT                   LAKRRGVVVLSYDVPQIQAHYLKTLARELRRFKVFLELKNPKTGLRSVHGLSVLESGES
FT                   REYPYGTLLTPIIGYPHKIEEDGYTSIRGVKGLEKRFDTELSPIQDGYSRGKRDVNSYI
FT                   ILNKESFTKPKINGLDIKLTIPVSFQIRIEKMLDAMKKELRAKEVMIAIMDSKRGDVYA
FT                   MASSNRYLPKDIKRSDYSSLNSSMIEYSFEPGSVLKPITFALLLEHKLVNPYDLVNGHN
FT                   GRFKIGRKVITDEHKFDWLSAENVIVYSSNVGIAQLAQRLPGYDFHRGLKSFGFSTKST
FT                   PDLIYEKTGSIPSAKRLENEIYKATCAYGYGIRANLMQLLRAYSAFNNNGRMVKPKLVK
FT                   SFIDERGSIKELGYEEPVQVIKSATAKRMNKILLKTVNEGTGKKAITKGLQVGGKTGTA
FT                   HIVEKGQYVSKYNTAFMGFANDKKHKYTIGVIVIQPKKSQFAAQTAVPVFKKAVDIMIE
FT                   EGYLEPNIVK"
FT   sig_peptide     complement(308254..308346)
FT                   /locus_tag="Saut_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(308371..308673)
FT                   /locus_tag="Saut_0329"
FT   CDS_pept        complement(308371..308673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0329"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="COGs: COG1677 Flagellar hook-basal body protein;
FT                   InterPro IPR001624; KEGG: tdn:Suden_0363 flagellar
FT                   hook-basal body protein FliE; PFAM: flagellar hook-basal
FT                   body complex protein FliE; SPTR: B5Z9I8 Flagellar
FT                   hook-basal body complex protein fliE; TIGRFAM: flagellar
FT                   hook-basal body complex subunit FliE; PFAM: Flagellar
FT                   hook-basal body complex protein FliE; TIGRFAM: flagellar
FT                   hook-basal body complex protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08378"
FT                   /db_xref="GOA:E0UUE2"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUE2"
FT                   /protein_id="ADN08378.1"
FT                   /translation="MSNINNISGASTADLLKQKSAVEKGGGGEAFAEQLKSAINEVNDI
FT                   QQDSEKAIADLATGQVKDLHQAALAIGKAETSMKLMLEIRNKALNAYKEIGRTQL"
FT   gene            complement(308691..309185)
FT                   /locus_tag="Saut_0330"
FT   CDS_pept        complement(308691..309185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0330"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="COGs: COG1558 Flagellar basal body rod protein;
FT                   InterPro IPR001444:IPR010930:IPR006299; KEGG:
FT                   tdn:Suden_0364 flagellar basal body rod protein FlgC; PFAM:
FT                   flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; SPTR: A1HN44 Flagellar
FT                   basal-body rod protein FlgC; TIGRFAM: flagellar basal-body
FT                   rod protein FlgC; PFAM: Domain of unknown function
FT                   (DUF1078); Flagella basal body rod protein; TIGRFAM:
FT                   flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08379"
FT                   /db_xref="GOA:E0UUE3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUE3"
FT                   /protein_id="ADN08379.1"
FT                   /translation="MSNFLNSFDISGYGLSAQRVRVNTISSNIANAQTTRTDEGGPYRR
FT                   REVVFKAINFNDVYNKALGENTQSAKYEDPLNEGEFGKKVNPAIMSVVVDKVIRDDSKP
FT                   LMKFEPNNPDADANGYVAYPNINPVVEMSDLVEATRSYQANVAAFQSAKDMANSAISLL
FT                   Q"
FT   gene            complement(309196..309627)
FT                   /locus_tag="Saut_0331"
FT   CDS_pept        complement(309196..309627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0331"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="COGs: COG1815 Flagellar basal body protein; InterPro
FT                   IPR001444:IPR019776:IPR006300; KEGG: tdn:Suden_0365
FT                   flagellar basal body rod protein FlgB; PFAM: flagellar
FT                   basal body rod protein; SPTR: A0YG85 Flagellar basal body
FT                   protein; TIGRFAM: flagellar basal-body rod protein FlgB;
FT                   PFAM: Flagella basal body rod protein; TIGRFAM: flagellar
FT                   basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08380"
FT                   /db_xref="GOA:E0UUE4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUE4"
FT                   /protein_id="ADN08380.1"
FT                   /translation="MSIEISKTHALLAKALDYRAARQDMISSNIANADTPYYKPRDISF
FT                   EDALIAKKNELYQDNAHQLKMAQTNSGHLQPKAQASQIKPTLYFRDGHMARNDGNSVDI
FT                   DVETTEMSKNSIMFNAIVMASKKDAAIFKSVIDASAKVN"
FT   gene            309779..310159
FT                   /locus_tag="Saut_0332"
FT   CDS_pept        309779..310159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0332"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: sun:SUN_2149 hypothetical
FT                   protein; SPTR: A2UWE7 Prepilin-type cleavage/methylation;
FT                   PFAM: Prokaryotic N-terminal methylation motif; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08381"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUE5"
FT                   /protein_id="ADN08381.1"
FT                   /translation="MKRAGFTMIELIFVIVILGILAAVAIPKLAATRDDAKVSSELTNL
FT                   STCIGDAGSAFTATGTEDNTSAACGALKCFTITLGTTTDGNVTIASGGTDNGTAYCTDA
FT                   QNKATAKGLIAVHQFGGAKVTY"
FT   sig_peptide     309779..309853
FT                   /locus_tag="Saut_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            310290..310748
FT                   /locus_tag="Saut_0333"
FT   CDS_pept        310290..310748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0333"
FT                   /product="N-terminal methylation"
FT                   /note="InterPro IPR012902; KEGG: tdn:Suden_0367 N-terminal
FT                   methylation; SPTR: A1HQ21 Tfp pilus assembly protein
FT                   PilE-like; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08382"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUE6"
FT                   /protein_id="ADN08382.1"
FT                   /translation="MQKSKSAFTMIELVFVIVVLGILAAIAIPKFAATRTDAQISKGRA
FT                   DIASIRSAIITDRQAHIIQGDQNYISGLSQNSTTLFDGNGTVGRELLMYGVTSGTIDGH
FT                   WSTTDAAAPYIHYVYKVGGKNCNFTYNPATGKFDLNANQDPLCDQLIN"
FT   sig_peptide     310290..310385
FT                   /locus_tag="Saut_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            310758..312629
FT                   /locus_tag="Saut_0334"
FT   CDS_pept        310758..312629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0334"
FT                   /product="primosomal protein N'"
FT                   /note="COGs: COG1198 Primosomal protein N' (replication
FT                   factor Y) - superfamily II helicase; InterPro
FT                   IPR001650:IPR011545:IPR006935:IPR014001:IPR
FT                   014021:IPR005259; KEGG: tdn:Suden_0368 primosome assembly
FT                   protein PriA; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; type III restriction protein res
FT                   subunit; SMART: DEAD-like helicase; helicase domain
FT                   protein; SPTR: O25149 Primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: Helicase conserved C-terminal
FT                   domain; DEAD/DEAH box helicase; TIGRFAM: primosomal protein
FT                   N'"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08383"
FT                   /db_xref="GOA:E0UUE7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUE7"
FT                   /protein_id="ADN08383.1"
FT                   /translation="MNYYNISIIGSPLEPFTYHSLQNINIGTKVQVHVKNRVLDGVVIA
FT                   TCNKPAFQTNEVLEVSEFYYSLKQIALAKFIASYYICSLGDAFSVMMPFTGKVETWAVR
FT                   HESKKGEVKTSLPKSNIVLSDKQEKALTFLQQHKVALLFGDTGSGKTEVYMKYFEQIIQ
FT                   EGKTSIFLMPEISLTPQMSKRLKEHFGDDFVMWHSKLTPLAKKKALAKIYAGEAKIIAG
FT                   ARSALFLPIKDLGLIVVDEEHDESYKSSSRPRYNARDLAIYMGKLYDVHVVLGSATPSL
FT                   NSYAKFEHTRLKGGHFSSLKTFIYEKSPESLSPLITENLQEVLQKKEQSIVFLPTRANF
FT                   KYLLCQDCGHTIKCAFCSVGMSVHQHSRALKCHYCNFTQAIPQVCPECHSPNLTSSRLG
FT                   TAEAVKILQEVLPQARVEQFDRDVITTANKLKKALKRFNDKESDILVGTQMLSKGHDYH
FT                   GVTLAVVLGMDNMLNMSDYRAREKALSSLIQVAGRSGRAKDAKVIVQTFNEDFFKNYID
FT                   NYEDFLEEEKFFRQELYPPYKKLCRILFAHKKGAKAQDEMRKMHDKLLTCKGVEIVGAK
FT                   KCSIEKVANKYRFEILLRADKSTDIIKAVKASKVDLAEVDMDPIEFG"
FT   gene            complement(312634..313209)
FT                   /locus_tag="Saut_0335"
FT   CDS_pept        complement(312634..313209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0335"
FT                   /product="UDP-sugar diphosphatase"
FT                   /EC_number="3.6.1.45"
FT                   /note="InterPro IPR000086:IPR004385; KEGG: tdn:Suden_0369
FT                   nucleoside diphosphate pyrophosphatase; PFAM: NUDIX
FT                   hydrolase; PRIAM: UDP-sugar diphosphatase; SPTR: B3RZ23
FT                   Putative uncharacterized protein; PFAM: NUDIX domain;
FT                   TIGRFAM: nudix hydrolase, YffH family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08384"
FT                   /db_xref="GOA:E0UUE8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUE8"
FT                   /protein_id="ADN08384.1"
FT                   /translation="MGEITSIEELKSPNFVKPIEINYTQNGMKKKWEAVLSHDSVAILL
FT                   YHTQKDAFVLVKQLRVTVLNKNKNNGYMYELCAGIVDKECSIEQIAKEEILEECGYDVP
FT                   VQNLEKISAFYTSVGISGTHQTLYYAQIDESMKIGEGGGLEEEEIEVVYVPLSEAKKFM
FT                   FDERYQKTTGVSLAFYWFFNHKKHICID"
FT   gene            complement(313202..314392)
FT                   /locus_tag="Saut_0336"
FT   CDS_pept        complement(313202..314392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0336"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   tdn:Suden_0370 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   A3UFA1 Peptidase, M23/M37 family protein; PFAM: Peptidase
FT                   family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08385"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR040653"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUE9"
FT                   /protein_id="ADN08385.1"
FT                   /translation="MIRFFILFLFTTSIFASHVERYRWNNGETYLVFLQNHNLPVRELY
FT                   YNLDKDDQRLTEEMRSGIHYQILKDKKEDIEQILLPLNDELQIHIYINKKNYKFEAIPI
FT                   ISTTKTEAFYTTITSSPNYNILKETGSKKLAQIFVSSFKHSLNFKNDIRKGDELVMIYD
FT                   QKYRLGEPFSMPTLKVAMIEMHHKKHFIYLNDDGRYYDEKAHEVEGFLLARPVRGARIS
FT                   SYFTKRRWHPVLHKWKAHLGVDYAARRGTPVIAAGSGTIIWASRMGSYGNLIKIRHNDG
FT                   YETRYAHLKSFRKGIYRGKHVKKGQTIAYVGTTGRSTGPHLHFELRKRGRAINPLRVVQ
FT                   VTTKKLKGKEKKAFIKLKKNYDQSINLHLNNKTAYKKRPPFEEMSYIHLLEEKNNG"
FT   sig_peptide     complement(314345..314392)
FT                   /locus_tag="Saut_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            314494..315291
FT                   /locus_tag="Saut_0337"
FT   CDS_pept        314494..315291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0371 hypothetical protein; SPTR:
FT                   Q9ZLW8 Plasminogen-binding protein pgbA"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08386"
FT                   /db_xref="InterPro:IPR029276"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUF0"
FT                   /protein_id="ADN08386.1"
FT                   /translation="MKYLLLLTILVLEVFGAVIKSPVIAVDNENETVKIKIDKIDVGVS
FT                   GFVMHHISPQHSAILKNAVVQSFDAKTQIATIKMSEFTALQNNALPHGKWKVQLGDTVE
FT                   LAFGYSRSLLIAPNETIYYKIAQSVKTQWIHPDLFATVLSFRGHPTPIKEDFAAMADAS
FT                   SVGLLFIYLNQKVYTLDIKSFKILSISDAKLKQAKVKLPFYTRVNNIDAAWWGAGSSRL
FT                   DSYEPHYYELMVANNKTNKQLYEIIKNGNPKLHYLLAEFEIGK"
FT   sig_peptide     314494..314568
FT                   /locus_tag="Saut_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            315293..316678
FT                   /locus_tag="Saut_0338"
FT   CDS_pept        315293..316678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0338"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterPro IPR004113:IPR006094; KEGG: tdn:Suden_0372 FAD
FT                   linked oxidase-like; PFAM: FAD linked oxidase domain
FT                   protein; SPTR: A1HPQ0 FAD linked oxidase domain protein;
FT                   PFAM: FAD binding domain; FAD linked oxidases, C-terminal
FT                   domain; TIGRFAM: glycolate oxidase, subunit GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08387"
FT                   /db_xref="GOA:E0UUF1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUF1"
FT                   /protein_id="ADN08387.1"
FT                   /translation="MIDAKHIQHFKNIVGEENIYSDKAHLLAYSYDATREHFEPDAVVF
FT                   PKDEEDVSEILKYCNEHHIVIVPRGAGSGFTGGALPSKGGIVLAMEKHMNKILEIDMKN
FT                   MVAIVQPGVINMDLQKKVEEVGLFYPPDPASQDYSTIGGNVSENAGGMRAAKYGITKDY
FT                   VMATRAVLPSGDVIKAGKRTIKDVAGYNISGILIASEGTLAVLTEITLKLIPKPKMTKT
FT                   AMGIFPTVNDAMEAVYNTMASGVTPVAMEFLDNLTIRAVEETFHKGLPVDAGALLVTDV
FT                   DGNMEDDLDFQLAQIEKVFRENGCSDFKVAKDEKEAADIWFARRNASPSLSIYGSKKLN
FT                   EDVTVPRSALPELLEKFYAIAKKYNVKIPCFGHTGDGNVHTNVMVDGSDPEQVKIAYKA
FT                   IEEVFQATVDLGGTLSGEHGIGLAKAPYMKMAFTDAEMELFKSIKKAFDPNNILNPSKM
FT                   GLD"
FT   gene            316685..317509
FT                   /locus_tag="Saut_0339"
FT   CDS_pept        316685..317509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0339"
FT                   /product="ribonuclease BN"
FT                   /note="COGs: COG1295 membrane protein; InterPro
FT                   IPR004664:IPR017039; KEGG: tdn:Suden_0373 ribonuclease BN;
FT                   PFAM: ribonuclease BN; SPTR: Q4QNR3 tRNA-processing
FT                   ribonuclease BN; TIGRFAM: ribonuclease BN; PFAM:
FT                   Ribonuclease BN-like family; TIGRFAM: YihY family protein
FT                   (not ribonuclease BN)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08388"
FT                   /db_xref="GOA:E0UUF2"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUF2"
FT                   /protein_id="ADN08388.1"
FT                   /translation="MNEKLTTVIKQIKIFVSSFVDKELTLFAASLSFYTIFTIIPLLLI
FT                   IMAILTSMPTFTEYYEKIQGFIFSNLMPVNSDTVMFQINGFLQNSSKMGAIGFIAILVS
FT                   SLLFFKNFEYIANRIFHAKSRTLWESITTYWTLLTLTPIALGVSFYITGYIAALMASNS
FT                   FTSGLNILPLVPYIIIWGLFFLIFQIAANAKINPKASAISSFIISIIFSVSKNAFIYYV
FT                   FLNKSYTTMYGSFAILMFLFLWIYVSWIIFLYGLKLCHIIDEIYKKKQRVSE"
FT   gene            complement(317456..318739)
FT                   /locus_tag="Saut_0340"
FT   CDS_pept        complement(317456..318739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0340"
FT                   /product="ComEC/Rec2-related protein"
FT                   /note="InterPro IPR004477; KEGG: tdn:Suden_0374
FT                   ComEC/Rec2-related protein; PFAM: ComEC/Rec2-related
FT                   protein; SPTR: A3IMN6 ComEC/Rec2-related protein; TIGRFAM:
FT                   ComEC/Rec2-related protein; PFAM: Competence protein;
FT                   TIGRFAM: ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08389"
FT                   /db_xref="GOA:E0UUF3"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUF3"
FT                   /protein_id="ADN08389.1"
FT                   /translation="MKILEKVSLFSSKKDLFLFFIFIFTLLSLSLFFEYYKYKELTKFD
FT                   SQLVDAKVLKEYDKTKLTKKGKIKSYKILKLRSDDGLVFYTMASKKLKNLKNKHLHVEI
FT                   WAGNISFKEYIKGFFAFSKILNICDKPTLKQKLASFIDAQHANSDIAKLYKALFLALPL
FT                   PTSMQTQFSNLGISHLIAISGFHLGVLAAILFFIIKYPYKILQNRYFPYRSYKRDTFII
FT                   ISLVLLGYLLFLDSPPSLLRAFVMLIVGFILYDRGIQIVSMQTLLITVLLILALFPKLV
FT                   FSIGFWLSASGVFYIFLFLIHFKEYSKIKQFILLPFWVYLMMLPFSMAIFGNFSLYHPL
FT                   SILWTTLFTLFYPLAIALHVIGMGNLLDTPLQHLLHVDTHAIQHILSKGYLVIEILLSL
FT                   AAVFSKKALYLLLGYTLLLFIYFVYNMA"
FT   gene            complement(318740..320185)
FT                   /locus_tag="Saut_0341"
FT   CDS_pept        complement(318740..320185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0341"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG0305 Replicative DNA helicase; InterPro
FT                   IPR007693:IPR007694:IPR007692; KEGG: tdn:Suden_0375
FT                   replicative DNA helicase; PFAM: DnaB domain protein
FT                   helicase domain protein; SPTR: O25916 Replicative DNA
FT                   helicase; TIGRFAM: replicative DNA helicase; PFAM:
FT                   DnaB-like helicase N terminal domain; DnaB-like helicase C
FT                   terminal domain; TIGRFAM: replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08390"
FT                   /db_xref="GOA:E0UUF4"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUF4"
FT                   /protein_id="ADN08390.1"
FT                   /translation="MQDNLYNLAFERSVLSSIVFEPSQFDELSVELSKDDFYLPAHQDI
FT                   FQAMLTLLQKDQPIDEEFIKKELIKAKKFDEQVLLEILSANPISNTKAYVDEIKDKSLK
FT                   RHLLTLTTEIKRVTVEEELPSAEVVDIVEKKLYEITQDNQTSDFKDSPKMTFDTMEYIK
FT                   EMKARGNSVLVGVDTGFKELNKMTTGFGKGDLVIIAARPAMGKTSFVLNTVNSLILQGK
FT                   GVAFFSLEMPAEQLMLRLLSIQTSIPLQKLRVGDMNDDQWSNLNGAIDRMNSVKLFVDD
FT                   QGSININQLRSKLRKLKNQHPEIEIAVIDYLQIMQGIGNQDRHLQVSEISRGLKMLARE
FT                   LEMPIVALSQLNRGLESRNDKRPMLSDIRESGSIEQDADIILFVYRDDVYLYKEEKERE
FT                   KAAKAEGKEFTSTYIEKEEEDAEIIIGKQRNGPTGHVKLVFQKKLTRFVDAPGFAQGVE
FT                   TVYENVDTKSANIDMPQVEMPPI"
FT   gene            complement(320185..321243)
FT                   /locus_tag="Saut_0342"
FT   CDS_pept        complement(320185..321243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0342"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="COGs: COG0821 Enzyme involved in the deoxyxylulose
FT                   pathway of isoprenoid biosynthesis; InterPro IPR004588;
FT                   KEGG: sun:SUN_2134 4-hydroxy-3-methylbut-2-en-1-yl
FT                   diphosphate synthase; PFAM: IspG family protein; PRIAM:
FT                   4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; SPTR:
FT                   A6QC65 4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase; TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase; PFAM: GcpE protein; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08391"
FT                   /db_xref="GOA:E0UUF5"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUF5"
FT                   /protein_id="ADN08391.1"
FT                   /translation="MIKRYPTKKIFVGDVAVGGDAPISVQSMTYSDTHNVAATVEQINR
FT                   LHFAGADIVRVAVPDMEDALALKAIKEQISLPLVADIHFNYKLALIAAQSVDCIRFNPG
FT                   NIGDKNKIKEIVKACQERNLPIRIGVNAGSLEKEFDDKYGPTAEAMVASADYNIKFLED
FT                   LGFSDIKISLKASDVQRTVEAYRMLRPKNIYPFHLGVTEAGTIFHATVKSAIGLGTLLL
FT                   EGIGDTMRVSITGELEEEIKVGRAILKDSGVAKEGLNIISCPTCGRIEADLVTAVAEIE
FT                   KRTAHIKTPLDVSVMGCVVNAIGEAKHADVAIAYGKGKGLVMVKGEVVANLDEKELVDR
FT                   FVHEVEDMAGKE"
FT   gene            complement(321321..323291)
FT                   /locus_tag="Saut_0343"
FT   CDS_pept        complement(321321..323291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0343"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG4771 Outer membrane receptor for
FT                   ferrienterochelin and colicins; InterPro
FT                   IPR012910:IPR000531:IPR010917; KEGG: tdn:Suden_0377
FT                   TonB-dependent receptor; PFAM: TonB-dependent receptor;
FT                   TonB-dependent receptor plug; SPTR: A3LEP1 Putative copper
FT                   transport outer membrane porin OprC; PFAM: TonB-dependent
FT                   Receptor Plug Domain; TonB dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08392"
FT                   /db_xref="GOA:E0UUF6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUF6"
FT                   /protein_id="ADN08392.1"
FT                   /translation="MKKTITLSLLVFSSLYASEIELAPINVESTTITEVAQNAQTSADV
FT                   AAALSTSVPGIDMSRRSGIANDVLIRGQKRDNISVEVDGTKVYGACPNRMDPPVSHILA
FT                   NQIDAIEVIEGPYDVENYGNLSGGLKISTKKPSKDFQGQVNLGFGSWNYKKFGATASGG
FT                   NNLIRVLVTASTESSDQYHDGNSDTLAQQVKKQAPTGNQYQSQYEDMQAYKKNSMMAKA
FT                   FVTTAKDQELQLSVTANRSDNILYPNSPMDAIYDDSNIYSVTYNIDNISDTYKNINLQY
FT                   YYSDVDHPMSTEYRKSALTAANNKTNHMWTTMQGVKLKNSFDINSYNLLFGLDGSRRTW
FT                   KGQYVNNVSGTVLGDSIDHALTKNSAVFAALEKQFDALHVKIGARYDHSTVRDDNSAHQ
FT                   ANTYNGLGTNIFTTYALNSQNKLFLGLGQAYRVPDGRELYFLKGGLQGTPTLNQTKNQE
FT                   VDFGYETDNDYFKLKVKGFYSKLKNYIYINSTKSTNIFENIDAKIYGAELSGSYYINDD
FT                   ITLDIGASYKRGKKDHALNSQTNTNLADIAPLRANAALNYEYANNSIATLEMQASKRWN
FT                   NIDDDNGEQVLAGWAVFNAKIKHALNKKFDFTLGVNNMFNTTYAQSNTYTDLTLVTTGS
FT                   GEKLLLNEPGRYIYTNLDFKF"
FT   sig_peptide     complement(323241..323291)
FT                   /locus_tag="Saut_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(323583..324587)
FT                   /locus_tag="Saut_0344"
FT   CDS_pept        complement(323583..324587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0344"
FT                   /product="Agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="COGs: COG2957 Peptidylarginine deiminase; InterPro
FT                   IPR007466; KEGG: tdn:Suden_0378 peptidyl-arginine
FT                   deiminase; PFAM: Porphyromonas-type peptidyl-arginine
FT                   deiminase; PRIAM: Agmatine deiminase; SPTR: A0Y6S9 Putative
FT                   uncharacterized protein; PFAM: Porphyromonas-type
FT                   peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08393"
FT                   /db_xref="GOA:E0UUF7"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUF7"
FT                   /protein_id="ADN08393.1"
FT                   /translation="MKEKKRLIAEFEAQSFTQIIFPHADTDWAEYLDKAQKTFVNIINT
FT                   IRKYQKCLVIAYDIDEVKAHFKDENNLEFVQYITDDTWARDCSALSLEQNDGTVLLDFI
FT                   FNGWGNKFDAKKDNAMTHNIAHKYLTCKLKNIDFILEGGAVESNGRGTILTTSVCMLNK
FT                   NRNPQFNAIQITQKLKAFFHAEHILYLNHGYLAGDDTDSHIDTLARFIDEKTIMYVKCD
FT                   NINDEHYHELKLMEEELQMTAKEQDLELISLPMCDALYFEAERLPATYANFLFVNGAVL
FT                   VPLYGVSQDKEALQIFRNTFKNRDVIGIDCSVLVRQHGSLHCVTMNFPANVNI"
FT   gene            324604..325623
FT                   /locus_tag="Saut_0345"
FT   CDS_pept        324604..325623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0345"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COGs: COG0787 Alanine racemase; InterPro
FT                   IPR000821:IPR011079:IPR001608; KEGG: tdn:Suden_0379 alanine
FT                   racemase; PFAM: alanine racemase domain protein; PRIAM:
FT                   Alanine racemase; SPTR: A8ESX7 Alanine racemase; PFAM:
FT                   Alanine racemase, C-terminal domain; Alanine racemase,
FT                   N-terminal domain; TIGRFAM: alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08394"
FT                   /db_xref="GOA:E0UUF8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUF8"
FT                   /protein_id="ADN08394.1"
FT                   /translation="MAYITLNKNHFFNNLTIIAKLTKAKDKIALVLKDNAYGHGLFEIA
FT                   TLAKEYGITKAVVRSNEEAKEIENLFEYILVLADTPKEASQKIRYTINDIRQIQKFAKN
FT                   TKVELKVDTGMCRNGIMMDELEEAFILCAQQGLQLEAVFTHHSSADEDNRYFDLQNENF
FT                   KRVKQDSQVLAKKYSFIPLRFHSFNSAALFRSNDFDEDMARVGIAAYGCLELPSSLHVK
FT                   NLQPVLSVYAQRLSSRRLQKGECVGYGAAFETAVTCNVSNYDFGYGDGFLRSCSHHYIT
FT                   PEGIKIAGRISMDNSSFLTNKEKLLIFDDARVIAKFADTISYEILTALKEKIKREVLH"
FT   gene            complement(325615..327576)
FT                   /locus_tag="Saut_0346"
FT   CDS_pept        complement(325615..327576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0346"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro
FT                   IPR001633:IPR000160; KEGG: tdn:Suden_0380 diguanylate
FT                   cyclase/phosphodiesterase; PFAM: EAL domain protein; GGDEF
FT                   domain containing protein; SMART: EAL domain protein; GGDEF
FT                   domain containing protein; SPTR: A0XXT6 Putative orphan
FT                   protein; putative EAL domain; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain; GGDEF domain; Protein of unknown function
FT                   (DUF3365); TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08395"
FT                   /db_xref="GOA:E0UUF9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUF9"
FT                   /protein_id="ADN08395.1"
FT                   /translation="MNQYFNNKILYAIPIIFLIVLLFRISYSYHEAKRQVYDFAKKEAK
FT                   VLNAHEMAHRDYYQNLFTNKTIPLNEKTLPALPAYSSYAISQIFSKNNILNIQIQTVSD
FT                   RARNPQNAADISELKAIKFFKKNPKEKEYFSDKNSEYYLYASVLRIENKCLTCHASKNK
FT                   APLFIQKRYSKAYDYKLNELRGIMSIKIPKNKINSYFMSHFFYSIIYDFLLFIVLFVIL
FT                   YNIVKKSKKINNFLEYQIHLKTDELKQTLITDNLTKLPNRLKLIDYIKNLYNASSVHLA
FT                   LINIDGFKDINDFYGHKTGDKLLKQIASTIVNLCKDKSTSVYKLPSDEYAIFSVADVKA
FT                   SEFINNIRTLINKIQETNYLIDGNSLYITVSCGVASNEHGLITKADMALQVAKENKKSL
FT                   ISYSSSIDTAEQVNKNIQCVTLLKNAIHNDQIQPYFQPIYNVKTKKIEKYEALVRIKTQ
FT                   DGRVIVPNSFLDISIKSKLYPNITKVMIEKSFAFFQNTDYEFSINLSINDILNKRTMDF
FT                   IMKSLHHYNNPSKVVFEILESDKIGNYDDIKLFIHNVKELGCKIALDDFGSGYSNFSHV
FT                   LELNVDYLKIDASLVKNITTDENSRKITQTIITFASNIGLKTIAEYVENEEALNILDEM
FT                   GIDFIQGYFIGKPAAKLV"
FT   gene            complement(327633..328022)
FT                   /locus_tag="Saut_0347"
FT   CDS_pept        complement(327633..328022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08396"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUG0"
FT                   /protein_id="ADN08396.1"
FT                   /translation="MLFFGHRFIESEKFYHVFDIDTIIQTPPSSTIYLEFDEKNLDIIN
FT                   YLKDNKIDFAPKVKNITELMYASALGASYIPVEQKLAKTAQKIAESYLFDAKILVHVED
FT                   EDDIEEMALLGIDGVIFAEAIIKIP"
FT   gene            complement(328022..328258)
FT                   /locus_tag="Saut_0348"
FT   CDS_pept        complement(328022..328258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08397"
FT                   /db_xref="GOA:E0UUG1"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUG1"
FT                   /protein_id="ADN08397.1"
FT                   /translation="MILKILIIGAVITAVYFLFFKTTPEAKVSKKSAKKESKKLDADEM
FT                   VECATCGVYAEVEECILSNGKYYCSRECLAKAK"
FT   gene            complement(328255..328842)
FT                   /locus_tag="Saut_0349"
FT   CDS_pept        complement(328255..328842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0349"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0357 S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell division; InterPro
FT                   IPR003682; KEGG: tdn:Suden_0383 glucose-inhibited division
FT                   protein B; PFAM: glucose inhibited division protein; SPTR:
FT                   Q30TL7 Ribosomal RNA small subunit methyltransferase G;
FT                   TIGRFAM: methyltransferase GidB; PFAM: rRNA small subunit
FT                   methyltransferase G; TIGRFAM: 16S rRNA methyltransferase
FT                   GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08398"
FT                   /db_xref="GOA:E0UUG2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUG2"
FT                   /protein_id="ADN08398.1"
FT                   /translation="MDLKTTLASDKIDLPNDFFQKVQKYKEHLFKWNKIHNLTGAKNEQ
FT                   TLNEFIYDAVFPVSFLPKVDSLMDIGTGAGFPGMILAFALPDTKITLVEPLTKRASFLQ
FT                   FIKADLGLENVSVVKKRVEEMEPQMFDLITSRAVTDTKMLLNLSKNFRDEHSKLLFYKG
FT                   EKVFDEVAADMHMKHKIIETKNRHYLLLGEEL"
FT   gene            complement(328914..329477)
FT                   /locus_tag="Saut_0350"
FT   CDS_pept        complement(328914..329477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0350"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="InterPro IPR013655:IPR000014; KEGG: cha:CHAB381_1223
FT                   signal-transduction sensor protein; PFAM: PAS fold-3 domain
FT                   protein; SPTR: A0NPS9 Putative sensor (PAS) domain for
FT                   methyl-accepting chemotaxis sensory transducer; TIGRFAM:
FT                   PAS sensor protein; PFAM: PAS fold; TIGRFAM: PAS domain
FT                   S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08399"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUG3"
FT                   /protein_id="ADN08399.1"
FT                   /translation="MKHPEPINNEIKLNPKKYIVSKTDPKGIIEYGNDYFVEISGYSEA
FT                   ELIGKPHSIVRHPDMPKVVFKMMWDRINEAKNIIAVVKNLAKDGSYYWVITEFEPKIDP
FT                   ITNKIISHTAFRKAAPQKAVNTMAPIYEKLLIIEKEGGMEASEKYLRGFFEEKRISYDD
FT                   FIDELIGNKGLFKIFFTAMKKIFS"
FT   gene            329590..330033
FT                   /locus_tag="Saut_0351"
FT   CDS_pept        329590..330033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08400"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUG4"
FT                   /protein_id="ADN08400.1"
FT                   /translation="MNKQETINAIEHAREAHIEQMAKVKSLIEGRHVDNLTPVSKMKCE
FT                   FGQWLYGDKERVKSILGVQFYENLDMIHEAWHIQYAKIHTIFVHEKGEGLFSKIFGIHK
FT                   INALELEKAKVYYKDLEQATKDLLRVLDASQRRVQALSASKFH"
FT   gene            complement(330037..330600)
FT                   /locus_tag="Saut_0352"
FT   CDS_pept        complement(330037..330600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0352"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="COGs: COG0807 GTP cyclohydrolase II; InterPro
FT                   IPR000926; KEGG: tdn:Suden_0384 GTP cyclohydrolase II;
FT                   PFAM: GTP cyclohydrolase II; PRIAM: GTP cyclohydrolase II;
FT                   SPTR: A7I3X0 GTP cyclohydrolase-2; TIGRFAM: GTP
FT                   cyclohydrolase II; PFAM: GTP cyclohydrolase II; TIGRFAM:
FT                   GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08401"
FT                   /db_xref="GOA:E0UUG5"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUG5"
FT                   /protein_id="ADN08401.1"
FT                   /translation="MNIKISDIANLPSRFGDFKVQAFKQGQKEHLVVCAKELAEVPIVR
FT                   VHSECLTGDAIGSLKCDCRDQLEYGLKMADETGGMVIYLRQEGRDIGLLNKINAYALQD
FT                   KGLNTIEANHQLGFAADERTYEAVTFILNHYNIKKIKLLTNNPDKINSISGVEIIERIP
FT                   IIMQANKHNAGYLDVKRDEMGHLL"
FT   gene            330666..331643
FT                   /locus_tag="Saut_0353"
FT   CDS_pept        330666..331643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0353"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="COGs: COG0113 Delta-aminolevulinic acid dehydratase;
FT                   InterPro IPR001731; KEGG: tdn:Suden_0385
FT                   delta-aminolevulinic acid dehydratase; PFAM:
FT                   delta-aminolevulinic acid dehydratase; PRIAM:
FT                   Porphobilinogen synthase; SPTR: P56074 Delta-aminolevulinic
FT                   acid dehydratase; PFAM: Delta-aminolevulinic acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08402"
FT                   /db_xref="GOA:E0UUG6"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUG6"
FT                   /protein_id="ADN08402.1"
FT                   /translation="MFQRFRRTRLNKHLRALVRETHVSTDDFIYPLFVRSGEDIKTEVA
FT                   SMPGVYQMSIDVAVKECQELKELGIYSIILFGIPDVKDSIGSDALCEHGIIASAVREIK
FT                   KAHPDMFVVTDLCFCEYTDHGHCGIIDEVHETVDNDATLEISGQQAIVHAKAGADMIAP
FT                   SGMMDGIIQTVRTSLDNAGYKDLPIMSYSTKFASGYYGPFRDVAESTPSFGDRASYQMD
FT                   PANRREAIAESISDEAQGADILMVKPALAYLDIVREIKDNTSLPMAVYNVSGEYAMLKF
FT                   AGMNDLIDYERVVMETMIAFKRAGADIIISYHAKEVAKMLNNNR"
FT   gene            331696..332616
FT                   /locus_tag="Saut_0354"
FT   CDS_pept        331696..332616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0354"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterPro IPR002082:IPR006130:IPR002292:IPR006132:IPR
FT                   006131; KEGG: tdn:Suden_0386 ornithine
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain;
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; SPTR: Q30TL4 Ornithine carbamoyltransferase;
FT                   TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   Aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain; Aspartate/ornithine carbamoyltransferase,
FT                   Asp/Orn binding domain; TIGRFAM: ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08403"
FT                   /db_xref="GOA:E0UUG7"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUG7"
FT                   /protein_id="ADN08403.1"
FT                   /translation="MRHFLTLKDYSKEEILEIVNIGLQIKKDLKAGIYKKELQMQTLAM
FT                   IFEKSSTRTRVSFETGMFQLGGHALFLSNRDIHLGRGEPVKDTARVISSMCDMVMIRTF
FT                   EHSMIEEFASYSKVPVINGLTDSYHPVQLLADYMTMIEFGMSENAVVAYVGDGNNMTNS
FT                   WLMLAAKLGFELRIATPKGYEVDEAVLRDALDMAKESGAVIKVMTDPKEAVRDATIVTT
FT                   DTWASMGQEDEKEQRIKDFKGFMVDGLMMCLADKNAKLLHCLPAYRGQEVSEELLEDNA
FT                   DIVFSEAQNRLHAQKGLMVWLDKQR"
FT   gene            complement(332628..333479)
FT                   /locus_tag="Saut_0355"
FT   CDS_pept        complement(332628..333479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_0580 putative methyl-accepting
FT                   chemotaxis sensory transducer; PFAM: Nitrate and nitrite
FT                   sensing"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08404"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUG8"
FT                   /protein_id="ADN08404.1"
FT                   /translation="MRLILLTLFILINLEAKSLFSNNNQADNSIYVGALKDLIIATQKT
FT                   RGLTNSYLNGNTVAMLLVYTSRDNMKKAIGVMESLPLAADPVINKRATSISQSLIKLNN
FT                   KAFSLKPSVTFSKYTEEIEQALMLAQTVNKRTSKDLNPFGKEASEIMMQTMLPMSEYVG
FT                   QLRGFGAGLAAKGSANKQELEKIYVLAQKVNNLNSQLDKQMQELQNKYPNKLPSILTTS
FT                   ISSLNNQAKDYSKYALDRFKNNPKSIDADGYFDRGTQLISSIIKIYDATNQALLEDSKG
FT                   WL"
FT   sig_peptide     complement(333402..333479)
FT                   /locus_tag="Saut_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(333537..334502)
FT                   /locus_tag="Saut_0356"
FT   CDS_pept        complement(333537..334502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0356"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COGs: COG0180 Tryptophanyl-tRNA synthetase; InterPro
FT                   IPR002306:IPR002305:IPR001412; KEGG: tdn:Suden_0389
FT                   tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; PRIAM: Tryptophan--tRNA ligase; SPTR:
FT                   Q5HW79 Tryptophanyl-tRNA synthetase; TIGRFAM:
FT                   tryptophanyl-tRNA synthetase; PFAM: tRNA synthetases class
FT                   I (W and Y); TIGRFAM: tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08405"
FT                   /db_xref="GOA:E0UUG9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUG9"
FT                   /protein_id="ADN08405.1"
FT                   /translation="MRVLTGIQPSGDLHIGNYFGSIKQMVDAQNNNDTFAFIANYHAQT
FT                   SVKDGKRLAELTMQSATDFLALGIDAQKSIFWVQSDVKEVLELYWVLSSFTPMGLLERA
FT                   HSYKDKTAKGIAANHSLFSYPVLMAADILLYQPDIVPVGKDQIQHVEIARDIAIKFNNE
FT                   YGDIFKLPEYKIEANVATVPGTDGQKMSKSYNNTVNIFGEEKKQLKTIKKIVTEPVPLE
FT                   EPKEYENCNVYNMAKLFLNENECKELQERYKRGGEGHGHFKLYLHDIIWEYFKPYRQRR
FT                   EYYAAHQDEVRDILKLGAAKAQEVALPMIDNIRSLTGIKY"
FT   gene            334613..334942
FT                   /locus_tag="Saut_0357"
FT   CDS_pept        334613..334942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0357"
FT                   /product="putative sigma 54 modulation protein/ribosomal
FT                   protein S30EA"
FT                   /note="InterPro IPR003489; KEGG: tdn:Suden_0390 putative
FT                   sigma 54 modulation protein/ribosomal protein S30EA;
FT                   TIGRFAM: ribosomal subunit interface protein; PFAM: Sigma
FT                   54 modulation protein / S30EA ribosomal protein; TIGRFAM:
FT                   ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08406"
FT                   /db_xref="GOA:E0UUH0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUH0"
FT                   /protein_id="ADN08406.1"
FT                   /translation="MIVQIRSKDITLRDEKKAHIEQGIEKFKKFSLDITRVNCMLSTEK
FT                   GGVLVEFEIHVAHTAPIIISEHHQDLDAAIDIGVDRANKALRRLHDKGTDHKGSSIKEL
FT                   EPIDA"
FT   gene            334956..335555
FT                   /locus_tag="Saut_0358"
FT   CDS_pept        334956..335555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA1960 hypothetical protein; SPTR:
FT                   A3URE5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08407"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUH1"
FT                   /protein_id="ADN08407.1"
FT                   /translation="MKLLLLLLVGLNLIAAQNNYSMRVAVGKPTLYSAAKIATGSFGQY
FT                   RDDLKAYDIDGGYLLVKDLFEWPIDLYLKGGLTYYEETIQDDVYGADIYIKAYYNIDFW
FT                   QNRIRFGLGEGVSYTNRILEIEQIDAELHNDNNSHYLNYVDVSLDFDLGKLIKHKALNE
FT                   TYVGVLLKHRSGIFGTIHNVKHGGSNYECIYVEKNF"
FT   sig_peptide     334956..335000
FT                   /locus_tag="Saut_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            335565..335987
FT                   /locus_tag="Saut_0359"
FT   CDS_pept        335565..335987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1981 membrane protein; InterPro
FT                   IPR005265:IPR014351; KEGG: tdn:Suden_0391 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: Q9ZJD5
FT                   UPF0093 membrane protein jhp_1377; PFAM: Uncharacterised
FT                   protein family (UPF0093); TIGRFAM: conserved hypothetical
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08408"
FT                   /db_xref="GOA:E0UUH2"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUH2"
FT                   /protein_id="ADN08408.1"
FT                   /translation="MYEWLLWFHVISFISWFAVLFYLPRLFVYHAENIENEGFVKVAKI
FT                   QEMKLFKYIGVPSMWATILSGAGLIYLGGWMSSPWLHVKLLFVALLIAYFYSLNKYRLE
FT                   FLEDRCTKSGKFFRIYNEVPTLLMLVIVAMVVLKPF"
FT   gene            complement(336001..336111)
FT                   /locus_tag="Saut_0360"
FT   CDS_pept        complement(336001..336111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08409"
FT                   /db_xref="GOA:E0UUH3"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUH3"
FT                   /protein_id="ADN08409.1"
FT                   /translation="MSYTLALVFLLGGLGLTALGIYFYRKLKEAEAEKRR"
FT   sig_peptide     complement(336052..336111)
FT                   /locus_tag="Saut_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(336112..337590)
FT                   /locus_tag="Saut_0361"
FT   CDS_pept        complement(336112..337590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0361"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /note="COGs: COG1160 GTPase; InterPro
FT                   IPR006073:IPR013684:IPR002917:IPR005225:IPR 016484; KEGG:
FT                   tdn:Suden_0392 GTP-binding protein EngA; PFAM: GTP-binding
FT                   protein HSR1-related; Miro domain protein; SPTR: Q30TK8
FT                   GTP-binding protein engA; TIGRFAM: ribosome-associated
FT                   GTPase EngA; small GTP-binding protein; PFAM: GTPase of
FT                   unknown function; TIGRFAM: ribosome-associated GTPase EngA;
FT                   small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08410"
FT                   /db_xref="GOA:E0UUH4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUH4"
FT                   /protein_id="ADN08410.1"
FT                   /translation="MKKIAIIGRPNVGKSSLFNRLVKKRDAITSDLAGTTRDVKRKTAL
FT                   IIDKEAELLDTGGLDKGCELFDKIKEMSLKAAYKADIILFMVDGKGLPEEEDKKLFYEL
FT                   QAMGKDIALVVNKIDNDKMKEKLWEFYEFGTDAIFGISVAHNRNTVELLDWIYDKLPES
FT                   DILKEEDENNVQIVEEEKEELSDEEFFSQYAEDEEDDGYIYWDEEEIEDDSIFAQNDRI
FT                   KEFDENDINHIKIAIIGRTNVGKSSLLNALLGEERSVVSSVAGTTIDPIDETIVYKDKQ
FT                   LTFVDTAGLRRRGKIVGIEKFALMRTKEMLENANMALVVLDASEPFLDLDEKIAGLVDQ
FT                   NRLACIIVLNKWDIAKREDHDKIIKEVRDRFKFLAYAPIITLSAKSHQRVDKLHDMILE
FT                   INENYSQRIPTSQLNEVVERALRRHTLPSMHGQVIRIYYATQYETRPPKIAIVMNKPKG
FT                   LHFTYRRYLTNKLREAFNFSGTPLLFKAKKRGEK"
FT   gene            337721..339535
FT                   /locus_tag="Saut_0362"
FT   CDS_pept        337721..339535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0362"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro
FT                   IPR000160:IPR000560:IPR000215; KEGG: tdn:Suden_1895
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein; SPTR: A0ZGP9
FT                   PleD-like protein; TIGRFAM: diguanylate cyclase; PFAM:
FT                   GGDEF domain; TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08411"
FT                   /db_xref="GOA:E0UUH5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUH5"
FT                   /protein_id="ADN08411.1"
FT                   /translation="MQIFRDKVFIALAGLFLVLISVYLWYIQQQKELLQTSVYTKESRY
FT                   MREKVQDLINAKQKGMMAVAIAISHDNKIKEILKTKSIDVKHFQAISEDIKEHTVFKNV
FT                   WLQLIDVNGISLFRSWSSLYGDNLKLKRKDISFVSKKRTPIMSISSDKYDLSIKALVPI
FT                   IEKNKILGELEVITHFNSISRALKKSGIESIVLLNKYYTKQLEYPFSKNFLGEFYIANL
FT                   DVSKKLLNNFKNIYIDHFLKQNNNYYIKKGYLLVKYPLQNYKNETIGSFLMLKPLTEIS
FT                   DKEIKTFTWQSIGIGIIVLLLLFGLIHIFFFFKVQREKRYYKKILDASNNMFVITNGEE
FT                   IIDVNQSFYYYFKQYSSLEEFTRKHSCVCDFFVKENGYLQTNTDGINWIEFVIKQKDKS
FT                   YIVKMNIEGKIYYFKITGKLVSVKPREYVTVFADITTEEEYRLELEYQSIIDPLTGIYN
FT                   RRYFERKISEEITRCERYEMVFSLIMLDIDFFKRINDTYGHDVGDKVLQSHSALILENL
FT                   RESDILCRVGGEEFMIILPQTTQEQAYYKAEDLRKKVQNEQDMHLQITMSFGVAQFHKA
FT                   DTYETLYKRVDTALYKAKESGRNKVAVL"
FT   gene            complement(339582..340184)
FT                   /locus_tag="Saut_0363"
FT   CDS_pept        complement(339582..340184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08412"
FT                   /db_xref="InterPro:IPR024952"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUH6"
FT                   /protein_id="ADN08412.1"
FT                   /translation="MHKIIKNTALLIMVAAAITGCSSKKAEPKKQEVYKPTFTCKQEGI
FT                   AAPRWTCIPEVPGFYAGVGVAEKSAAGIAHMRRVALMNGRSDLAQQIESKIKDKMEGFT
FT                   RATGNGSAETVDKVTTAVTKQVAKVDLKDSKAVDMWNAPSGAIYMLVTVPEANVNKEVK
FT                   KVYKKTVDSSFKNDDALWQQFQSKQALENLDKEFPTE"
FT   sig_peptide     complement(340110..340184)
FT                   /locus_tag="Saut_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            340254..340697
FT                   /locus_tag="Saut_0364"
FT   CDS_pept        340254..340697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0364"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG2236 phosphoribosyltransferase; InterPro
FT                   IPR000836; KEGG: tdn:Suden_0395 phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; SPTR: O30000
FT                   Xanthine-guanine phosphoribosyltransferase (GptA-1); PFAM:
FT                   Phosphoribosyl transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08413"
FT                   /db_xref="GOA:E0UUH7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUH7"
FT                   /protein_id="ADN08413.1"
FT                   /translation="MKRYYSYENFRNDTCKLISEVKTFEAEAIVAVARGGLTLAHCMAE
FT                   GLDIRDVQSIRTELYDKECKREELSLFGECSLKYAKRVLIVDDIADSGETLNFIMNYLR
FT                   KDFPAIEFKSSALFYKKTSIYEPDFWINEADIWIEFFWEKDFI"
FT   gene            complement(340690..341028)
FT                   /locus_tag="Saut_0365"
FT   CDS_pept        complement(340690..341028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0365"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR009056; KEGG: tdn:Suden_0396 C-type
FT                   cytochrome, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08414"
FT                   /db_xref="GOA:E0UUH8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUH8"
FT                   /protein_id="ADN08414.1"
FT                   /translation="MKFSLLFLWLFMSLSNASDANSLLFHGNCTTCHFETKSVSAPSMM
FT                   EVRKRYLSAFPQKKDFVKQMAQWVQQPNETTSIMQDAINKYELMPNLAFEKDVLEDIAS
FT                   YIYETDFK"
FT   sig_peptide     complement(340978..341028)
FT                   /locus_tag="Saut_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(341032..341787)
FT                   /locus_tag="Saut_0366"
FT   CDS_pept        complement(341032..341787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0366"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="COGs: COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain; InterPro IPR001623; KEGG:
FT                   tdn:Suden_0397 heat shock protein DnaJ-like; PFAM: heat
FT                   shock protein DnaJ domain protein; SMART: heat shock
FT                   protein DnaJ domain protein; SPTR: A3JHN7 Dna-J like
FT                   membrane chaperone protein; PFAM: DnaJ domain; Tellurite
FT                   resistance protein TerB"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08415"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUH9"
FT                   /protein_id="ADN08415.1"
FT                   /translation="MSNIILFAFLAAVFYYIFKSYGRYTAQYSQEAFKDFSVSYESLKN
FT                   SDLGLFVALVAKVAKADGHVDALEAQLVGIMFDDIAKLFPEPQKTKDILKQIFNEEKDR
FT                   RDNIEAVAHQLGEALRRNKAQQEQFMGFLIQLAFADGKVTQSEEDILATIAEALEFDPN
FT                   KYHALFDQFEAMMKNVHPQATLDDAYKVLGVSKDDNMDTIKKAYRKLVRQYHPDIIKSQ
FT                   GKSEEYIKEATAKTQEINQAYEMIKKARG"
FT   gene            complement(341859..344531)
FT                   /locus_tag="Saut_0367"
FT   CDS_pept        complement(341859..344531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0367"
FT                   /product="calcium-translocating P-type ATPase, PMCA-type"
FT                   /note="COGs: COG0474 Cation transport ATPase; InterPro
FT                   IPR000695:IPR001757:IPR006068:IPR008250:IPR
FT                   005834:IPR004014:IPR018303:IPR006408; KEGG: sun:SUN_2183
FT                   cation-transporting P-tyep ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; cation transporting
FT                   ATPase domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: A3CXF4 ATPase, P-type (Transporting), HAD
FT                   superfamily, subfamily IC; TIGRFAM: calcium-translocating
FT                   P-type ATPase, PMCA-type; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC; PFAM: E1-E2 ATPase; Cation
FT                   transporting ATPase, C-terminus; Cation transporter/ATPase,
FT                   N-terminus; haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   plasma-membrane calcium-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; potassium and/or sodium efflux P-type ATPase,
FT                   fungal-type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08416"
FT                   /db_xref="GOA:E0UUI0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUI0"
FT                   /protein_id="ADN08416.1"
FT                   /translation="MKANKKWYTKNIQDVIALFHTNIKTGLENEKAEEALKTYGYNELK
FT                   RINKTPWYIIFLRQFTDVLILILFVAAGISIAIGEMGDAITILVIIVLNGILGFVQEYK
FT                   AENAIEALKKMLHPTCKVLRDAKEEIIDAKLLVPGDIVLLEIGDKIPADLRLIESFNLK
FT                   VDEASLTGESESVSKNTLTLGIDTPLAAESNMAWMGTSVVNGRGTGIVVETGMNTQFGK
FT                   IAAMTQNVATEPTPLQKKLATLGKKLGIYSVGISVLVSIIGWLLGKDLLEMFLTGVALA
FT                   VAVVPEGLPAVVTITLALGIKAMAKQKALLRRLQAAETLGAATTICTDKTGTLTQNQMT
FT                   VKKIWLASSKEIDVTGSGYDPAGHFEFHGKKLDYKHDTDLLMLLKTALICNHAKVQKNE
FT                   SDWEAIGEPTEAALIVAAYKAWLHDDDTQKTISEFSFNSIRKRMSVIVHDKDSVVAYVK
FT                   GAPEVILERSSSYFKNGQIVPLDNPHKKEIKNAYQTMDKHGLRTLAIAFRKLPSDTTLS
FT                   QESVENELTLLGIVGIIDPAHEEVPDAIDMAYTAGIKVIMITGDNPDTALAIANSIGLK
FT                   TKKAITSSNLSKMSDENLQKELNGSVLFARARPEDKLRIVKILKNSNEIVAMTGDGVND
FT                   APALKEADIGIAMGKKGTDVAKSASDMVLSDDNFASIINAVRQGRREYDNIQKFVLYLL
FT                   SSNSGEVIAIFINIVIGGPLILIPVQILWMNLVTDGMTAVALGVEPAEKGIMKRPPRAV
FT                   EEPILDRYGIIMIALLGSYIGFATLWLFHYYMAKDPQGGVVLAQTVAFTGIIILEKMNV
FT                   LNYRSTREPMTKIGFFSNKWLLLAIFFTVSLQICAVYVPFLQDALHTTAMGWKDWGIIL
FT                   LVAMPIFILTEIYKWVRFR"
FT   gene            complement(344521..345732)
FT                   /locus_tag="Saut_0368"
FT   CDS_pept        complement(344521..345732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0368"
FT                   /product="transporter, CPA2 family (2.A.37)"
FT                   /note="COGs: COG0475 Kef-type K+ transport systems membrane
FT                   components; InterPro IPR006153; KEGG: sun:SUN_2183
FT                   cation-transporting P-tyep ATPase; PFAM: sodium/hydrogen
FT                   exchanger; SPTR: B6YUY2 NapA-type sodium/hydrogen
FT                   antiporter; PFAM: Sodium/hydrogen exchanger family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08417"
FT                   /db_xref="GOA:E0UUI1"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUI1"
FT                   /protein_id="ADN08417.1"
FT                   /translation="MNEVELGKFLLSLSLIFGLTYILGSFLSQLKIPTILAALFIGVFL
FT                   SYTPFLSFVDAGTNFKNTFEFLSNLGVLFLLFYIGLQIDLSEMKKSSSDIVWLTVLNTI
FT                   LPFIFGTAAMLLFGYGWAIALVIGMTRMPTAEAVIVPILDEFKMIKTRIGTFIIGAGVL
FT                   DDIIEVLLVGIVSIWVSTKTVQHHEGITALALGIVVFMLVAWIFYMWMHKVMQYYKPKS
FT                   LNTLMIFSLVILFGFGGFAEYVELGMVVGAIAAGVIMRPMYESDEKQGEQLTKMTQTLS
FT                   YGFFGILFFFWIGFNADIQGFIKEPLLAIVLYLVGTLGKLFGVLLMVPMKKITLKEAVI
FT                   VGVGLDARLTTEIIVAQLLFSASIIDIKLFTALVAASSFTAITVPLLFSLLIRLWPKEA
FT                   RHES"
FT   gene            345773..346678
FT                   /locus_tag="Saut_0369"
FT   CDS_pept        345773..346678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0369"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: tdn:Suden_0400
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF6 transmembrane; SPTR: O25832 Uncharacterized
FT                   transporter HP_1234; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08418"
FT                   /db_xref="GOA:E0UUI2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUI2"
FT                   /protein_id="ADN08418.1"
FT                   /translation="MVIISLMNRIKNLNKGVQYMLIASFTFAIMGAFAKLASQNMSSLE
FT                   VVFFRNIAGVIIVGLAVLKKPMQHPGGKPFLLFFRGFIGFVALLAFFYNIAHIPLGDAM
FT                   TYSKTSPIFTAVFAWLFLHEKLSLKGWLAVFVGFIGILFITQPSGVGFSKYDLLGIFSG
FT                   VGAALAYTSVRELKAYYDTRAIVLSFMITGTLGPIFLFLISPYINFPELDFMLGKFIMP
FT                   HGIVWFYLLAMGLFATFSQILMTKAYGETKAGIVGAVSYTNILFSIIVGLFLGDAFPSL
FT                   VTSFGIVLIVAAGIMVARDK"
FT   sig_peptide     345773..345874
FT                   /locus_tag="Saut_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            346891..347685
FT                   /locus_tag="Saut_0370"
FT   CDS_pept        346891..347685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0370"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="COGs: COG2877 3-deoxy-D-manno-octulosonic acid (KDO)
FT                   8-phosphate synthase; InterPro IPR006218:IPR006269; KEGG:
FT                   tdn:Suden_0401 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; SPTR: Q7VK53
FT                   2-dehydro-3-deoxyphosphooctonate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphooctonate aldolase; PFAM: DAHP
FT                   synthetase I family; TIGRFAM: 3-deoxy-8-phosphooctulonate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08419"
FT                   /db_xref="GOA:E0UUI3"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUI3"
FT                   /protein_id="ADN08419.1"
FT                   /translation="MKLLAGPCVIESEENIFTIAKALEKYQEDATIDFYFKASFDKANR
FT                   TSLDSFRGLGMEKGLEILQKVKDDFGYKIVTDVHESIQVEPVAKVVDMLQIPAFLCRQT
FT                   DLLVACAKTDKEVNIKKGQFINPPDMRYSVMKVLKTRGCDEVSYENAQKHGIYLTERGS
FT                   SFGYGNIVVDMRSLVIMREFAPVIFDATHSVQMPGALGGKTGGDSSMVPYLASAAAAVG
FT                   VDGFFFETHFDPSCALSDGPNMVKLDELEKLIEKIKKIQAIK"
FT   gene            347703..348167
FT                   /locus_tag="Saut_0371"
FT   CDS_pept        347703..348167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0371"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="COGs: COG0054 Riboflavin synthase beta-chain;
FT                   InterPro IPR002180; KEGG: tdn:Suden_0402 riboflavin
FT                   synthase subunit beta; PFAM: 67-dimethyl-8-ribityllumazine
FT                   synthase; PRIAM: Riboflavin synthase; SPTR: Q30TJ8
FT                   6,7-dimethyl-8-ribityllumazine synthase; TIGRFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase; PFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase; TIGRFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08420"
FT                   /db_xref="GOA:E0UUI4"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUI4"
FT                   /protein_id="ADN08420.1"
FT                   /translation="MNLIEGKLKVVNGKKIAIVSTRWNHFIVDRLVEGAKDAFDRHGGN
FT                   AEDLTHVLVPGAFELPMIVDQLLASGKYDAICALGAVIRGSTPHFDYVAAEATKGIASM
FT                   SLKYQKPVSFGLLTTDTIEQAIERAGTKAGNKGFEAMGVVIEMLDLYEAL"
FT   gene            348167..348574
FT                   /locus_tag="Saut_0372"
FT   CDS_pept        348167..348574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0372"
FT                   /product="NusB antitermination factor"
FT                   /note="COGs: COG0781 Transcription termination factor;
FT                   InterPro IPR006027:IPR011605; KEGG: tdn:Suden_0403
FT                   transcription antitermination protein NusB; PFAM:
FT                   NusB/RsmB/TIM44; SPTR: Q30TJ7 N utilization substance
FT                   protein B homolog; TIGRFAM: transcription antitermination
FT                   factor NusB; PFAM: NusB family; TIGRFAM: transcription
FT                   antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08421"
FT                   /db_xref="GOA:E0UUI5"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUI5"
FT                   /protein_id="ADN08421.1"
FT                   /translation="MATRQQARMAVVSLLYAYDLGNGNTSEHSNEILEEKKIRNKQKDF
FT                   ALGLYEGVMEHIEEIDKAIVEHLKEWDFERLGAIERATLRLATYEILFGELDSAVVINE
FT                   AVEITKSFGTEQSPKFINGVLDAIAKDHKAK"
FT   gene            348575..351004
FT                   /locus_tag="Saut_0373"
FT   CDS_pept        348575..351004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011031; KEGG: sun:SUN_0092 hypothetical
FT                   protein; SPTR: A3WHQ5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08422"
FT                   /db_xref="GOA:E0UUI6"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUI6"
FT                   /protein_id="ADN08422.1"
FT                   /translation="MKKTLWLTVFFATFLVASTNYHEKNNCLKCHGGIEHIRAPESGMA
FT                   KAIAKKSAEAGYAKNSCIVCHGGNPATKHKSKAHKGTVQYFLTHEGPKEFYPAPGSTWV
FT                   NQNTCGMCHKEEVAAQMNSLMMTEQGKIQGALWSFGGKEGYNHTIGNYKTKNPTDIHAR
FT                   LGTKKYQEYMQKLSKMEPQAFPKEMTELPPAPTAEEVEKDPSLAVYTYLRQECLRCHTG
FT                   SKGRQKRGDYRGIGCASCHIPYSNEGYYEGGDKSISHKERGHLLVHEIQSSRETKVTVH
FT                   KQSYSGIPTETCSTCHNRGKRIGVSYQGLMETAYKATFDAKGNPQPKLHTKRYIHMQGD
FT                   VHFKKGMLCQDCHTSNDMHGDGFLSGANAGAVEIECQDCHGTTKKYPWELPLGYSDEFE
FT                   TSPKTGKARGVTKTMAEYLKQGSVNAADEGYLLSARGNPLIHTTKKGKEVIMHLASGKD
FT                   VVLKPLKLLKEQEKLSKVGLLAMDKISVHNDRLECYTCHATWAPQCYGCHVKIDYSGGK
FT                   QNPDYLQSSHDHDMHGRTGIMRKSLKKYLVDGQVTETRSFLRWEDPALSQNGEGRISPT
FT                   IPGCQTTVTVIGKDGNALLQNHIFKIPNVEGAGAEGQNAIDMAPIQPHTIQKEPRSCES
FT                   CHAMKKALGYGITGSQTTFDPSVDTIVDIMSADGKVMPTIIDEQIPAIPNLHFDYSKFL
FT                   DKNGTQLQTVGHHWKLSQPLTKAQIDKTDRAGACVACHESIPEGNLAVSAMTHIAEMAN
FT                   MKIDKKKHMGILNKILNLAAWVQVLVGIFIGMLGMYIFYRLFIKKKSISSRNRGWK"
FT   sig_peptide     348575..348625
FT                   /locus_tag="Saut_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            351001..352053
FT                   /locus_tag="Saut_0374"
FT   CDS_pept        351001..352053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0374"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1060 Thiamine biosynthesis protein ThiH;
FT                   InterPro IPR007197:IPR020050; KEGG: tdn:Suden_0404
FT                   hypothetical protein; PFAM: Radical SAM domain protein;
FT                   SPTR: A1HSV4 Radical SAM domain protein; PFAM: Radical SAM
FT                   superfamily; TIGRFAM: radical SAM domain protein, CofH
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08423"
FT                   /db_xref="GOA:E0UUI7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUI7"
FT                   /protein_id="ADN08423.1"
FT                   /translation="MSRLTKEEALDLIRNADLKDLGRMATQRKKELHPKGITTFVIDRN
FT                   INYTNICWVDCKFCAFYRHEKDADAYVLTFDEIDAKIDELLEIGGTQILFQGGVHPKLK
FT                   IEWYEDLVEHIHQKYPTITIHGFSSIELDFIAKVSRITIQEVLARLKAKGLASIPGAGA
FT                   EILSDKVRDIIAPKKIDSEVWIDVHRQAHKLDIMSTATMMYGTVETDEDIIDHLDMVRN
FT                   LQDETGGFRAFIMWSFQGKNTELLARIPDMEKPSSNRYLRLLAVARLYLDNVPNIQSSW
FT                   VTQGPYIGQMALRFGANDLGSTMMEENVVSSAGAAYTMAKDEMVHLIKDIGETPAVRNT
FT                   AYETLEIFNS"
FT   gene            352092..353330
FT                   /locus_tag="Saut_0375"
FT   CDS_pept        352092..353330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0375"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011765:IPR007863; KEGG: tdn:Suden_0405 peptidase
FT                   M16-like; PFAM: peptidase M16 domain protein; SPTR: A3X1I5
FT                   Peptidase M16; PFAM: Peptidase M16 inactive domain;
FT                   Insulinase (Peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08424"
FT                   /db_xref="GOA:E0UUI8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUI8"
FT                   /protein_id="ADN08424.1"
FT                   /translation="MAAQIDSIEVKGIKVPLIFEQDTRLPLVNTQIVFTNSGSITDTKK
FT                   AGLAKFSAKLLNEGTKKLGSNGFADKLESRAIHISASTGTETFVLETSSLKDEFTNAAK
FT                   FLAKLLKDPNYTEEALSKVKTMTIGSLSRKENDFDYVASNELKKLLFPNTPLAQPASGT
FT                   VQSVKSIDLEDVKNFVKEHLVVSRAIVVVGGDVDRAEVKKNIAKILNTLPKGKSEPLPH
FT                   FRASDKPKESILKRETKQAYIYFGSPYNMAVNDEDYYKARVATFILGTGGFGSRLMEEI
FT                   RVKRGLAYSAYARVHVSKSSSYLNGYLQTKLDSMDEAKKTVVNVISEFVHKGVSEDELE
FT                   QTKKFLLGSEPLRVETMSQRLQRTFMDYYKGFPLNHSELELKKIKKLKLKDLNDFIKKH
FT                   TEILEQSFAIVTK"
FT   gene            353335..355569
FT                   /locus_tag="Saut_0376"
FT   CDS_pept        353335..355569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0376"
FT                   /product="AAA ATPase"
FT                   /note="COGs: COG0507 ATP-dependent exoDNAse (exonuclease V)
FT                   alpha subunit - helicase superfamily I member; InterPro
FT                   IPR003593; KEGG: tdn:Suden_1852 ATPase; SMART: AAA ATPase;
FT                   SPTR: A1HT63 Helicase, RecD/TraA family; PFAM: Viral
FT                   (Superfamily 1) RNA helicase; TIGRFAM: helicase, putative,
FT                   RecD/TraA family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08425"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUI9"
FT                   /protein_id="ADN08425.1"
FT                   /translation="MTLIGQIDRILFESEGFFIAVLKSGEKISGTYFESDVASIKDAAI
FT                   TLEGEWVEHKKYGKTFKFETLKVNQNELFFFLNKIIKGFTKKLSADLIEHFGSDRLIEI
FT                   LDNDIEKLLEFKGIKEKRLKKIQASWKQFRSMRRLGEFLSPYDVTPVLLTTIATAMKDV
FT                   DEPCTKIKENPYILTSINSIGFKRADELALKMGVAPENEQRISSAMDYVLLNYCEAQGN
FT                   SCIAKEVLFGGLDELLGFVNKQNLYEAALVERVAEQSIVIMKNERVSPARLYDAEKFLY
FT                   DDFTARAKLDNGGFVKDLDAFLSESSLKLGEQQRTAAEMINNGASLLFLVGYAGTGKST
FT                   TSKTILELLNTRYDKKEIITCALSGIASQRISDTTGYESATIQSLLVKHEESDKFPYSV
FT                   VLIDEASMINSTLFARLMRKISKKAIVIIVGDDAQLPPIGAGNVLSDVLSLELAPTVKL
FT                   TQIYRQSEEQAITLIANQIRQAELPEYRQKYEDFEFVDVSIQNYYALKNQLSQDELKNL
FT                   RDENSKQIITEIIHRVVASIEKARYRLNNKQIKEYLNYFQVITPMKGGILGTTNLNKVL
FT                   QEYFNPNPKKCVKRGELEFRLMDKVVHTKNENMASWSGEGFKEGEDTDERRIFNGMSGL
FT                   LFKIDEEEEQVFVFYPNEDVVVRYEYEELKSHLMLSYALTIHKVQGMEYDIIVIPMSFT
FT                   HYIMHNTKLIYTAITRAKHKCIVIGEGGAFENACRRVDVTRRDTVLLELK"
FT   gene            355603..356526
FT                   /locus_tag="Saut_0377"
FT   CDS_pept        355603..356526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0377"
FT                   /product="L-glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="COGs: COG2066 Glutaminase; InterPro IPR015868; KEGG:
FT                   abu:Abu_2331 glutaminase A; PFAM: Glutaminase, core; PRIAM:
FT                   Glutaminase; SPTR: A8EX66 Glutaminase; PFAM: Glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08426"
FT                   /db_xref="GOA:E0UUJ0"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUJ0"
FT                   /protein_id="ADN08426.1"
FT                   /translation="MDYQQILQDIEIEIQPLFGKGKVADYIPALADADAGQFAMSITLF
FT                   DGSSYDVGASDTLFSIQSISKVFTFTMALKYLGSELYKRVGREPSGNPFNSLVQLEYEN
FT                   GIPRNPFINAGAIVITDTLITHYKNDTAAFDAIVDFIRSIADDESIRMNVVVAGSEMEH
FT                   AYRNLALTNLMKSFGNIDNEAIKLVQTYFNHCALEMNTKMLSRSMLYLANHGVDPINNK
FT                   AYVTKAQAKRINAVMLTCGHYDASGDFAFKVGVPGKSGVGGGIVAVIPQKMGICVWSPA
FT                   LNEQGNSLIGTKALELFTTKTGLSIF"
FT   gene            356628..357377
FT                   /locus_tag="Saut_0378"
FT   CDS_pept        356628..357377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0378"
FT                   /product="HAD-superfamily subfamily IIA hydrolase like
FT                   protein"
FT                   /note="COGs: COG0647 sugar phosphatase of the HAD
FT                   superfamily; InterPro IPR005834:IPR006355:IPR006357; KEGG:
FT                   nis:NIS_1049 HAD family hydrolase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR: A7I4Z2
FT                   HAD-superfamily subfamily IIA hydrolase like protein;
FT                   TIGRFAM: HAD-superfamily subfamily IIA hydrolase like
FT                   protein; HAD-superfamily hydrolase, subfamily IIA; PFAM:
FT                   haloacid dehalogenase-like hydrolase; TIGRFAM: Haloacid
FT                   Dehalogenase Superfamily Class (subfamily) IIA;
FT                   HAD-superfamily subfamily IIA hydrolase, TIGR01458"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08427"
FT                   /db_xref="GOA:E0UUJ1"
FT                   /db_xref="InterPro:IPR006355"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUJ1"
FT                   /protein_id="ADN08427.1"
FT                   /translation="MFDESIKAVLCDIGGVLYVGDKPIEGAVEAVKEIKKHYPIRFLTN
FT                   TTQRTSAQVVKKLQKMGFEITSNEIITALDVTKMFLEKEKSFAEFLLTDDALCFFDDLK
FT                   YYEEKYVVVGDAQDNFNYKNLNCAFRKLMDGASLLGIAKNRYFKDSDNELSMDAGCFVS
FT                   ALEYGSGQEASLIGKPSREFYHLACASLHVSPNECVMIGDDIESDIKGAQEAGIQAALV
FT                   KTGKFSKIDLSFGIKPDYIFESIAAIL"
FT   gene            complement(357367..357936)
FT                   /locus_tag="Saut_0379"
FT   CDS_pept        complement(357367..357936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_2333 hypothetical protein; SPTR:
FT                   A3LKW5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08428"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUJ2"
FT                   /protein_id="ADN08428.1"
FT                   /translation="MKNIIIAILAAFLLLGCSSKSDENKNVEPKLVAGKSLADLHLKDQ
FT                   FGKEHTLNADTYKVIFAFDKEPAHTCNDFFNTQKPTYLQEHHVQFVADVSAAPSIIRSL
FT                   FILPGLKDFKHIVLLLDDKKTAAPYRKGIDTTKIVVVTVLNKKITDLKTISTKQELQKT
FT                   VEDDSAMSYIAPVINKVMNSVDSVTK"
FT   sig_peptide     complement(357874..357936)
FT                   /locus_tag="Saut_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            358194..358472
FT                   /locus_tag="Saut_0380"
FT   CDS_pept        358194..358472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0380"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="COGs: COG0760 Parvulin-like peptidyl-prolyl
FT                   isomerase; InterPro IPR000297; KEGG: psb:Psyr_2901
FT                   PpiC-type peptidyl-prolyl cis-trans isomerase; PFAM:
FT                   PpiC-type peptidyl-prolyl cis-trans isomerase; SPTR: A3JEU8
FT                   Peptidyl-prolyl cis-trans isomerase C2; PFAM: PPIC-type
FT                   PPIASE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08429"
FT                   /db_xref="GOA:E0UUJ3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUJ3"
FT                   /protein_id="ADN08429.1"
FT                   /translation="MAWATARHILVDSEEKCNELKTEIENGADFGEVAQANSSCPSSRN
FT                   GGDLGQFGPGQMVPEFDKAVFSGDVGVVYGPIQTQFGYHLLEVTGRG"
FT   gene            358475..359332
FT                   /locus_tag="Saut_0381"
FT   CDS_pept        358475..359332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0381"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /note="COGs: COG0388 amidohydrolase; InterPro
FT                   IPR003010:IPR017755; KEGG: tdn:Suden_1844 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; SPTR: B9DGV9 AT2G27450 protein; TIGRFAM:
FT                   N-carbamoylputrescine amidase; PFAM: Carbon-nitrogen
FT                   hydrolase; TIGRFAM: N-carbamoylputrescine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08430"
FT                   /db_xref="GOA:E0UUJ4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUJ4"
FT                   /protein_id="ADN08430.1"
FT                   /translation="MHAKVKVSAIQMRMSEDKNSNVKKAEQLVKKAAAEGANIILLPEL
FT                   FQTLYFCKDIDEKYFEWAQPLKNNELIQHFAALAKEYHVVILVSYFEKAEKGYFNSLVV
FT                   VDADGSVMDNYRKTHIPDGPGYEEKFYFAPGDTGFKVYETAYAKIGVGICWDQWFCETA
FT                   RALTLMGAEIIFYPTAIGSEPEIHLDSKEHWQRVQMGHAATNTVPVVAANRTGKERGES
FT                   CELTFYGSSFITDYTGKIIAEAPRDKEAVIYAEFDLDENAKQREYWGLLKDRRSDMYAK
FT                   ICQE"
FT   gene            complement(359313..360203)
FT                   /locus_tag="Saut_0382"
FT   CDS_pept        complement(359313..360203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0382"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="COGs: COG0324 tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; InterPro IPR002627:IPR018022; KEGG:
FT                   tdn:Suden_1812 tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; PFAM: tRNA isopentenyltransferase; PRIAM: tRNA
FT                   isopentenyltransferase; SPTR: Q30PJ5 tRNA
FT                   Delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   IPP transferase; TIGRFAM: tRNA isopentenyltransferase
FT                   (miaA)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08431"
FT                   /db_xref="GOA:E0UUJ5"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUJ5"
FT                   /protein_id="ADN08431.1"
FT                   /translation="MKQIAIIGPTASGKSDLAIAIAQQMNAYILSIDSLSLYKEIDIVS
FT                   AKPSREELAQIKHYGINELFVNEYFSVDIFIDLYKKVRLTCKEDNKNLVIVGGTSFYLK
FT                   SLIEGLSSLPNISPEHSLHVTEQLQDLDACYKFLTKIDAEYMQKIAPNDKYRMEKALLI
FT                   YEASRISPSEWFRQNLPKPVITDVKIYNIDVSREVLRERIANRTHKMYEKGLIDEICFL
FT                   EQKYTRAPHAMGAIGIVEVLDYLDGKADKDAMLSLISTHTAQLAKRQQTFNRTQFSDIT
FT                   SAKLEDLQDIILDRF"
FT   gene            complement(360221..360958)
FT                   /locus_tag="Saut_0383"
FT   CDS_pept        complement(360221..360958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0383"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="COGs: COG3021 conserved hypothetical protein;
FT                   InterPro IPR005135; KEGG: pin:Ping_2456 hypothetical
FT                   protein; PFAM: Endonuclease/exonuclease/phosphatase; SPTR:
FT                   Q87MF7 UPF0294 protein VP2298; PFAM:
FT                   Endonuclease/Exonuclease/phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08432"
FT                   /db_xref="GOA:E0UUJ6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUJ6"
FT                   /protein_id="ADN08432.1"
FT                   /translation="MFIPKQIPKKLTHQADSLPCKFSLLVWNVHKENQTKAFEKSFSAL
FT                   MQTNPSDILLLQEVKYPKKSTFSFNKYSFALGANIETKQNIFGVLTAAKCSFHNITISL
FT                   STKKELWFSSHKSFLISQHKVCNAKTLYLANIHAVNFVSHKAFTHELQKIKNSLQELEG
FT                   PLIIGGDFNNWSKKRLKILENFQKELGLCKLAVEESHHVKQIFSQTIDHIYYRGIKPLK
FT                   AMAVDTKKISDHNPIYALFELEQ"
FT   gene            complement(360973..362388)
FT                   /locus_tag="Saut_0384"
FT   CDS_pept        complement(360973..362388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0384"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="COGs: COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase; InterPro IPR001736; KEGG:
FT                   dma:DMR_01830 cardiolipin synthetase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase; SPTR: Q1I2L0 Cardiolipin
FT                   synthetase; PFAM: Phospholipase D Active site motif"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08433"
FT                   /db_xref="GOA:E0UUJ7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUJ7"
FT                   /protein_id="ADN08433.1"
FT                   /translation="MLFTIVLFVYILGLLSALNAIMTARTSQGATAWVISLVTLPYIAV
FT                   PLYWFFGRSKFNGYTAARKKAEKLVTDRLQNIVTQTKNYIPQESALGIFERTSQQLAKM
FT                   PYLQANELDLLIDGEKTFQSILAGINEAEKYILLEFYIIRDDNLGYQIQRTLIKKANEG
FT                   VKIYFLYDEIGSYELSQNYLDEMRQAGIQVYNFHTQKGIKNRFQINFRNHRKIVVVDGK
FT                   SAWIGGHNIGDEYLSKNKKFGHWRDTHIKITGPSVIAVQTIFIEDWYWAAEYLIDCLKW
FT                   NPVSSKKENKKVLIVPSSPADILETASLMFMQAINSATKRIWISSSYFVPDSAIIKALQ
FT                   LAGLRGIDVRILIPKRADHILVYLAAFSYFKTVSATGVKFFRYNNGFLHQKVMLIDDSH
FT                   TAVSTANLDNRSFRLNFEITALVTDNSFAQEIKEMFENDFRHSYEIKIAELEKQAFLFK
FT                   LATRLARLTSPVL"
FT   sig_peptide     complement(362302..362388)
FT                   /locus_tag="Saut_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(362398..363072)
FT                   /locus_tag="Saut_0385"
FT   CDS_pept        complement(362398..363072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_1665 hypothetical protein; SPTR:
FT                   Q9VYU0 CG32662"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08434"
FT                   /db_xref="GOA:E0UUJ8"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUJ8"
FT                   /protein_id="ADN08434.1"
FT                   /translation="MKFIIFISFILLFSACNLTESKEDIAAKKLEQKKAFEEKIADTKE
FT                   VQLKKIDAQKEQELAKINSQTTLATLEKEQLLEKIKLEAQAEKEKMLLAQAKEKEVFEA
FT                   KLRDLERQDAMEIKRYLLLILFLLLVIASYFIYLYFKRRHDDKLKAYQDNLDKYFHQQE
FT                   NMTKMRIAEKIIDTVASGKLAKEQESELIKALSGNISPADEPKLLNETNKNIELIEEKN
FT                   SH"
FT   sig_peptide     complement(363010..363072)
FT                   /locus_tag="Saut_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            363198..366299
FT                   /locus_tag="Saut_0386"
FT   CDS_pept        363198..366299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0386"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR004358:IPR019494:IPR013702:IPR013656:IPR
FT                   013767:IPR003594:IPR003661:IPR013655:IPR008207:IPR001789:I
FT                   PR001610:IPR000014:IPR000700:IPR005467; KEGG: gme:Gmet_1707
FT                   PAS/PAC sensor hybrid histidine kinase; PFAM: domain of
FT                   unknown function DUF1745; FIST C domain; PAS fold-4 domain
FT                   protein; PAS fold domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAS
FT                   fold-3 domain protein; Hpt domain protein; response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   histidine kinase A domain protein; PAC repeat-containing
FT                   protein; ATP-binding region ATPase domain protein; SPTR:
FT                   A1ZSA0 Sensor protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   FIST C domain; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Response regulator receiver domain; His
FT                   Kinase A (phosphoacceptor) domain; PAS fold; Hpt domain;
FT                   FIST N domain; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08435"
FT                   /db_xref="GOA:E0UUJ9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUJ9"
FT                   /protein_id="ADN08435.1"
FT                   /translation="MQQYNHNYTDLDDFGKFLKKSAIDVNQKNILIQMFTSHNSKKEIE
FT                   NIASQIISALPSATLIGASAAGEIVNGEMLDESTVVSISVFEKTKISAYYEREDDSYRL
FT                   GLALSKRVFDKDTKCVITFLDGLEHNGQEYLHGLSSCNFNKVAIAGGMAADMLQFQQTY
FT                   TVIGDKVFDGGAVCVSLKGDALEVLQDYNLGWRAVGPTFTITKADGARVYEINHRPIKD
FT                   VYAEVLGEFAVDNMPASTIEFPLIRKEDDMLIARSMLNVFDDGSLLYGGTLEEGEEVYF
FT                   GIGSRTLVNQYSLKEDMDNNSLQACFIYSCIARKQFLDKELEKIFRLLENAAPTSGFFT
FT                   FGEFFHNDDKARLFNVTTTILFLREKGTQTVKHGVNEKRKIRNSSKTDSALFNLIEYVT
FT                   TELKEQEKIFRASKFKLDEFLKALDSVVIISRTDMLGNITYVNERFEEVSGYTKEELIG
FT                   KSHNIVRDPDVPDEVFTELWKEITKGNIWQGEFSNIAKDGSSYYVKSSIIPIHDENNEI
FT                   IEYMAIREDVTSLVQSRKKAEEAEAAQAMFLANMSHEIRTPMNGILGFTELLSKTQLDT
FT                   AQEKYVNVINSSTKTLLDIVNDILDSSKITNNKISLEKIPLNPFVEFATTYELLKSVAE
FT                   EKALNYTLEIDNAISTCIYSDATRLRQVIINLLSNAIKFTPEYGDVRFCISLLQQKENR
FT                   QIMHFSIEDSGIGIAKEKLQEIFKPFAQAETSTTRKFGGTGLGLSISADLLQVFGSELH
FT                   VSSVKNEGSCFFFDLEFDTCNALQDVLVENNVDVVCQEQKDCDKLYLSVLVAEDYHVNR
FT                   MLIESIFQKYKNITLEFACDGKEAVQKVQQNDYDVIFMDINMPVMNGLEAAEYIRKDLQ
FT                   ADVAIVALTANAIKGDKERFIQSGMDDYLSKPIDTTMLEQILCKYAKKGETEKTIDIQK
FT                   VLQQVNEKIGLNKEVGLKLLRLFLESLQEFVPVLEKAFKEQDNKKIYETAHKLKGAAGA
FT                   LYLEDIYELMQEVEKSALEKDAMRHTDKVQLLYEYMKAFEKGMT"
FT   gene            366363..367223
FT                   /locus_tag="Saut_0387"
FT   CDS_pept        366363..367223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0387"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /note="COGs: COG0382 4-hydroxybenzoate
FT                   polyprenyltransferase and related prenyltransferase;
FT                   InterPro IPR000537:IPR006371; KEGG: tdn:Suden_1811
FT                   prenyltransferase; PFAM: UbiA prenyltransferase; SPTR:
FT                   A1HNK5 4-hydroxybenzoate polyprenyltransferase, putative;
FT                   TIGRFAM: 4-hydroxybenzoate polyprenyltransferase; PFAM:
FT                   UbiA prenyltransferase family; TIGRFAM: putative
FT                   4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08436"
FT                   /db_xref="GOA:E0UUK0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUK0"
FT                   /protein_id="ADN08436.1"
FT                   /translation="MQRIIQKAKDFNELVMFEHSIFSLPFIFIAMIVAADGWFGLWLLI
FT                   MGVLAAVSARNFAMGVNRYADIDIDAKNPRTTNRPNVDGRLDKVSIFIFIVVNAAIFVA
FT                   VAYMINSLAFALSIPILVVLASYSYIKRFSSLAHVVLGVALGLAPIAGVVAVSASIPLW
FT                   SVLLSLGVIFWVAGFDLLYSLQDMDFDKDNDLYSIPSRYGADATLFISALFHALAVLFW
FT                   LLFVWAADLGLFAYIAAIGSGFVLYYEQMLVRKDFTKIDRAFFTVNGYLGIAFFVLIII
FT                   DRTVS"
FT   gene            367220..367744
FT                   /locus_tag="Saut_0388"
FT   CDS_pept        367220..367744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08437"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUK1"
FT                   /protein_id="ADN08437.1"
FT                   /translation="MSTPRLVPAPIDIVFSEANLDKGAYEREYQQLSQSDDDPISQWLK
FT                   LAKARGETAESDPVLLNLMVELHRKIDALEMFLKNETPKRLSLTNEAHIRAIGFEYFEL
FT                   EEPLLQEGKEYYGRIAMPVHPKRDIGVFFKAVSQNLAQITRMHERDEKEWAAYLTARER
FT                   ILIRESKEKKQ"
FT   gene            367741..368265
FT                   /locus_tag="Saut_0389"
FT   CDS_pept        367741..368265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08438"
FT                   /db_xref="GOA:E0UUK2"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUK2"
FT                   /protein_id="ADN08438.1"
FT                   /translation="MNLENFSFNIEYLIVILGGVILYLLYYVFTKDAQYSRNIRSVASV
FT                   VEDLNRELYYLKKKLDQTQSSIEDNSQRMNDDEIYQEIERSVYDMVHPLSLAIKQLQSN
FT                   INTIEHDMETKILQLESGVKQISIPASIHGNDDEKIISLFQQGVSIETISKELHLSKPE
FT                   VEFVLKINKIK"
FT   gene            368272..369438
FT                   /locus_tag="Saut_0390"
FT   CDS_pept        368272..369438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0390"
FT                   /product="cell cycle protein"
FT                   /note="COGs: COG0772 Bacterial cell division membrane
FT                   protein; InterPro IPR001182:IPR018365; KEGG: tdn:Suden_1808
FT                   cell cycle protein; PFAM: cell cycle protein; SPTR: P56096
FT                   Probable cell division protein ftsW; PFAM: Cell cycle
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08439"
FT                   /db_xref="GOA:E0UUK3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUK3"
FT                   /protein_id="ADN08439.1"
FT                   /translation="MSADRKLFTLVSLLIGISIVLSYTLTPYTTLLFGVNEFHFAIRQT
FT                   IFGLMSIVLIFILSQLDPDKWLKPIGFTLFFGSLILMIAMPFLPESVVSEVGGAKRWIK
FT                   IAGFSLAPVEFFKVGFVYFLAWSFSRKLGHHDGIGLSGEFKRFMPYAIIFLGAMFIIAF
FT                   LQKDLGQVVVLGATLLFMLIFAGSSFRFFLSILAVIFGAIIVFILTAHHRILRIKSWWA
FT                   LAQNSVLELLPDAIADKLRVPVEVEPYQIGHSLNAIHNGGLFGTGLANGTFKLGFLSEV
FT                   HTDFVLAGLAEEFGFLGVLSVVVIFMWMIQRIFKIANRTKDTSIYLFSIGIGLILSFSF
FT                   LVNAYGISGITPIKGISVPFLSYGGSAMLGAAFGVGMVLMASKKAKMD"
FT   sig_peptide     368272..368337
FT                   /locus_tag="Saut_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            369449..370471
FT                   /locus_tag="Saut_0391"
FT   CDS_pept        369449..370471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0391"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="COGs: COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase; InterPro
FT                   IPR004276:IPR007235:IPR006009; KEGG: tdn:Suden_1807
FT                   N-acetylglucosaminyl transferase; PFAM: Glycosyltransferase
FT                   28 domain; glycosyl transferase family 28; PRIAM:
FT                   Undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; SPTR: Q30PK0
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase;
FT                   TIGRFAM:UDP-N-acetylglucosamine--N-acetylmuramyl-
FT                   (pentapeptide) pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase; PFAM: Glycosyltransferase
FT                   family 28 C-terminal domain; Glycosyltransferase family 28
FT                   N-terminal domain; TIGRFAM:
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08440"
FT                   /db_xref="GOA:E0UUK4"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUK4"
FT                   /protein_id="ADN08440.1"
FT                   /translation="MKLCITGGGTGGHLMIAESLSEAAAADGNEVIFIGSTSGQDKKYF
FT                   QEHSNFSHVYFLETTGVVNQKGSAKLKALYKVFKAFLQARKILKKHKIQATYSVGGFSA
FT                   APASFASLSLFIPLFIHEQNSVEGRLNSLLKKYAKSFVSAYDENSPIQGYPVKEFYYKN
FT                   ARVRDELKTIIFLGGSHGAKAINDLALSVAHKLQKMGIAIIHQAGETDYERVKQEYEKL
FT                   GVAVELYAFTKNLPELITRADLAVSRAGASTLWELTANGCPAFFVPYPYAAGDHQYYNA
FT                   QFLVKNNLAWCEREGQNLKPKLIKVFKNPELKEKSEKLLEYVTQDVAQQMIQDVQKKLK
FT                   "
FT   gene            370468..371067
FT                   /locus_tag="Saut_0392"
FT   CDS_pept        370468..371067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0392"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="COGs: COG0586 membrane-associated protein; InterPro
FT                   IPR015414; KEGG: tdn:Suden_1806 hypothetical protein; PFAM:
FT                   SNARE associated Golgi protein; SPTR: A0YUB7 DedA family
FT                   protein; PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08441"
FT                   /db_xref="GOA:E0UUK5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUK5"
FT                   /protein_id="ADN08441.1"
FT                   /translation="MIQELAQQLVDLIFDWGYLGIFIMMVIESSFIPFPSEIVLVPAGY
FT                   LASKGDMSITYIMGSALGGSLLGAFINYYLALTLGRKFLLKFGKYFFIFPETLDKMERY
FT                   FKSHGHISTFTGRLIPGIRQLISIPAGLARMNIVEFSIFTTLGAGIWALVLTLLGYFIG
FT                   ANEALIHEYLKEITIIVLVLLVILVWIYYTYQKRKA"
FT   gene            371071..371550
FT                   /locus_tag="Saut_0393"
FT   CDS_pept        371071..371550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_0309 hypothetical protein; PFAM:
FT                   Protein of unknown function (DUF420)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08442"
FT                   /db_xref="GOA:E0UUK6"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUK6"
FT                   /protein_id="ADN08442.1"
FT                   /translation="MDYMFAQGFLGTRAPLFMDVVTLIVAVLPVLVYGAIKLARQKLYK
FT                   AHALSQNLIFIVSVIVVGYFEYGVRIGGGFDAFIKGSGVSHTYVSIVLGLHVIIAVLTL
FT                   IYWSITIVKADYQFSKRLIPGPKSNEHKVLALKTFLGIVFTSFSGIWVYLLLFVY"
FT   gene            371575..372042
FT                   /locus_tag="Saut_0394"
FT   CDS_pept        371575..372042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0394"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG1225 Peroxiredoxin; InterPro
FT                   IPR000866:IPR013740; KEGG: sun:SUN_0313 peroxiredoxin
FT                   family protein; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; Redoxin domain protein;
FT                   SPTR: A0ZDT7 Alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Malallergen; PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08443"
FT                   /db_xref="GOA:E0UUK7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUK7"
FT                   /protein_id="ADN08443.1"
FT                   /translation="MIEVGDKAPDFCLPNQDDVEMCLRDLKGKWIVLYFYPRDNTPGCT
FT                   TEACEFTEAAPDFSSLDAVILGVSADTTKKHRNFIEKHDLGITLLSDESTDMMQKYGVW
FT                   QLKKNYGKEYMGIVRSTFIIDPQGIVRAKWEKVRVKGHIETVKEKLEELQN"
FT   gene            372305..374350
FT                   /locus_tag="Saut_0395"
FT   CDS_pept        372305..374350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0395"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR012910:IPR000531; KEGG:
FT                   glo:Glov_1115 TonB-dependent receptor; PFAM: TonB-dependent
FT                   receptor; TonB-dependent receptor plug; SPTR: A1ZU58
FT                   TonB-dependent receptor, putative; PFAM: TonB-dependent
FT                   Receptor Plug Domain; TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08444"
FT                   /db_xref="GOA:E0UUK8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUK8"
FT                   /protein_id="ADN08444.1"
FT                   /translation="MKYRINLFLVLCMGALHLQADNLLSSISTDMKHFNTIATQTKQNE
FT                   HYQPYIISTFKSKELEKLGVSNLKEALMLVPGIDMATDNTNNQIPIFRGSNPFAYGQSK
FT                   LLIDGVLVNNLFFDAYSEYLSMPIDMIKRIEVIRGSGSKVDGINAYAGSINVVTYAEDF
FT                   KGFESNDKLVFKYGSYDYKMGGFVKNFKTENFKTHIDFYYQKDDKKISSGPDGLSQGSL
FT                   GAANTGLSQSGEAPLWLDEYSLGVNLLYKGISLKARVLQHKQGSAYGINLALPQASDRV
FT                   KLPSYYAELGYAKKINDFNIDIKAGVKYDTYDSKAKLGPDDVNLSGVVFPDGAYGEHYA
FT                   KQRVLYQSSYLKYNGFKKHQIAFGYRVTQEKTIEMISKLSNRATGDVALVDYTYTLPFF
FT                   DKDAHRSVFAFSLEDAYDVNDKLSILYGVNYEQNSYKDAGLEPRISFVYRKDYKNIFKA
FT                   IYSTSHRNPSWQEMFTKNNRARVGSTDLEPEKVASYEMAYIRNFSNDTYLQSSVFYLVN
FT                   KNQIYNSAADPVYKNTAKTDIYGIELEYKGHILANDELYANYTYIDGSYTIDGTNATNN
FT                   IPNVSHHLAKGYYIYNFNCALSLGTTLKYVSSKERMNTDLRPKVKPYTTLDTALNYENS
FT                   HYNYTVNVSVKNIFNADVRYLSPQNTYVDDYAQERRTFLITLKKNF"
FT   sig_peptide     372305..372364
FT                   /locus_tag="Saut_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            374351..374899
FT                   /locus_tag="Saut_0396"
FT   CDS_pept        374351..374899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08445"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUK9"
FT                   /protein_id="ADN08445.1"
FT                   /translation="MIRVLLFYFLLVQLLFGYNYDDLLLKAQASIFPKIMLLDKKIENK
FT                   LVKNKIIYTIVYDGSDYQTALHVKKYIETTFKGRFDKYPYEIHLVDFSHLSTDTKASAF
FT                   YVLKSSTKNIQKAAKIAYEKRIISFSYDINNLKYGLLFSLIIENSTVLYLNKEYLHIKN
FT                   IDFGDFLLQMVKFIDKNSI"
FT   gene            374944..376872
FT                   /locus_tag="Saut_0397"
FT   CDS_pept        374944..376872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0397"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /note="COGs: COG5001 signal transduction protein containing
FT                   a membrane domain an EAL and a GGDEF domain; InterPro
FT                   IPR001633:IPR000160:IPR003660; KEGG: wsu:WS0108 GGDEF
FT                   family protein; PFAM: EAL domain protein; GGDEF domain
FT                   containing protein; histidine kinase HAMP region domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; SPTR: A0XXT6 Putative orphan protein; putative EAL
FT                   domain; TIGRFAM: diguanylate cyclase; PFAM: EAL domain;
FT                   HAMP domain; GGDEF domain; TIGRFAM: diguanylate cyclase
FT                   (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08446"
FT                   /db_xref="GOA:E0UUT4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUT4"
FT                   /protein_id="ADN08446.1"
FT                   /translation="MKERKFESLSFRIMSSIIITSIIVIGGVFLVFEKINKEAFYKLEL
FT                   QKATLIVKTIEPLLAIDIYLGMENKIQSILEQLMQNKDILSVKVLKDNITLYEIKSTNK
FT                   YESFFVIKKDILQPNSQKKIGIIVLNYSNHNYKQLINTYTKLLLMMLVILMIIIVLLGM
FT                   YIKKLLKPLRKTAKLLKDFSPQKKLQIEPIKENNEISLILSALNEMQEKIFDFASKQKD
FT                   INAYLEKEVDNKTAELRKQLFIDDLTQLPNRRKLFKDIKNSNNNGALLILNIDDFKEIN
FT                   DFYGQNVGDYILIEFAKRLQYLVEDEKNISISRLSGDEFALFFQHKPSYRSFVRVVNTL
FT                   SKGIEKMLFIHKQHEIYIRVTIGGTLDSKEMLEKADIALKLAKEHRKYFLLYDEKLEVK
FT                   RQYKENMEWVKKLKSAIKEDRIVPFFQPIFDTQTKEAVSYECLIRLVDTDGSVVSPYKF
FT                   LGIAKKSKLYPKLTKIMIEKSCQYFQHIDTTFSVNLSIHDILDVDMVVYIQKTMQKYEV
FT                   SNKIVFEILETEGIDNYEEVSSFILNMKRLGCKISIDDFGSGYSNYEHILKLDIDYIKI
FT                   DGSLIKNLDTDVNVQIVVETIVDFAKKLNLITIAEFVHNQAVFEKVKALDIERVQGFYL
FT                   GEPNKEI"
FT   gene            complement(376875..378446)
FT                   /locus_tag="Saut_0398"
FT   CDS_pept        complement(376875..378446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0069 hypothetical protein; PFAM:
FT                   Protein of unknown function (DUF3373)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08447"
FT                   /db_xref="InterPro:IPR021803"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUT5"
FT                   /protein_id="ADN08447.1"
FT                   /translation="MKKPLLLSLATIAILGTTNVSAESMYDRFQAMELEMKKMKKELDE
FT                   LKAKQNAVAAADEEEDEDEVSSDNKETASADDEEDEGEDEEMTVEEQLADIQDTLSDLN
FT                   KNTNGNHIKFNVDYRFAVENLQYKMADGSKQENDAFMTNRLWLNMNWAATKNLSFTGQL
FT                   AYNKAFGARSGASDPTNSSFETFDWIANENAYDDTLRVRSAYFLYKNDTFMGTDVPWTF
FT                   SIGRRPSTNGHLVNLRDDDHAASPMGHNINVEFDGLSSKFALENVTGVDGMYVKFCAGR
FT                   GMSNAAPRFNSAPYADTTSNSAIDLVGLIFTPWSDGQYTINSQYYYAGNLIDVKNSNDQ
FT                   SQGFKTVGNLHAITANFVANGIGDGINDFLDDTVFFISGAMSITDPDNGQSMLGSTEAQ
FT                   NGYSEWVGVQYPSLISEEGRWGLEYNHGSKYWRSITYGEDTNIGSKLAARGDAYEAYFT
FT                   EPLIDDILSLQIRYTYIDYKYAGSNGFFGSTSGNAMSINEAIAAGNGSKVVDKAQDIRF
FT                   YLRYRY"
FT   sig_peptide     complement(378381..378446)
FT                   /locus_tag="Saut_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            378754..379527
FT                   /locus_tag="Saut_0399"
FT   CDS_pept        378754..379527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0399"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="COGs: COG0052 Ribosomal protein S2; InterPro
FT                   IPR001865:IPR018130:IPR005706; KEGG: tdn:Suden_1802 30S
FT                   ribosomal protein S2; PFAM: ribosomal protein S2; SPTR:
FT                   Q30PK5 30S ribosomal protein S2; TIGRFAM: ribosomal protein
FT                   S2; PFAM: Ribosomal protein S2; TIGRFAM: ribosomal protein
FT                   S2, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08448"
FT                   /db_xref="GOA:E0UUT6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUT6"
FT                   /protein_id="ADN08448.1"
FT                   /translation="MVTMKDLLECGVHFGHQTRRWNPKMKKYIFGVRKNIYIIDLQKTL
FT                   RYFRNTYTIVMDAAAEGKTVLFVGTKKQARNSVRDAAIACNMPYVDNRWLGGMLTNFPT
FT                   IQKSIRKLDVITEMQENGQIDLLTKKEALMLSRKKDKLEQYFGGIRNMKKLPDMLFVVD
FT                   AVKEHIAVLEARCLNIPVVAPLDTNCDPDLITYPIPGNDDAIRSIQLFCREMTAAINEG
FT                   KALRDAPAEQEQTEEAATEEAPATEAAAVETTEEA"
FT   gene            379530..380585
FT                   /locus_tag="Saut_0400"
FT   CDS_pept        379530..380585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0400"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /note="COGs: COG0264 Translation elongation factor Ts;
FT                   InterPro IPR014039:IPR000449:IPR018101:IPR001816; KEGG:
FT                   tdn:Suden_1801 elongation factor Ts; PFAM: Translation
FT                   elongation factor EFTs/EF1B dimerisation;
FT                   ubiquitin-associated- domain-containing protein; SPTR:
FT                   Q30PK6 Elongation factor Ts; TIGRFAM: translation
FT                   elongation factor Ts; PFAM: Elongation factor TS; UBA/TS-N
FT                   domain; TIGRFAM: translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08449"
FT                   /db_xref="GOA:E0UUT7"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUT7"
FT                   /protein_id="ADN08449.1"
FT                   /translation="MAAVTAAMVKELRQATDAPMMDCKKVLVEADGDMEKAKELLKERG
FT                   IAKAAKKADRVAAEGLTGLKIADDFSKATVAEVNSETDFVAQNEGFQNLVKETAEEIFN
FT                   NNPADVEAFMNSDFGNKFTESVTKIGEKIELRRFATLNADEPNEALNGYIHSNNRIAVI
FT                   VKAKCDSEKTAECMRDTLKQVAMHASAMKPSTLSYKDFDSEYVEGETKGRIEALKKDNE
FT                   ELARLKKPLKNVPQYVSMMQLTDEVMAKAEADIKAELLAEGKPEKILDKIIPGKIARFI
FT                   LDNTLLDQEQALLDQQYVLDDKLTVAQAVEKAAKACGGTAEITEFIRLEVGEGIEKAED
FT                   DFAAEVAAQMS"
FT   gene            380669..381874
FT                   /locus_tag="Saut_0401"
FT   CDS_pept        380669..381874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0401"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1252 NADH dehydrogenase FAD-containing
FT                   subunit; InterPro IPR013027:IPR001327; KEGG: abu:Abu_2220
FT                   NADH dehydrogenase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: A0ZLN3 Putative
FT                   uncharacterized protein; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08450"
FT                   /db_xref="GOA:E0UUT8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUT8"
FT                   /protein_id="ADN08450.1"
FT                   /translation="MNTHTHNKIIVVGGGYGGLKAVENLAKHQNNQITLLDKNAYHFMQ
FT                   TDVYELIANEKDFAKVSVDLFTYCSGFDGNVSFYKQEVDDIDFENKKIITAVQRFSYDY
FT                   LIIAVGARTKFVKSINGLKEYAHGVKALHRAMYFKQKFEMSLFKKVQESGITCKPLSIV
FT                   VAGAGLSGVEIAAQMASFAKEFYCENNFLCRKLNIILVSSSKQILKGLDSFLVEKSQKR
FT                   LFDLEVVIKSQARVISLTKESVTLSSGEIISMDFMIFAGGIEPNGLIYKLDLAKNERGF
FT                   LNINECLQADGKKEVFAIGDCATLYNKGEFIAPTADVAEQMGELCSENIMRIGKNQELK
FT                   EHNIRSRGILIALGRRYAVGKVFNVHISGYLAFIMKKIIEKVYFIKLDRHSKKGCDKIF
FT                   KV"
FT   gene            381912..382556
FT                   /locus_tag="Saut_0402"
FT   CDS_pept        381912..382556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0402"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: tdn:Suden_1799 ABC
FT                   transporter-related protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: O66646 Lipoprotein-releasing
FT                   system ATP-binding protein lolD; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08451"
FT                   /db_xref="GOA:E0UUT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUT9"
FT                   /protein_id="ADN08451.1"
FT                   /translation="MNLLSAKNLSHSFEYELFSDVSLSLDTNESIAIIGMSGSGKSTLL
FT                   HLLSTLLTPEKGSIELFGKDIASMNKKELTLIKRNKLGIVFQSHYLFKGFSAYENLEVA
FT                   EILSRKNIDDILIKNLEIKQCMHQKVTELSGGQQQRVSIARVLTKKPSIIFADEPTGNL
FT                   DNQTAAEVMKLFFQYCEDNDAGMILVTHDNDLAHMCKRVYKLEDKELKLIK"
FT   gene            382568..383332
FT                   /locus_tag="Saut_0403"
FT   CDS_pept        382568..383332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0403"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="COGs: COG1684 Flagellar biosynthesis pathway
FT                   component FliR; InterPro IPR002010:IPR006303; KEGG:
FT                   tdn:Suden_1798 flagellar biosynthesis protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein; SPTR:
FT                   P35537 Flagellar biosynthetic protein fliR; TIGRFAM:
FT                   flagellar biosynthetic protein FliR; PFAM: Bacterial export
FT                   proteins, family 1; TIGRFAM: flagellar biosynthetic protein
FT                   FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08452"
FT                   /db_xref="GOA:E0UUU0"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUU0"
FT                   /protein_id="ADN08452.1"
FT                   /translation="MGWIEIFNETNVVGFLLLFFRFAGLFIAVPIFNHQNIPMNIKASM
FT                   AFFFAVVFYSSMPALHISIDVPTILVAVLGELLLGLSVGVVLQLAYNVITFAGGQISFM
FT                   MGFSMASAIDPQSGVSMPIISQFLSLMGLMILLSLNLHHWMLLFIDHSLKTVPLGGFVM
FT                   SKDLFHYIMHATSNMFLVGFIIAFPIIALSWLADVIFGMLMKTMPQFNLLVIGFPIKIM
FT                   VAFVVLIATFTAIMLILKGQIQEAFNSLEMLF"
FT   gene            383404..384840
FT                   /locus_tag="Saut_0404"
FT   CDS_pept        383404..384840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1797 hypothetical protein; SPTR:
FT                   Q8I414 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08453"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUU1"
FT                   /protein_id="ADN08453.1"
FT                   /translation="MKILLLNDNPVVNKLVTLSAQKTSDEVDITSTIEGIESQNYDLLI
FT                   VDDSVYSDELLSELQEQEKVKYKKSLFICAKDAEEVESFSSIILKKPFLPTDLVELFMM
FT                   FEKEVASEVDKEMPVEETQVEEIQSSDLEELSDELSLDDEESLGESVLDDEEAQKVKDL
FT                   LDENEEELSFDEEVENDIESLELDEEEGLAEVPEEAEEDLELEDDDLLADYDMALDLED
FT                   EADVDIAEEDSFDLEDEVETLEDEELEELDTATVAELEDEIDDVVTEELSEKEGDLAVD
FT                   MALDLEDEADIDISHDMVDEFNLEEDIEEPEEESVQEPEEEVEEEPEDVDTPAVAELED
FT                   IIENEEAEEEPEEVVEAEDINLESEIQSAVENLSQEDLESELDEDTLLQIATNEIDPLA
FT                   DLTSKDLKVALGEELEEVEEVDTAAVAEIEDTIMSEEEDEGQNSGVEALKKLLEALSDK
FT                   DVAASMKGMKISINITLGDN"
FT   gene            384840..385460
FT                   /locus_tag="Saut_0405"
FT   CDS_pept        384840..385460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0405"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COGs: COG0194 Guanylate kinase; InterPro
FT                   IPR008144:IPR008145:IPR020590:IPR017665; KEGG:
FT                   tdn:Suden_1796 guanylate kinase; PFAM: guanylate kinase;
FT                   PRIAM: Guanylate kinase; SMART: guanylate kinase/L-type
FT                   calcium channel region; SPTR: Q30PL1 Guanylate kinase;
FT                   TIGRFAM: guanylate kinase; PFAM: Guanylate kinase; TIGRFAM:
FT                   guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08454"
FT                   /db_xref="GOA:E0UUU2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUU2"
FT                   /protein_id="ADN08454.1"
FT                   /translation="MSAIHGAVLVLSGPSGAGKSSLIHKVMNDLGECYFSISTTTRPIR
FT                   EGEVDGVDYYFVDEEEFKKEIEEDQFLEYAIVHGNYYGTSLKPVKKALSKGKLVIFDID
FT                   VQGNSAINSRLGDITTSVFITPPTLSELKKRLVNRHTDAEEVIERRVKMARREIQRVSE
FT                   YEYLLVNDDLDEAADKLRIIAKVARFKKSNEEINEFVQKWEDL"
FT   gene            385548..385778
FT                   /locus_tag="Saut_0406"
FT   CDS_pept        385548..385778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0406"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="InterPro IPR003369:IPR006312; KEGG: tdn:Suden_1795
FT                   twin-arginine translocation protein TatA/E; PFAM:
FT                   sec-independent translocation protein mttA/Hcf106; SPTR:
FT                   Q30PL2 Sec-independent protein translocase protein tatA/E
FT                   homolog; TIGRFAM: twin-arginine translocation protein,
FT                   TatA/E family subunit; PFAM: mttA/Hcf106 family; TIGRFAM:
FT                   twin arginine-targeting protein translocase, TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08455"
FT                   /db_xref="GOA:E0UUU3"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUU3"
FT                   /protein_id="ADN08455.1"
FT                   /translation="MGMPSGTELLIIFGIIVLLFGAKKIPDLAKGLGKGIKNFKAEMKD
FT                   VDEVEVETPKKVEKSDEVASSDETPKSTTQA"
FT   gene            385782..387377
FT                   /locus_tag="Saut_0407"
FT   CDS_pept        385782..387377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0407"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase; InterPro
FT                   IPR015945:IPR005148:IPR008909:IPR001412:IPR 001278; KEGG:
FT                   tdn:Suden_1794 arginyl-tRNA synthetase; PFAM: Arginyl-tRNA
FT                   synthetase, class Ic, core; arginyl tRNA synthetase domain
FT                   protein; DALR anticodon binding domain protein; PRIAM:
FT                   Arginine--tRNA ligase; SPTR: Q30PL3 Arginyl-tRNA
FT                   synthetase; TIGRFAM: arginyl-tRNA synthetase; PFAM: DALR
FT                   anticodon binding domain; Arginyl tRNA synthetase N
FT                   terminal domain; tRNA synthetases class I (R); TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08456"
FT                   /db_xref="GOA:E0UUU4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUU4"
FT                   /protein_id="ADN08456.1"
FT                   /translation="MKQRVSALLREKIGREVVLEKPRDRSFGHFATPIAFSLAKELRKS
FT                   PMVIADELASSFESSDVFSKVEAVKGYLNFRLSEDFLAEYASWALKNPSEFATQEKNQK
FT                   ILLEFVSANPTGPLHIGHARGAVYGDTLYRMAKHLGYDITAEYYVNDAGNQIDLLGLSI
FT                   QLHARDNLLDETVEYPESYYRGEYLDALARDVMEKFGSEIFYDESRQRELALWAKDEVM
FT                   KIIAKDLGDLNIFFDTFVYESTLYDDWDRVMKKMGSGIYEKDGKIWIASEAKGDEKDRV
FT                   VVREDGRPTYLAGDIVYHNQKFERGYDHYINIWGADHHGYIPRVKAAIEYLGYDSNKLE
FT                   VLLSQMVSLLKDGEPYKMSKRAGNVILMSDIVEEIGADALRFIFASKKSDTALEFDLAE
FT                   FKKQDSSNPIFYIQYAHARIQTLLSKATLTKEDIANASLKNLGENADTLLFDALLLPEV
FT                   IEDAFNTRQVQKLTDYLKSLAASLHKFYYDVRMIGTEDEAKLLKLMLMVALSIKTGLSL
FT                   MGIDAKDKMSKEEE"
FT   gene            complement(387385..388077)
FT                   /locus_tag="Saut_0408"
FT   CDS_pept        complement(387385..388077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0408"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="COGs: COG3786 conserved hypothetical protein;
FT                   InterPro IPR005490; KEGG: tdn:Suden_1793 hypothetical
FT                   protein; PFAM: ErfK/YbiS/YcfS/YnhG family protein; SPTR:
FT                   A3S8Y9 Putative uncharacterized protein; PFAM:
FT                   L,D-transpeptidase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08457"
FT                   /db_xref="GOA:E0UUU5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUU5"
FT                   /protein_id="ADN08457.1"
FT                   /translation="MIKSFLIMTSFSILLFSSQQIVLVVADDMNSSQAKLECYEASQKA
FT                   FETMHVNLGKNGLGWGVESEQFTKNPDDALKYEGDKKAPAGIFRLSNIFGYAQKSNYNV
FT                   PYLYTAKNLICIDDTHSNFYNQIIMAHGDEKSFEYMKRDDAQYKLGIVVDYNKKALKDR
FT                   GSCIFMHIERAPNSTTVGCTSMSEKNIQKIANWLDKRKNPILIQIPKKSAKEVLKLYPQ
FT                   LKNSELLK"
FT   sig_peptide     complement(388000..388077)
FT                   /locus_tag="Saut_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            388164..388787
FT                   /locus_tag="Saut_0409"
FT   CDS_pept        388164..388787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08458"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUU6"
FT                   /protein_id="ADN08458.1"
FT                   /translation="MSITIKQATAGDASFLAQMILQSSRAGKKDGLFDVLFGTDDDKIV
FT                   LEKLEKLTQTEAKSHCHYKNFLIAQMDGKNVGTLCSYEPRIATKEAFVQALKEIGCGDE
FT                   INKPLEVVYNCSFDTNKSRLMFDFMEELEGFIDVGVLKALMQKSLLSARLKGYRIVQTI
FT                   IEIGSLEAELFYKKLGFEIVDKKECEAYREIFGRAGVMLLAMEF"
FT   gene            388833..390182
FT                   /locus_tag="Saut_0410"
FT   CDS_pept        388833..390182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0410"
FT                   /product="transporter, NhaC family"
FT                   /note="COGs: COG1757 Na+/H+ antiporter; InterPro IPR018461;
FT                   KEGG: tdn:Suden_1791 Na+/H+ antiporter NhaC; PFAM: Na+/H+
FT                   antiporter NhaC-like; SPTR: A0Y5W1 Putative Na+/H+
FT                   antiporter family protein; PFAM: Na+/H+ antiporter family;
FT                   (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08459"
FT                   /db_xref="GOA:E0UUU7"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUU7"
FT                   /protein_id="ADN08459.1"
FT                   /translation="MAIALALYTKNIMLSLFGGIFLGLFFLHDFSVIAAVNSTFELFFS
FT                   LLSEAWILKTLAFAVLVGSVMELMQKSGGISGFVSFMTQETALVNSPRSALLVSYFIGV
FT                   IIFIESSITSLIAGAVGRPLCDKEKVPHAKLAFVCDSTSAPISSLIVLNGWGALLLGLI
FT                   ATQVQTGIISGDNVNILLHSVAYNFYAVSALIVTFLAVWFNINIGPMKNAKPSLDKASL
FT                   HVNSKVSMAYMIIPIFLMITFVFMFLYITGKGDMLKGSGSSSIFYTMLATLMVMFIYYI
FT                   GTKNMSAKTYTKSAYIGAKKLFPIAMILLFAFAIGEVTVDLKTGQYLASLASDNLSVFL
FT                   LSGVIFLLSSIISFSTGTSWGTFSIMIPIAVPMAVGMDTDVALAIGAVISGGVFGDHCS
FT                   PISDTTIISSLASDCEVVEHVKTQLPYALISGAVALVLFIVFGFTTLNNS"
FT   sig_peptide     388833..388934
FT                   /locus_tag="Saut_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(390160..390903)
FT                   /locus_tag="Saut_0411"
FT   CDS_pept        complement(390160..390903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0411"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG0847 DNA polymerase III epsilon subunit and
FT                   related 3'-5' exonuclease; InterPro IPR013520:IPR006055;
FT                   KEGG: tdn:Suden_1790 exonuclease; PFAM: Exonuclease RNase T
FT                   and DNA polymerase III; SMART: Exonuclease; SPTR: P0AEK0
FT                   Exodeoxyribonuclease 10; PFAM: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08460"
FT                   /db_xref="GOA:E0UUU8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUU8"
FT                   /protein_id="ADN08460.1"
FT                   /translation="MAKQYVILDTETTGTNEEDRVIQLGYMVLGAKEIEVHNEFCSTDV
FT                   AIKFGAMEVHGITPDLLEGKPPCVETVAYKRLLELNTSENYLIIHNAPFDITMLEKEGF
FT                   KTQMKVIDTLRVAKHVMPDEEAHRLQYFRYKMELYKDEEKEAKALGIVVKAHDAIGDVL
FT                   VLKLFLSKLKDIVQAQFPNENPVEKMVDLTNTPILVKTFRFGKHKGKSLEEVAREDAGY
FT                   LRWMLKNMENIDEDLRYSINYYLES"
FT   gene            390969..392117
FT                   /locus_tag="Saut_0412"
FT   CDS_pept        390969..392117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0412"
FT                   /product="protein of unknown function DUF819"
FT                   /note="COGs: COG5505 integral membrane protein; InterPro
FT                   IPR008537; KEGG: tdn:Suden_1788 hypothetical protein; PFAM:
FT                   protein of unknown function DUF819; SPTR: A3U8M0 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF819)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08461"
FT                   /db_xref="GOA:E0UUU9"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUU9"
FT                   /protein_id="ADN08461.1"
FT                   /translation="MIDSPLVYLFTLALLVAAVSFLQIKTKWKFFSYVPVVVLIYALAM
FT                   LLASLGVFEQNKEITTIYKLTKTNLLPAMLFLMLLEVDFKHFFKLGKSLLIAYSLAALS
FT                   IAFSFIIVAYIFDFNKETAAAFGALAGSWMGGTANMIAVGSALHVSEDAFAYALVVDSV
FT                   NYTLWVMLLLFLVPFAKFFNRFTKSEEKLAYLDKIGCACSMGAKRYWLLIVLALGASLL
FT                   SQLVASKLVILNTTTSIVLFSTLLGVIGSFTKLRFINGSSEVATTMLYILIALIGSRAV
FT                   IENFNGLGMYVLAGFVILLIHALIMLAGAKIFKLDLFSISVASLANIGGVASAPILAAT
FT                   YNKALVSIGVLMAIMGYLIGTFGGLLVGSVLLYFTTASGNFF"
FT   gene            complement(392082..392495)
FT                   /locus_tag="Saut_0413"
FT   CDS_pept        complement(392082..392495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0413"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="COGs: COG1959 transcriptional regulator protein;
FT                   InterPro IPR000944; KEGG: abu:Abu_1353 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0074; SPTR:
FT                   O66625 Putative HTH-type transcriptional regulator aq_268;
FT                   TIGRFAM: transcriptional regulator, Rrf2 family; PFAM:
FT                   Transcriptional regulator; TIGRFAM: rrf2 family protein
FT                   (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08462"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUV0"
FT                   /protein_id="ADN08462.1"
FT                   /translation="MQLSKSAQYAIRILAYMADHKDSKLLNATELSETLLIPYKFLTKI
FT                   MTEVVKSGLVVSIRGRDGGYSFAKPPSEIMVSEILDIFHDSIKDEQCVLGIGFCNGMCK
FT                   CALHDQWMEPKHLMQKMFQESTLEEIAGRGCKI"
FT   gene            392630..393076
FT                   /locus_tag="Saut_0414"
FT   CDS_pept        392630..393076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0414"
FT                   /product="nitric oxide reductase, NorC subunit apoprotein"
FT                   /EC_number="1.7.2.5"
FT                   /note="InterPro IPR009056; KEGG: cps:CPS_0600 nitric-oxide
FT                   reductase, C subunit; SPTR: A3JBU6 Nitric-oxide reductase,
FT                   C subunit; PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08463"
FT                   /db_xref="GOA:E0UUV1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUV1"
FT                   /protein_id="ADN08463.1"
FT                   /translation="MTERITKSMAKNIYYGGGTFALMIFIALSFDTVHQIPKRSNQQNM
FT                   TASVVAGKKLWEANDCVGCHTLIGEGAYYAPELMNVFQRRGGGDEGAFKAYMQGWMAAQ
FT                   PLDTPNRRKMPQFHLTDKEVNNLADFLIWTSKVNANEWPPTIEG"
FT   gene            393086..394471
FT                   /locus_tag="Saut_0415"
FT   CDS_pept        393086..394471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0415"
FT                   /product="nitric oxide reductase, NorB subunit apoprotein"
FT                   /EC_number="1.7.2.5"
FT                   /note="COGs: COG3256 Nitric oxide reductase large subunit;
FT                   InterPro IPR000883:IPR018062; KEGG: sdn:Sden_1980
FT                   cytochrome c oxidase, subunit I; PFAM: cytochrome c oxidase
FT                   subunit I; PRIAM: Nitric-oxide reductase; SPTR: P98008
FT                   Nitric oxide reductase subunit B; PFAM: Cytochrome C and
FT                   Quinol oxidase polypeptide I"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08464"
FT                   /db_xref="GOA:E0UUV2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUV2"
FT                   /protein_id="ADN08464.1"
FT                   /translation="MKYTSQAVAKPYFIFALTLLAGEILFGILMGIQYVWGDFLFPLIP
FT                   FNVLRMVHTNLLIVTLLFGFMGATYYLIPEETESELWSPKLAIITFWIFAAAGVATILG
FT                   YLFVPYATLTEWTFNNLLPTMGREFLEQPLPTKVGIVIVVLSYILNTAMTILKGRRTVI
FT                   TTVLLTGLLGLAVFFLFAFYVPDNLIQDKFFWWFTVHLWVEATWELILGAILAFVLIKV
FT                   TGVDREHIDKWLYLIIAMTMVSGILGTGHHFFYMGAPEYWLWIGSISSAVEPLPFLLMI
FT                   LFAFTMARERKIEHKNKMALTWAKGTAVMAFLGAGVWGFFHTLAPVNMYTHGTQLTAAH
FT                   GHLSFYGAYVMIVFTVISYAMPILRGRPYGNCAKAQKVELASFWMMNIGMVGLTLALSI
FT                   AGLVQIFDQRVGTNLIGFMDSQESIAGIYMVRLAFGFLVFTGLLTYFYSFFVKEPAVEP
FT                   AKV"
FT   gene            394482..396281
FT                   /locus_tag="Saut_0416"
FT   CDS_pept        394482..396281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0416"
FT                   /product="von Willebrand factor type A"
FT                   /note="COGs: COG4548 Nitric oxide reductase activation
FT                   protein; InterPro IPR002035; KEGG: sdn:Sden_1979 von
FT                   Willebrand factor, type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: A3JBU3 Von
FT                   Willebrand factor type A domain protein; PFAM: von
FT                   Willebrand factor type A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08465"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUV3"
FT                   /protein_id="ADN08465.1"
FT                   /translation="MLHYWLEFEESMGKVWDKYLNKKVHKFHEDKRVYFEDISKPLHIF
FT                   HRLMGGEKAKELQITDKRYVETSRTLLEKISFLGKEFFLTWQDEESVYLPASFAYFSTK
FT                   QENEMLYYWLIAMAAQIENVTNNSFIEKNQQAMYYLTKRYSGFDVFYKSASQYLMDKYE
FT                   QLSFLKSLDEQSNQDLIDDYPNPLWIYPPSITLSYANNVDSGDEELTREEDKDKSEELH
FT                   MKKQANQIDDKHETDGFLAFLPESLMSIFEQVNVDRCEDDSFDEDALYHAEDLDEITVG
FT                   QKQANLSARIKMDLELLPDNTVTYPLGKGHFVDEWDYKRQDYLLKYARILPQVTLNVIP
FT                   IELPRRLKKTVKKIQGELDLLQLDRIKNDRLPYGDELNMDSWIEYMSHQNKSMHHQNFY
FT                   TTYEKKTRDMSTLLLADISLSTEGGITQELRIIDVIKDSLMVFSEALEKLEDKFAIYTF
FT                   SSLQNKKVYFNIIKNFKDKYDALIRGRIESIKPQYYTRMGAAIRESAKILDKQQSANKL
FT                   LLIISDGKPNDEDRYDGRYGIEDTKKALQEIKKKGITPFCITIDLDAKEYLNYLFGQNG
FT                   YAIVRDGQKLPKVLTEVYINLTK"
FT   gene            396291..397082
FT                   /locus_tag="Saut_0417"
FT   CDS_pept        396291..397082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0417"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro
FT                   IPR013615:IPR011704; KEGG: sdn:Sden_1978 ATPase; PFAM:
FT                   ATPase associated with various cellular activities AAA_5;
FT                   CbbQ/NirQ/NorQ domain protein; SPTR: A3JBT9 Putative
FT                   chaperone required for activity of nitric oxide reductase
FT                   (NorQ), member of the AAA+ superfamily of proteins; PFAM:
FT                   AAA domain (dynein-related subfamily); CbbQ/NirQ/NorQ
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08466"
FT                   /db_xref="GOA:E0UUV4"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUV4"
FT                   /protein_id="ADN08466.1"
FT                   /translation="MSQTYYLPQSNEVELFSAAAQMNLPVLIKGPTGCGKTRFIESMGE
FT                   QLGRDVYTVVCHDDLSAADLVGRHLISEKGTYWQDGPLTKAVRNGGICYIDEIIEARKD
FT                   TTVVLHSLADYRRVLPIDRTGEVIEAHPDFMLVVSYNPGYQNVLKGMKPSTKQRFISLS
FT                   FNYPKPEIEKEVLIKESGVNAQTAQKLVDIASEIRSLDDTDIQEAVSTRLLIYAGKLIT
FT                   KGFDPYQACMHSIVESLSDEEDVLEVLQKLITLHFAKSSDV"
FT   gene            397075..397674
FT                   /locus_tag="Saut_0418"
FT   CDS_pept        397075..397674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0418"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="COGs: COG1845 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 3; InterPro IPR000298; KEGG: tbd:Tbd_0560
FT                   putative additional subunit of nitric oxide reductase (Nor)
FT                   complex, membrane protein; PFAM: cytochrome c oxidase
FT                   subunit III; SPTR: A3JBU2 Cytochrome c oxidase subunit III
FT                   family protein; PFAM: Cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08467"
FT                   /db_xref="GOA:E0UUV5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUV5"
FT                   /protein_id="ADN08467.1"
FT                   /translation="MSKTMRLKEKYPPGDFGIWIIIYVELLTFGLFFIGYAFSRRENIE
FT                   MFNTSQLMLNQTSGFINTFILITSSYFVAKGVHFMQTMTQENVEESNKKASVWLLLAIA
FT                   CGAAFVFIKGAEFAHIFGEGITLSTNKFFMFYLLLTMFHFMHVVLGTVILFNIRQRTKI
FT                   SGYTPDDTGGFESGASYWHMVDLLWIVLFPLVYIIR"
FT   gene            397685..397948
FT                   /locus_tag="Saut_0419"
FT   CDS_pept        397685..397948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmb:Mmol_1053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08468"
FT                   /db_xref="GOA:E0UUV6"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUV6"
FT                   /protein_id="ADN08468.1"
FT                   /translation="MINRKRTLEYVWIILVALTIFAYLLGYLKLISTSLVAVLLLTTFI
FT                   KGMLVSDYFMGLRAVEMKYRLIPIIWLGVIILLIGVAYYLPI"
FT   gene            398029..399096
FT                   /locus_tag="Saut_0420"
FT   CDS_pept        398029..399096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0420"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="COGs: COG4948 L-alanine-DL-glutamate epimerase;
FT                   InterPro IPR013342:IPR006395; KEGG: tdn:Suden_1785
FT                   mandelate racemase/muconate lactonizing protein; PFAM:
FT                   Mandelate racemase/muconate lactonizing protein;
FT                   methylaspartate ammonia-lyase; SPTR: A1HLW3 Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein; PFAM: Mandelate racemase / muconate lactonizing
FT                   enzyme, C-terminal domain; Mandelate racemase / muconate
FT                   lactonizing enzyme, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08469"
FT                   /db_xref="GOA:E0UUV7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUV7"
FT                   /protein_id="ADN08469.1"
FT                   /translation="MKIKNIQTNIEKIPLRTPFATALRRVENVEFVRVKLTCNNGATAY
FT                   GEAPATKAITGEDLESIISSIESIKEKLLGLPLLEALESLHVKAMGSSAKAALDMAIVA
FT                   LMVEQKGETLLQYFGAKDFSCVKTDVTISLNDADTMLQDAQTAYNNGFDILKVKLGSDI
FT                   NHAVDVTKAIAKKLPHSQLLIDANQAWNLETSLYYIEAVKGLHVSLIEQPVIADDLESL
FT                   KIISHSTEIPILADEAVFTLEDVKKVYENGCADMINIKLMKCGGLSRAKEILEFAREKN
FT                   IGCMLGSMLEGPVSICAAYALCFAYRDVIKYVDLDSPLLYKEVPDFVGGFAINRNQIKP
FT                   INPANIEASKIPTLA"
FT   gene            complement(398988..400340)
FT                   /locus_tag="Saut_0421"
FT   CDS_pept        complement(398988..400340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0421"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="COGs: COG3004 Na+/H+ antiporter; InterPro IPR004670;
FT                   KEGG: tdn:Suden_1784 Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; SPTR: Q30PM3 Na(+)/H(+) antiporter nhaA;
FT                   TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+ antiporter 1;
FT                   TIGRFAM: Na+/H+ antiporter NhaA; (TC 2.A.33.1.1)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08470"
FT                   /db_xref="GOA:E0UUV8"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUV8"
FT                   /protein_id="ADN08470.1"
FT                   /translation="MKLYAPWEKAFEKISTPLENFIHAQTTTGLILFFTTIIALILANS
FT                   PFAETYQHIFHIPIAISIGSWQLSQSLSHWINDGLMTFFFFLVGLEIKREILIGELSNI
FT                   KVAILPILAAIGGMIFPALIYMSINADSPGANGWGIPMATDIAFAISALVILGHRVSPA
FT                   LVTFLIALAIVDDLGAVVVIAIFYTEQIHLLPLFLAGVSFLIMVSFNRFGIHMILPYLI
FT                   IGTFMWLFMLESGIHATIAGVIAAFAIPSKPNYTPVDFTAHTKNLLEEYDNYPVATDHT
FT                   MHEKQKAILQNIKDKINAVSSPAARLEHTLHLPIGLIVIPLFALANAGVSLNFTALSDS
FT                   LAEPVSLGIILGLLAGKIIGIFGVSYLSIKLSIATLPQNSTMSQLFGVAALGGIGFTMS
FT                   IFVAELAFAHSEELLIHAKVGILLASMFAGFIGFIWLRFIAKPPTKSGTSL"
FT   gene            400416..401660
FT                   /locus_tag="Saut_0422"
FT   CDS_pept        400416..401660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08471"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUV9"
FT                   /protein_id="ADN08471.1"
FT                   /translation="MNLQDLKNTTILLLGKSRAFSEDEFFSQLKFHNISIAQETGDDVR
FT                   FIVEGRMMSPYEQNMSDAFYEEKRYEFINIDVFEKLLAQEIDNDTLLMSLKLSNDKMRL
FT                   KSFIQNSCIDDTLFFKLLKMYSFEGEDFFENDDNRDVSAALIGRFYENIERNHNVQYAT
FT                   TGIYHLIAQTDNEQLLEAIAQLTPALQHPKIMKALAMHEKTPRSVHKIFLKKGDDSVKE
FT                   AMAYNANLDKSIIHELIKYEDLAAVVAQNTKLDDELFGFLSAYKTFLAANETLSEVMQQ
FT                   ELFSLNEEQVHLALAQNRGLHVSICKLLLHVKSEEIKKALYINRATPVDILQNAYKEGG
FT                   YNEALSANSATPQSILQELAQSQDEKILYNLAKNENTPVDILYQLQLDSRFERAVKTNE
FT                   AFGKYIQSQNIGWLV"
FT   gene            401657..402652
FT                   /locus_tag="Saut_0423"
FT   CDS_pept        401657..402652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0423"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR011703;
FT                   KEGG: tdn:Suden_1782 ATPase; PFAM: ATPase associated with
FT                   various cellular activities AAA_3; SPTR: A0MZB4 Gp24; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08472"
FT                   /db_xref="GOA:E0UUW0"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUW0"
FT                   /protein_id="ADN08472.1"
FT                   /translation="MRAGELSQALQALVLQKVPTFLWGAPGIGKSSIVKQIAQENDLDF
FT                   IDLRLALMDPTDLKGIPFYDKESHTALWAPPAFLPREGRGILFLDELNSAAPAVQSSAY
FT                   QLILDRRVGEYELPDGWAIVAAGNREGDRGVTYRMPAPLANRFVHFELEVSVDDWREWA
FT                   YKYGLDSRIIAYISYKNEHLFTFDAKNESKSFATPRSWEYVGNILKSSLAQALLLDTIS
FT                   GAVGRDAAVSFLSFLKVMDRLPDIETILNGEDFTYGEEVDVLYALSSGIVSHYLQNPSS
FT                   QRLENLLCYTLELKGEFAVMIAQDLQRAGITMEGSEVFKEWVRKFSYLLE"
FT   gene            402672..403817
FT                   /locus_tag="Saut_0424"
FT   CDS_pept        402672..403817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3864 conserved hypothetical protein; KEGG:
FT                   tdn:Suden_1781 hypothetical protein; SPTR: A0MZB5 Gp25;
FT                   PFAM: Predicted metallopeptidase (DUF2201)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08473"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUW1"
FT                   /protein_id="ADN08473.1"
FT                   /translation="MQNTEKKISQAKAKLLVDYPYFGTLASKISVVINDDIEAFKNDGQ
FT                   NLEINSDYLQNLELSEMEFVFANGAMHTSLAHEMRKNNRSGWLWQMATDMAVNDMLVQN
FT                   GLDMPYGAQYRERFSGMYAEEIYAELKDDILRDDENLEYEADDVDDVQHSENEKNDEKQ
FT                   NNQQTQQELEEEILQEQLFAQEAISLLESKMQTGEAPAMIERFFQLKDFGKIDWRNELR
FT                   VALDKYFRDDYVVMPPSKKLLYSGIYLPSNVSQTFRLVIAVDSSGSIDEVLLNEFLSEV
FT                   NFLMTLVQNYQIELLVCDEKIRSHKTFYSGDVLEVDVKGGGATDFRPVFHFINENFDDV
FT                   KLLLYFTDLDGAFPQNRPEYEVKWVSANGQEIPFGTLVKLD"
FT   gene            complement(403814..405067)
FT                   /locus_tag="Saut_0425"
FT   CDS_pept        complement(403814..405067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0425"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="COGs: COG3706 Response regulator containing a
FT                   CheY-like receiver domain and a GGDEF domain; InterPro
FT                   IPR000160:IPR001789; KEGG: tdn:Suden_1780 diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; response
FT                   regulator receiver; SMART: GGDEF domain containing protein;
FT                   response regulator receiver; SPTR: A0Y2E6 Response
FT                   regulator/GGDEF domain protein; TIGRFAM: diguanylate
FT                   cyclase; PFAM: GGDEF domain; Response regulator receiver
FT                   domain; TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08474"
FT                   /db_xref="GOA:E0UUW2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUW2"
FT                   /protein_id="ADN08474.1"
FT                   /translation="MSEKILIVEDNKTLAKLIAKKIQTSLGIEVDVAYTLAEAKLFIAR
FT                   YTYFVTLLDINLPDAPNGEIVDYVTKKKIHAMVLSGNIDKEFRKKILKKNIIDYVNKSG
FT                   VDDINYIIHTIQRLQNNQKHKVLVVDDSRIFRQQMQTMLENLFFNVISVAHGEEAIGML
FT                   QAQPDISLVLTDYHMPVMDGLELTIQIRKTYTKNELCILALSSNEDEEITALFLKHGAN
FT                   DYVKKPFSKEEFSCRVNNSIEALENIQMITNYANRDYLTGLYNRRYFFETINEYIDEIK
FT                   DSGEKFSIGMIDIDHFKKINDTYGHDVGDKVITALADILRSSTNPHDVVARFGGEEFCV
FT                   VLKNINQYSAHEIFNRLREEAEKFSFHLKDEQYINFSVSIGALLFNEEESLEENINAAD
FT                   MLLYKAKDNGRDQVVFEA"
FT   gene            405149..406417
FT                   /locus_tag="Saut_0426"
FT   CDS_pept        405149..406417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0426"
FT                   /product="AAA ATPase"
FT                   /note="COGs: COG0507 ATP-dependent exoDNAse (exonuclease V)
FT                   alpha subunit - helicase superfamily I member; InterPro
FT                   IPR003593; KEGG: tdn:Suden_1779 ATPase; SMART: AAA ATPase;
FT                   SPTR: A3J342 Helicase, putative; PFAM: PIF1 helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08475"
FT                   /db_xref="GOA:E0UUW3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003840"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUW3"
FT                   /protein_id="ADN08475.1"
FT                   /translation="MNYMDLILDKLHNKQNVFLTGGAGVGKTTITREIIKQYESEAKKV
FT                   AKLASTGMAATLINGQTLHSFFDLGIASDVEELQNNAKYEIKKKIKKLISSMDLIVIDE
FT                   ISMVSDTLFEMIELRLNQAGFSGSLLVVGDFLQLPPVVRGYGEVKFAFESPSWKNFAFE
FT                   KVELTHIYRTDDLRFIELLHAVRFGTINEAVHNQLNEFIKPLPNDLSQFTFLFGKNISA
FT                   TKHNKTQLDFIDEALHVKEAQVVKHLKSTQDKEVERFMDDARIDKELALKVGAPVLFTR
FT                   NSWNYFNGERGVVVNVDASYVYVQKSDGKVVKLEPTAQSKAQWKEKSVEGKKEMVEENI
FT                   FTVYQFPIKLAFAITIHKSQGMSIEDLIIDTNEIFAPSQFYVALSRSSNPARLTLIAPS
FT                   KQWYDLAYVNPKAMIFTQKEQSC"
FT   gene            406414..407298
FT                   /locus_tag="Saut_0427"
FT   CDS_pept        406414..407298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0427"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: tdn:Suden_0400
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF6 transmembrane; SPTR: A3L355 Putative uncharacterized
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08476"
FT                   /db_xref="GOA:E0UUW4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUW4"
FT                   /protein_id="ADN08476.1"
FT                   /translation="MKKVDSGVLFMLGSALISALNGALTKILSEDISALEIVFFRNFIG
FT                   VFIIFYALKHTAPKLTGGKIHMLFTRGLFGFMAMILFFYTITVIPLGEAITLNKTSPFF
FT                   VTLFAYFLLHEHLNRRTLFALLIGFLGVVLIVKPFGMSFSYAHFLGILGGFFAAAAYTT
FT                   IKKIKDIYDSRVIVLSFVGMGTLLPALLFLTAPFIHAPASLEFLFPKFILPNTLHVWLL
FT                   IILMAFISTLSQWLLTKAYSASNLSIVGVVSYTNIPFAIGFGTLLGDNFPDTLTFLGIL
FT                   FIVLGGILVSKRQ"
FT   sig_peptide     406414..406479
FT                   /locus_tag="Saut_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            407364..408632
FT                   /locus_tag="Saut_0428"
FT   CDS_pept        407364..408632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0428"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro
FT                   IPR000160:IPR013656:IPR013767:IPR001610:IPR
FT                   000014:IPR000700; KEGG: tcx:Tcr_0090 diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: GGDEF domain
FT                   containing protein; PAC repeat-containing protein; PAS
FT                   domain containing protein; SPTR: A3JA35 Sensory box/GGDEF
FT                   domain protein; TIGRFAM: diguanylate cyclase; PAS sensor
FT                   protein; PFAM: GGDEF domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box; diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08477"
FT                   /db_xref="GOA:E0UUW5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUW5"
FT                   /protein_id="ADN08477.1"
FT                   /translation="MQDTSKNVTIAIDEIPENVAIYKFEEGDFVIVDFNKNAQKTEHIS
FT                   KEEVVGKKLTEAFPGVKDFGLFDILLNVYEDGKPRELDTRLYKDEKVNSWRYNSVRKLP
FT                   SGELIVFYKDVTKYKELEDEVHHLDKETAHKRKKVQLLAKALEQTDDMVLITDANGIIE
FT                   YVNDSVTLKTGYDKSELIGSKTNIFKSGKHTNEFYKNLWGTILSGKNYHSIVIDKTKDD
FT                   RLYYADLKITPLFDENKTIQNFVATSTDITSRIKMEKKLKKLATIDSLTKIYNRYKIDE
FT                   AINIQIARYRRYKEPFCIFMFDIDNFKTVNDTYGHDAGDRVLKALSRLVSNHIRTTDIF
FT                   GRWGGEEFVIILENTSKEEAFVITEKLRKIVEVSVIDGKYKITISIGVAQYEESESREE
FT                   LVKKADKALYRAKENGRNQVVAA"
FT   gene            408622..408762
FT                   /locus_tag="Saut_0429"
FT   CDS_pept        408622..408762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08478"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUW6"
FT                   /protein_id="ADN08478.1"
FT                   /translation="MLHKSLLLAILVVVGSFTACASHQDDGYYDRANKASEKALKKLDR
FT                   E"
FT   sig_peptide     408622..408684
FT                   /locus_tag="Saut_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(408783..409379)
FT                   /locus_tag="Saut_0430"
FT   CDS_pept        complement(408783..409379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0430"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG0450 Peroxiredoxin; InterPro
FT                   IPR019479:IPR000866:IPR013740; KEGG: tdn:Suden_1778 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; Peroxiredoxin-like;
FT                   Redoxin domain protein; SPTR: A2V536 Alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; PFAM:
FT                   C-terminal domain of 1-Cys peroxiredoxin; AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08479"
FT                   /db_xref="GOA:E0UUW7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUW7"
FT                   /protein_id="ADN08479.1"
FT                   /translation="MLVTNPAPDFTATAVLADGSIVEDFTLSENYGEKGTVVFFYPLDF
FT                   TFVCPSEIIAFSHRYEEFQKRGVNVVGISVDSQFSHFAWRETPVSEGGIGRINFPLVAD
FT                   LTKDIARDFDVLLNNAVALRGSFLIDDKGIVRHAVVNDLPLGRNVDEMLRMIDAQQFTD
FT                   EFGEVCPAGWQKGDEGMKADTEGVAEYLAKHESEL"
FT   gene            complement(409487..410434)
FT                   /locus_tag="Saut_0431"
FT   CDS_pept        complement(409487..410434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0431"
FT                   /product="permease"
FT                   /note="COGs: COG0701 permease; InterPro IPR005524; KEGG:
FT                   sun:SUN_1419 hypothetical protein; PFAM: permease; SPTR:
FT                   A1HQT6 Permease; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08480"
FT                   /db_xref="GOA:E0UUW8"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUW8"
FT                   /protein_id="ADN08480.1"
FT                   /translation="MWKESVDYLTNNILHLEGHLGDAVNFFIYDTVKIWFLLITIIFIV
FT                   SYLRTHFNTEYVRAHLQGKSELYGNVLAALFGIITPFCSCSAIPLFLGFIQARIPIGVT
FT                   FSFLISAPMNNEVAIALLFGLFGWKITAIYIGFGLFVAIAGGFVIGKLGMEKYILLNVK
FT                   PMEGELEEVKITLTMKDRAKEAWDYTLDIFKQIYLYVLVGVGVGAFIHGYIPADFIAKY
FT                   AGADNPFAVLIAVVMGVPMYSNAAGIMPLVEVLTNKGMLLGTALSFMMAVTALSLPEAM
FT                   ILKKILHTKLIATFFGIVGLGIIAIGYLFNAILS"
FT   gene            complement(410438..410671)
FT                   /locus_tag="Saut_0432"
FT   CDS_pept        complement(410438..410671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0432"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="InterPro IPR005243; KEGG: sun:SUN_1418 redox-active
FT                   disulfide protein 2; SPTR: A0B707 Redox-active disulfide
FT                   protein 2; TIGRFAM: redox-active disulfide protein 2;
FT                   TIGRFAM: small redox-active disulfide protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08481"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUW9"
FT                   /protein_id="ADN08481.1"
FT                   /translation="MKIEILGTGCTKCKTLEEVVKQAVAKSGKFVQIEKVDDIMKIMEY
FT                   NVVSTPGLVIDGQVVSTGKVLTVDEVLKLING"
FT   gene            complement(410673..411092)
FT                   /locus_tag="Saut_0433"
FT   CDS_pept        complement(410673..411092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0433"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="COGs: COG0394 Protein-tyrosine-phosphatase; InterPro
FT                   IPR000106:IPR017867; KEGG: sun:SUN_1381 protein tyrosine
FT                   phosphatase; PFAM: Protein-tyrosine phosphatase, low
FT                   molecular weight; SMART: Protein-tyrosine phosphatase, low
FT                   molecular weight; SPTR: B3RU39 Putative uncharacterized
FT                   protein; PFAM: Low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08482"
FT                   /db_xref="GOA:E0UUX0"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUX0"
FT                   /protein_id="ADN08482.1"
FT                   /translation="MSQKKEVLILCTGNSCRSIMAEALVNAKIGDCVHAQSSGVKASGK
FT                   VNPHAQALLEKKGYWRDEYHSKVIETILDTPFDLVVTVCDAAKETCPMFPKAVKTIHIG
FT                   FEDPSGKAEQEYEKTLDLLEKELLPIIKKELCEEK"
FT   gene            complement(411089..411412)
FT                   /locus_tag="Saut_0434"
FT   CDS_pept        complement(411089..411412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0434"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845; KEGG: sun:SUN_1382 ArsR family
FT                   transcriptional regulator; PFAM: regulatory protein ArsR;
FT                   SMART: regulatory protein ArsR; SPTR: P96677 HTH-type
FT                   transcriptional repressor aseR; PFAM: Bacterial regulatory
FT                   protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08483"
FT                   /db_xref="GOA:E0UUX1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUX1"
FT                   /protein_id="ADN08483.1"
FT                   /translation="MEIFLKTVSALNDETRVLLLRFLDEYGECCVCDLQDSLDMIQSRL
FT                   SRHLKILKEAGFLRVERKGTWAYYAIRSPLDRFRTEALEEIRHLDIQLPPIKKSSQNGE
FT                   CKI"
FT   gene            411526..412788
FT                   /locus_tag="Saut_0435"
FT   CDS_pept        411526..412788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0435"
FT                   /product="arsenite efflux membrane protein ArsB"
FT                   /note="COGs: COG1055 Na+/H+ antiporter NhaD and related
FT                   arsenite permease; InterPro IPR000802:IPR004680; KEGG:
FT                   sun:SUN_1383 arsenic efflux pump protein; PFAM: Arsenical
FT                   pump membrane protein; Citrate transporter; SPTR: Q01255
FT                   Arsenical pump membrane protein; PFAM: Arsenical pump
FT                   membrane protein; TIGRFAM: arsenical pump membrane protein;
FT                   (TC 3.A.4.1.1; TC 2.A.45.1.1)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08484"
FT                   /db_xref="GOA:E0UUX2"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUX2"
FT                   /protein_id="ADN08484.1"
FT                   /translation="MALAFGLFLVTLVFIIWQPKGLQIGTTAVIGAIVAIVLGIVSFDD
FT                   VITVIDIVWDATLAFIGIIILSMVLDEIGFFEWAAIKMARLSGGSGNKMFVYILLLGAV
FT                   VAAFFANDGAALILTPILLAKMKYLKMKPLPIFAFLMAGGFIGDAASNPLVISNLTNIV
FT                   TVGYFDIGFVEYAKNMFLPNLLSIMASIAILWVYFRKDIPLHVNVDELPQAASVIKNQT
FT                   MFKFSWGFLALLMGGYFIGDRLHLPVSVFALGGALLFLAIANHYKAVKPIMTIKAAPWQ
FT                   VVWFSIGLYVVVYGLKNAGLTDIIASWIELLIAQGEVAAVIGTGFLSALISSIMNNMPT
FT                   IMIMDIAIDKVGYAGHEALVYANILGSNLGPKMTPIGSLATLLWLHVLAQKGVKIGWGE
FT                   YMKVGLVVTPPVLFIALLGLI"
FT   gene            412814..413785
FT                   /locus_tag="Saut_0436"
FT   CDS_pept        412814..413785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0436"
FT                   /product="Protein of unknown function DUF2219"
FT                   /note="COGs: COG3528 conserved hypothetical protein;
FT                   InterPro IPR018707; KEGG: abo:ABO_0138 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2219; SPTR:
FT                   A3UGG3 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2219)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08485"
FT                   /db_xref="InterPro:IPR018707"
FT                   /db_xref="InterPro:IPR037107"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUX3"
FT                   /protein_id="ADN08485.1"
FT                   /translation="MKIKLLALSLLLFISLRADEYSFVVYNDFFAGEDGHFTNGVSLSW
FT                   LEDNEENSYTNFLTASLGTLSFPLENSKNYNAGLSINQIILTPINTEKATPQYNDLPYA
FT                   GYLSLATYLFEWDSYSFNEYSIEIGVVGKESGAEYVQNKFHKIIGNDESKGWNTQLGTR
FT                   YTFNLFFHHGVKPWQGKIGQNLQADWFYHYGATLGTFDVSGFGGTAFRIGQNYVHNFNS
FT                   HYPYLKEEAGLVSVDGLKQGFGWSVSAGADGEYLAYSYVFNKAKNDGYAVHIEGLSAVA
FT                   NLSASLYYNHHKFRFFYEIPSHYIKEERGVNIFGGFMYSYKF"
FT   sig_peptide     412814..412867
FT                   /locus_tag="Saut_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            413861..414490
FT                   /locus_tag="Saut_0437"
FT   CDS_pept        413861..414490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0437"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647; KEGG: sun:SUN_1429 TetR family transcriptional
FT                   regulator; PFAM: regulatory protein TetR; SPTR: Q8TK36
FT                   Transcriptional regulator, TetR family; PFAM: Bacterial
FT                   regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08486"
FT                   /db_xref="GOA:E0UUX4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUX4"
FT                   /protein_id="ADN08486.1"
FT                   /translation="MAKQKRDAEATKAKILTSAIALFSKNGFDATTADDIAKESQVNKA
FT                   LIYYYFKNKAGLYETVMSSLFNSIYEEVIKAEKCCDSITSELHAFIETYANYAQKHPYF
FT                   PALLLRELSDSGAHLPEMMFASMRRLFLLLSDILRRGEAEGVFKKSIPMVLHFMIIGSL
FT                   NLLVTTQPLRKQAAQMDSEVDTCSECPMDEIAEYIFNTVKAALEVN"
FT   gene            414491..415762
FT                   /locus_tag="Saut_0438"
FT   CDS_pept        414491..415762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1538 Outer membrane protein; KEGG:
FT                   sun:SUN_1428 hypothetical protein; PFAM: Outer membrane
FT                   efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08487"
FT                   /db_xref="GOA:E0UUX5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUX5"
FT                   /protein_id="ADN08487.1"
FT                   /translation="MKKIILSLAVPFVMYAQNLSQLFDALKVHSQTKSDEIAVQKSEVQ
FT                   QDLVYANLYPKVNLFGSFDNYSSPTNMKPIAPNVLKPMLSDQSIAQPYSYNIYKTGANF
FT                   TMPIFVKFIYTAADKAKALQKSAKAKKHINLLKNEALIVGANANYLYLDSLLKALHVKE
FT                   ESLQETQKTTQIKVDNGRAPESALYKINDALNQVAIAKNNIQLEKKKLISTIQTLTGIV
FT                   LDKPVSMHELASFSKGQMGALQPLQDKLRADRLGIKAEKEKLYPTLVAHGNYAFSKATA
FT                   YNNDKDVNEEYGNVGVVLNIPLLAMDSYASIKLSQIELRAGEIELAKLSDELTAQAKML
FT                   EDSLELLKNSQKLYVHSVEDKKKLLEIAKVNYNSGRLSTEEYLRYEDDVVSQEANLYKI
FT                   EATRWQTLMQLAVIYANNIEEMVQ"
FT   sig_peptide     414491..414544
FT                   /locus_tag="Saut_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            415759..416808
FT                   /locus_tag="Saut_0439"
FT   CDS_pept        415759..416808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0439"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COGs: COG0845 Membrane-fusion protein; InterPro
FT                   IPR006143; KEGG: sun:SUN_1427 hypothetical protein; SPTR:
FT                   A1HLV3 Efflux transporter, RND family, MFP subunit;
FT                   TIGRFAM: efflux transporter, RND family, MFP subunit; PFAM:
FT                   HlyD family secretion protein; TIGRFAM: RND family efflux
FT                   transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08488"
FT                   /db_xref="GOA:E0UUX6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUX6"
FT                   /protein_id="ADN08488.1"
FT                   /translation="MSKIVKIGLGVVVTVALVVGGVKAVKNAQAKDKATPKAKIYPVVV
FT                   SKMNPKMSQVQLTLPYLAEVANDKDVKLSARIAARIMKIMPSGSRVKKGDLLIKLDTTS
FT                   IESSLSSVKEQLHSAQITLQNLERTHGRTLDLLKVKGASIEESQKEESMIASAQAALNA
FT                   LKQKEIELRNNLSYATITSPVDGVIAKTFANQGAISAPGKPLVAISSKNGFFLLVRVPS
FT                   DLPIKGVEFSGKKYDATALGSTFNGLSEYKVYTGNTNLTSGDRVEVNVLVFNAKAILLP
FT                   FDALLNRNGKSYVLVISGNKANAEEVHIIQSAQQGVVVSDNLEGKNIVVAKPDILLKLT
FT                   SGYSLKVKD"
FT   sig_peptide     415759..415830
FT                   /locus_tag="Saut_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            416812..419919
FT                   /locus_tag="Saut_0440"
FT   CDS_pept        416812..419919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0440"
FT                   /product="acriflavin resistance protein"
FT                   /note="COGs: COG0841 Cation/multidrug efflux pump; InterPro
FT                   IPR001036:IPR001760; KEGG: sun:SUN_1426 RND family
FT                   multidrug efflux transporter; PFAM: acriflavin resistance
FT                   protein; SPTR: A3VAG3 Putative uncharacterized protein;
FT                   PFAM: AcrB/AcrD/AcrF family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08489"
FT                   /db_xref="GOA:E0UUX7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUX7"
FT                   /protein_id="ADN08489.1"
FT                   /translation="MFEFFYKRPYLLYSIIAAFFIMGIIALITLPKNLFPDANPPQVIV
FT                   ITQVPGATAQVAASTVSKPIEQEISRLGLVTDVSSVNVAGFSIVKADFGYKKGLNAAAV
FT                   DVANALSIAKAKLPAGVNPAIYTAGDFTLPVDVIALSPKNTNVNLADIRKIADSFIKPH
FT                   LLSNKTIGNVEVFGGYQSAINIEVDPFKAKRYGVNFETITKAINTLNRDIPIGFIKGDN
FT                   DFYTVTFYGEKDNIEKLNQLQIMPNVRLSDIADVKWGYKKRTSGYMGNGKDAIALAIQR
FT                   APGGSVLDVSKAARKELAKLKQEYPNIKFEISDTQRDLIEQANDNMLEALRDAVIYTLL
FT                   VIMLFLGNFRAIIAAGLSIPMVFFSTMAIIWLTGGELNIVIYTAIILALGMLTDDAVVV
FT                   LENIERHLNEGHEKLEDAITHGTKEVLSPVFAGTAATIAILFPLMFVGGFPEKIFKPLI
FT                   ETLIIALLVSYFLSITFIPSLSKWLYKNGVGKTKIEGYFEWFYQNTIGRLVAPYVGIIK
FT                   FSNGKWWFVRRMLLTIGVIAVLLVSMKNIMPTIGKDAMPPMDTGIIKAQIAFSSNETVD
FT                   SAQKKIQPVLDWLKTQKWVKMSSVAFGTEPGVLSLGSGNLPSEATITINAVNRFERKQT
FT                   MWELENIIRDKLAKVEGLKRNDVFDFGATALSSIKATVDVRLSSPVIDGLTDNAHKVAN
FT                   AIQNVHGLTSVSTSWDKDFMEVELDIDENKALSYGVTPYQIAMQIPIKGQIVGLNANLE
FT                   SMNTQFVRLYLKGKFSKNIETLRLLPIATPRGEIPLSQIATLKRHLTFAKIERDKMLYS
FT                   VDVNGYRAKRPVTHLTDDTIAALKKANIKDVKIDQTGDIAQINDSFARMLKAIGLGVII
FT                   LLMTLIAIYKSVRMAFVMILVLPLSLIGAAWGMLLFGKPSCMPSLLGILLLFGIIIKNA
FT                   VLLIDFYQSYRAEGERPFESAIESVRVRFRPVMMTAFGTIAGMIPIALEQAVGLERLSP
FT                   LADVAIGGLLIGTLLTLIYVPMYAYIFDKDNKKTNPINKAEEALLS"
FT   gene            419932..420243
FT                   /locus_tag="Saut_0441"
FT   CDS_pept        419932..420243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_1405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08490"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUX8"
FT                   /protein_id="ADN08490.1"
FT                   /translation="MQEIACHTMNEGEILNESHPEYPLYEGVLYGDRVSTAKFSKRLSC
FT                   SIKHLPLRLKFHYEYDTLKAIENGVTKSPTLILNGDIFLEGLTQAEEITKAFEQLSKQ"
FT   gene            420351..420812
FT                   /locus_tag="Saut_0442"
FT   CDS_pept        420351..420812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0442"
FT                   /product="N-terminal methylation"
FT                   /note="InterPro IPR012902; KEGG: nam:NAMH_1368 N-terminal
FT                   methylation; SPTR: A3GZ54 Type IV pilin, putative; PFAM:
FT                   Prokaryotic N-terminal methylation motif; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08491"
FT                   /db_xref="GOA:E0UUX9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUX9"
FT                   /protein_id="ADN08491.1"
FT                   /translation="MKRDGFTLIELIFVIVIIGVLAAVAVPKFTNLKQSAEARNMIKIV
FT                   KDAETAVPSAAANMSDLENNTSYSLNDILTLTGKNIVLVDTNNTYDLNNTANNATIASV
FT                   KFSRANREVNTSIDCDAFVDTKSQDKCADELGTTKSGNTTPEYTAHITY"
FT   sig_peptide     420351..420425
FT                   /locus_tag="Saut_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            420817..421293
FT                   /locus_tag="Saut_0443"
FT   CDS_pept        420817..421293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0443"
FT                   /product="fimbrial protein"
FT                   /note="InterPro IPR012902; KEGG: nis:NIS_1561 fimbrial
FT                   protein; SPTR: P02973 Fimbrial protein; PFAM: Prokaryotic
FT                   N-terminal methylation motif; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08492"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUY0"
FT                   /protein_id="ADN08492.1"
FT                   /translation="MKKAFTLIELIFVLVIIGVLAAVAIPKFGGLIANSKVSAELATAS
FT                   TIQSALDDVHSDWIISEGSFSWGNDKNESDINSQGYPKKLGNCPPAFDWILKSSSIVNA
FT                   KWTCVDNGDGTFKYEGPASQADSGVNSIKEGKPDKSKHWDYNSSDGSFSLVSDS"
FT   sig_peptide     420817..420888
FT                   /locus_tag="Saut_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(421290..421388)
FT                   /locus_tag="Saut_0444"
FT   CDS_pept        complement(421290..421388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08493"
FT                   /db_xref="GOA:E0UUY1"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUY1"
FT                   /protein_id="ADN08493.1"
FT                   /translation="MNIENSGSIVIAIVSALILGFALWIVKRMSNL"
FT   gene            complement(421399..422637)
FT                   /locus_tag="Saut_0445"
FT   CDS_pept        complement(421399..422637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0445"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR003004:IPR018076:IPR000209; KEGG:
FT                   nis:NIS_1562 general secretory pathway protein F; PFAM:
FT                   Type II secretion system F domain; SPTR: A3WP72 Type II
FT                   secretory pathway; PFAM: Bacterial type II secretion system
FT                   protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08494"
FT                   /db_xref="GOA:E0UUY2"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUY2"
FT                   /protein_id="ADN08494.1"
FT                   /translation="MKYFRINYKIGKKKDSIVLEAENKISAMQNFYEMKIGVLIRIQEI
FT                   SKPLKIAFGQYVNKFKNPIKNKKVDTEKLIAILDQIAIMLDAGLPLNYVLAEAVKNQND
FT                   EMIKAIFTKINNDIEGGKSLYNSAITFKEQLGFITLSMFKLGEETGRLSESVSHLTSIL
FT                   QNIIDNRKKFQKATRYPLIIIFAMGIAFSVVIIFVVPQFKSFFQQSNMELPLPTQFLLW
FT                   IEHALIVYGPYIIVSAVILSIFINILYKRSEKVRLYLDKLMLKIYILGKATLNAMISRF
FT                   MYVFQVLVDAGIPMLEALNIASDIIENSYLKEKIKRISTSIEEGKSLYQGFEKTEVFEN
FT                   MIVEMIKAGEIGGGLDKMLNKITKIYKDRFDYIVDNIATLIEPILIAAIAGFVMVLALG
FT                   IFLPMWNMVDLAK"
FT   gene            complement(422640..424319)
FT                   /locus_tag="Saut_0446"
FT   CDS_pept        complement(422640..424319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0446"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG2804 Type II secretory pathway ATPase
FT                   PulE/Tfp pilus assembly pathway ATPase PilB; InterPro
FT                   IPR001482:IPR007831:IPR003593; KEGG: nis:NIS_1563 general
FT                   secretory pathway protein E; PFAM: type II secretion system
FT                   protein E; General secretory system II protein E domain
FT                   protein; SMART: AAA ATPase; SPTR: A1HQ24 General secretory
FT                   pathway protein E; PFAM: Type II/IV secretion system
FT                   protein; GSPII_E N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08495"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUY3"
FT                   /protein_id="ADN08495.1"
FT                   /translation="MIQRKVRLGDILIKNDFITKDQLNEALKKQKELNYTKKLGEIFIA
FT                   EGYVTQRDLLKTLSKQLDIDFVDLYGENINFNAIATKYPLHILQAAQAIPFKEDEDFVY
FT                   IATSDPLNYDALEALERTISIKPVKIYLAYSDDIHVIFHRIKILQTTREIISEVKKELT
FT                   TQGLKKEDENSAIMKLILFIAKEAINKRASDIHIEPDEKEMIVRSRIDGILHENFVFDS
FT                   EIYNALSSRIKLLGNLDISEKRIPQDGRFSLVINEKNYDFRLSTTPTIFGESIVMRILD
FT                   RDKVLLKLEDLGFEDENLDNFMDFIHSPNGIVLITGPTGSGKTTTLYAALNEIKNISNK
FT                   VMTAEDPVEYRLPLVQQIQINEKTGLTFSLAVRSFLRQDPDIILIGEVRDFETLNSASQ
FT                   AALTGHLVFTTLHTNDAPGAIPRMIQMGLKPYLIADALVGIVGQRLVRKICPYCKNEIK
FT                   LTKAQLSKIEKYLSNPEIKFYTGQGCSKCDFTGYFNRTMISEILTIDTVLAKMISENAN
FT                   KIAIIEYAESNGLYKPMIADGIKKALKGITTVEEVLRITKDR"
FT   gene            complement(424316..425245)
FT                   /locus_tag="Saut_0447"
FT   CDS_pept        complement(424316..425245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1564 hypothetical protein; SPTR:
FT                   Q7RBY6 Putative uncharacterized protein PY06000"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08496"
FT                   /db_xref="GOA:E0UUY4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUY4"
FT                   /protein_id="ADN08496.1"
FT                   /translation="MYNFDMLEKKCKIYHLKKYLFAIIPVVVILSASIYIFLSYSDNFK
FT                   TKKTSIVKKDVVIKKDVVIKKDVVMKKKKDKTKENSKSIQHKKKQIIKKNECYYLQFFI
FT                   ARKFNAKYLYKKKEKIEKLGFTCYVHKGKQLLYLRCNKTKNYNEFLHSKKLADKNNLEY
FT                   IIKKVICTNKEPKVIQAKKTFKKPKAIVKQKTIVKQNKKIEKNNFVLKSQKYNIENLKK
FT                   LFQERKSYNIALKLAQHYYHIQDYKNAVKWSKTANSIDKTDDKSWIIYAKSLYILGDKK
FT                   KAKKILTIYSQFENSSEVNKILSKWNNK"
FT   gene            complement(425238..426029)
FT                   /locus_tag="Saut_0448"
FT   CDS_pept        complement(425238..426029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_1565 hypothetical protein; PFAM: RNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08497"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUY5"
FT                   /protein_id="ADN08497.1"
FT                   /translation="MDYLEISRIFEEKSQEMNFFESFETMHLKNNLLNIFKNDTKQLIF
FT                   LIGEPGVGKSAFVNHLENENNENINIIKFDIPFLEPVDFIKTLIKKSKEEVKDFSIEGL
FT                   IKQVVSIYKNSNYVVIIDEAQLLSKDMIEVIRILADSKAFWFILVMHKHESKNILNAPQ
FT                   FSSRPHKILELNHLQKNEYKDYIYLKLKDINKPYLLEELSFKYLNFIYKNTKGNFREFK
FT                   KMLHTAFLLLNYAQNNHKHKYQKLSKCILTMAAIEGGLIDV"
FT   gene            complement(426031..427545)
FT                   /locus_tag="Saut_0449"
FT   CDS_pept        complement(426031..427545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0449"
FT                   /product="type II and III secretion system protein"
FT                   /note="COGs: COG1450 Type II secretory pathway component
FT                   PulD; InterPro IPR003522:IPR001775:IPR004846; KEGG:
FT                   nis:NIS_1566 general secretory pathway protein D; PFAM:
FT                   type II and III secretion system protein; SPTR: A3UZA6 MSHA
FT                   biogenesis protein MshL; PFAM: Secretin N-terminal domain;
FT                   Bacterial type II and III secretion system protein;
FT                   TIGRFAM: pilus (MSHA type) biogenesis protein MshL"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08498"
FT                   /db_xref="GOA:E0UUY6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUY6"
FT                   /protein_id="ADN08498.1"
FT                   /translation="MKYIFIFFIFTRILTANTNNCDEHLFSLSAYDKGSKSLKISNVLK
FT                   ELSQKCNISIFFKDKESKQKINKSLDYVNIKDYTLESFLNFLFNEANLFYTYDREKHFI
FT                   NVQYMKTKTFNIDYINVSELTSESSKSINSGSGSSSGINTTTNNTTTNNTNNTNNTNNS
FT                   SGNSSSNDQTTIVTKSKFTFWDNLKNNLTKLFLDPKNVNMFINRDASLLTVNADKKDLQ
FT                   KIQNFLDLLMKRMHKQVLIEVKLIELVYDDSHSSGIDWSQLNVSLNGTLGGTQGTGGNT
FT                   FNNSYSIAYNFSTSNFFKYLNTFGDVKVMSNPKILTMNNQPAVVNVGQQLSYKYQTGSV
FT                   TTTGGTAAGTNTFSLGSTFIGITLYVIPEITDSNEILMSINPVVSSLSADNTPTTSIRE
FT                   IPPDTKIKQMTSVVKVKNGQKVLIGGLISATKGKDSKKIPILGDIPILSTIFRYTNNKK
FT                   SRTEMFILITPKIVKNSSMPTIDDIDDDKFFSTSKYKLDFNSSKVK"
FT   sig_peptide     complement(427498..427545)
FT                   /locus_tag="Saut_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(427542..427889)
FT                   /locus_tag="Saut_0450"
FT   CDS_pept        complement(427542..427889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08499"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUY7"
FT                   /protein_id="ADN08499.1"
FT                   /translation="MKKFIAFLFILSSIAGAKSLNIIHYDPFKKAKILLNTHSAKKLFS
FT                   TPKRILSINAILNKKVYINGRFYRVGEVVYGYKIINIADNYIQVKKKGKISIIPLIKSN
FT                   NLDIIKLKDQG"
FT   sig_peptide     complement(427839..427889)
FT                   /locus_tag="Saut_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(427886..428506)
FT                   /locus_tag="Saut_0451"
FT   CDS_pept        complement(427886..428506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08500"
FT                   /db_xref="GOA:E0UUY8"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUY8"
FT                   /protein_id="ADN08500.1"
FT                   /translation="MREKIDLFEEKFQSLNKNEKTALLIFIPFAVIILFYFLYISNAID
FT                   EKKSNDMKLTKINHDLNKYSVKKILNKIQSSKQEILQVKSKIAEDEQKLKYLDSALSKS
FT                   HFLFLSQKDFNIFLNNLLAKSVKNNILLDDVNISKKDDDFIGKLKYKKNVKVTGHGEFL
FT                   NVLSFIRKVEENSMLMQIKNLSIETDGTVPYVSYDINFYGIKK"
FT   gene            complement(428503..429981)
FT                   /locus_tag="Saut_0452"
FT   CDS_pept        complement(428503..429981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_1569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08501"
FT                   /db_xref="GOA:E0UUY9"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUY9"
FT                   /protein_id="ADN08501.1"
FT                   /translation="MSSDNIIFLYNQKAIIYDGYNIQSADFKDSKKYFTAAIIPLKYLN
FT                   TFSYKIANTTNDDEIAIQTEIKMYSEGGLNADKEYVVDYIKYDIGSDYLVEAFALSKEH
FT                   FDEYFGEYTKKVAAIDMVFPQFLVYQSLYDNKLDKQSNDLIIYISETESFAALYQNGRY
FT                   IGHRILSSLSDISKKTGIEIVKLKEYLQTKGLIQSNYTMDETHILDSIQSILFKDIEKI
FT                   MYSINHKRSLFGFDALDKVFIDFNNHNILGLEQLFVPYGYDSLTINTFDFKEDEKFGNI
FT                   FLYVDYLYKLNSMAKEDNNYQHLNFSFLERRKPIFEYLLVKYSFVFAFSVIICLIIYTY
FT                   IEILLFQQQSEINQKQTALKEEKAKYLKFEKKLQKIKKEYTDLHKKQNKIEDSIFVYEN
FT                   TINTIPLIQNAKYKRQKFMNDVILALAKFKLNTQFIKQHNDKTMDIMLISNSKNRENIA
FT                   KFINELLKKQYHNVSTKQIYLDKTIYKSLIRIEL"
FT   gene            complement(430053..430520)
FT                   /locus_tag="Saut_0453"
FT   CDS_pept        complement(430053..430520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0453"
FT                   /product="N-terminal methylation motif domain protein"
FT                   /note="InterPro IPR012902; KEGG: nam:NAMH_1378 prokaryotic
FT                   N-terminal methylation motif domain protein; PFAM:
FT                   Prokaryotic N-terminal methylation motif; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08502"
FT                   /db_xref="GOA:E0UUZ0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUZ0"
FT                   /protein_id="ADN08502.1"
FT                   /translation="MKKQAFSLLELIFVIIIIGILSGVAISSFKPHHLRDDTNFVLMKL
FT                   EETRYKAIGYNKSLPSSDINYSIGCISVDTLSKTDTQAYKFYSYFDLSSSSAINVICFD
FT                   ALGRVHDGDIDNNQTTLDSLQNNEIHLTYTYQNKISVLKIDSLSGNIHRVN"
FT   gene            complement(430517..430990)
FT                   /locus_tag="Saut_0454"
FT   CDS_pept        complement(430517..430990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_1570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08503"
FT                   /db_xref="GOA:E0UUZ1"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUZ1"
FT                   /protein_id="ADN08503.1"
FT                   /translation="MRKAFNLIMAIGMILILSGAAIMTLKYVSISAKHITDSYIKEQAE
FT                   IFSQSVLEATILKIEGYDRSSNHDCIDLLNFNSSDGRFKADVNITHYYLYNGKDNDGND
FT                   TLPNCNSNIVSINTNESHGYVIIETIITTNNNNVKIKGYVTPVRIVRRSLQRP"
FT   sig_peptide     complement(430931..430990)
FT                   /locus_tag="Saut_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(430987..431940)
FT                   /locus_tag="Saut_0455"
FT   CDS_pept        complement(430987..431940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: nis:NIS_1571 hypothetical
FT                   protein; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08504"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUZ2"
FT                   /protein_id="ADN08504.1"
FT                   /translation="MKRNAATLLELIFVLIIISFLSTATYKGLQAIMIRSYKAKEITKL
FT                   SLESQIAVNQLSNYLSSRVPYTTIGYDTESDKFQYIGDLTDNKPILEWIGTAHESFTKG
FT                   DYSEFIDMSTLDTANATLSSKNSDGDKISDSTKAKFHISNDIYAEKIVNLIFAGSFDRA
FT                   SSNINDYNSSFGWHGHNSIETYDITIDNNGLITINDTKKPKFIYEKYFLVDTAYAVARG
FT                   TDINTSSSCISDLNISTQKLNNTLFLFSNYRPWKGETFCADKNGNNKDGNVSILMQNVD
FT                   GFKFEELDYTIRINLDINKAIRGASPIHFSKMKVVF"
FT   gene            complement(431937..432566)
FT                   /locus_tag="Saut_0456"
FT   CDS_pept        complement(431937..432566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: nis:NIS_1572 hypothetical
FT                   protein; PFAM: Prokaryotic N-terminal methylation motif;
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08505"
FT                   /db_xref="GOA:E0UUZ3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUZ3"
FT                   /protein_id="ADN08505.1"
FT                   /translation="MIKKNAFTLIELILSMVIIAIAFTVLPKILQLSAKVSVQNLKGEA
FT                   MYNAIAYIGLIKSTAWDEENIKYNDILLVANGDSDYDCNTTTTYRIGGFDGSRNCKNAK
FT                   NASSLGSDSNESYNNDMDDFDTINATNNTNSRAYDLNVSVDYLEDIAENGNTFSSTTKS
FT                   NTTNTKRITIKVDVKKKASALGNSFVQMSFIAQNIGQFQINKRVWN"
FT   sig_peptide     complement(432501..432566)
FT                   /locus_tag="Saut_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(432563..436762)
FT                   /locus_tag="Saut_0457"
FT   CDS_pept        complement(432563..436762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1573 hypothetical protein; SPTR:
FT                   B4YQD3 Sporozoite asparagine-rich protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08506"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUZ4"
FT                   /protein_id="ADN08506.1"
FT                   /translation="MIKIIFIFFIFVNVLFAKTLVVDNTPSFLGYFNCEGFSFSNNYVS
FT                   IQDAVNNAQNGNTIKICKGDYNEAVIIDGLKNLIITNGADASSPTDVNWYSNTYTLTIG
FT                   SNNSSENTIIKNISLKETSSNANYYALRLLKGKIITLNNVILKTEAGSAIYGDWNFDGE
FT                   GIYKNLTINSKANGIYINKGTKQTFEDINITIDGNNANYFGIFLGDNIKNENHIFKNLN
FT                   FNVKKQSAIFVKHSKNITFENIDIKATDYDSDYKTALYLDWGIDSNAQFTFKNVNIDLN
FT                   KGEGINVKKADDINFDTLSINGSSGYGIFLDSSIKGKLTFTHLSLKANQEYGIYIKNGN
FT                   DLNMEDANITGISGTGYILFCDWGMQGNYTFKDVNSSTSSYGFIIRKSNDITFDNLTLK
FT                   GNSPNENYWGIYGDANVNGTVSIKNSDINVTGIALELKNGKPNIEKSKIVSQKNHTIFF
FT                   DTNTNNIQIKDSCFYKNNDSSFYDLYVHNWETNAKVNNNCIYGAPKENLARTEKNGNDY
FT                   KGNFWEGVSGDYNYNHVFDNQTLSSCPNSCSGETPSLTPIINYHMDECSWDSGSNTYEI
FT                   KNFGSLENDYNASALNNADTIEDGKIYRAGDINSTASDDKAIISKTDLSLPHKYTLTTW
FT                   IKFPLNTNGHKIFRSGRKRVQYFNIADRTGSNKDFIYFTKDIRRNKWTLNIDDDHDSKS
FT                   MNFNPQNLSGWYMLTFVITNNGTDFYLDTNKEHTFTTHPNRGNLGLLFNSDYNSNDNVT
FT                   NAQSIGASVDEFKIFDKALSNSQIQTIYGNENNGKNYDGSDRTAPECGGTQPPIRNYQF
FT                   DARDIFRGEDDRNISTKIVSREFQLTLMSLDENGTKQDFNGTVCAKVESTSGYAGDYNK
FT                   TIWSDNKEKNASFTVIRAIGGGVNATLYIKWFKNIQDAECMSSIDSNDTNATDNFTIRP
FT                   DRFIIYPPSTQIYAGEDFNISYAAKVYGSDANASDYNESNGSSFHLHVNEINTNCINGD
FT                   FNGSINFNDGNVTVTSNYNEVGKIDLNITDRDITCTNRFAGIDCKDQNISGHWNTDTDT
FT                   RIDENATRLTVLPHHFKIDSILYNFDENNEFTYISQDLNMSTRLDLNVTAQNKQNEAAK
FT                   NYNKNCYAKNIDINISHSSIGDGNLSKILYIYQDDSDLNSSLNIVNKNVDINITSYPKE
FT                   NFTTDHNGSTLLKVFINFDRNYSKTVNPFDFNITDVNVSDENISLSNAATDGNATFYFA
FT                   RTYTQDLATSQTDDNVSAEILVYDSADNDYVDGFKEELLDWYLINKHTTQNDGNISDSN
FT                   ISSSTDKTDSVESADFNTSVTFKGNGVFDISVHNAGKNEGTYFIHLGVDKWLWYAPQNF
FT                   GNTYDYSAGSNCTQHPCIKYNYEKKSEGNAVTSGNTTGVHFDANVSKNSRGVRLLR"
FT   sig_peptide     complement(436712..436762)
FT                   /locus_tag="Saut_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            436895..437122
FT                   /locus_tag="Saut_0458"
FT   CDS_pept        436895..437122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR020441; KEGG: nis:NIS_1622 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08507"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUZ5"
FT                   /protein_id="ADN08507.1"
FT                   /translation="MVEFLKKAMDWVLEKEQEAAKKCYVNPADVQKQIEILEAKRAQLR
FT                   KKFEEEDAEFGHVLSRLSLIKVNASKCETK"
FT   gene            437097..438044
FT                   /locus_tag="Saut_0459"
FT   CDS_pept        437097..438044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_1032 hypothetical protein; PFAM:
FT                   Protein of unknown function (DUF540)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08508"
FT                   /db_xref="GOA:E0UUZ6"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUZ6"
FT                   /protein_id="ADN08508.1"
FT                   /translation="MQVNVKQNKMQNILEAIFFGFSGILNYKTMKLALAIGAVVTIIWS
FT                   VIGYFVWDDLVSFAAYFIDLVPFSMLRANGAWILSSFLWFSLVLVTFALVLAFFGNMIL
FT                   ERVSKEKYSSFSLLVVFVSAAFWSLIWFFKGSYIHVQFLKLLNWLPFETVEASLSYLMG
FT                   LYFIYSAIIVTMLLVTSFFSQTLLEDIRDKNFPYEPLLEEDEVKVSENRLLDILIYAII
FT                   SIIAFPLLFIPILNFVLQLGLWIWLIKDTFVNDSAALVIPKEKRAKLSEYKGGFLTISV
FT                   VTSLFNFLPVFNIFGPFFGEIAMFYYLKGIQKEL"
FT   gene            complement(438227..439786)
FT                   /locus_tag="Saut_0460"
FT   CDS_pept        complement(438227..439786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0460"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro
FT                   IPR000160:IPR013767:IPR001610:IPR000014:IPR 000700; KEGG:
FT                   aeh:Mlg_2511 diguanylate cyclase with PAS/PAC sensor; PFAM:
FT                   GGDEF domain containing protein; PAS fold domain protein;
FT                   SMART: GGDEF domain containing protein; PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   SPTR: A3JA35 Sensory box/GGDEF domain protein; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box; diguanylate
FT                   cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08509"
FT                   /db_xref="GOA:E0UUZ7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUZ7"
FT                   /protein_id="ADN08509.1"
FT                   /translation="MVYIYFIYGLSFFSFGLAVLLYPKMSAFIKLSAHFWLIGVFGIIH
FT                   GISEWIDMFAYIEQTKTPVVEMASFVILPLSFLFLLYFGLISLSEQKKVSYTHIKFVVG
FT                   TLLLMFAVFSFQSDNLYLEGNVWARYLFGIPGIFLTSYVLFMQKDAQGIETLISAKVYL
FT                   FILSFSFFFYGIFAGIVVPKAPILMASIINYTTFQEYFGVPVQVFRSFCGVVSAFAAIA
FT                   LFQLLRQRTEMDMLKLSSAIEHSGDSVVITDRNGVIEYVNSAFEQQTGFTKKEAIGKKS
FT                   NIVKSGRHSIDFYRNELWATILSKNIFRSYMLNKKKNGELYHEYKAIAPIVDAKGNISY
FT                   FVSTGKDVTEQMLLEEKLRELAAIDKLTGISNRLRFDEVLQFSIDRAKRYKVNLSVILF
FT                   DVDKFKKVNDTYGHLCGDDVLKMIAKIGHDSIRKSDLIARWGGDEFIILQSNIPSDEAQ
FT                   ILVERLRHNIESYNFKDVGKVTVSFGVTHFKEDDTKESLIKRADDALYEAKEHGRNRVE
FT                   VK"
FT   gene            440112..442526
FT                   /locus_tag="Saut_0461"
FT   CDS_pept        440112..442526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0461"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="COGs: COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase; InterPro
FT                   IPR008279:IPR002192:IPR000121:IPR018274:IPR 006319; KEGG:
FT                   sun:SUN_1214 phosphoenolpyruvate synthase; PFAM: pyruvate
FT                   phosphate dikinase PEP/pyruvate-binding; PEP-utilising
FT                   protein mobile region; PEP-utilizing protein; SPTR: Q12XS1
FT                   Phosphoenolpyruvate synthase; TIGRFAM: phosphoenolpyruvate
FT                   synthase; PFAM: PEP-utilising enzyme, TIM barrel domain;
FT                   PEP-utilising enzyme, mobile domain; Pyruvate phosphate
FT                   dikinase, PEP/pyruvate binding domain; TIGRFAM:
FT                   phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08510"
FT                   /db_xref="GOA:E0UUZ8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUZ8"
FT                   /protein_id="ADN08510.1"
FT                   /translation="MSQNIKWFNEIGIEDVAEVGGKNASLGEMYQNLTQEGVRVPNGFA
FT                   VTSSAYIHLLDANNTWEKLHAQLDNLDVNNVDALQSAGKKCREIVYNAKLPDDLREDIL
FT                   QAYKKLKEEYGESLSLAVRSSATAEDSPEASFAGQNDTYLHISNADELLDAYKRCLASN
FT                   FTDRSIHYKYDNSFDYLKVYLSVVVMKMVRSDIGASGVMFSLDTETGFKDVAFINAAFG
FT                   LGENVVQGTINPDAFYVHKPTYNKGFKTVLKRSLGSKEKKMIFTDTINLDNIAVEYTKN
FT                   IPTTPEEQSHFCITDEEVIVLAGYAVKVENHYSQKAGFHKPMDMEWAKDGLDGHLYMVQ
FT                   ARPETVESQKKGNVLETYHLKEKGKVLVTGQAIGTKIGQGKARYIAGVKELNTFEAGEV
FT                   LIADTTNPDWEPIMKIASAIITNKGGRTCHAAILSRELGIPAVVGCDNATDVLQDADKV
FT                   TVSCAEGEEGHVYEGLLEYEVIKTDLSNLPRTKTEIMMNLGNPDIAFSLSSMPVDGIGL
FT                   ARMEFIINEYIKAHPMALKHPQKVDETTRKKLEELTQAYNSMEDFFVKTLSEGVATIAS
FT                   SVYPKPCVVRMSDFKSNEYATLLGGETFELKEDNPMIGFRGASRYAHPNYEEGFALECA
FT                   AMKRVRDEMGFDNVTLMIPFCRRVDEGQRVLDTMAKYGLKQGENGLQIYVMCEIPNNVI
FT                   QIDNFSKLFDGFSIGSNDLTQLTLGVDRDSQIVAFDYDERDEGVKEMIRLAVEGCKRNN
FT                   RHSGICGQAPSDYPEIAEYLVRLGIDSMSLNPDSVLKTIENIGKLEQELGR"
FT   gene            442529..443131
FT                   /locus_tag="Saut_0462"
FT   CDS_pept        442529..443131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_1282 hypothetical protein; SPTR:
FT                   B5IGW6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08511"
FT                   /db_xref="GOA:E0UUZ9"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:E0UUZ9"
FT                   /protein_id="ADN08511.1"
FT                   /translation="MWKWHKNLNIEMNINKNLVDNFKKHAKISGMLFILFGLAGILFPP
FT                   MMSLTTTILVGYLMLFAGVSAGILTYKSNPEDWMGWLKSFVLVLSSLFIVFYPVQGAAA
FT                   LGLVFAIYFFTDAFASFSLAFSLRPQKIWLVWLFNAITSLALGVLFVIGWPMSSLLLIG
FT                   ILVGISLLFDGIALLLGGAFVQDIDDENNEKKNGEEK"
FT   sig_peptide     442529..442678
FT                   /locus_tag="Saut_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            443128..444030
FT                   /locus_tag="Saut_0463"
FT   CDS_pept        443128..444030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0463"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="COGs: COG1830 DhnA-type fructose-1 6-bisphosphate
FT                   aldolase; InterPro IPR002915; KEGG: sun:SUN_1211 aldolase;
FT                   PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PRIAM: Fructose-bisphosphate aldolase; SPTR: Q46G31
FT                   Fructose-bisphosphate aldolase; PFAM: DeoC/LacD family
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08512"
FT                   /db_xref="GOA:E0UV00"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0UV00"
FT                   /protein_id="ADN08512.1"
FT                   /translation="MKYNIPADVDKNRVSQYKKNLKEATNGTNHLMLFAGDQKVEHLNN
FT                   DFYGKDIPLEDNSPEHMFKIASSAKIGVFATQFGLISRYGRDYKNVPYLVKLNSKTNLI
FT                   PYDKQDPYSQSWISVGDVVNFAKESGLDIKGVGYTLYLGGEHEHSMLSEAAKIVHEAHK
FT                   NGLLAVLWIYPKGKFVKDEHDGHLIAGAAGVGAALGADFVKLKVPYDKEGKFDSKLLRE
FT                   ATMAAGRTGMLCEGGAKIDEKVFLTELYAQIHKGGSRGNGTGRNIHQRPLKEAVKMANA
FT                   IYAITSENATVKEALKLLK"
FT   gene            444040..445437
FT                   /locus_tag="Saut_0464"
FT   CDS_pept        444040..445437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0464"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3); InterPro
FT                   IPR013027:IPR000103:IPR000815:IPR001327:IPR
FT                   004099:IPR002218:IPR004792:IPR012999; KEGG: sun:SUN_1210
FT                   pyruvate/2-oxoglutarate dehydrogenase complex, E3
FT                   component, dihydrolipoamide dehydrogenase; PFAM: pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   HI0933 family protein; SPTR: A3IQZ1 Pyridine
FT                   nucleotide-disulfide oxidoreductase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08513"
FT                   /db_xref="GOA:E0UV01"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0UV01"
FT                   /protein_id="ADN08513.1"
FT                   /translation="MKIHYDLIVIGAGPAGTPAAMTAAQFGAKVLLVDKRDAPGGECLF
FT                   EGCIPSKVLENAANNYWRVISSKKFHIQNTNTAQIHWEAVIQDKDEILKKRSQGAMQVI
FT                   KKLPTLDFKQGTAKFTDAHTLNIDGEFFSFDKALIATGGKTTIPPLKGNGVDKIWTNKD
FT                   VFFEKELPKELLFIGAGAISCELTQMFNKLGVKCHILERSERILRHLPSEAALTVQNKM
FT                   IENGVTVDLHVDLQKIDYENDKFIVTFMQEGKERILECKHVLMATGRGANVDGLELENA
FT                   NVEYNKGGVVVNKQLQSSQAHIYACGDCVPGPKFAHTATYEAGIVVHNMFAPSSHFVNY
FT                   DKNSWVLFSDPQIGIAGINEQQAHERGLDVDIATYDYSQDARSQIDKSTEGFVKFIIDK
FT                   KSKVIIGIEIVSEDAASLLGEAALIVANEMNSMDIMKAIHPHPTLTESFGKLAQQIFFK
FT                   SMMQRNR"
FT   sig_peptide     444040..444105
FT                   /locus_tag="Saut_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(445521..446546)
FT                   /locus_tag="Saut_0465"
FT   CDS_pept        complement(445521..446546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0465"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR007197:IPR006638; KEGG: sun:SUN_1453
FT                   [pyruvate formate-lyase]-activating enzyme; PFAM: Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   SPTR: C4LZZ7 Radical SAM domain protein; PFAM: Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08514"
FT                   /db_xref="GOA:E0UV02"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:E0UV02"
FT                   /protein_id="ADN08514.1"
FT                   /translation="MSATAWLSKKLSSGKILCQACAQSCKMDEGEYGICGVRKVEDGEL
FT                   KLLVYGLAAAVNIDPVEKKPMFNFLPNTKAFSLGTVGCNFSCKFCQNFDISQYPKEHEH
FT                   KIFGKELPPERIIELAIENGCKSIAYTYNEPIVFFEYTYDTAKLAHEKGLKNIYVTSGF
FT                   ETRKALDLLAPYIDGMNIDIKGFTEEFYKEICGARLKPVLECVKYAHEKGIWVEITTLL
FT                   IPGKNDSDEEIRNIAKFIAEVDPTMPWHLSAFHPMYKMLDVPSTPLSTLRRAYKIGKEE
FT                   GLKYIYVGNIADEDYESTYCPQCGERVIDRQGQIGQYVTNELDENGTCPHCGYSLEGVW
FT                   H"
FT   gene            446682..447884
FT                   /locus_tag="Saut_0466"
FT   CDS_pept        446682..447884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0466"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: sun:SUN_1452 S-adenosylmethionine
FT                   synthetase; PFAM: S-adenosylmethionine synthetase; PRIAM:
FT                   Methionine adenosyltransferase; SPTR: Q8KEG7
FT                   S-adenosylmethionine synthetase; TIGRFAM:
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase, C-terminal domain; S-adenosylmethionine
FT                   synthetase, central domain; S-adenosylmethionine
FT                   synthetase, N-terminal domain; TIGRFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08515"
FT                   /db_xref="GOA:E0UV03"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E0UV03"
FT                   /protein_id="ADN08515.1"
FT                   /translation="MYYFVSEAVSAGHPDKCADIIADSIVDRLLQLDSTAKVATEVFIS
FT                   GKHIIIGGEVKTAALVDTSFYEEIAREALKQIGYPEIGFKKDETLFPDETDIEVYISRQ
FT                   SPDITMGVVKEDDEIGAGDQGMIFGYATSEREDCMPTAFSYARQIRDVLYQYALKNPKI
FT                   FGVDIKTEIVMDYGSKENFDNCKPQRIAKIIVAIPHNSSVEAEEVQVLVKKIIAEEVNF
FT                   KAGHFNEDSIVFYINNTGRYVTHSPIADSGLTGRKVVCDTYGSYAPIGGGAQSSKDYSK
FT                   VDRSALYAARWLAKHIVAAGLAKKALVQLSYVIAEARPIAVTVDTQHTSLIKMKDEELS
FT                   QIIADKFSLSPKWIMQKFHLNKPSKESFLYADIAAKGQVGYAQYPWEQLDELNWFKSLK
FT                   E"
FT   gene            447895..450027
FT                   /locus_tag="Saut_0467"
FT   CDS_pept        447895..450027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0467"
FT                   /product="alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="COGs: COG0058 Glucan phosphorylase; InterPro
FT                   IPR000811:IPR011834; KEGG: sun:SUN_1278
FT                   glycogen/starch/alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35; PRIAM: Phosphorylase; SPTR: A0B900
FT                   Alpha-glucan phosphorylases; TIGRFAM: alpha-glucan
FT                   phosphorylase; PFAM: Carbohydrate phosphorylase; Protein of
FT                   unknown function (DUF3417); TIGRFAM: alpha-glucan
FT                   phosphorylases"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08516"
FT                   /db_xref="GOA:E0UV04"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:E0UV04"
FT                   /protein_id="ADN08516.1"
FT                   /translation="MINKDPSVNIAIPKLPKAIDGLKEISLNLWWTWNPRGKNLFKRLN
FT                   AYLWKESSHNPIAMLKNMSKEELDKACADEYFMREYHYVYDMFKVYINDTNIYADEPLP
FT                   IAYFCAEYGLHHSVPIYSGGLGFLAGDILKESSDMGLPMVGIGFMYPKGYVRQFIGTDG
FT                   WQNGAEEPLEKDVAPIERVLDKDENHFTIEVPFIDPPVYASVWKINVGRVTLYLLDTDI
FT                   EKNDPWDRQISSRLYTSDRNQRLRQQIVLGIGGYRVLEELGIEYSILHLNEGHPAFALF
FT                   ERVRSFMENDKLSLDAAIQKVKKTSVFTTHTPLQAATDVYNFDMISASFKDYWEKLGMN
FT                   KEQFMSFGLNPDNQSAGFNMTVFGINMCDNRNAVSKKHCEVATKIWEHVLPKMKDDKPA
FT                   MDYVTNGVHLPTWIGDELAEVIMSSLGDKWSLIQDDSALWGFVKEINNKKLWDISQRSK
FT                   VAMVNFIRERVRIKYAQDGIDPVVAMAEGVLLDPDILTIGFARRMTEYKRPDLILHDLD
FT                   RLEKILNNSGKPVQIIFAGKAHPSDMAGKKILQHIFKTAQDCRFRGRIAFVEDYGENVA
FT                   KYLVHGVDIWLNNPQIPMEACGTSGMKASLNGTLHLSVLDGWWPEAYNGKNGWAFGVEP
FT                   SENAKDASALYDLLENEIVPLFYDVDNKGVPNNWILKMKEAMLSIPPEFSARRMMKDYL
FT                   EKFYIPISKDLQNKES"
FT   gene            450037..451041
FT                   /locus_tag="Saut_0468"
FT   CDS_pept        450037..451041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1808 membrane protein; InterPro
FT                   IPR005240:IPR013031; KEGG: dal:Dalk_0015 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: A0B8J5
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF389); TIGRFAM: conserved hypothetical protein
FT                   TIGR00341; uncharacterized hydrophobic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08517"
FT                   /db_xref="GOA:E0UV05"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:E0UV05"
FT                   /protein_id="ADN08517.1"
FT                   /translation="MALRLIEIIVPKAKKKNIIDLKKLPLVIDAWQEENTVSNFIFKIL
FT                   VEAENSEVLIDKVSRLFKKDEIFRIVVQDVEATLPLVEVPLKEPIKKSIGKLTVSREEL
FT                   YNQVAGMAELNYLYLLMIAFATIIASFGFIEDKWVVIIGAMVVAPLIAPNIAFSLGVVL
FT                   GDKNLGMMGILAMGAGVLLVLAISLILGLTYPPDIASKSLQSTLFFSYADIIVALASGA
FT                   VAVLAFTSGTAFALIGVMVSISLLPPLVAAGLVLGMGNFYLFSSAITLFLINFVALNLS
FT                   GVVTFWFQGVRPKNWWEEKKAKHYRLAATGMWLFLLIILIIIIYLTHINFLFT"
FT   gene            451090..452097
FT                   /locus_tag="Saut_0469"
FT   CDS_pept        451090..452097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0469"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="COGs: COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase; InterPro
FT                   IPR000173:IPR006424; KEGG: sun:SUN_1212 glyceraldehyde
FT                   3-phosphate dehydrogenase; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase; PRIAM: Glyceraldehyde-3-phosphate
FT                   dehydrogenase (phosphorylating); SPTR: A7I7U0
FT                   Glyceraldehyde 3-phosphate dehydrogenase; TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I; PFAM:
FT                   Glyceraldehyde 3-phosphate dehydrogenase, C-terminal
FT                   domain; Glyceraldehyde 3-phosphate dehydrogenase, NAD
FT                   binding domain; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08518"
FT                   /db_xref="GOA:E0UP54"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP54"
FT                   /protein_id="ADN08518.1"
FT                   /translation="MKKRVAINGLGRIGNQVLRHYINNLPQNCEIVAANTSSVEDAAYL
FT                   LQYDSVHGRAGFDIQTRENKLIIDRHEITIVSSHNPLELPWKELGIDIVIDCTGRFTDG
FT                   TLAVQHIQAGAKKVLISAPGKNVDLTIVKGVNHQAYDSAKHHIISNASCTTNSLAPVMK
FT                   VLEEEFGVENAMITTTHAYTSSQVTVDKRAKKRRRGRAAAVNIIPTTTGAAVATIEVIP
FT                   ALEGKMEAMALRVPVPDGAITEVVALLNKDVNADEVNAAFIKASQGELQGILEFTKDEI
FT                   VSSDILGNRHSSIVDGLSTSVIGGRMVKVMAWYDNEYGYSQRLLEVADYMASKL"
FT   gene            452115..452546
FT                   /locus_tag="Saut_0470"
FT   CDS_pept        452115..452546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0470"
FT                   /product="17 kDa surface antigen"
FT                   /note="InterPro IPR008816; KEGG: nis:NIS_1071 hypothetical
FT                   protein; PFAM: 17 kDa surface antigen; SPTR: A2WCU6 Outer
FT                   membrane lipoprotein; PFAM: Rickettsia 17 kDa surface
FT                   antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08519"
FT                   /db_xref="GOA:E0UP55"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP55"
FT                   /protein_id="ADN08519.1"
FT                   /translation="MKKFLVTVLLGSLFFSGCATRGLQEMDANSVNYEMSYQVGIVKRI
FT                   KPVVIKDNGAGTFVGAITGAVLGSLVGKGRGNTLATLGGGLGGAYVGNQIGKANAQELS
FT                   VALNDGRNVVVLAKGKDFYVGQRVRIVKHDGRVYSVEAF"
FT   sig_peptide     452115..452189
FT                   /locus_tag="Saut_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            452548..454209
FT                   /locus_tag="Saut_0471"
FT   CDS_pept        452548..454209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0471"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /note="COGs: COG0033 Phosphoglucomutase; InterPro
FT                   IPR005841:IPR005844:IPR005846:IPR005843:IPR
FT                   005845:IPR016066:IPR005852; KEGG: sun:SUN_1277
FT                   phosphoglucomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; SPTR: P38569 Phosphoglucomutase; TIGRFAM:
FT                   phosphoglucomutase, alpha-D-glucose phosphate-specific;
FT                   PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I; TIGRFAM: phosphoglucomutase,
FT                   alpha-D-glucose phosphate-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08520"
FT                   /db_xref="GOA:E0UP56"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP56"
FT                   /protein_id="ADN08520.1"
FT                   /translation="MLSPLAGKLTPHSKLIDVASLIADYYEYEPDYSLESQKVSFGTSG
FT                   HRGSAFKKSFNEAHVLAITQAVCEYKKKMGYNSVLYIGKDTHALSTPAQMSAVRVCAAN
FT                   GIHIAIAKDGIYTPTPLISFAILEHNKKEQATADGIVITPSHNPPSDGGFKYNPPNGGP
FT                   ADTDVTSLIEKRANEILKNNLEDVAFVSYEKALQSQYVTEYDFITPYVEALSKIIDFKA
FT                   IKNAKFKLAADPLGGSSIQVYEKIKEYYHLDMDIIHPYADFTFSFMTLDHDGKIRMDCS
FT                   SPYAMASLLKLKEKYDLAFANDTDADRHGIVTPKGGLINPNHYLSVAIWYLFTHRKNFT
FT                   KDLKVGKTLVSSSMIDRICANLGIEVYEVPVGFKWFAQGLFEGWLGFGGEESAGASFLR
FT                   NDASVWTTDKDGLIMTLLSAEIMAVTGKDIADIYAEFEKEFGASYYARIDAPATLEQKK
FT                   ILKNLNADSIDIQMLGDEKIEKILTKASGNGAAIGGLKIVTQNGWVAMRPSGTEDIYKI
FT                   YAESFLSKEHLSAIQKEAQEIMKGLFSEARFSNAKV"
FT   gene            454317..456818
FT                   /locus_tag="Saut_0472"
FT   CDS_pept        454317..456818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0472"
FT                   /product="Nucleotidyl transferase"
FT                   /note="COGs: COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B gamma/epsilon
FT                   subunits (eIF-2Bgamma/eIF-2Bepsilon); InterPro
FT                   IPR005844:IPR001451:IPR005835; KEGG: sun:SUN_1275
FT                   mannose-1-phosphate guanylyltransferase; PFAM: Nucleotidyl
FT                   transferase; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I; transferase hexapeptide repeat
FT                   containing protein; SPTR: A3ILX5 Mannose-1-phosphate
FT                   guanyltransferase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Nucleotidyl transferase;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08521"
FT                   /db_xref="GOA:E0UP57"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP57"
FT                   /protein_id="ADN08521.1"
FT                   /translation="MKAVVMAGGFGTRIQPLTNSRPKPMLPIMNKPMMEYTMMMLKDLG
FT                   ITEFIVLLYFKPEIIQDYFKDGSDFGINISYVIPDDDYGTAGAVKLAQELIGDENFIII
FT                   SGDLVTDFNFKKLFTFHKEKKSKLSIGLTSVENPLQFGVVIANEEGVIEKFLEKPSWGE
FT                   VFSDTINTGIYIIEPEILDFIPEGENFDFAKDLFPALMDKKIELMAYNLKGYWRDVGNP
FT                   QSYREVYEDILGGEVKFKIPGKKKKYPDGVLYSLGENKLADSVEIIGTVVLGHNVTIQR
FT                   NVKLTNTVIGDNVHIGDASKIKNSVFWEDIQVSRHAFMDSCVICNDNIIEKNVTATAGL
FT                   ILAEGCEVGELTRFDKDVIIWPNKKIEPASVVTNNLILGSKYKNSIFEDGSVYGKSNIE
FT                   LSCEMATKLGEALGAQLPVHSTVLAGRDHDKNSRMIKRAFLGGLVSSGVNILDLKETPP
FT                   SVLRFTLAHSSNIIAGVHFKRCLNDTASSEITFFNDEAMKIHSESAKTIEKTFFTEKFR
FT                   RVDYNQIGRIRDTQHNIECSNYQRAIMDNIDHKIVKHENFKVVMDLMHGTTIDIFPKII
FT                   NDMAVEHVTLNSYYDEQKLTNISMLEKKSRLNVSKIVRCLNYDMGFLIYPNAQQLVLVA
FT                   ENGVVLSKVKALYAVLELLNLDAMNTKKKVFLPTWAPDIRYFKNLIIERGKYSDFKVEK
FT                   LKEYDLIATVDGNFVFTEFSYTRDAIYASFKIMELLSIYKIDLSILITSLSDFYYKQFK
FT                   VDCPQKLKGKMMRKFLQYAKGKKSSSEVGVKIWEGKNDWVLMIPDQYSEHLNLYIQAEN
FT                   DEKGELLYESYLKKIEQFSQE"
FT   gene            456826..458847
FT                   /locus_tag="Saut_0473"
FT   CDS_pept        456826..458847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0473"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="COGs: COG1449 Alpha-amylase/alpha-mannosidase;
FT                   InterPro IPR004300; KEGG: sun:SUN_1274 glycoside hydrolase;
FT                   PFAM: glycoside hydrolase family 57; SPTR: A3EQN9
FT                   Alpha-amylase/alpha-mannosidase; PFAM: Glycosyl hydrolase
FT                   family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08522"
FT                   /db_xref="GOA:E0UP58"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP58"
FT                   /protein_id="ADN08522.1"
FT                   /translation="MNLSFMWHMHQPDYRNEDGIMQMPWVFLHAIKDYYDMPWMLSRYK
FT                   NIQATFNITSPLIEQLKLYYKNPEQSDKFILLWLQNPSSLKTQERQWLVKICKSSQFDT
FT                   MVKGLPRYEELYKKDSFSDDEVLDLEILFILSWCGMYLKENNLHVKSLINKEKNYTDED
FT                   KKVLLNELSKFIGGIWKFYKELYNEKRITISTTPFYHPILPLLLDMQNAKRANAHTQIP
FT                   QNYEKLEEDALLHIQKAKDLFSDTFGYTTDVFWPAEGAVDEKSVKLLKSLGVNFIATDE
FT                   EILYKSLNSKSKKLIYAPYNYNNMLIGFRDHTLSDLIGFEYRYKKAEDAAQNFMSQLQS
FT                   IKSINDNATVFVILDGENAWEFYKNNGFDFFEALYSALEKASWCKTLTMDEVKDLPFRE
FT                   LINLAPGSWINGSFDTWVGEYEKTRAWELLFLTKKDYEHHKESLSDDIKAKITDNFLGA
FT                   ECSDWFWWYGSDHYTNFSLEFDAIFRRHLINIYNLIGISVPNDLFIPIGKNQSSTKFWI
FT                   KPQSKITPKIDGKRDSFFEWMGCGVIDESKLFSTMHANTQPVKKIYYGQDDNKLYFAFE
FT                   GDIKKLCKKGIINIIIDPLELSSTISFNQKKVFLQNIEIKLACKEWLEISLDKTQIKQK
FT                   KIWLRFEIADSSGSLQTLPSFGELEIDLQDDYSKNWFI"
FT   gene            458861..460861
FT                   /locus_tag="Saut_0474"
FT   CDS_pept        458861..460861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0474"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="COGs: COG1449 Alpha-amylase/alpha-mannosidase;
FT                   InterPro IPR015178:IPR004300:IPR015179; KEGG: sun:SUN_1273
FT                   4-alpha-glucanotransferase; PFAM: glycoside hydrolase
FT                   family 57; Domain of unknown function DUF1925; Domain of
FT                   unknown function DUF1926; PRIAM:
FT                   4-alpha-glucanotransferase; SPTR: A9QMB3 Cyclodextrin
FT                   glucanotransferase; PFAM: Domain of unknown function
FT                   (DUF1925); Glycosyl hydrolase family 57; Domain of unknown
FT                   function (DUF1926)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08523"
FT                   /db_xref="GOA:E0UP59"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015178"
FT                   /db_xref="InterPro:IPR015179"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP59"
FT                   /protein_id="ADN08523.1"
FT                   /translation="MKKVSLLFGIHMHQPVDNFDEEVQKAVELCYEPFFQTMLKYPKFK
FT                   FSLHCSGWLLDKIKSEYPKLFENMQILTKEGAIEWLSGGYYEPVLASIASNDRRAQIKK
FT                   LSNYIKKHFKVKPRGLWLAERVWESSLVSDLYACGIKYAMVDDYHFLSNGYDADKMNGY
FT                   YTTEDNARELELFPISKALRYALPFSNIDDAIKSVLVHQKEENAAAVIFDDAEKFGLWP
FT                   DTNKWVYEQKWLQKFIEAVLDNENIVTQHYGEYLQKNNSLGLAYLDNCSYAEMGEWSQQ
FT                   TKDALAFKEAQEKVLPYIIKGGIWKNFFIKYHESNYLHKRMLYLSLQQKDFDKYSLDAL
FT                   YRLQTNDAFWHGVFGGFYLPSLRDNAYKYLLEIQQQRAKENTAFEVLDIDKDGYDELKV
FT                   LTSNLSLMFSTKNGAQMIEFGSFDTLFNWQNTIMRRQESYHSKILHADIKENHTDKAAV
FT                   TTIHNREVAVDESLKAELIYDWHAKNSFIDHFSGNEFSLENFKSLVFQEVGDFANKPFL
FT                   LKNKKFVRKGGIYIAKEKYPAKLQKSYSFDVNTVHLKSKFKTQYIDKLYFAQEFNFHFA
FT                   HPDKVTFNGKILQNDFSEYNTEKLIINDDFTKKTLVITANQKCNVFAFVLHTVSQSESG
FT                   FEKIAQQISFIFTTSFISELQLQFSLEVRNV"
FT   gene            460854..461867
FT                   /locus_tag="Saut_0475"
FT   CDS_pept        460854..461867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0475"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="COGs: COG1085 Galactose-1-phosphate
FT                   uridylyltransferase; InterPro IPR001937; KEGG: sun:SUN_1272
FT                   galactose-1-phosphate uridylyltransferase; PRIAM:
FT                   UDP-glucose--hexose-1-phosphate uridylyltransferase; SPTR:
FT                   A9SCJ2 Galactose-1-phosphate uridylyltransferase; TIGRFAM:
FT                   galactose-1-phosphate uridylyltransferase; PFAM:
FT                   Galactose-1-phosphate uridyl transferase, N-terminal
FT                   domain; TIGRFAM: galactose-1-phosphate uridylyltransferase,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08524"
FT                   /db_xref="GOA:E0UP60"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP60"
FT                   /protein_id="ADN08524.1"
FT                   /translation="MSEIRYDRLHNKYVIIAPERLHRPNLIKRELLESEKKDCPFCEGH
FT                   EDFTPPEIFALRDNAANATGWRTRVVPNLYKAVQIEEEDISQRDGFFEYIKGFGAHEII
FT                   IDAPCHESRISSLSKKEIFDWLRTINARINDLAKDKRVIYLNIFKNSGQNAGASQQHPH
FT                   TQIIALPIMAQNTLEFLKRNQEYYSVHGRGIVQDMVHNEKEVKVRIIDELGIFTAYCPY
FT                   ASFFSFEVIIAPSKVISNMSRCSQDELTDLAQVIKNVFTMLDTQLDSYDYNISFHIAPV
FT                   NKNFENEKYMDDIAENFTFYIRIMPRLYTLAGFEMSAETAINGVAPENCAKLLRGE"
FT   gene            461869..463227
FT                   /locus_tag="Saut_0476"
FT   CDS_pept        461869..463227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0476"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="COGs: COG0297 Glycogen synthase; InterPro
FT                   IPR001296:IPR013534:IPR011835; KEGG: sun:SUN_1271 glycogen
FT                   synthase; PFAM: Starch synthase catalytic domain protein;
FT                   glycosyl transferase group 1; PRIAM: Starch synthase; SPTR:
FT                   B2V5P9 Glycogen synthase; TIGRFAM: glycogen/starch
FT                   synthase, ADP-glucose type; PFAM: Starch synthase catalytic
FT                   domain; Glycosyl transferases group 1; TIGRFAM:
FT                   glycogen/starch synthases, ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08525"
FT                   /db_xref="GOA:E0UP61"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP61"
FT                   /protein_id="ADN08525.1"
FT                   /translation="MHVLFAASEIFPYAKTGGLADVSYSLPLALKEYVKISRVMPLYGF
FT                   MDENKYLFYDNFTISLDGGDYSVAIFIKEEKNIVTYFVKAPYLSQTQNLYTDENGDYKN
FT                   NALRFGIFCMAIIELALRLNCKLIHLNDWHTALVALFVKEHQLKIKTVFTIHNLAYQGV
FT                   FEKSALKTLGISYKYFTMDALEFYSKVNLLKAGIAYSDMITTVSPTYAQEILTEGFGCG
FT                   LNGFLQKHKEKLVGIINGIDYTVFKPLQDKGTKSKAKADFCKRYGFENPKLPLFIMVSR
FT                   LAEQKGIDLLISSFDELQNKKINLFILGEGEAKYSKALNKFAKKYRNFSFFQSFDEDLS
FT                   HQAYLASDFLLMPSRFEPCGLNQLIAMNCGSVAVVHEVGGLKDSVHEQKAVCGQGISYK
FT                   EQNKKEFLYAIERAMSLYRVKKKMQEIIDFNLTCDFSFDKSAKKYFKIYKSLL"
FT   gene            463224..464066
FT                   /locus_tag="Saut_0477"
FT   CDS_pept        463224..464066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0477"
FT                   /product="ROK family protein"
FT                   /note="COGs: COG1940 Transcriptional regulator/sugar
FT                   kinase; InterPro IPR000600; KEGG: sun:SUN_1270 hypothetical
FT                   protein; PFAM: ROK family protein; SPTR: C3ZTK3 Putative
FT                   uncharacterized protein; PFAM: ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08526"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP62"
FT                   /protein_id="ADN08526.1"
FT                   /translation="MKLGIDIGGTYLRYELRENDKTIKKSSLKSAQTGLCSFLEMILHE
FT                   EKKISSIFIAYAGQVNEGVILSAPNITIDKHEIKAYIEAKYNVKLFIENDLNCAVLAEA
FT                   KSCKTENICAVYAGTGLGLGVVSSSVLIKGSDNIATELGHIPYKDTPFTCNCGKHNCIE
FT                   LFCSGSGLLRWKEYYKLKPELSLEQLHQSKKDEAQKIYNEFIEALLYAVGTTITLFNPK
FT                   VLVIGGGLIMHNRYLHGIIQERIKAYALPLALKNIKITISTLEDASLEGAFLLKDLYE"
FT   gene            464059..465537
FT                   /locus_tag="Saut_0478"
FT   CDS_pept        464059..465537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0478"
FT                   /product="glycogen synthase (ADP-glucose)"
FT                   /note="COGs: COG0297 Glycogen synthase; InterPro
FT                   IPR001296:IPR013534:IPR011835; KEGG: sun:SUN_1269 glycogen
FT                   synthase; PFAM: Starch synthase catalytic domain protein;
FT                   glycosyl transferase group 1; SPTR: Q74ED9 Glycogen
FT                   synthase 1; TIGRFAM: glycogen/starch synthase, ADP-glucose
FT                   type; PFAM: Starch synthase catalytic domain; Glycosyl
FT                   transferases group 1; TIGRFAM: glycogen/starch synthases,
FT                   ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08527"
FT                   /db_xref="GOA:E0UP63"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP63"
FT                   /protein_id="ADN08527.1"
FT                   /translation="MSEKLNILFAAAEVVPFAKTGGLADVAGALPKALQKLGHNIIVVM
FT                   PRYYSIDKSKLQKLPAPLGVPMGIMGEFWAAVYKTTLPQSEVEIYFIDYEHYFGRSGLY
FT                   EDDNGGYHDNDNRFVFFSKAALQLCKMLQFTPDIIHANDWHTAAMPILAKTRFVHDFGF
FT                   AASVLTIHNLQHQGHFYKGVMDVMEVGWEYFNPHSLESLDGVNILKGGIAEADAITTVS
FT                   KKYAQEIQTPEFGFGLDGHIRAHNYKLFGILNGVDYAEWNPSIDTFLAQNYDVGNIQGK
FT                   LTCKRNLQKYFNLSVRDDVPLIGFVGRFVEQKGIELIARVINGLLNHDIQVVMLGTGES
FT                   WAEEFFSEVAYFRDNFALHVGYSNELAHKIEAGCDMFLMPSLFEPCGLNQIYSLRYGTL
FT                   PIVRATGGLDDTIVNFDEEHHIGNGFKFYDATQEALYNTVLWAVDVYNNNKEAFERMQK
FT                   FAMQEHFSWEDSAKEYEKVYDFALEHKRGENYGI"
FT   gene            465527..467446
FT                   /locus_tag="Saut_0479"
FT   CDS_pept        465527..467446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0479"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="COGs: COG0296 1 4-alpha-glucan branching enzyme;
FT                   InterPro IPR006048:IPR004193:IPR006047:IPR006589:IPR
FT                   006407; KEGG: sun:SUN_1268 1,4-alpha-glucan branching
FT                   enzyme; PFAM: alpha amylase all-beta; glycoside hydrolase
FT                   family 13 domain protein; alpha amylase catalytic region;
FT                   SMART: alpha amylase catalytic sub domain; SPTR: A2TZZ6
FT                   1,4-alpha-glucan branching enzyme; TIGRFAM:
FT                   1,4-alpha-glucan branching enzyme; PFAM: Alpha amylase,
FT                   C-terminal all-beta domain; Carbohydrate-binding module 48
FT                   (Isoamylase N-terminal domain); Alpha amylase, catalytic
FT                   domain; TIGRFAM: alpha-1,4-glucan:alpha-1,4-glucan
FT                   6-glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08528"
FT                   /db_xref="GOA:E0UP64"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP64"
FT                   /protein_id="ADN08528.1"
FT                   /translation="MEYEVFHDVSLFSEFDIYLFKEGTHFQLYKHFGSHKMQREGVEGV
FT                   YFAVWAPNAKSVCVQGDFNHYNRYAHFLKRREDGSGIWEGFISNIEEEITYKYFVDSDN
FT                   EHANKDKSDPFAFYAEVAPSSASKIYDLSGYEWSDAKWMKNRAKNNSHKAPISIYEVHL
FT                   GSWKRKVEEDNRFLTYGESAKELALYLNEMNYTHVEIMPVMEHPFEGSWGYQTTGYFAP
FT                   TSRYGSPHEFMEFVDVMHEHNIGVILDWVPSHFVNDGHGLMNFDGTCLYEHADPRKGYH
FT                   PEWKSAIFNYDRNEVRAFLISSAMFWLDLYHADGIRVDGVASMLYLDYAREEGEWIPNE
FT                   DGSNINRGAVKFLQDLNTTVYENFPDIIMAAEESTNYSMVTGLVDKGGLGFGYKWNMGW
FT                   MHDILKYMKVNPLFRQHHHKDLTFSFVYMFNESYILPLSHDEVVHMKGSLVNKMPGDNY
FT                   KKFANLRALYALMTAHPGKKLLFMGGEFAQFNEWHYEQSLDWHLLDYFEHQGVQNCVRT
FT                   LNRLYKDEASLHRNDVINEGFSWIEENDYRANVIAFIRKGARNQKPVLIICNFADKEHK
FT                   NYPLGVPAKGVYSEIFNSDYIDFGGSSAELHIVKSIAKEQHGRKNSVEITLPPLSVIYL
FT                   KKTK"
FT   gene            467459..468721
FT                   /locus_tag="Saut_0480"
FT   CDS_pept        467459..468721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0480"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="COGs: COG0166 Glucose-6-phosphate isomerase;
FT                   InterPro IPR001672:IPR018189; KEGG: sun:SUN_1276
FT                   glucose-6-phosphate isomerase; PFAM: phosphoglucose
FT                   isomerase (PGI); SPTR: Q9PMD4 Probable glucose-6-phosphate
FT                   isomerase; PFAM: Phosphoglucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08529"
FT                   /db_xref="GOA:E0UP65"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP65"
FT                   /protein_id="ADN08529.1"
FT                   /translation="MIEFDNDFTWESDKSIDEMMQEAYQKILLEKENGVSGYFTLGEDS
FT                   LEIMEDALAYAASNEFIKKSDTIVIIGIGGSSLGTKAIDSIFKHQNTDVKKMLFLENPD
FT                   EIDLSEKLASIEKEKTLFIIVSKSGSTIETISIFKEIIERFSLDFADGDKSRVTTITDE
FT                   DSVLHKFSKYYGIESFLIPSNVGGRFSVLSAVGVVPLAIAGYDMKSILEGASIMAERFF
FT                   TKKENHILKKAVFLTKHKKETPMNVVFSYANCLEDFTKWYVQLWGESLGKIDKQGNHTG
FT                   LTPIGHIGSVDQHSFLQLIMQGPRDKTVTFIKVDNFEKDIKVPDITLKFIEKTDYINGY
FT                   SFNELIDGECEATKESIVKEGINVDAVTLDVLNEKNIGKLIMYYELLTSLCGIMLGVNT
FT                   YDQPGVEIGKQILLKKFTKSS"
FT   gene            complement(468728..469228)
FT                   /locus_tag="Saut_0481"
FT   CDS_pept        complement(468728..469228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_1388 hypothetical protein; SPTR:
FT                   A4FY50 Putative uncharacterized protein; PFAM: Predicted
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08530"
FT                   /db_xref="GOA:E0UP66"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP66"
FT                   /protein_id="ADN08530.1"
FT                   /translation="MSKKKQPKNRSGIIMLIVVILLYVVLYFYNPDKIFASLKASLNVL
FT                   KMIAPILLIVFFLMALLNTFIDEKSIAKHLGKESGVKGWFIALFGGILSHGPGYIWYPM
FT                   LQELRKKGALDGLLVAFLYARSIKLPWLPLMISYFGISFTIVLSFYVVLGAFVQGVITN
FT                   RLK"
FT   gene            complement(469225..469659)
FT                   /locus_tag="Saut_0482"
FT   CDS_pept        complement(469225..469659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_1389 hypothetical protein; SPTR:
FT                   A6VK48 Putative uncharacterized protein; PFAM: Predicted
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08531"
FT                   /db_xref="GOA:E0UP67"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP67"
FT                   /protein_id="ADN08531.1"
FT                   /translation="MQKIKTASINTLKNLWMITPMLLAVIGLVGLFETYITPQIIHSLF
FT                   NAHVIHDTVIGTVAGAVSVGQPFLSYIIGGELLKEGVSFYAVTAFILSFVTLGVIQLPL
FT                   EFSIFGMRFAIIRNILSIIFALIISWVTVYTLNLFHGFFA"
FT   gene            469795..470751
FT                   /locus_tag="Saut_0483"
FT   CDS_pept        469795..470751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0483"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type alpha
FT                   subunit; InterPro IPR001017; KEGG: sun:SUN_0970
FT                   pyruvate/2-oxoglutarate dehydrogenase complex, E1
FT                   component, alpha subunit; PFAM: dehydrogenase E1 component;
FT                   PRIAM: Pyruvate dehydrogenase (acetyl-transferring); SPTR:
FT                   Q6B8T2 Pyruvate dehydrogenase E1 component alpha subunit;
FT                   PFAM: Dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08532"
FT                   /db_xref="GOA:E0UP68"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP68"
FT                   /protein_id="ADN08532.1"
FT                   /translation="MNKLVAEDMYYLMILGRAFEYGAKENYMKGNVSGFLHLDIGQEAF
FT                   SVAAIKAFEKGDIFSGYREHIMAITRGIEPKAIMAELFGKSTGVSGGKGGSMHLFEPSR
FT                   FFYGGDAIVGGQLPNAVGCAYARDLQGSEEGVMVIFGDGATNGGAFFESLNIAAAHKLP
FT                   LLFVCENNQYAIATKITRVAPFKEQAKKAEPYMLTYSVDGMDAEAVYECVKKAKKQIEE
FT                   GHGPIFIEAFTCRYEGHSVSDSNAYRSAQEMKHCKAKDPIEYFKNELKEKWLCTDKELE
FT                   EIEAKVQKTIQEAVEYAENSPQPELRVLYENVFDEEA"
FT   gene            470753..471730
FT                   /locus_tag="Saut_0484"
FT   CDS_pept        470753..471730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0484"
FT                   /product="Transketolase central region"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG0022 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type beta
FT                   subunit; InterPro IPR005476:IPR005475; KEGG: sun:SUN_0971
FT                   pyruvate/2-oxoglutarate dehydrogenase complex, E1
FT                   component, beta subunit; PFAM: Transketolase central
FT                   region; Transketolase domain protein; SPTR: A0YTB6
FT                   Transketolase; PFAM: Transketolase, C-terminal domain;
FT                   Transketolase, pyrimidine binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08533"
FT                   /db_xref="GOA:E0UP69"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP69"
FT                   /protein_id="ADN08533.1"
FT                   /translation="MLYREALNRALDEMMSADDTVVTLGEDVGLYGGSFRVTEGLVEKY
FT                   GEKRVIDTPIAELSIVGNAVGMAIGGLRPVAELMTGNFSLLAFDQIINHMAKLHYMSNG
FT                   KIILPMVVRFPQGVSRQLGAQHSESYEQMLSAVPGLRVLSVNDVNYAYHALKHVVLLDD
FT                   PVIFIEHELLYNKKGEVDFEQELDPFKARIAKEGSDITIVSYLKILDDVLLAVPEIEKE
FT                   LGCSCEVIDLCSLNPVDYETLSKSMEKTSRLVMVEEDHKTGGYGAQIVSWAAEEMFYAL
FT                   DAAPLRLAGEDVPIPYNRSLELASIPTPESIVRDIVAWGKKNDV"
FT   gene            471723..472991
FT                   /locus_tag="Saut_0485"
FT   CDS_pept        471723..472991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0485"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="COGs: COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide acyltransferase (E2) protein;
FT                   InterPro IPR000089:IPR001078:IPR003016:IPR000276; KEGG:
FT                   sun:SUN_1209 pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   E2 component, dihydrolipoamide acetyltransferase; PFAM:
FT                   catalytic domain of components of various dehydrogenase
FT                   complexes; biotin/lipoyl attachment domain-containing
FT                   protein; SPTR: A3XR08 Dihydrolipoamide acetyltransferase
FT                   component (E2) of pyruvate dehydrogenase complex; PFAM:
FT                   2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08534"
FT                   /db_xref="GOA:E0UP70"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP70"
FT                   /protein_id="ADN08534.1"
FT                   /translation="MYEIVMPQLSDSMDEGKLISWKVKEGQKVNPGDVIAEVESDKAIM
FT                   EMQSFKSGVVKEITAKEGDVVPVGEVIAKIETGGVKDAKESTSAATDELPVKKPAPKPV
FT                   VKQEPKPTVKKETKTEPNLQTSVIKHISKEATSGISPKARAKAGQYGIDTQIIAQKTSK
FT                   SVLHVEDVEEYLREHYFTPKALKLLDKYGLDIATFELNHKIDETEIQEFIANNETPLPQ
FT                   PLSQMQKAIIANVTASAQKPVYHLYEHIDAALFVKNEAYSITAWLIKIFAKVMMAHDSF
FT                   RARLQNDALIISSNASISVAVADSQNLYMPVVKDANKRSIAEIAKELENFKTKLKENSF
FT                   TAADMQGSSFSISNLGMLGVERFDAMINKNDSGVVAVGRVNEGKISITLSADHRLINGY
FT                   EAALFIQDVKQEVQNPLFFQNPH"
FT   gene            473089..474381
FT                   /locus_tag="Saut_0486"
FT   CDS_pept        473089..474381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0486"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3); InterPro
FT                   IPR013027:IPR000815:IPR001327:IPR004099:IPR 012999; KEGG:
FT                   sun:SUN_1208 pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   E3 component, dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; SPTR: P54533
FT                   Dihydrolipoyl dehydrogenase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08535"
FT                   /db_xref="GOA:E0UP71"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP71"
FT                   /protein_id="ADN08535.1"
FT                   /translation="MYDIIFIGGGLNYAGAIVAAKNGKKVALIEKDMKQLGGVCLHKGC
FT                   IPSKMFLHYANVVYESKSDILEGEAVLCMQKLFHKKTNLIENAWHAITKQCSHVDLIEG
FT                   EAKLKEPHKVEINGEILEAEHIVMGTGSHSFVPEGIEYNTKDIIVSDEVLMMQELPKKI
FT                   AIYGVGAIGLEMASFFATAGVEVTLINHSGKILKQSNPLIQKEIKNQLEKIGVKILENH
FT                   GIKTAKSTKKGVHITFEDKSSIYIPVLLVAAGRRPNVDFLTCKDIKVEKGIVTDRFFET
FT                   TLAKHYAIGDCNGKLQLAHAARAEVLNVTERILGKNPRPLNLDHVVKFIHILPMSYAVV
FT                   GKTDGEKSGVVPLSQFPYSAYNHASAGLMISYTDNNGFIVGAEILAPNAEELAAIVGMS
FT                   LAGEMDAAQAKRTIFGHPTFSEALERTFYKL"
FT   gene            474405..475238
FT                   /locus_tag="Saut_0487"
FT   CDS_pept        474405..475238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0487"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.8"
FT                   /note="COGs: COG0320 Lipoate synthase; InterPro
FT                   IPR007197:IPR006638:IPR003698; KEGG: nis:NIS_0925 lipoyl
FT                   synthase; PFAM: Radical SAM domain protein; PRIAM: Lipoyl
FT                   synthase; SMART: Elongator protein 3/MiaB/NifB; SPTR:
FT                   A1ZHQ4 Lipoic acid synthetase; TIGRFAM: lipoic acid
FT                   synthetase; PFAM: Radical SAM superfamily; TIGRFAM: lipoate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08536"
FT                   /db_xref="GOA:E0UP72"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP72"
FT                   /protein_id="ADN08536.1"
FT                   /translation="MIYKPKIKVPNPEFLQNMQSILKSNALTAVCEEAACPNRAECYAR
FT                   NSATFMILGDTCTRACTFCNVKTGHGKDVDINEPQRLAKAIKELQLKYVVITSVDRDDL
FT                   KDYGSKHFTACVQAIKEQNPNTKIELLTPDFKYNTEALDTIISANAHKLAHNQETIRRL
FT                   SKGVRPQSNYDRSLKVLEYYAKNSGLHVKSSLMLGLGETKEELLVTMKELLDVGVSELT
FT                   LGQYLQPTPSHHKVQKYYPPEFFDEMKEEALGMGFRAVASGILVRSSYFAENLGE"
FT   gene            475240..475938
FT                   /locus_tag="Saut_0488"
FT   CDS_pept        475240..475938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0488"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.4"
FT                   /note="COGs: COG0588 Phosphoglycerate mutase 1; InterPro
FT                   IPR013078:IPR001345:IPR005952; KEGG: sun:SUN_1290
FT                   phosphoglycerate mutase; PFAM: Phosphoglycerate mutase;
FT                   PRIAM: Bisphosphoglycerate mutase; SPTR: Q73M14
FT                   2,3-bisphosphoglycerate-dependent phosphoglycerate mutase;
FT                   TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase family; TIGRFAM: phosphoglycerate
FT                   mutase, BPG-dependent, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08537"
FT                   /db_xref="GOA:E0UP73"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP73"
FT                   /protein_id="ADN08537.1"
FT                   /translation="MSKARLVLVRHGQSIYNQKNIFTGWTDIDLSEQGIDEAKKAGLLL
FT                   KKNNIYPDICFTSWLNRAIHTAQILLKELEWEHIDSLRSYKLNERHYGDWQGRDKDEVK
FT                   NEYGEEKFLAVRRGYDVAPPPLKPNDARCVSNDKKYANIDKKLLPLNESLKDTKKRVLE
FT                   YYSEQIISKLQEQKTVLISAHGNSLRALVMELEQISETNIVSFEIPTGEIIVYTFDCDM
FT                   KIIEKNVLIG"
FT   gene            476006..476725
FT                   /locus_tag="Saut_0489"
FT   CDS_pept        476006..476725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_1425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08538"
FT                   /db_xref="GOA:E0UP74"
FT                   /db_xref="InterPro:IPR025508"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP74"
FT                   /protein_id="ADN08538.1"
FT                   /translation="MKEFFAYGEKVPGYDVRMLNEREARAAAAILFVGAFLGLTNGVML
FT                   GTAVFSEYFVSFFAIDFTMRVIQPRYAPSLLLGRFFVRNQTPEYVGAAQKRFAWALGMI
FT                   LAWPMFYYLVIDFQPNPLKVLVCLICMGLLFFESAFSVCLGCKIFNLVKREKATHCPGD
FT                   VCEMKIKEPIQRFNPIQKIIVILTAIAMFYGAFAYMTKLPDRTNLTKKMKKIMTSDAEL
FT                   QRIEDEKADQEFENDDF"
FT   gene            476735..478024
FT                   /locus_tag="Saut_0490"
FT   CDS_pept        476735..478024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_01670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08539"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP75"
FT                   /protein_id="ADN08539.1"
FT                   /translation="MKNILLLLSLASFLYADGLSVVGSLRERVESWSGFNKKAYGDSSI
FT                   DANGKKVGDSNDAILLQRIMLGGEYKTSNIDYSLIMYDAREWGSSLADSDFIKNKNTPY
FT                   SYAMNPYHEHFELYDASLTFKSLGIQNLSFKVGRQDIAYGDKRIIGPGSWGNTIGWLWD
FT                   AGRFSYKFDENFIDAWYGRTRTKDPNKFSMIEKHLYEGAIVYSHFQTILQGVVEPFYVY
FT                   KHSLIPKISSEQKSYEYLNYAGARLYENDYKNFTYDVTYVNESGKEGSQKINDFAYIVK
FT                   GGYQFKTAVLKPKIVLGRVYAGKDFTTPFGSTDGSHYGRMDLINWANMQDNQIALYLYP
FT                   TSKINTKFTYHDFSLADASGKWAYYGYVNKSGYLDKKLGDEIDAEFFYKPVKNIKVSFI
FT                   YAYFKAGAFVKNSVADNNAQHLFLQFEYKL"
FT   sig_peptide     476735..476782
FT                   /locus_tag="Saut_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            478021..479166
FT                   /locus_tag="Saut_0491"
FT   CDS_pept        478021..479166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0491"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: afr:AFE_1496 cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein; SPTR:
FT                   A3CXT0 Cation diffusion facilitator family transporter;
FT                   TIGRFAM: cation diffusion facilitator family transporter;
FT                   PFAM: Cation efflux family; TIGRFAM: cation diffusion
FT                   facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08540"
FT                   /db_xref="GOA:E0UP76"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP76"
FT                   /protein_id="ADN08540.1"
FT                   /translation="MINALKNVDEKKSWLFASTLLNASLAAAKLGWGWFMGSTLVMADG
FT                   IHSISDVFGALLIFLALFFAAHKSERFPYGLHKLEDMAAFFGGFGILFAGYEIVHSVFF
FT                   ESGIQTPTNILSTVLFILVLITIQFIFYFFELKAAKRLNSPGVKADAINWLGDIGAGFI
FT                   VVVGLIAHQYHIAYAQEIAVVIIVFMIFEGAYDVLKEATLSLLDAADIELTKKIKSIIL
FT                   SYSDITEIKRIMVRKSGSVYFADIEVNIDETMMKKAHTTIDKIVNQLHNEIEELEAVTI
FT                   HYEPQHLPYKTIIELLDENKNISEDFKHAVWLKIIKKTDEEVLSEQIIKSPVASDGKAK
FT                   AFKLVAWMIRNNVDEVVVNKKDIDENILALFETLDITLSTN"
FT   sig_peptide     478021..478104
FT                   /locus_tag="Saut_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            479225..479866
FT                   /locus_tag="Saut_0492"
FT   CDS_pept        479225..479866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0492"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="COGs: COG1814 Uncharacterized membrane protein;
FT                   InterPro IPR008217; KEGG: pin:Ping_1569 hypothetical
FT                   protein; PFAM: protein of unknown function DUF125
FT                   transmembrane; SPTR: A3UCI9 Similar to nodulin 21; PFAM:
FT                   VIT family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08541"
FT                   /db_xref="GOA:E0UP77"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP77"
FT                   /protein_id="ADN08541.1"
FT                   /translation="MSNENTTVTIHIEEAHKSHRIGWLRAAVLGANDGIVSTASLIVGI
FT                   AAGEYISVSSQADTENADLELEKKALQENEAYEKEELAQIYEARGIKPELAKEVASQLM
FT                   EHDALDAHARDELGITEGGKSNPIEAALSSAASFTVGAAMPLLTAWLVPQEQLIISVSV
FT                   ASLLFLAVLGAIAAKAGGASMTKGAIRVTFWGALAMGLTAAVGQLFGVVA"
FT   gene            479896..480858
FT                   /locus_tag="Saut_0493"
FT   CDS_pept        479896..480858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0493"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR006311; TIGRFAM: Tat (twin-arginine
FT                   translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08542"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP78"
FT                   /protein_id="ADN08542.1"
FT                   /translation="MQRRNFLKTAAVAAGTMAMMPAVASSSMLKPAKGETIPKGAVTLY
FT                   IEFRIMPNFKDDLLDKVNQYNKVLAKTKGFLSLSLKNMVGDSTMVHNYDTKLKGVLSSA
FT                   YFDASKEGSMPLFYSLFIRFENYHDLMASKTTEWFSKVISKYGPLSKNYSEGVYKTVSA
FT                   GDREHIYTSQSDIEKFLKNQQDKPTNRYITVNNHVGIFTKDVNAFNKKSTSLLKVAQNT
FT                   FRPAKGDYDYNPKFPKGIPGSYQNLHYRRAISTEILQSAFSDGDKTHYLFHGTWESVYD
FT                   HENSHTDPRFRADVMKIFPYIVEGPVEPFYETIILNNKA"
FT   sig_peptide     479896..479967
FT                   /locus_tag="Saut_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            480910..482568
FT                   /locus_tag="Saut_0494"
FT   CDS_pept        480910..482568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0494"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="COGs: COG0025 NhaP-type Na+/H+ and K+/H+ antiporter;
FT                   InterPro IPR006153; KEGG: sun:SUN_0351 NhaP family
FT                   Na(+)/H(+) antiporter; PFAM: sodium/hydrogen exchanger;
FT                   SPTR: O29412 Na+/H+ antiporter (Nhe2); PFAM:
FT                   Sodium/hydrogen exchanger family; (TC 2.A.36)"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08543"
FT                   /db_xref="GOA:E0UP79"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP79"
FT                   /protein_id="ADN08543.1"
FT                   /translation="MLEVFSAILLIILVSKFLEDKTKVPFVLIVIILAYIADTFLDLST
FT                   LGNNFEEIIYLMLPIILIPDVLGLSRSELKENAGDIFYLAFVAVIVSIALAVGATFYVD
FT                   TKYHFSLFELLIVFTPLMATDVISVSAIFAKFKLPQKLKLYAEGESLFNDITAMLIFFF
FT                   IALPILHGDNLDFATLTQTTIYTVVISAVIGVVMGLVGYYSFKISQNSFEEFLSIYVMA
FT                   SMAFLVADKMQLSGILSVVISVLLFKFLFDKEGHYKKRNYNAIIKHLNTPSSLESSFRA
FT                   YKKEAYYLGQFANAVIFIAIANVIDLDLLLKYKVEILYVFTLTTIIRYIVIVPLVKYRK
FT                   LSLLWNNILTLSGMKGGLALIMIVSLSDNFVYKEMFLAVVLGVVILSIFFYTIVLMAYL
FT                   YTNKDKLISDTAKEHHLEIKNVQDLLQKEQLSKAYNEMAFEDIVEKEIQRAQRYKYDFS
FT                   LMAFQTDALTAHQIYKKLVRKSDYFGKINAQTYAILLTHNDVDNSLEFANKIKEHFTCI
FT                   EHIAIAQYTTGDSVEMLFDKLYAALSDDKAVDVEI"
FT   gene            482639..483034
FT                   /locus_tag="Saut_0495"
FT   CDS_pept        482639..483034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0495"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0607 Rhodanese-related sulfurtransferase;
FT                   InterPro IPR001763; KEGG: nis:NIS_0081 hypothetical
FT                   protein; SMART: Rhodanese domain protein; SPTR: A2VIF6
FT                   Putative uncharacterized protein; PFAM: Rhodanese-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08544"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP80"
FT                   /protein_id="ADN08544.1"
FT                   /translation="MKSKVEEFDKYLRSFDYQERKDMKIKRDELFERYAKGELQIIDIR
FT                   FNEEYEAWHIGFGDHIPLNELPDRLDEIDKSKTIVTMCPHYDRAEIARLYLKLQGFDAK
FT                   YLTDGMLGLVEGLRGDKARDYMKKLKD"
FT   gene            483055..483705
FT                   /locus_tag="Saut_0496"
FT   CDS_pept        483055..483705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08545"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP81"
FT                   /protein_id="ADN08545.1"
FT                   /translation="MKTTLTKVVLGTILTGTLAFGGNPLYEKAGTINIVDHKAMVAGSK
FT                   APGHDNFKISLEDTGIITGHICGCTTAAFIITKNALKKLYPNTTPLRRGVNVEMSTYNM
FT                   DIVDAITYLTGTRFNRAQTNYDFIIDPNLQGKKGTITIKFTRKDNKKSVTAVIDRMKIL
FT                   SKEEAKVIQTIKPKVGQHKATKQEIMKLAKIQQEVVKKIITNLPQGSISYSSK"
FT   sig_peptide     483055..483117
FT                   /locus_tag="Saut_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            483724..484086
FT                   /locus_tag="Saut_0497"
FT   CDS_pept        483724..484086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR001763; KEGG: nis:NIS_0082 hypothetical
FT                   protein; SPTR: A3XN10 Metallo-beta-lactamase superfamily
FT                   protein; PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08546"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP82"
FT                   /protein_id="ADN08546.1"
FT                   /translation="MNELARKIVPSEMNNMRIEIEDFVSLYNEGKCELVDVRVPFETAV
FT                   WQVNFGLKIPANELPERLNELPKDKLIVVACPKTDRSNMARTYLASEGFEVKYLVGGLL
FT                   GLMDALKGGKAKGIKL"
FT   gene            484088..484828
FT                   /locus_tag="Saut_0498"
FT   CDS_pept        484088..484828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0498"
FT                   /product="protein of unknown function DUF81"
FT                   /note="InterPro IPR002781; KEGG: nis:NIS_0083 hypothetical
FT                   protein; PFAM: protein of unknown function DUF81; SPTR:
FT                   Q5JDE5 Hypothetical membrane protein, conserved, DUF81
FT                   family; PFAM: Sulfite exporter TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08547"
FT                   /db_xref="GOA:E0UP83"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP83"
FT                   /protein_id="ADN08547.1"
FT                   /translation="MEYYVIYFFLTLALSTLFSMGGVGSAIGLVPIFSMMGMPLNLAKA
FT                   IGLFINSASTITASIMNFFRGVLDVGFAIPLIVSIMIATPVGAWMSQYVQKEIVEWVLV
FT                   AFLVVSALLLIFSNREQKVVYDKAWILYVIGGTVGLISGTIGVGGGSLIMPLLILLGFD
FT                   AKKAAYAISFVIPFSTLGAFATYLSFVHMDWILLGVVTVAAIIGGYLGDRIMHYRLTPS
FT                   QVKKLIAVVLLLLAAKMIYKLIGV"
FT   sig_peptide     484088..484162
FT                   /locus_tag="Saut_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            484831..485073
FT                   /locus_tag="Saut_0499"
FT   CDS_pept        484831..485073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08548"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP84"
FT                   /protein_id="ADN08548.1"
FT                   /translation="MLHIMKKIAMKMLENEKKDALDCSVSDEVVDEWLDTIEERKKRMQ
FT                   EHHKTDTEQYDMLLGVEKEVKKIKEIRAKKCTKPD"
FT   gene            485089..485334
FT                   /locus_tag="Saut_0500"
FT   CDS_pept        485089..485334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08549"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP85"
FT                   /protein_id="ADN08549.1"
FT                   /translation="MLHVMARIADWLIENEKKSALDCTIPDEVLDEWRETIEEREKSMK
FT                   EHHLKGSEQYDMLLELDKKVKNLEAIRAKKCAQKEK"
FT   gene            485419..485799
FT                   /locus_tag="Saut_0501"
FT   CDS_pept        485419..485799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0501"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="InterPro IPR003779; KEGG: nis:NIS_0077 hypothetical
FT                   protein; PFAM: Carboxymuconolactone decarboxylase; PFAM:
FT                   Carboxymuconolactone decarboxylase family; TIGRFAM:
FT                   alkylhydroperoxidase AhpD family core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08550"
FT                   /db_xref="GOA:E0UP86"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP86"
FT                   /protein_id="ADN08550.1"
FT                   /translation="MQMPTPEQVLAQMEEKFGHEGVPNSIRLAMDVAPEMLVEQAMSSK
FT                   MSMQSDTNALDPKTSLLVYFSAALGMKDQSCIDTLTYAALNAGVSKEELLSVVKIVRHA
FT                   AFSGIVGAAEDVLKIIKEHEAK"
FT   gene            485811..486449
FT                   /locus_tag="Saut_0502"
FT   CDS_pept        485811..486449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0502"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR001450:IPR017900; KEGG: nis:NIS_0087
FT                   hypothetical protein; PFAM: 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; SPTR: B5IBX4 4Fe-4S binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08551"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP87"
FT                   /protein_id="ADN08551.1"
FT                   /translation="MAKDFSKTQWHGIEREEIPWFPTVDKVKCIGCELCFVTCGRDVYD
FT                   MVLPDGKHRKAEVLHPYNCMVGCTTCASVCPTHAISFPSQEIVWQAEKEHKIFSVVHKE
FT                   AKEKREKLQALQERNQQQSKPEKVTKQRVMIAGEFAEENFLKNLQEFIQDKAVDIVNLK
FT                   LEVPTLKGLLENTPAHMEFEVTSTKQEDIADFLNELRGLVNKSGLVWVK"
FT   gene            486468..487688
FT                   /locus_tag="Saut_0503"
FT   CDS_pept        486468..487688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0503"
FT                   /product="sulfide-quinone oxidoreductase"
FT                   /EC_number="1.8.5.-"
FT                   /note="COGs: COG1252 NADH dehydrogenase FAD-containing
FT                   subunit; InterPro IPR013027; KEGG: sun:SUN_0073
FT                   sulfide-quinone reductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: Q979D2 Putative
FT                   uncharacterized protein TVG1267449; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08552"
FT                   /db_xref="GOA:E0UP88"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP88"
FT                   /protein_id="ADN08552.1"
FT                   /translation="MKKVVILGAGFAGLHIFYKIRHLIGKKIDVTVIDSRSHSLLKPSL
FT                   PEVAFEGAPISHSLVELKHTLESRGAEFIQDEVVSIDEKNNSLSLKSGESVGYDYLMVT
FT                   LGALKDYDAIKGFREYGYSVCDDEQAQRLWERVKTFEGGKVVTGAAKSTWGTRVDAPPL
FT                   SAPCEGPIGEIMFMLDYYLDKDKGKKRAEDYSINVFTPGEVFFEDVGDTPREAIGKFMK
FT                   EYQMNLSNNKELTEIGKDFVAFEDGTKMDCDLAIIIPPYSAPQVLKDSNIGDEKGFIPT
FT                   DKTMRHLDFDNIFAAGDITALAQPKLGHVAIIQGGIAAASLMKELGEDVEIPPHDLSVF
FT                   CIMNMGGHNTTLIESNVLYGGNVDIGFYSPIAKMMKWGFDNYLYYNKGHMPPDLALEAT
FT                   DKLIKLL"
FT   gene            487701..487925
FT                   /locus_tag="Saut_0504"
FT   CDS_pept        487701..487925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0504"
FT                   /product="FeoA family protein"
FT                   /note="COGs: COG1918 Fe2+ transport system protein A;
FT                   InterPro IPR007167; KEGG: sun:SUN_1387 ferrous iron
FT                   transport protein A; PFAM: FeoA family protein; SPTR:
FT                   Q2NEE2 FeoA; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08553"
FT                   /db_xref="GOA:E0UP89"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP89"
FT                   /protein_id="ADN08553.1"
FT                   /translation="MNVTDLKPNQKAIIKHIGDLGDLSHRLVELGITCGEIIKLVRVAP
FT                   LGNPLEVKVHDERIVMRKEDAKKIEVEEL"
FT   gene            487922..490051
FT                   /locus_tag="Saut_0505"
FT   CDS_pept        487922..490051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0505"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterPro IPR011642:IPR002917:IPR011619:IPR011640:IPR
FT                   003373; KEGG: sun:SUN_1386 ferrous iron transport protein
FT                   B; PFAM: GTP-binding protein HSR1-related; nucleoside
FT                   recognition domain protein; Ferrous iron transport protein
FT                   B domain protein; Ferrous iron transport B domain protein;
FT                   SPTR: A5UKR6 Ferrous iron transport protein B, FeoB;
FT                   TIGRFAM: ferrous iron transport protein B; PFAM: Ferrous
FT                   iron transport protein B; Ferrous iron transport protein B
FT                   C terminus; Nucleoside recognition; TIGRFAM: ferrous iron
FT                   transporter FeoB; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08554"
FT                   /db_xref="GOA:E0UP90"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP90"
FT                   /protein_id="ADN08554.1"
FT                   /translation="MNIAFIGNPNTGKTALINAIAKSDLEVGNWPGVTVEKKEAHFKYE
FT                   NQEINLIDLPGIYTLTPYSLEEKVTVDYLLDNSIDGIINVLDATNLRRNLYLTLSLIDI
FT                   QKPMVLALNMFDDFKKRGYEVDTKKLSDILGVKIVPTIASKKIGSQKVLESTVETITDN
FT                   NLPKIQPLQHHIEKEIVFMEHKLQMIDNFNYSPRAFAIKLLEDDNFIKSLQLNESFKNV
FT                   IEFTKEARKRIEAHTQLPIKTIISNSRYSLIDKILDEVLSKPLMDKVVLSEKIDRIILN
FT                   KYLAFPIFILVMYMMFDFTFSLSMPLVDWMNNFFTDFIAKYITIVLYDSPEWVKGLVVD
FT                   GVLNGVGLLLSFLPLLFFLYLFMAILEESGYMSRVSFLLDALAKKLGVKGNAFISMIIG
FT                   FGCNVPAVYGTRVLTTKRERVITTLMIPFMSCSGRLPIYALFVAIFFKENQALTVLSIY
FT                   LLGIIAAFLVGFIANKLLPKQQEKPFFLELATYHMPNINSIWILMKPKLIDFIFKAGKF
FT                   IILASVILWVVISLPLNSTPQTSYLAKGAKTITPIFKPLGFGEHWELVAVLIPGTLAKE
FT                   VVVGSLGTIYGIESQNKMTEEKADIKNDIRSQMILLKNALRESIFNVVKIKPAITSDEH
FT                   VASKLQEVIKSQFSSKAAAYSYMIFILLYIPCISTMAAIQQEFGNAFMIFEIMFLPLFA
FT                   YTVSFVFYQVMLLFA"
FT   gene            490062..490382
FT                   /locus_tag="Saut_0506"
FT   CDS_pept        490062..490382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_1407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08555"
FT                   /db_xref="GOA:E0UP91"
FT                   /db_xref="InterPro:IPR025557"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP91"
FT                   /protein_id="ADN08555.1"
FT                   /translation="MWDFLTFNSFITQDVLLFFYYIGALVIPITLYYFRDYLMKNFSLF
FT                   KTVNDKVKDFYISLSATEQKVFWITFITLFLCMELCWRMIFEAMIGYFDMHDYLYEISK
FT                   KM"
FT   gene            490451..491674
FT                   /locus_tag="Saut_0507"
FT   CDS_pept        490451..491674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0507"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="COGs: COG2059 Chromate transport protein ChrA;
FT                   InterPro IPR003370:IPR014047; KEGG: pin:Ping_2327 chromate
FT                   transporter, chromate ion transporter (CHR) family protein;
FT                   PFAM: Chromate transporter; SPTR: Q58128 Putative
FT                   uncharacterized transporter MJ0718; TIGRFAM: chromate
FT                   transporter, chromate ion transporter (CHR) family; PFAM:
FT                   Chromate transporter; TIGRFAM: chromate transporter,
FT                   chromate ion transporter (CHR) family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08556"
FT                   /db_xref="GOA:E0UP92"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP92"
FT                   /protein_id="ADN08556.1"
FT                   /translation="MNAEKESKLQTTPSLLQLSWAFLIIGLTAYSVAMLQQLKTLVVGR
FT                   KWLSQKEMDEGLAMVQLYPGPIMFNLATYSAYRIKGFWGALIATFLFVLPSYLLMLFLS
FT                   WLYFNYGNVAWVHPLFIVLEAMVVGIIIHVSLDFATRYIDDGKTAFIAGIAFVLMLYKI
FT                   NAFWVILLAVVVGTMLFWRDKMNIDSEKNEQIQSVPIPGLWQWRLVSIVLSGSVFLAMI
FT                   VLGLLWKNELSLLFLSMFKVGAVAFGNGMTIMPLLQQEAVISHHWLSMKQFADGIAFGQ
FT                   ITPGPFLITATFIGYKVSGLIGSLLATVGMFYPSFFYTIVMSELYSKIKKYLFIRKVIK
FT                   GILAAFTGMLFFVVLSMGTVSLISPSVYIWAIGALIAVRYYEMNILWIFLTGIAVELGL
FT                   FLTGISIL"
FT   gene            491796..492617
FT                   /locus_tag="Saut_0508"
FT   CDS_pept        491796..492617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0508"
FT                   /product="protein of unknown function DUF980"
FT                   /note="COGs: COG3228 conserved hypothetical protein;
FT                   InterPro IPR010384; KEGG: sun:SUN_1033 hypothetical
FT                   protein; PFAM: protein of unknown function DUF980; SPTR:
FT                   A0YBS8 Putative uncharacterized protein; PFAM:
FT                   Phosphoenolpyruvate:glucose-phosphotransferase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08557"
FT                   /db_xref="GOA:E0UP93"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP93"
FT                   /protein_id="ADN08557.1"
FT                   /translation="MNYYFALLLLMISIGLTLFGAYFIYTFYKQKKLQNILAQPIRKEY
FT                   IDILDNIPLYGRLNEKEKQQIYKSILIFINTKEFVGINIGVTEEMKIVIAFHACLLLLH
FT                   VELVSCYENLATVLIYPHTMVAKQVSANGGIYTKGEFFLEGQSASDTVIVAWHDAKKDA
FT                   YHLHENNVMLHEFAHEIDFLDGSADGTPPLPYSKYHEWAKVLSQEFNKLSKVALRNRDW
FT                   GKYKLIGSYAATNEAEFFAVVTERYFEKSEALKKHFPELFKELNSFYKVYI"
FT   sig_peptide     491796..491855
FT                   /locus_tag="Saut_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            492632..493525
FT                   /locus_tag="Saut_0509"
FT   CDS_pept        492632..493525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0509"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG1230 Co/Zn/Cd efflux system component;
FT                   InterPro IPR002524; KEGG: sun:SUN_1408 cation efflux system
FT                   protein CzcD; PFAM: cation efflux protein; SPTR: A3XRG5
FT                   Cobalt/zinc/cadmium cation efflux pump protein; TIGRFAM:
FT                   cation diffusion facilitator family transporter; PFAM:
FT                   Cation efflux family; TIGRFAM: cation diffusion facilitator
FT                   family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08558"
FT                   /db_xref="GOA:E0UP94"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP94"
FT                   /protein_id="ADN08558.1"
FT                   /translation="MSEHHHHHDVSGKNLFITIVLNIIITLSQIVGGIFSGSLALLSDA
FT                   MHNFSDVLALLIAYVANRLAAKENTKAKTFGYKRAEIIAALFNASVLIGIAIFLIIEAF
FT                   HKFYHPEVINSIWVIGLGLLSIVLNAASVLLIKDDAHSNMNIKAAYLHLLTDVMTSVAV
FT                   VLGGVLMYFYQIFWIDPLISFLIALYLIWASFDLVKESSAILMQFTPKGIDIDEIVKFI
FT                   MQEKEIANVHHLHIWKLDDHRIHLEAHLDFNEDVTLSESNKVIDTLEKILHDTFGIEHT
FT                   TFQCEYNREDDKSLIV"
FT   gene            493579..494736
FT                   /locus_tag="Saut_0510"
FT   CDS_pept        493579..494736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0510"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: tdn:Suden_1777
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase; PRIAM: Methionine adenosyltransferase; SPTR:
FT                   Q30PN0 S-adenosylmethionine synthetase; TIGRFAM:
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase, C-terminal domain; S-adenosylmethionine
FT                   synthetase, central domain; S-adenosylmethionine
FT                   synthetase, N-terminal domain; TIGRFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08559"
FT                   /db_xref="GOA:E0UP95"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP95"
FT                   /protein_id="ADN08559.1"
FT                   /translation="MTKEYIFTSESVTEGHPDKMADQISDAILDYIIEHDANARVACET
FT                   MVSNGFCVIAGELKTTAYAPMQEIARQVIRDIGYTDATYGFDYRSAAVLNGIGEQSPDI
FT                   NQGVDQAGGEIGAGDQGLMFGYACRETDVLMPLPIHLSHRLTERLAAVRKEGIVPYLRP
FT                   DGKAQISVKYVGDKPVSVETVVISTQHAPEVSQEQIHKDVIEEVIRKVIPVQMMDENTV
FT                   FHINPTGKFVIGGPQGDAGLTGRKIIVDTYGGSCPHGGGAFSGKDPTKVDRSAAYAARW
FT                   VAKNLVAAGACDKVTIQVAYAIGVVQPVSIMVDTHNTGKVAEEKIEACVKDIFDLSPAG
FT                   IIKSLDLLKPIYRKTAAYGHFGREEAGFNWERTDKVDEIKEYLSI"
FT   gene            494854..495138
FT                   /locus_tag="Saut_0511"
FT   CDS_pept        494854..495138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0511"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR001450:IPR017900; KEGG: tdn:Suden_1776
FT                   4Fe-4S ferredoxin, iron-sulfur binding; PFAM: 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; SPTR: A2U2G8
FT                   Putative uncharacterized protein; PFAM: 4Fe-4S binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08560"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP96"
FT                   /protein_id="ADN08560.1"
FT                   /translation="MAVLITDTCINCGACIDECPVEAIVDEDDNPTGEEIYYVYGDKCV
FT                   ECVGHHDEPACATACPTEGCITWDAVGESPEHREDVSAEQRSNHEPVVE"
FT   gene            495271..495684
FT                   /locus_tag="Saut_0512"
FT   CDS_pept        495271..495684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0512"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="COGs: COG0105 Nucleoside diphosphate kinase;
FT                   InterPro IPR001564; KEGG: tdn:Suden_1775
FT                   nucleoside-diphosphate kinase; PFAM: nucleoside diphosphate
FT                   kinase; PRIAM: Nucleoside-diphosphate kinase; SMART:
FT                   nucleoside diphosphate kinase; SPTR: Q30PN2 Nucleoside
FT                   diphosphate kinase; PFAM: Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08561"
FT                   /db_xref="GOA:E0UP97"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP97"
FT                   /protein_id="ADN08561.1"
FT                   /translation="MERTLSIIKPDAVAKGVIGKILDRFESNGLKIAATKKLQLSRGDA
FT                   EAFYAIHAERPFFNDLVDFMISGPVVVSVLEGENAMQKNRDLMGATNPKEAEAGTIRAD
FT                   FAENIDANAVHGSDSVENAANEIAFFFAEREIS"
FT   gene            495694..496074
FT                   /locus_tag="Saut_0513"
FT   CDS_pept        495694..496074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1774 hypothetical protein; PFAM:
FT                   Uncharacterized ACR, COG1399"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08562"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP98"
FT                   /protein_id="ADN08562.1"
FT                   /translation="MRIVLRKVTKTPLDFEVVSNEIAFKGYLEYHSAKLILLKAKISGT
FT                   LEKSCDICAEDFDLMVNEDIEFFINDGIFEDDDSTLLDVVESLDGNVDIEELLRSEIEL
FT                   IKSDYHSCNNCRALVASAAQAK"
FT   gene            496163..496312
FT                   /locus_tag="Saut_0514"
FT   CDS_pept        496163..496312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0514"
FT                   /product="LSU ribosomal protein L32P"
FT                   /note="InterPro IPR002677; KEGG: tdn:Suden_1773 50S
FT                   ribosomal protein L32; PFAM: ribosomal L32p protein; SPTR:
FT                   Q30PN4 50S ribosomal protein L32; TIGRFAM: ribosomal
FT                   protein L32; PFAM: Ribosomal L32p protein family; TIGRFAM:
FT                   ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08563"
FT                   /db_xref="GOA:E0UP99"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E0UP99"
FT                   /protein_id="ADN08563.1"
FT                   /translation="MAVPKRRVSHSRSAKRRTHYKISLARPVKDKDGTYRLPHHINPTT
FT                   GEYK"
FT   gene            496316..497314
FT                   /locus_tag="Saut_0515"
FT   CDS_pept        496316..497314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0515"
FT                   /product="phosphate:acyl-(acyl carrier protein)
FT                   acyltransferase"
FT                   /note="COGs: COG0416 Fatty acid/phospholipid biosynthesis
FT                   enzyme; InterPro IPR003664:IPR012281; KEGG: tdn:Suden_1772
FT                   putative glycerol-3-phosphate acyltransferase PlsX; PFAM:
FT                   fatty acid synthesis plsX protein; SPTR: Q30PN5 Fatty
FT                   acid/phospholipid synthesis protein plsX; TIGRFAM: fatty
FT                   acid/phospholipid synthesis protein PlsX; PFAM: Fatty acid
FT                   synthesis protein; TIGRFAM: fatty acid/phospholipid
FT                   synthesis protein PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08564"
FT                   /db_xref="GOA:E0UPA0"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPA0"
FT                   /protein_id="ADN08564.1"
FT                   /translation="MVKIAIDAMGGDFGPEPIVNGCIKALKKKKFTPILVGNKSEILPL
FT                   LPKRYRDKILIIDCDDVIAMSDAATDAVKRKESSIYKAVDLVRDGVADGIVSAGHSGAT
FT                   MTLATLRLGRLKGVSRPALVTLMPTKTSRRSVLLDVGANVDSKPEHLAEFAVMGGCYAE
FT                   DVLGIKEPSIGLLANGEEASKGNEVTKAAFKLLEGYKGFKGNVEGGDIFNGSCDVITCD
FT                   GFVGNLVLKTGEGVASTISQLIKDYIKKSPIRITGALLMRKVFKLLKKEIDYAEIGGAP
FT                   LIGIKGCAIVSHGKSNARAIENAIYQAISYVDTGVNEHIITRLQELKQKEI"
FT   gene            497316..498314
FT                   /locus_tag="Saut_0516"
FT   CDS_pept        497316..498314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0516"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="COGs: COG0332 3-oxoacyl-(acyl-carrier-protein);
FT                   InterPro IPR013751:IPR013747:IPR004655; KEGG:
FT                   tdn:Suden_1771 3-oxoacyl-(acyl carrier protein) synthase
FT                   III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III domain protein; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III; PRIAM: Beta-ketoacyl-acyl-carrier-protein
FT                   synthase I; SPTR: Q30PN6 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase 3; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III C terminal; 3-Oxoacyl-[acyl-carrier-protein
FT                   (ACP)] synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08565"
FT                   /db_xref="GOA:E0UPA1"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPA1"
FT                   /protein_id="ADN08565.1"
FT                   /translation="MAYAAFRSIGAYVPQKILTNEELSHMVDTSDEWITKRTGIKERHI
FT                   ASKDEFTSDLGAKAAQKALDRSGIDKSEIDMVITATISPDYFCMPSTATVISTKLGIKN
FT                   ATAFDISAACTGFIYILAIAKSFIESGMKKNILIIGAEKLSAITDYSDRGTCILFGDGA
FT                   GAAVISATDNKSEAIIDVHTGADGEYADLLMTPNGGSGSAHDALDAEAGTCFMQMKGNE
FT                   TFKVAVRTLTKDVKEILEDNNIKSEDIKHFIPHQANLRIIKAVGDALKMRDDQVVITVE
FT                   KYGNTSGASIPMAINDLYEAGELEKGELMLLDAFGGGLTWGSALVPFSPLK"
FT   gene            complement(498493..498879)
FT                   /locus_tag="Saut_0517"
FT   CDS_pept        complement(498493..498879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0517"
FT                   /product="HIT family protein"
FT                   /note="InterPro IPR001310; KEGG: tdn:Suden_1768 HIT family
FT                   protein; SPTR: B9TJQ5 Putative uncharacterized protein;
FT                   PFAM: HIT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08566"
FT                   /db_xref="GOA:E0UPA2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPA2"
FT                   /protein_id="ADN08566.1"
FT                   /translation="MTQVPIFENAHLYVEKEASEIPWLKIFTKEPYKELGDVPKELRLQ
FT                   LFEVFDIIEDEMKKYYKPTKINMASFANMLPRVHLHVMARFENDSYFPNPMWGAKLRDA
FT                   DLDLPDEEEFHKRVVEALKQLSLD"
FT   gene            complement(498879..500435)
FT                   /locus_tag="Saut_0518"
FT   CDS_pept        complement(498879..500435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0518"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG0513 Superfamily II DNA and RNA helicase;
FT                   InterPro IPR001650:IPR011545:IPR014001:IPR014021:IPR
FT                   000629:IPR014014; KEGG: tdn:Suden_1767 DEAD/DEAH box
FT                   helicase-like; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; SPTR: Q81IT9 DEAD-box
FT                   ATP-dependent RNA helicase cshA; PFAM: Helicase conserved
FT                   C-terminal domain; DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08567"
FT                   /db_xref="GOA:E0UPA3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPA3"
FT                   /protein_id="ADN08567.1"
FT                   /translation="MQENAQQTNKQTTNEEPTITFDSLGLKPEILKSVKFAGFTIPSPI
FT                   QAQAIPIILEGRDMVGQAHTGTGKTAAFSLPVLSNMKLDGSVEMLVITPTRELATQVSD
FT                   EIFKYGRNLGVKTVTVYGGSSYKRQLDLIGRGASVVVATPGRMLDLLKRNMLNNFAPSV
FT                   VVLDEADEMLDMGFLDDINEIFSYLPTNRQTLLFSATMPQPIKNLANRILKDPAFVSIT
FT                   KGETTNTDIEQEYYVIDEHERDDAIIRLMDAEDTKKAVVFCRTKSEVDRLSNVLSNAGY
FT                   LANGLHGDMEQRQRETVIKGFKNDSVKVLVATDVAARGIHVNNISHVFNYHIPFDPESY
FT                   VHRIGRTGRAGTKGKAITLLTPLEFKELQRIKQKVGTSMNHAFVPSKNDLKASTVDKMV
FT                   KSIEDQKIYDEAHKVLDRLKEDIDEETIMFKLISMILDRQDIKGPSNIGIPADKLTAIL
FT                   ERASKRNDSRGRNGRSRGGFRGNSRNRSGGDRNRSGGERNRDGGGYRGNRSSSNRNRNR
FT                   D"
FT   gene            500686..501975
FT                   /locus_tag="Saut_0519"
FT   CDS_pept        500686..501975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0519"
FT                   /product="protein of unknown function DUF195"
FT                   /note="COGs: COG1322 conserved hypothetical protein;
FT                   InterPro IPR003798; KEGG: vsp:VS_0097 DNA recombination
FT                   protein RmuC homolog; PFAM: protein of unknown function
FT                   DUF195; SPTR: A3UP54 Putative uncharacterized protein;
FT                   PFAM: RmuC family"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08568"
FT                   /db_xref="GOA:E0UPA4"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPA4"
FT                   /protein_id="ADN08568.1"
FT                   /translation="MNENIYFAVIAFLVLSFLIVLFFYFKEKNMNQRLHVKAEELQNSY
FT                   FTISNSYEQLKEDYNALEIEYAVLSARYTDEMKASSEKLEVLKNAKDELSQEFKLLANK
FT                   IFEDKSKQFTSSNKEQLELLLKPFREQITNFSKEARSQFEVELKERHLLKDELGRLKLM
FT                   NETLAQEALNLTNALKGENKTQGNWGELVLENILEQSGLREGVEYELQATLKSNEGKAY
FT                   RPDVIIHMPQNRDIIVDSKVSLTAYERFVNVEEPEQKAKALKEHIASISSHIKELSAKN
FT                   YEKLEGVNTLDFVLLFMPIEGAFLLALEQDGEFFKRAYENNILVVSPSTLLVTLRTIEH
FT                   IWRTQRQEEHAKKIAAEAEAMYDKLVLFVDEMKHIGTHLQKTQDSYDKAMNRLSTGRGN
FT                   VIKRAQNMKALGLKPKKELPLQSENDMEEV"
FT   gene            501972..502163
FT                   /locus_tag="Saut_0520"
FT   CDS_pept        501972..502163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08569"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPA5"
FT                   /protein_id="ADN08569.1"
FT                   /translation="MKIETRYNYEKVWTLTQEKDLLKIIEEEVGSSDGAQGTLVYIKEA
FT                   IKNGKEISVGTCKFRLQK"
FT   gene            502175..502561
FT                   /locus_tag="Saut_0521"
FT   CDS_pept        502175..502561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0521"
FT                   /product="DoxX family protein"
FT                   /note="InterPro IPR011637; KEGG: tdn:Suden_1765 DoxX; PFAM:
FT                   DoxX family protein; SPTR: A3JBC4 Putative uncharacterized
FT                   protein; PFAM: DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08570"
FT                   /db_xref="GOA:E0UPA6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPA6"
FT                   /protein_id="ADN08570.1"
FT                   /translation="MFINPDIAKLLLRVSLGVLILFHGIHKVIHGIGGVKSMVVSAGLP
FT                   EFFAYGVYVGELIAPIFIILGLYARVASTVLALNMFVAIYLAYGFSLTLSKFGGLAWET
FT                   PLFYFIMSLLVVLLGSGKYAVNSK"
FT   gene            complement(502646..503203)
FT                   /locus_tag="Saut_0522"
FT   CDS_pept        complement(502646..503203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0522"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="COGs: COG1183 Phosphatidylserine synthase; InterPro
FT                   IPR000462; KEGG: tdn:Suden_1764 CDP-alcohol
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; SPTR: A3SV40
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08571"
FT                   /db_xref="GOA:E0UPA7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPA7"
FT                   /protein_id="ADN08571.1"
FT                   /translation="MKFLWTPSSHFNLANMFTFVNITAGLMATYFITQNNFTLAIILAW
FT                   IGGAFDIFDGKIARKYKLSNEFGVQLDSFADFLSFVLVPVFLIFQASYAPSLHGFWLIV
FT                   AAIVSIYYVISGLRRLIHFNLNADAGAIEKYFTGVPTPLGAILLWLVYLLNAYNILPAY
FT                   GVMFCMLVIGWSLNSTIKVRHP"
FT   gene            503359..504630
FT                   /locus_tag="Saut_0523"
FT   CDS_pept        503359..504630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1763 hypothetical protein; SPTR:
FT                   A0Y8F3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08572"
FT                   /db_xref="GOA:E0UPA8"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPA8"
FT                   /protein_id="ADN08572.1"
FT                   /translation="MSNIIKVSIFCLSLFTALAAAEQEIGEDKRLHSVRENIDKEAVME
FT                   VKEVSVTDNLKHMFKDAKVSGQIRAMYAGYEQKEQNVDNNYATALGGKLKYELAQLQGF
FT                   NAGVAFYTSHDLNFASGDNTYHNNELSSSDGSYTQTAEAYLNYKYQDFNFRAGRQVLDT
FT                   PLADSDDIRMISNSFEAYVATYNYNGFEFMAGNIQSWQGYDAGLDTPWEKTGKNGTNFG
FT                   GVAYNNVWELNLWYYNITDVVNAFYFDGGIEYNINKDILIHAMVQYLDENELALSGYES
FT                   TIYGAMAEFVSHGVSVGIAYNKSFGTQSKMSFSGFGGGTLFTSMDTLILDDIADDRDTH
FT                   SLVPSIGYEIQNFSFLYAYGDFKGDADSLGKKAHIIEQDVSLEYNVNDEFLVACVYAMQ
FT                   EDKANSVKTDHDWNRFQLMVNYNF"
FT   sig_peptide     503359..503421
FT                   /locus_tag="Saut_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            504643..504870
FT                   /locus_tag="Saut_0524"
FT   CDS_pept        504643..504870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0524"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167; KEGG: tdn:Suden_1762
FT                   hypothetical protein; PFAM: FeoA family protein; PFAM: FeoA
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08573"
FT                   /db_xref="GOA:E0UPA9"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPA9"
FT                   /protein_id="ADN08573.1"
FT                   /translation="MKRLIDCEKGEKVKVLKLDANYDLKQRLISFGVMKDAQIQVLEHA
FT                   PRKKTIEVKVGKMRIALRAEEAELIEVEEV"
FT   gene            504867..507008
FT                   /locus_tag="Saut_0525"
FT   CDS_pept        504867..507008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0525"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterPro IPR011642:IPR002917:IPR011619:IPR011640:IPR
FT                   005225:IPR003373; KEGG: tdn:Suden_1761 ferrous iron
FT                   transport protein B; PFAM: Ferrous iron transport protein B
FT                   domain protein; GTP-binding protein HSR1-related;
FT                   nucleoside recognition domain protein; Ferrous iron
FT                   transport B domain protein; SPTR: O25396 Ferrous iron
FT                   transport protein B; TIGRFAM: ferrous iron transport
FT                   protein B; small GTP-binding protein; PFAM: Ferrous iron
FT                   transport protein B; Ferrous iron transport protein B C
FT                   terminus; Nucleoside recognition; TIGRFAM: ferrous iron
FT                   transporter FeoB; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08574"
FT                   /db_xref="GOA:E0UPB0"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPB0"
FT                   /protein_id="ADN08574.1"
FT                   /translation="MNEDVKTCPIIANHIKVALVGQPNVGKSMLINSVSNAHLHVGNFS
FT                   GVTVDKTEVLFDYKNYHFTVVDLPGTYAFTDYTIEERVTRDYLCAEDYDIIINVVDSTN
FT                   LEKNLQLTAELFTMSKKMVIALNMSDEAEKEGIEVNAEYMSELLNIPCVKVSAAQKTGI
FT                   EELINTVVKVHEKPKAEPKLVFSEAVEEETENIVTYLQKHKYEATNSYRNIATNLLKEN
FT                   KKTYEKLHDNPIWTELQPILIEASKHIELHHNTDDIKEAFAEEYASFNRGIVAEVVKVK
FT                   KQEKEEKTLTEKIDSILIHPVYGIPIFLFLMWGLFQLTFVLGAVPMDWIDAFFGWFGDA
FT                   VGATITNDDMRSLIVDGLIAGVGAVILFTPNIIILFIGIALLESTGYMSRVAFLLDGFF
FT                   HKFGLHGQSFIPLVTGFGCSIPAYMSARILKNDRDRLLTLFIISFMSCGARLPVYVLFA
FT                   GAFFSESIAGNVLFAIYITGAMLGLIAAKVLKMTAFKGEDEPFVMEMPKYRLPSAKLIW
FT                   HTVLSKTLMYLKKAGTFIAGATVLIWFLSNYPHDTQLEKSYEAKIAQVQSKEEKNKLTN
FT                   ELASKNLEQSYLGRIGAFSEPVFRPLGLDWKMAVALEAGLSAKEVVVSTLGVLYALGEN
FT                   VDETTYSLKDAISKNISFASAVAFIVIIMVYLPCFAASIVFTREAGGIKYFFYLLAFTT
FT                   ITAYVLAFLAYHITLLLGY"
FT   gene            507042..507704
FT                   /locus_tag="Saut_0526"
FT   CDS_pept        507042..507704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0526"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR001867; KEGG: tdn:Suden_1759
FT                   two component transcriptional regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator domain
FT                   protein; SMART: response regulator receiver; SPTR: A3J9V5
FT                   Response regulator consisting of a CheY-like receiver
FT                   domain and a winged-helix DNA-binding domain; PFAM:
FT                   Response regulator receiver domain; Transcriptional
FT                   regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08575"
FT                   /db_xref="GOA:E0UPB1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPB1"
FT                   /protein_id="ADN08575.1"
FT                   /translation="MQKILMIEDDLELAEILTEYLEQFEFEVITEDDPFKAVSILKLEP
FT                   FDLVILDLTLPGMDGLEVCEAIRERQDIPIIISSARSDVTDKIKALELGADDYLPKPYD
FT                   PRELEARIHSVLRRYEAKSEEKAESKSDFKCDKSTMTISYKGRNIDLTNAEFGILSYMI
FT                   SKQGLVVSREDLIHNVNAINEDSSNKSIDVMVGRIRNKLGDKSLIESVRGVGYKLLK"
FT   gene            507701..508981
FT                   /locus_tag="Saut_0527"
FT   CDS_pept        507701..508981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0527"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR003660:IPR005467; KEGG: tdn:Suden_1758
FT                   histidine kinase; PFAM: histidine kinase HAMP region domain
FT                   protein; SPTR: A1BZN4 Sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08576"
FT                   /db_xref="GOA:E0UPB2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPB2"
FT                   /protein_id="ADN08576.1"
FT                   /translation="MIKRHAVLLTVLFALTVSLVSLSAIFWEFYKLNKEQYINHIFTKY
FT                   SVITQIYREHQQRQSSEIMLEANLAVYNLEVTKDEKLKKEIFEKGKILKREGFKSFNTS
FT                   LLINDKGLYTKNVVTNLRATMIQYKRNIYFHIETPNGDILIKDNELKPYSYINLLYSYI
FT                   TIFMIISLSFILILQRLRPLIRLRKKIELYGNGNMDISFKTNRDDEIGAVANELEHARQ
FT                   KINTILESRTLFLRNLMHELKTPIAKGTIATQMLDSQKQRDRFSSIFKRLETLVTEFAM
FT                   IEEVTSLDDKKDFSEYRLLDVIDGAIDMAMVDKEHVTMKISGKIKVHVNYRLYTTAIKN
FT                   MIDNAMKYSTDSHITILMNDKNELCFESKGECLAHPLQYYIEPFTKENPSKNSFGLGLY
FT                   LVDSILKAHGEVLAHEYENGVNRFIFA"
FT   sig_peptide     507701..507769
FT                   /locus_tag="Saut_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            509005..510414
FT                   /locus_tag="Saut_0528"
FT   CDS_pept        509005..510414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0528"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="COGs: COG4623 soluble lytic transglycosylase fused
FT                   to an ABC-type amino acid-binding protein; InterPro
FT                   IPR001638:IPR008258:IPR000189; KEGG: tdn:Suden_1757 lytic
FT                   transglycosylase, catalytic; PFAM: Lytic transglycosylase
FT                   catalytic; extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; SPTR:
FT                   Q30PQ0 Membrane-bound lytic murein transglycosylase F;
FT                   PFAM: Transglycosylase SLT domain; Bacterial extracellular
FT                   solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08577"
FT                   /db_xref="GOA:E0UPB3"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023703"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPB3"
FT                   /protein_id="ADN08577.1"
FT                   /translation="MNKYLDSFLLLFFALSFFAFGWLSHTAYVPYIKKEELSTLDRIKQ
FT                   AKNLNVVLLNAPSTYYIGTEGPQGFEYDLLQSYADHLGVDLNITAAHTIKEAIELSKNP
FT                   NIHITSASLAKTPQREQKFHFGPSYFEVQEQVICNRGMLRSSKFPRDVEDLAGLSIMVG
FT                   DDTSYSETIKSLQADGFEINATTTSEYSTEELLEKVANHEIDCTIADSNIYALNLRYFP
FT                   EIALAFSVSGREQLAWLLPKNEKKLEADMYAWLNDYNQKGMMTQLKDHYYSYILFFDYY
FT                   NTKMFYKRMKSRLPKYEKYFQSAAKKFKIPWTLLASVAYQESHWNPRAKSFTGVRGLMM
FT                   LTKRTAKILGVKNRLNPKQSVIGGTRHLKQMIKFVPKEVEGENRLKFALAAYNIGMGHI
FT                   KDAQRLAKKLGLNQNVWSDLKIVLPLLSQKKYYRNLKYGYARGAEPVKYVESIYNYKDI
FT                   LDKQKKALVIP"
FT   sig_peptide     509005..509067
FT                   /locus_tag="Saut_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(510400..510717)
FT                   /locus_tag="Saut_0529"
FT   CDS_pept        complement(510400..510717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0529"
FT                   /product="iojap-like protein"
FT                   /note="COGs: COG0799 Iojap protein; InterPro IPR004394;
FT                   KEGG: tdn:Suden_1756 iojap-related protein; PFAM:
FT                   Iojap-related protein; SPTR: A3UHR2 Iojap-related protein;
FT                   TIGRFAM: iojap-like protein; PFAM: Domain of unknown
FT                   function DUF143; TIGRFAM: iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08578"
FT                   /db_xref="GOA:E0UPB4"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPB4"
FT                   /protein_id="ADN08578.1"
FT                   /translation="MQNRIQKIADTLDKNKAESIEVFDLRDKNYFVDYAIIASSLGQKH
FT                   TTALLDHLKNDLKPEEHFNNVDESGDWVVVDLGDILIHIMTPEYRIKYDMETFLGELGN
FT                   H"
FT   gene            complement(510677..511249)
FT                   /locus_tag="Saut_0530"
FT   CDS_pept        complement(510677..511249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0530"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COGs: COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase; InterPro
FT                   IPR004820:IPR004821:IPR005248; KEGG: tdn:Suden_1755
FT                   nicotinate-nucleotide adenylyltransferase; PFAM:
FT                   cytidylyltransferase; PRIAM: Nicotinate-nucleotide
FT                   adenylyltransferase; SPTR: Q30PQ2 Probable
FT                   nicotinate-nucleotide adenylyltransferase; TIGRFAM:
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Cytidylyltransferase; TIGRFAM: nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08579"
FT                   /db_xref="GOA:E0UPB5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPB5"
FT                   /protein_id="ADN08579.1"
FT                   /translation="MKTIALYGGSFDPPHLAHEAIVKALRELDFIDKVVVMPTFLNPFK
FT                   ETFTAPAELRLQWLKDIFSSYEDVQVSSYEVDLKKKVPTIETVKYLLNSYDKVYLIIGA
FT                   DNLKSLHQWYKFDALKRVVTFIVVTRDEIAIPKNFIRLDLHEDISSSDLRKNFDSLKIP
FT                   KKVRDKITQYYKEHNAKQNTKNSRYTR"
FT   gene            511311..512312
FT                   /locus_tag="Saut_0531"
FT   CDS_pept        511311..512312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0531"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="COGs: COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase; InterPro
FT                   IPR000173:IPR006424; KEGG: tdn:Suden_1754
FT                   glyceraldehyde-3-phosphate dehydrogenase; PFAM:
FT                   glyceraldehyde 3-phosphate dehydrogenase; PRIAM:
FT                   Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating);
FT                   SPTR: A3I3G7 Glyceraldehyde-3-phosphate dehydrogenase, type
FT                   I; TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase, type
FT                   I; PFAM: Glyceraldehyde 3-phosphate dehydrogenase,
FT                   C-terminal domain; Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NAD binding domain; TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08580"
FT                   /db_xref="GOA:E0UPB6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPB6"
FT                   /protein_id="ADN08580.1"
FT                   /translation="MALKIAINGFGRIGRCVARIAHKRDDVEVVAINDTASIDMMMYLL
FT                   KNDSVHGTFESEVVQLDDENIAIDGKKIRVFSDRDPKNLKFADCGADMVLECTGVFLTQ
FT                   ESAQVHIDNGIQKVLFSAPAKDKATPTFVMGVNEEKYAGQKIVSNASCTTNCLGPVARV
FT                   LDDAFGIEKGLMTTIHSYTNDQNILDVKHTKDKRRARAGAINMIPTTTGAAKAISLVMP
FT                   QLEGKLHGQSVRVPTPDVSMVDLNVVVSKNTTKEEVTAVFNEMANTRLKGLLLMDKEMR
FT                   VSQDFVGCNYSSIVAEDLTQVIGGNMIKVMAWYDNEWGYSSRLLDMALHISK"
FT   gene            512321..513532
FT                   /locus_tag="Saut_0532"
FT   CDS_pept        512321..513532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0532"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COGs: COG0126 3-phosphoglycerate kinase; InterPro
FT                   IPR001576:IPR015911; KEGG: tdn:Suden_1753 phosphoglycerate
FT                   kinase; PFAM: phosphoglycerate kinase; PRIAM:
FT                   Phosphoglycerate kinase; SPTR: Q30PQ4 Phosphoglycerate
FT                   kinase; PFAM: Phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08581"
FT                   /db_xref="GOA:E0UPB7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPB7"
FT                   /protein_id="ADN08581.1"
FT                   /translation="MELLQLKKLNLKDKKVFIRCDFNVPMDEFGNIADDRRIRSAISTI
FT                   NYCLDQDCAVILASHFGRPKSEVVEKYSMAPIARRLQQLLKRHVELAPGVVDDVTMQIA
FT                   RKLPRHEVLLLENLRFEPGETKDDEELSKKLASMAEFYVNDAFGVSHRAHASVHGITKF
FT                   FDNEHKAAGFLLEREINFFSKLMNNPVRPFAAIVGGSKVSGKLEALVNLLPKVDKIFIG
FT                   GGMAFTFLKQMGYEIGASLVEDDLLEEAQHIMDEAKKLGVKFYLPVDVVAAQKFSEDSV
FT                   SKIVTAQEIPHEWMGLDIGPATVRLYREGLNDVQTILWNGPMGVYEMDKFARGSSKIAH
FT                   FVADSYSTTVVGGGDTADLVQRVGVDEDISFISTGGGASLELLEGKTLPGVEPLMIKMT
FT                   QTKD"
FT   gene            513536..514240
FT                   /locus_tag="Saut_0533"
FT   CDS_pept        513536..514240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0533"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="COGs: COG0149 Triosephosphate isomerase; InterPro
FT                   IPR000652; KEGG: tdn:Suden_1752 triosephosphate isomerase;
FT                   PFAM: triosephosphate isomerase; SPTR: Q30PQ5
FT                   Triosephosphate isomerase; TIGRFAM: triosephosphate
FT                   isomerase; PFAM: Triosephosphate isomerase; TIGRFAM:
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08582"
FT                   /db_xref="GOA:E0UPB8"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPB8"
FT                   /protein_id="ADN08582.1"
FT                   /translation="MIIAANLKTNLTRSATHEYIKQLQTCVQNSSQEVLVFPATSSLDG
FT                   YDTKITIGAQNAYPVEHGAFTGEIGLDHLNEFGIKTILIGHSERRHILGESQEFIAKKF
FT                   DYFKEQGFKIVYCVGEPLAVRESSKEEMLTYIYNQYEGIDTEYENLVIAYEPVWAIGTG
FT                   KVPTLEDIQDIHKELKKKSSAPLLYGGSVKVNNVKDILKVENVDGVLVGSAALYADHFC
FT                   SMIQAAEELGKN"
FT   gene            514308..515129
FT                   /locus_tag="Saut_0534"
FT   CDS_pept        514308..515129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0534"
FT                   /product="Enoyl-(acyl-carrier-protein) reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /note="COGs: COG0623 Enoyl-(acyl-carrier-protein); InterPro
FT                   IPR002347; KEGG: tdn:Suden_1751 enoyl-(acyl carrier
FT                   protein) reductase; SPTR: O24990
FT                   Enoyl-[acyl-carrier-protein] reductase [NADH]; PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08583"
FT                   /db_xref="GOA:E0UPB9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPB9"
FT                   /protein_id="ADN08583.1"
FT                   /translation="MLMKGKKGLIVGLANNKSIAYGIAKACAAQGAEMAFTYLNDALKK
FT                   RVEPIAKEFGSEYVYELDVSNEEHMSGIAAKIEKDFGKIDFLVHSVAFAPKEALSEPFM
FT                   KTTKQAFQIAMDISVYSFIDLTNRLESVLSDDASILTLSYLGGPKYIVNYNVMGVAKAA
FT                   LESSVRYMAVDLGKKGQRVNAISAGPIRTLAAAGIGDFKQILNWNEVNAPLKKNVTIDE
FT                   VGNSAMYLLSDLSSGVTGEIHYVDAGYNIMGMAMAETNEEGKTVLSWDACK"
FT   gene            complement(515148..515588)
FT                   /locus_tag="Saut_0535"
FT   CDS_pept        complement(515148..515588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08584"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPC0"
FT                   /protein_id="ADN08584.1"
FT                   /translation="MKQLITTSLTASLFILLSGCATDAPVAPSQNSDLNKITNSNGKEK
FT                   PGLIQKSLDSWLKNEWTLTVNKDKKVQKKYLKKADGSLSKDTNNSTEKIDNDTEVKYVE
FT                   KEDRNFTLQEYIDKASAYMKVHPSDDKDSNVQKLESMPVIGK"
FT   sig_peptide     complement(515526..515588)
FT                   /locus_tag="Saut_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            515696..516973
FT                   /locus_tag="Saut_0536"
FT   CDS_pept        515696..516973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08585"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPC1"
FT                   /protein_id="ADN08585.1"
FT                   /translation="MKFTKMSLVAALLIGSSAFAIENTKVSGDANLFYNTTDAGSNSLF
FT                   DKDNSAADTAINLNVTTDLIKNSTVAVSAGAGYTVLSTLGLEQNLVSSVWGGAHGIKGN
FT                   SSSRGAHVSTPNWMTEAWLAATAGKTTAKIGRMELDTPLAFTETWTIEKNTFEAAVVIN
FT                   QDVPDTTLVGAYVGNGNGTESLGGSTMPQGPVAMGAVVNQDGAFDTYGKSGAYAIGVVN
FT                   NSFKPLTAQAWYYNVTAVADAYWLQADLDAGSLGAEGLTAGVQYTSVKSVASGAKADNV
FT                   YAVKLGYEMKDLFAASIAYSSVNDNGTIGYAGFNTATAAGTAQSKLYTEAWWNYGKITQ
FT                   TDTDAYNITITSPVQGLFDLGLYYTDADQTAAAGDNDMTEFTLTAGKSFGPLDATLAYI
FT                   YSDVKTATVGDDETTNAIQAYLTLNF"
FT   sig_peptide     515696..515755
FT                   /locus_tag="Saut_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            517087..518046
FT                   /locus_tag="Saut_0537"
FT   CDS_pept        517087..518046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0537"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: tdn:Suden_1749 binding-protein dependent transport
FT                   system inner membrane protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: P42062 Oligopeptide transport system
FT                   permease protein appB; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08586"
FT                   /db_xref="GOA:E0UPC2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPC2"
FT                   /protein_id="ADN08586.1"
FT                   /translation="MQTLIKKLSYIIFMLLLISIISFLAIHAAPNSFFGAGELNPNMTK
FT                   EAIEKLKAVYGLDKPLFAQYIDWIKNLLTLNFGISFVSGQDVSSEILKRLPITLWMNII
FT                   SLVVVFVLSLYLGIKAALSFEKKSDYIIRQISLVSFSMPSFYLALLLIIVFSIKLEWFP
FT                   IAGLHAIEPKEGFANYIDMAWHVTLPIAVMIFTGLGSMIIYVRSLTLEILKSDYYFFAL
FT                   SRGLQEKELLRYYILPNLMPPIITLLGLSLPGLIGGSVILESIFGIEGMGQLFYISALS
FT                   RDYPIIMGILMITALLTLLGNMIADLILVKLNPYMSRG"
FT   sig_peptide     517087..517170
FT                   /locus_tag="Saut_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(518180..519316)
FT                   /locus_tag="Saut_0538"
FT   CDS_pept        complement(518180..519316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0538"
FT                   /product="NusA antitermination factor"
FT                   /note="COGs: COG0195 Transcription elongation factor;
FT                   InterPro IPR013735:IPR004088:IPR003029:IPR010213; KEGG:
FT                   tdn:Suden_1748 transcription elongation factor NusA; PFAM:
FT                   NusA domain protein; SPTR: Q9ZJA6 Transcription elongation
FT                   protein nusA; TIGRFAM: transcription termination factor
FT                   NusA; PFAM: NusA N-terminal domain; TIGRFAM: transcription
FT                   termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08587"
FT                   /db_xref="GOA:E0UPC3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPC3"
FT                   /protein_id="ADN08587.1"
FT                   /translation="MEKILDIAEAIGHEKGLQPEKVMEALKTAFVQTAKRVIGQNFAFE
FT                   AQIDEDTKNIKIVQTITVVADDDEKLQDEEVAPAYISLTEAREYDDQVELGDQLQIDHD
FT                   LEDYGRTAASQLHREIEYHIQRLVEDEIYNKYKSKVGTLVSGRVTRVDAQNNTYIEVDE
FT                   IRAVLPMKSRIKGEIFDVGDHIKAVVRRVNMDKENGMQIELSRTSPKFLEALLELEVPE
FT                   IAEGSVIIEKAARIPGERAKIALLSTHPQVDAVGATVGVKGVRINAVSQELIGENIDCI
FT                   EYTTIPELFVSRTMSPAIISHVEIVKNEEGENEKAIITLPADQKSKAIGKSGINIRLAS
FT                   MLTGMQIELLENDAVTTNEDGTVEEKKENVDALEALFS"
FT   gene            519615..519860
FT                   /locus_tag="Saut_0539"
FT   CDS_pept        519615..519860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Saut_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADN08588"
FT                   /db_xref="InterPro:IPR040748"
FT                   /db_xref="UniProtKB/TrEMBL:E0UPC4"
FT                   /protein_id="ADN08588.1"
FT                   /translation="MDLKFARTDLDAKPKKADLAKLDAEVAKNDSIIFYFDRENSHKDL
FT                   LELQDHYEAMGKSFYMSEVKYGLSDNDYMYQVHIMS"
FT   gene            519871..521175
FT                   /locus_tag="Saut_0540"
FT   CDS_pept        519871..521175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Saut_0540"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="COGs: COG0621 2-methylthioadenine synthetase;
FT                   InterPro IPR007197:IPR002792:IPR013848:IPR006638:IPR
FT                   005839:IPR006463; KEGG: tdn:Suden_1746 tRNA-i(6)A37
FT