(data stored in SCRATCH9089 zone)

EMBL: CP002209

ID   CP002209; SV 1; circular; genomic DNA; STD; PRO; 4279159 BP.
XX
AC   CP002209;
XX
PR   Project:PRJNA30799;
XX
DT   27-SEP-2010 (Rel. 106, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Ferrimonas balearica DSM 9799, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Ferrimonas balearica DSM 9799
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Ferrimonadaceae; Ferrimonas.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4279159
RX   PUBMED; 21304747.
RA   Nolan M., Sikorski J., Davenport K., Lucas S., Del Rio T.G., Tice H.,
RA   Cheng J.F., Goodwin L., Pitluck S., Liolios K., Ivanova N., Mavromatis K.,
RA   Ovchinnikova G., Pati A., Chen A., Palaniappan K., Land M., Hauser L.,
RA   Chang Y.J., Jeffries C.D., Tapia R., Brettin T., Detter J.C., Han C.,
RA   Yasawong M., Rohde M., Tindall B.J., Goker M., Woyke T., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.,
RA   Lapidus A.;
RT   "Complete genome sequence of Ferrimonas balearica type strain (PAT)";
RL   Stand Genomic Sci 3(2):174-182(2010).
XX
RN   [2]
RP   1-4279159
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Davenport K., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Tindall B., Faehnrich R., Schneider S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Ferrimonas balearica DSM 9799";
RL   Unpublished.
XX
RN   [3]
RP   1-4279159
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Davenport K., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Tindall B., Faehnrich R., Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (15-SEP-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; b662621036bf282ea787b27f76fe0660.
DR   BioSample; SAMN00115627.
DR   CABRI; DSM 9799.
DR   EnsemblGenomes-Gn; EBG00001036915.
DR   EnsemblGenomes-Gn; EBG00001036916.
DR   EnsemblGenomes-Gn; EBG00001036917.
DR   EnsemblGenomes-Gn; EBG00001036918.
DR   EnsemblGenomes-Gn; EBG00001036919.
DR   EnsemblGenomes-Gn; EBG00001036920.
DR   EnsemblGenomes-Gn; EBG00001036921.
DR   EnsemblGenomes-Gn; EBG00001036922.
DR   EnsemblGenomes-Gn; EBG00001036923.
DR   EnsemblGenomes-Gn; EBG00001036924.
DR   EnsemblGenomes-Gn; EBG00001036925.
DR   EnsemblGenomes-Gn; EBG00001036926.
DR   EnsemblGenomes-Gn; EBG00001036927.
DR   EnsemblGenomes-Gn; EBG00001036928.
DR   EnsemblGenomes-Gn; EBG00001036929.
DR   EnsemblGenomes-Gn; EBG00001036930.
DR   EnsemblGenomes-Gn; EBG00001036931.
DR   EnsemblGenomes-Gn; EBG00001036932.
DR   EnsemblGenomes-Gn; EBG00001036933.
DR   EnsemblGenomes-Gn; EBG00001036934.
DR   EnsemblGenomes-Gn; EBG00001036935.
DR   EnsemblGenomes-Gn; EBG00001036936.
DR   EnsemblGenomes-Gn; EBG00001036937.
DR   EnsemblGenomes-Gn; EBG00001036938.
DR   EnsemblGenomes-Gn; EBG00001036939.
DR   EnsemblGenomes-Gn; EBG00001036940.
DR   EnsemblGenomes-Gn; EBG00001036941.
DR   EnsemblGenomes-Gn; EBG00001036942.
DR   EnsemblGenomes-Gn; EBG00001036943.
DR   EnsemblGenomes-Gn; EBG00001036944.
DR   EnsemblGenomes-Gn; EBG00001036945.
DR   EnsemblGenomes-Gn; EBG00001036946.
DR   EnsemblGenomes-Gn; EBG00001036947.
DR   EnsemblGenomes-Gn; EBG00001036948.
DR   EnsemblGenomes-Gn; EBG00001036949.
DR   EnsemblGenomes-Gn; EBG00001036950.
DR   EnsemblGenomes-Gn; EBG00001036951.
DR   EnsemblGenomes-Gn; EBG00001036952.
DR   EnsemblGenomes-Gn; EBG00001036953.
DR   EnsemblGenomes-Gn; EBG00001036954.
DR   EnsemblGenomes-Gn; EBG00001036955.
DR   EnsemblGenomes-Gn; EBG00001036956.
DR   EnsemblGenomes-Gn; EBG00001036957.
DR   EnsemblGenomes-Gn; EBG00001036958.
DR   EnsemblGenomes-Gn; EBG00001036959.
DR   EnsemblGenomes-Gn; EBG00001036960.
DR   EnsemblGenomes-Gn; EBG00001036961.
DR   EnsemblGenomes-Gn; EBG00001036962.
DR   EnsemblGenomes-Gn; EBG00001036963.
DR   EnsemblGenomes-Gn; EBG00001036964.
DR   EnsemblGenomes-Gn; EBG00001036965.
DR   EnsemblGenomes-Gn; EBG00001036966.
DR   EnsemblGenomes-Gn; EBG00001036967.
DR   EnsemblGenomes-Gn; EBG00001036968.
DR   EnsemblGenomes-Gn; EBG00001036969.
DR   EnsemblGenomes-Gn; EBG00001036970.
DR   EnsemblGenomes-Gn; EBG00001036971.
DR   EnsemblGenomes-Gn; EBG00001036972.
DR   EnsemblGenomes-Gn; EBG00001036973.
DR   EnsemblGenomes-Gn; EBG00001036974.
DR   EnsemblGenomes-Gn; EBG00001036975.
DR   EnsemblGenomes-Gn; EBG00001036976.
DR   EnsemblGenomes-Gn; EBG00001036977.
DR   EnsemblGenomes-Gn; EBG00001036978.
DR   EnsemblGenomes-Gn; EBG00001036979.
DR   EnsemblGenomes-Gn; EBG00001036980.
DR   EnsemblGenomes-Gn; EBG00001036981.
DR   EnsemblGenomes-Gn; EBG00001036982.
DR   EnsemblGenomes-Gn; EBG00001036983.
DR   EnsemblGenomes-Gn; EBG00001036984.
DR   EnsemblGenomes-Gn; EBG00001036985.
DR   EnsemblGenomes-Gn; EBG00001036986.
DR   EnsemblGenomes-Gn; EBG00001036987.
DR   EnsemblGenomes-Gn; EBG00001036988.
DR   EnsemblGenomes-Gn; EBG00001036989.
DR   EnsemblGenomes-Gn; EBG00001036990.
DR   EnsemblGenomes-Gn; EBG00001036991.
DR   EnsemblGenomes-Gn; EBG00001036992.
DR   EnsemblGenomes-Gn; EBG00001036993.
DR   EnsemblGenomes-Gn; EBG00001036994.
DR   EnsemblGenomes-Gn; EBG00001036995.
DR   EnsemblGenomes-Gn; EBG00001036996.
DR   EnsemblGenomes-Gn; EBG00001036997.
DR   EnsemblGenomes-Gn; EBG00001036998.
DR   EnsemblGenomes-Gn; EBG00001036999.
DR   EnsemblGenomes-Gn; EBG00001037000.
DR   EnsemblGenomes-Gn; EBG00001037001.
DR   EnsemblGenomes-Gn; EBG00001037002.
DR   EnsemblGenomes-Gn; EBG00001037003.
DR   EnsemblGenomes-Gn; EBG00001037004.
DR   EnsemblGenomes-Gn; EBG00001037005.
DR   EnsemblGenomes-Gn; EBG00001037006.
DR   EnsemblGenomes-Gn; EBG00001037007.
DR   EnsemblGenomes-Gn; EBG00001037008.
DR   EnsemblGenomes-Gn; EBG00001037009.
DR   EnsemblGenomes-Gn; EBG00001037010.
DR   EnsemblGenomes-Gn; EBG00001037011.
DR   EnsemblGenomes-Gn; EBG00001037014.
DR   EnsemblGenomes-Gn; EBG00001037016.
DR   EnsemblGenomes-Gn; EBG00001037018.
DR   EnsemblGenomes-Gn; EBG00001037019.
DR   EnsemblGenomes-Gn; EBG00001037021.
DR   EnsemblGenomes-Gn; EBG00001037022.
DR   EnsemblGenomes-Gn; EBG00001037023.
DR   EnsemblGenomes-Gn; EBG00001037024.
DR   EnsemblGenomes-Gn; EBG00001037025.
DR   EnsemblGenomes-Gn; EBG00001037026.
DR   EnsemblGenomes-Gn; EBG00001037027.
DR   EnsemblGenomes-Gn; EBG00001037028.
DR   EnsemblGenomes-Gn; EBG00001037029.
DR   EnsemblGenomes-Gn; EBG00001037030.
DR   EnsemblGenomes-Gn; EBG00001037031.
DR   EnsemblGenomes-Gn; EBG00001037032.
DR   EnsemblGenomes-Gn; EBG00001037033.
DR   EnsemblGenomes-Gn; EBG00001037034.
DR   EnsemblGenomes-Gn; EBG00001037035.
DR   EnsemblGenomes-Gn; EBG00001037036.
DR   EnsemblGenomes-Gn; EBG00001037037.
DR   EnsemblGenomes-Gn; EBG00001037038.
DR   EnsemblGenomes-Gn; EBG00001037040.
DR   EnsemblGenomes-Gn; EBG00001037042.
DR   EnsemblGenomes-Gn; EBG00001037043.
DR   EnsemblGenomes-Gn; EBG00001037044.
DR   EnsemblGenomes-Gn; EBG00001037046.
DR   EnsemblGenomes-Gn; EBG00001037048.
DR   EnsemblGenomes-Gn; EBG00001037050.
DR   EnsemblGenomes-Gn; EBG00001037051.
DR   EnsemblGenomes-Gn; EBG00001037053.
DR   EnsemblGenomes-Gn; EBG00001037055.
DR   EnsemblGenomes-Gn; EBG00001037057.
DR   EnsemblGenomes-Gn; EBG00001037058.
DR   EnsemblGenomes-Gn; EBG00001037060.
DR   EnsemblGenomes-Gn; EBG00001037061.
DR   EnsemblGenomes-Gn; EBG00001037064.
DR   EnsemblGenomes-Gn; EBG00001037066.
DR   EnsemblGenomes-Gn; EBG00001037067.
DR   EnsemblGenomes-Gn; EBG00001037069.
DR   EnsemblGenomes-Gn; EBG00001037070.
DR   EnsemblGenomes-Gn; EBG00001037072.
DR   EnsemblGenomes-Gn; EBG00001037073.
DR   EnsemblGenomes-Gn; EBG00001037075.
DR   EnsemblGenomes-Gn; EBG00001037076.
DR   EnsemblGenomes-Gn; EBG00001037078.
DR   EnsemblGenomes-Gn; EBG00001037080.
DR   EnsemblGenomes-Gn; EBG00001037081.
DR   EnsemblGenomes-Gn; EBG00001037083.
DR   EnsemblGenomes-Gn; EBG00001037084.
DR   EnsemblGenomes-Gn; EBG00001037086.
DR   EnsemblGenomes-Gn; EBG00001037089.
DR   EnsemblGenomes-Gn; EBG00001037090.
DR   EnsemblGenomes-Gn; EBG00001037092.
DR   EnsemblGenomes-Gn; EBG00001037094.
DR   EnsemblGenomes-Gn; EBG00001037095.
DR   EnsemblGenomes-Gn; EBG00001037096.
DR   EnsemblGenomes-Gn; EBG00001037100.
DR   EnsemblGenomes-Gn; EBG00001037102.
DR   EnsemblGenomes-Gn; EBG00001037104.
DR   EnsemblGenomes-Gn; EBG00001037106.
DR   EnsemblGenomes-Gn; EBG00001037107.
DR   EnsemblGenomes-Gn; Fbal_R0001.
DR   EnsemblGenomes-Gn; Fbal_R0002.
DR   EnsemblGenomes-Gn; Fbal_R0003.
DR   EnsemblGenomes-Gn; Fbal_R0004.
DR   EnsemblGenomes-Gn; Fbal_R0005.
DR   EnsemblGenomes-Gn; Fbal_R0006.
DR   EnsemblGenomes-Gn; Fbal_R0007.
DR   EnsemblGenomes-Gn; Fbal_R0008.
DR   EnsemblGenomes-Gn; Fbal_R0009.
DR   EnsemblGenomes-Gn; Fbal_R0010.
DR   EnsemblGenomes-Gn; Fbal_R0011.
DR   EnsemblGenomes-Gn; Fbal_R0012.
DR   EnsemblGenomes-Gn; Fbal_R0013.
DR   EnsemblGenomes-Gn; Fbal_R0014.
DR   EnsemblGenomes-Gn; Fbal_R0015.
DR   EnsemblGenomes-Gn; Fbal_R0016.
DR   EnsemblGenomes-Gn; Fbal_R0017.
DR   EnsemblGenomes-Gn; Fbal_R0018.
DR   EnsemblGenomes-Gn; Fbal_R0019.
DR   EnsemblGenomes-Gn; Fbal_R0021.
DR   EnsemblGenomes-Gn; Fbal_R0022.
DR   EnsemblGenomes-Gn; Fbal_R0023.
DR   EnsemblGenomes-Gn; Fbal_R0024.
DR   EnsemblGenomes-Gn; Fbal_R0025.
DR   EnsemblGenomes-Gn; Fbal_R0026.
DR   EnsemblGenomes-Gn; Fbal_R0027.
DR   EnsemblGenomes-Gn; Fbal_R0028.
DR   EnsemblGenomes-Gn; Fbal_R0029.
DR   EnsemblGenomes-Gn; Fbal_R0030.
DR   EnsemblGenomes-Gn; Fbal_R0031.
DR   EnsemblGenomes-Gn; Fbal_R0032.
DR   EnsemblGenomes-Gn; Fbal_R0033.
DR   EnsemblGenomes-Gn; Fbal_R0034.
DR   EnsemblGenomes-Gn; Fbal_R0035.
DR   EnsemblGenomes-Gn; Fbal_R0036.
DR   EnsemblGenomes-Gn; Fbal_R0037.
DR   EnsemblGenomes-Gn; Fbal_R0038.
DR   EnsemblGenomes-Gn; Fbal_R0039.
DR   EnsemblGenomes-Gn; Fbal_R0040.
DR   EnsemblGenomes-Gn; Fbal_R0041.
DR   EnsemblGenomes-Gn; Fbal_R0042.
DR   EnsemblGenomes-Gn; Fbal_R0043.
DR   EnsemblGenomes-Gn; Fbal_R0044.
DR   EnsemblGenomes-Gn; Fbal_R0045.
DR   EnsemblGenomes-Gn; Fbal_R0048.
DR   EnsemblGenomes-Gn; Fbal_R0049.
DR   EnsemblGenomes-Gn; Fbal_R0050.
DR   EnsemblGenomes-Gn; Fbal_R0051.
DR   EnsemblGenomes-Gn; Fbal_R0052.
DR   EnsemblGenomes-Gn; Fbal_R0053.
DR   EnsemblGenomes-Gn; Fbal_R0054.
DR   EnsemblGenomes-Gn; Fbal_R0055.
DR   EnsemblGenomes-Gn; Fbal_R0056.
DR   EnsemblGenomes-Gn; Fbal_R0057.
DR   EnsemblGenomes-Gn; Fbal_R0058.
DR   EnsemblGenomes-Gn; Fbal_R0059.
DR   EnsemblGenomes-Gn; Fbal_R0060.
DR   EnsemblGenomes-Gn; Fbal_R0061.
DR   EnsemblGenomes-Gn; Fbal_R0062.
DR   EnsemblGenomes-Gn; Fbal_R0063.
DR   EnsemblGenomes-Gn; Fbal_R0064.
DR   EnsemblGenomes-Gn; Fbal_R0065.
DR   EnsemblGenomes-Gn; Fbal_R0066.
DR   EnsemblGenomes-Gn; Fbal_R0067.
DR   EnsemblGenomes-Gn; Fbal_R0068.
DR   EnsemblGenomes-Gn; Fbal_R0069.
DR   EnsemblGenomes-Gn; Fbal_R0070.
DR   EnsemblGenomes-Gn; Fbal_R0071.
DR   EnsemblGenomes-Gn; Fbal_R0072.
DR   EnsemblGenomes-Gn; Fbal_R0073.
DR   EnsemblGenomes-Gn; Fbal_R0074.
DR   EnsemblGenomes-Gn; Fbal_R0075.
DR   EnsemblGenomes-Gn; Fbal_R0076.
DR   EnsemblGenomes-Gn; Fbal_R0077.
DR   EnsemblGenomes-Gn; Fbal_R0078.
DR   EnsemblGenomes-Gn; Fbal_R0079.
DR   EnsemblGenomes-Gn; Fbal_R0080.
DR   EnsemblGenomes-Gn; Fbal_R0081.
DR   EnsemblGenomes-Gn; Fbal_R0082.
DR   EnsemblGenomes-Gn; Fbal_R0083.
DR   EnsemblGenomes-Gn; Fbal_R0084.
DR   EnsemblGenomes-Gn; Fbal_R0085.
DR   EnsemblGenomes-Gn; Fbal_R0086.
DR   EnsemblGenomes-Gn; Fbal_R0087.
DR   EnsemblGenomes-Gn; Fbal_R0088.
DR   EnsemblGenomes-Gn; Fbal_R0089.
DR   EnsemblGenomes-Gn; Fbal_R0090.
DR   EnsemblGenomes-Gn; Fbal_R0091.
DR   EnsemblGenomes-Gn; Fbal_R0092.
DR   EnsemblGenomes-Gn; Fbal_R0093.
DR   EnsemblGenomes-Gn; Fbal_R0094.
DR   EnsemblGenomes-Gn; Fbal_R0095.
DR   EnsemblGenomes-Gn; Fbal_R0096.
DR   EnsemblGenomes-Gn; Fbal_R0097.
DR   EnsemblGenomes-Gn; Fbal_R0098.
DR   EnsemblGenomes-Gn; Fbal_R0099.
DR   EnsemblGenomes-Gn; Fbal_R0100.
DR   EnsemblGenomes-Gn; Fbal_R0101.
DR   EnsemblGenomes-Gn; Fbal_R0102.
DR   EnsemblGenomes-Gn; Fbal_R0103.
DR   EnsemblGenomes-Gn; Fbal_R0104.
DR   EnsemblGenomes-Gn; Fbal_R0105.
DR   EnsemblGenomes-Gn; Fbal_R0106.
DR   EnsemblGenomes-Gn; Fbal_R0107.
DR   EnsemblGenomes-Gn; Fbal_R0108.
DR   EnsemblGenomes-Gn; Fbal_R0109.
DR   EnsemblGenomes-Gn; Fbal_R0110.
DR   EnsemblGenomes-Gn; Fbal_R0111.
DR   EnsemblGenomes-Gn; Fbal_R0112.
DR   EnsemblGenomes-Gn; Fbal_R0113.
DR   EnsemblGenomes-Gn; Fbal_R0114.
DR   EnsemblGenomes-Gn; Fbal_R0115.
DR   EnsemblGenomes-Gn; Fbal_R0116.
DR   EnsemblGenomes-Gn; Fbal_R0117.
DR   EnsemblGenomes-Gn; Fbal_R0118.
DR   EnsemblGenomes-Gn; Fbal_R0119.
DR   EnsemblGenomes-Gn; Fbal_R0120.
DR   EnsemblGenomes-Gn; Fbal_R0121.
DR   EnsemblGenomes-Gn; Fbal_R0122.
DR   EnsemblGenomes-Gn; Fbal_R0124.
DR   EnsemblGenomes-Gn; Fbal_R0125.
DR   EnsemblGenomes-Gn; Fbal_R0126.
DR   EnsemblGenomes-Gn; Fbal_R0127.
DR   EnsemblGenomes-Gn; Fbal_R0128.
DR   EnsemblGenomes-Gn; Fbal_R0129.
DR   EnsemblGenomes-Gn; Fbal_R0130.
DR   EnsemblGenomes-Gn; Fbal_R0131.
DR   EnsemblGenomes-Gn; Fbal_R0132.
DR   EnsemblGenomes-Gn; Fbal_R0134.
DR   EnsemblGenomes-Gn; Fbal_R0135.
DR   EnsemblGenomes-Gn; Fbal_R0136.
DR   EnsemblGenomes-Gn; Fbal_R0137.
DR   EnsemblGenomes-Gn; Fbal_R0138.
DR   EnsemblGenomes-Gn; Fbal_R0139.
DR   EnsemblGenomes-Gn; Fbal_R0140.
DR   EnsemblGenomes-Gn; Fbal_R0141.
DR   EnsemblGenomes-Gn; Fbal_R0142.
DR   EnsemblGenomes-Gn; Fbal_R0143.
DR   EnsemblGenomes-Gn; Fbal_R0144.
DR   EnsemblGenomes-Gn; Fbal_R0145.
DR   EnsemblGenomes-Gn; Fbal_R0146.
DR   EnsemblGenomes-Gn; Fbal_R0147.
DR   EnsemblGenomes-Gn; Fbal_R0148.
DR   EnsemblGenomes-Gn; Fbal_R0149.
DR   EnsemblGenomes-Tr; EBT00001639675.
DR   EnsemblGenomes-Tr; EBT00001639676.
DR   EnsemblGenomes-Tr; EBT00001639677.
DR   EnsemblGenomes-Tr; EBT00001639678.
DR   EnsemblGenomes-Tr; EBT00001639679.
DR   EnsemblGenomes-Tr; EBT00001639680.
DR   EnsemblGenomes-Tr; EBT00001639681.
DR   EnsemblGenomes-Tr; EBT00001639682.
DR   EnsemblGenomes-Tr; EBT00001639683.
DR   EnsemblGenomes-Tr; EBT00001639684.
DR   EnsemblGenomes-Tr; EBT00001639685.
DR   EnsemblGenomes-Tr; EBT00001639686.
DR   EnsemblGenomes-Tr; EBT00001639687.
DR   EnsemblGenomes-Tr; EBT00001639688.
DR   EnsemblGenomes-Tr; EBT00001639689.
DR   EnsemblGenomes-Tr; EBT00001639690.
DR   EnsemblGenomes-Tr; EBT00001639691.
DR   EnsemblGenomes-Tr; EBT00001639692.
DR   EnsemblGenomes-Tr; EBT00001639693.
DR   EnsemblGenomes-Tr; EBT00001639694.
DR   EnsemblGenomes-Tr; EBT00001639695.
DR   EnsemblGenomes-Tr; EBT00001639696.
DR   EnsemblGenomes-Tr; EBT00001639697.
DR   EnsemblGenomes-Tr; EBT00001639698.
DR   EnsemblGenomes-Tr; EBT00001639699.
DR   EnsemblGenomes-Tr; EBT00001639700.
DR   EnsemblGenomes-Tr; EBT00001639701.
DR   EnsemblGenomes-Tr; EBT00001639702.
DR   EnsemblGenomes-Tr; EBT00001639703.
DR   EnsemblGenomes-Tr; EBT00001639704.
DR   EnsemblGenomes-Tr; EBT00001639705.
DR   EnsemblGenomes-Tr; EBT00001639706.
DR   EnsemblGenomes-Tr; EBT00001639707.
DR   EnsemblGenomes-Tr; EBT00001639708.
DR   EnsemblGenomes-Tr; EBT00001639709.
DR   EnsemblGenomes-Tr; EBT00001639710.
DR   EnsemblGenomes-Tr; EBT00001639711.
DR   EnsemblGenomes-Tr; EBT00001639712.
DR   EnsemblGenomes-Tr; EBT00001639713.
DR   EnsemblGenomes-Tr; EBT00001639714.
DR   EnsemblGenomes-Tr; EBT00001639715.
DR   EnsemblGenomes-Tr; EBT00001639716.
DR   EnsemblGenomes-Tr; EBT00001639717.
DR   EnsemblGenomes-Tr; EBT00001639718.
DR   EnsemblGenomes-Tr; EBT00001639719.
DR   EnsemblGenomes-Tr; EBT00001639720.
DR   EnsemblGenomes-Tr; EBT00001639721.
DR   EnsemblGenomes-Tr; EBT00001639722.
DR   EnsemblGenomes-Tr; EBT00001639723.
DR   EnsemblGenomes-Tr; EBT00001639724.
DR   EnsemblGenomes-Tr; EBT00001639725.
DR   EnsemblGenomes-Tr; EBT00001639726.
DR   EnsemblGenomes-Tr; EBT00001639727.
DR   EnsemblGenomes-Tr; EBT00001639728.
DR   EnsemblGenomes-Tr; EBT00001639729.
DR   EnsemblGenomes-Tr; EBT00001639730.
DR   EnsemblGenomes-Tr; EBT00001639731.
DR   EnsemblGenomes-Tr; EBT00001639732.
DR   EnsemblGenomes-Tr; EBT00001639733.
DR   EnsemblGenomes-Tr; EBT00001639734.
DR   EnsemblGenomes-Tr; EBT00001639735.
DR   EnsemblGenomes-Tr; EBT00001639736.
DR   EnsemblGenomes-Tr; EBT00001639737.
DR   EnsemblGenomes-Tr; EBT00001639738.
DR   EnsemblGenomes-Tr; EBT00001639739.
DR   EnsemblGenomes-Tr; EBT00001639740.
DR   EnsemblGenomes-Tr; EBT00001639741.
DR   EnsemblGenomes-Tr; EBT00001639742.
DR   EnsemblGenomes-Tr; EBT00001639743.
DR   EnsemblGenomes-Tr; EBT00001639744.
DR   EnsemblGenomes-Tr; EBT00001639745.
DR   EnsemblGenomes-Tr; EBT00001639746.
DR   EnsemblGenomes-Tr; EBT00001639747.
DR   EnsemblGenomes-Tr; EBT00001639748.
DR   EnsemblGenomes-Tr; EBT00001639749.
DR   EnsemblGenomes-Tr; EBT00001639750.
DR   EnsemblGenomes-Tr; EBT00001639751.
DR   EnsemblGenomes-Tr; EBT00001639752.
DR   EnsemblGenomes-Tr; EBT00001639753.
DR   EnsemblGenomes-Tr; EBT00001639754.
DR   EnsemblGenomes-Tr; EBT00001639755.
DR   EnsemblGenomes-Tr; EBT00001639756.
DR   EnsemblGenomes-Tr; EBT00001639757.
DR   EnsemblGenomes-Tr; EBT00001639758.
DR   EnsemblGenomes-Tr; EBT00001639759.
DR   EnsemblGenomes-Tr; EBT00001639760.
DR   EnsemblGenomes-Tr; EBT00001639761.
DR   EnsemblGenomes-Tr; EBT00001639762.
DR   EnsemblGenomes-Tr; EBT00001639763.
DR   EnsemblGenomes-Tr; EBT00001639764.
DR   EnsemblGenomes-Tr; EBT00001639765.
DR   EnsemblGenomes-Tr; EBT00001639766.
DR   EnsemblGenomes-Tr; EBT00001639767.
DR   EnsemblGenomes-Tr; EBT00001639768.
DR   EnsemblGenomes-Tr; EBT00001639769.
DR   EnsemblGenomes-Tr; EBT00001639770.
DR   EnsemblGenomes-Tr; EBT00001639771.
DR   EnsemblGenomes-Tr; EBT00001639772.
DR   EnsemblGenomes-Tr; EBT00001639773.
DR   EnsemblGenomes-Tr; EBT00001639774.
DR   EnsemblGenomes-Tr; EBT00001639775.
DR   EnsemblGenomes-Tr; EBT00001639776.
DR   EnsemblGenomes-Tr; EBT00001639777.
DR   EnsemblGenomes-Tr; EBT00001639778.
DR   EnsemblGenomes-Tr; EBT00001639779.
DR   EnsemblGenomes-Tr; EBT00001639780.
DR   EnsemblGenomes-Tr; EBT00001639781.
DR   EnsemblGenomes-Tr; EBT00001639782.
DR   EnsemblGenomes-Tr; EBT00001639783.
DR   EnsemblGenomes-Tr; EBT00001639784.
DR   EnsemblGenomes-Tr; EBT00001639785.
DR   EnsemblGenomes-Tr; EBT00001639786.
DR   EnsemblGenomes-Tr; EBT00001639787.
DR   EnsemblGenomes-Tr; EBT00001639788.
DR   EnsemblGenomes-Tr; EBT00001639789.
DR   EnsemblGenomes-Tr; EBT00001639790.
DR   EnsemblGenomes-Tr; EBT00001639791.
DR   EnsemblGenomes-Tr; EBT00001639792.
DR   EnsemblGenomes-Tr; EBT00001639793.
DR   EnsemblGenomes-Tr; EBT00001639794.
DR   EnsemblGenomes-Tr; EBT00001639795.
DR   EnsemblGenomes-Tr; EBT00001639796.
DR   EnsemblGenomes-Tr; EBT00001639797.
DR   EnsemblGenomes-Tr; EBT00001639798.
DR   EnsemblGenomes-Tr; EBT00001639799.
DR   EnsemblGenomes-Tr; EBT00001639800.
DR   EnsemblGenomes-Tr; EBT00001639801.
DR   EnsemblGenomes-Tr; EBT00001639802.
DR   EnsemblGenomes-Tr; EBT00001639803.
DR   EnsemblGenomes-Tr; EBT00001639804.
DR   EnsemblGenomes-Tr; EBT00001639805.
DR   EnsemblGenomes-Tr; EBT00001639806.
DR   EnsemblGenomes-Tr; EBT00001639807.
DR   EnsemblGenomes-Tr; EBT00001639808.
DR   EnsemblGenomes-Tr; EBT00001639809.
DR   EnsemblGenomes-Tr; EBT00001639810.
DR   EnsemblGenomes-Tr; EBT00001639811.
DR   EnsemblGenomes-Tr; EBT00001639812.
DR   EnsemblGenomes-Tr; EBT00001639813.
DR   EnsemblGenomes-Tr; EBT00001639814.
DR   EnsemblGenomes-Tr; EBT00001639815.
DR   EnsemblGenomes-Tr; EBT00001639816.
DR   EnsemblGenomes-Tr; EBT00001639817.
DR   EnsemblGenomes-Tr; EBT00001639818.
DR   EnsemblGenomes-Tr; EBT00001639819.
DR   EnsemblGenomes-Tr; EBT00001639820.
DR   EnsemblGenomes-Tr; EBT00001639821.
DR   EnsemblGenomes-Tr; EBT00001639822.
DR   EnsemblGenomes-Tr; EBT00001639823.
DR   EnsemblGenomes-Tr; EBT00001639824.
DR   EnsemblGenomes-Tr; EBT00001639825.
DR   EnsemblGenomes-Tr; EBT00001639826.
DR   EnsemblGenomes-Tr; EBT00001639827.
DR   EnsemblGenomes-Tr; EBT00001639828.
DR   EnsemblGenomes-Tr; EBT00001639829.
DR   EnsemblGenomes-Tr; EBT00001639830.
DR   EnsemblGenomes-Tr; EBT00001639831.
DR   EnsemblGenomes-Tr; EBT00001639832.
DR   EnsemblGenomes-Tr; EBT00001639833.
DR   EnsemblGenomes-Tr; Fbal_R0001-1.
DR   EnsemblGenomes-Tr; Fbal_R0002-1.
DR   EnsemblGenomes-Tr; Fbal_R0003-1.
DR   EnsemblGenomes-Tr; Fbal_R0004-1.
DR   EnsemblGenomes-Tr; Fbal_R0005-1.
DR   EnsemblGenomes-Tr; Fbal_R0006-1.
DR   EnsemblGenomes-Tr; Fbal_R0007-1.
DR   EnsemblGenomes-Tr; Fbal_R0008-1.
DR   EnsemblGenomes-Tr; Fbal_R0009-1.
DR   EnsemblGenomes-Tr; Fbal_R0010-1.
DR   EnsemblGenomes-Tr; Fbal_R0011-1.
DR   EnsemblGenomes-Tr; Fbal_R0012-1.
DR   EnsemblGenomes-Tr; Fbal_R0013-1.
DR   EnsemblGenomes-Tr; Fbal_R0014-1.
DR   EnsemblGenomes-Tr; Fbal_R0015-1.
DR   EnsemblGenomes-Tr; Fbal_R0016-1.
DR   EnsemblGenomes-Tr; Fbal_R0017-1.
DR   EnsemblGenomes-Tr; Fbal_R0018-1.
DR   EnsemblGenomes-Tr; Fbal_R0019-1.
DR   EnsemblGenomes-Tr; Fbal_R0021-1.
DR   EnsemblGenomes-Tr; Fbal_R0022-1.
DR   EnsemblGenomes-Tr; Fbal_R0023-1.
DR   EnsemblGenomes-Tr; Fbal_R0024-1.
DR   EnsemblGenomes-Tr; Fbal_R0025-1.
DR   EnsemblGenomes-Tr; Fbal_R0026-1.
DR   EnsemblGenomes-Tr; Fbal_R0027-1.
DR   EnsemblGenomes-Tr; Fbal_R0028-1.
DR   EnsemblGenomes-Tr; Fbal_R0029-1.
DR   EnsemblGenomes-Tr; Fbal_R0030-1.
DR   EnsemblGenomes-Tr; Fbal_R0031-1.
DR   EnsemblGenomes-Tr; Fbal_R0032-1.
DR   EnsemblGenomes-Tr; Fbal_R0033-1.
DR   EnsemblGenomes-Tr; Fbal_R0034-1.
DR   EnsemblGenomes-Tr; Fbal_R0035-1.
DR   EnsemblGenomes-Tr; Fbal_R0036-1.
DR   EnsemblGenomes-Tr; Fbal_R0037-1.
DR   EnsemblGenomes-Tr; Fbal_R0038-1.
DR   EnsemblGenomes-Tr; Fbal_R0039-1.
DR   EnsemblGenomes-Tr; Fbal_R0040-1.
DR   EnsemblGenomes-Tr; Fbal_R0041-1.
DR   EnsemblGenomes-Tr; Fbal_R0042-1.
DR   EnsemblGenomes-Tr; Fbal_R0043-1.
DR   EnsemblGenomes-Tr; Fbal_R0044-1.
DR   EnsemblGenomes-Tr; Fbal_R0045-1.
DR   EnsemblGenomes-Tr; Fbal_R0048-1.
DR   EnsemblGenomes-Tr; Fbal_R0049-1.
DR   EnsemblGenomes-Tr; Fbal_R0050-1.
DR   EnsemblGenomes-Tr; Fbal_R0051-1.
DR   EnsemblGenomes-Tr; Fbal_R0052-1.
DR   EnsemblGenomes-Tr; Fbal_R0053-1.
DR   EnsemblGenomes-Tr; Fbal_R0054-1.
DR   EnsemblGenomes-Tr; Fbal_R0055-1.
DR   EnsemblGenomes-Tr; Fbal_R0056-1.
DR   EnsemblGenomes-Tr; Fbal_R0057-1.
DR   EnsemblGenomes-Tr; Fbal_R0058-1.
DR   EnsemblGenomes-Tr; Fbal_R0059-1.
DR   EnsemblGenomes-Tr; Fbal_R0060-1.
DR   EnsemblGenomes-Tr; Fbal_R0061-1.
DR   EnsemblGenomes-Tr; Fbal_R0062-1.
DR   EnsemblGenomes-Tr; Fbal_R0063-1.
DR   EnsemblGenomes-Tr; Fbal_R0064-1.
DR   EnsemblGenomes-Tr; Fbal_R0065-1.
DR   EnsemblGenomes-Tr; Fbal_R0066-1.
DR   EnsemblGenomes-Tr; Fbal_R0067-1.
DR   EnsemblGenomes-Tr; Fbal_R0068-1.
DR   EnsemblGenomes-Tr; Fbal_R0069-1.
DR   EnsemblGenomes-Tr; Fbal_R0070-1.
DR   EnsemblGenomes-Tr; Fbal_R0071-1.
DR   EnsemblGenomes-Tr; Fbal_R0072-1.
DR   EnsemblGenomes-Tr; Fbal_R0073-1.
DR   EnsemblGenomes-Tr; Fbal_R0074-1.
DR   EnsemblGenomes-Tr; Fbal_R0075-1.
DR   EnsemblGenomes-Tr; Fbal_R0076-1.
DR   EnsemblGenomes-Tr; Fbal_R0077-1.
DR   EnsemblGenomes-Tr; Fbal_R0078-1.
DR   EnsemblGenomes-Tr; Fbal_R0079-1.
DR   EnsemblGenomes-Tr; Fbal_R0080-1.
DR   EnsemblGenomes-Tr; Fbal_R0081-1.
DR   EnsemblGenomes-Tr; Fbal_R0082-1.
DR   EnsemblGenomes-Tr; Fbal_R0083-1.
DR   EnsemblGenomes-Tr; Fbal_R0084-1.
DR   EnsemblGenomes-Tr; Fbal_R0085-1.
DR   EnsemblGenomes-Tr; Fbal_R0086-1.
DR   EnsemblGenomes-Tr; Fbal_R0087-1.
DR   EnsemblGenomes-Tr; Fbal_R0088-1.
DR   EnsemblGenomes-Tr; Fbal_R0089-1.
DR   EnsemblGenomes-Tr; Fbal_R0090-1.
DR   EnsemblGenomes-Tr; Fbal_R0091-1.
DR   EnsemblGenomes-Tr; Fbal_R0092-1.
DR   EnsemblGenomes-Tr; Fbal_R0093-1.
DR   EnsemblGenomes-Tr; Fbal_R0094-1.
DR   EnsemblGenomes-Tr; Fbal_R0095-1.
DR   EnsemblGenomes-Tr; Fbal_R0096-1.
DR   EnsemblGenomes-Tr; Fbal_R0097-1.
DR   EnsemblGenomes-Tr; Fbal_R0098-1.
DR   EnsemblGenomes-Tr; Fbal_R0099-1.
DR   EnsemblGenomes-Tr; Fbal_R0100-1.
DR   EnsemblGenomes-Tr; Fbal_R0101-1.
DR   EnsemblGenomes-Tr; Fbal_R0102-1.
DR   EnsemblGenomes-Tr; Fbal_R0103-1.
DR   EnsemblGenomes-Tr; Fbal_R0104-1.
DR   EnsemblGenomes-Tr; Fbal_R0105-1.
DR   EnsemblGenomes-Tr; Fbal_R0106-1.
DR   EnsemblGenomes-Tr; Fbal_R0107-1.
DR   EnsemblGenomes-Tr; Fbal_R0108-1.
DR   EnsemblGenomes-Tr; Fbal_R0109-1.
DR   EnsemblGenomes-Tr; Fbal_R0110-1.
DR   EnsemblGenomes-Tr; Fbal_R0111-1.
DR   EnsemblGenomes-Tr; Fbal_R0112-1.
DR   EnsemblGenomes-Tr; Fbal_R0113-1.
DR   EnsemblGenomes-Tr; Fbal_R0114-1.
DR   EnsemblGenomes-Tr; Fbal_R0115-1.
DR   EnsemblGenomes-Tr; Fbal_R0116-1.
DR   EnsemblGenomes-Tr; Fbal_R0117-1.
DR   EnsemblGenomes-Tr; Fbal_R0118-1.
DR   EnsemblGenomes-Tr; Fbal_R0119-1.
DR   EnsemblGenomes-Tr; Fbal_R0120-1.
DR   EnsemblGenomes-Tr; Fbal_R0121-1.
DR   EnsemblGenomes-Tr; Fbal_R0122-1.
DR   EnsemblGenomes-Tr; Fbal_R0124-1.
DR   EnsemblGenomes-Tr; Fbal_R0125-1.
DR   EnsemblGenomes-Tr; Fbal_R0126-1.
DR   EnsemblGenomes-Tr; Fbal_R0127-1.
DR   EnsemblGenomes-Tr; Fbal_R0128-1.
DR   EnsemblGenomes-Tr; Fbal_R0129-1.
DR   EnsemblGenomes-Tr; Fbal_R0130-1.
DR   EnsemblGenomes-Tr; Fbal_R0131-1.
DR   EnsemblGenomes-Tr; Fbal_R0132-1.
DR   EnsemblGenomes-Tr; Fbal_R0134-1.
DR   EnsemblGenomes-Tr; Fbal_R0135-1.
DR   EnsemblGenomes-Tr; Fbal_R0136-1.
DR   EnsemblGenomes-Tr; Fbal_R0137-1.
DR   EnsemblGenomes-Tr; Fbal_R0138-1.
DR   EnsemblGenomes-Tr; Fbal_R0139-1.
DR   EnsemblGenomes-Tr; Fbal_R0140-1.
DR   EnsemblGenomes-Tr; Fbal_R0141-1.
DR   EnsemblGenomes-Tr; Fbal_R0142-1.
DR   EnsemblGenomes-Tr; Fbal_R0143-1.
DR   EnsemblGenomes-Tr; Fbal_R0144-1.
DR   EnsemblGenomes-Tr; Fbal_R0145-1.
DR   EnsemblGenomes-Tr; Fbal_R0146-1.
DR   EnsemblGenomes-Tr; Fbal_R0147-1.
DR   EnsemblGenomes-Tr; Fbal_R0148-1.
DR   EnsemblGenomes-Tr; Fbal_R0149-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; CP002209.
DR   SILVA-SSU; CP002209.
DR   StrainInfo; 161701; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083268
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Ferrimonas balearica PAT, DSM 9799
CC   collection_date     :: Missing
CC   lat_lon             :: 39.56666 2.63333
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Spain
CC   environment         :: Fresh water, Marine
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 9799
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Facultative
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02307
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 9123
CC   Funding Program     :: DOE-GEBA 2007
CC   Gene Calling Method :: Prodigal, GenePRIMP
CC   Isolation Site      :: Surface sediment in harbor of Palma de
CC                          Mallorca, Spain
CC   Cell Shape          :: Rod-shaped
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 28C
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: Sanger/454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4279159
FT                   /organism="Ferrimonas balearica DSM 9799"
FT                   /strain="DSM 9799"
FT                   /mol_type="genomic DNA"
FT                   /country="Spain:Palma de Mallorca harbor"
FT                   /lat_lon="39.5667 N 2.6333 E"
FT                   /isolation_source="surface sediment"
FT                   /db_xref="taxon:550540"
FT   gene            298..1704
FT                   /locus_tag="Fbal_0001"
FT   CDS_pept        298..1704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation; InterPro IPR020591: IPR013159: IPR013317:
FT                   IPR003593: IPR 018312: IPR001957; KEGG: saz:Sama_0013
FT                   chromosomal replication initiation protein; PFAM:
FT                   Chromosomal replication initiator DnaA; Chromosomal
FT                   replication initiator DnaA domain; SMART: Chromosomal
FT                   replication initiator DnaA domain; AAA ATPase; SPTR: A1S1G9
FT                   Chromosomal replication initiator protein dnaA; TIGRFAM:
FT                   chromosomal replication initiator protein DnaA; PFAM:
FT                   domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74215"
FT                   /db_xref="GOA:E1SUL0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL0"
FT                   /protein_id="ADN74215.1"
FT                   /translation="MILFWTDNLGAFAVSLPVWQQCVERLRDELPAQQFSMWIRPLQAE
FT                   LMGDTLVLYAPNRFVLDWVRDKYLNSITAFLAETLGDQAPALQFDIGSKPEARPKVDIG
FT                   TPRPAAAVPASPVRTEPPASSNQSVRSNINPNYQFDNFVEGKSNQLARAAASQVADNPG
FT                   GAYNPLFLYGGTGLGKTHLLHAVGNGIMKRKPNAKVVYMHSERFVQDMVKALQNNAIAE
FT                   FKRYYRSVDALLIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVED
FT                   RLKSRFGWGLTVAIEPPELETRVAILMRKAEESNIHLPDEVAFFIAKRLRSNVRELEGA
FT                   LNRVIANANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKR
FT                   RSRSVARPRQVAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKED
FT                   YANLIRTLSS"
FT   gene            1718..2818
FT                   /locus_tag="Fbal_0002"
FT   CDS_pept        1718..2818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: sse:Ssed_0007
FT                   DNA-directed DNA polymerase; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: A2V492 DNA polymerase III,
FT                   beta subunit (Fragment); TIGRFAM: DNA polymerase III, beta
FT                   subunit; PFAM: DNA polymerase III beta subunit, C-terminal
FT                   domain; DNA polymerase III beta subunit, N-terminal domain;
FT                   DNA polymerase III beta subunit, central domain; TIGRFAM:
FT                   DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74216"
FT                   /db_xref="GOA:E1SUL1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL1"
FT                   /protein_id="ADN74216.1"
FT                   /translation="MQFVINRETLLKPLQLVSGAVERRHNLPILANVLLEVSGNLLKVT
FT                   GTDLEVELIGQVEVEGDIQPGRTTVPARKFLDICKSLPDQAELRIEQQDNRLLIKSGRS
FT                   RFSLSTLPADEFPEIGDWKGELQFTLPQGVLKSLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GNVLRTVATDGHRLAVSHRVIEASLPEKQVIVPRKGVIELSRLFEDEQAEITLCIGESS
FT                   IRAVTRDAIFTSKLVDGRFPDYRRVLPKDGDKVVVAERDALRQAFARASILSNEKFRGV
FT                   RLLLENDRLTITANNPEQEEAEEVLDLAYPYTSLEIGFNVSYVLDVLNALKQENVKMVL
FT                   GEANSSALFENADNDESLYVVMPMRL"
FT   gene            2818..3885
FT                   /locus_tag="Fbal_0003"
FT   CDS_pept        2818..3885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR003395: IPR018078: IPR001238;
FT                   KEGG: spl:Spea_0003 recombination protein F; PFAM: SMC
FT                   domain protein; SPTR: A8GYE5 DNA replication and repair
FT                   protein recF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74217"
FT                   /db_xref="GOA:E1SUL2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL2"
FT                   /protein_id="ADN74217.1"
FT                   /translation="MGIDRLHIQNLRNIQAATLEPAGGLNLIYGDNGSGKTSVLEAIWF
FT                   LSVGRSFRTHLAPRAIRHDEPNLVLFARTTAGEKLGLRRGRDGDNEVRINGERPERLAD
FT                   LAACLPLQLISPESFALLLEGPQARREFIDWGAFHSDPQFIGIWSRYRRLLKQRNQLLR
FT                   QQAPDHQFAIWDKQLSEYGEALTAIRKRWVSSLNDTLTGIINQFLPDLPIRVSFSQGWD
FT                   SKSPLSAQIQGQLERDKQLGYTVSGPHKADLRLRVGNLPVQDGLSRGQLKLLVCALKIA
FT                   QGKILGQKDTSRGCIYLVDDLASELDESHRTLLLEQLISTGEQVFVTAIEPGQLAMIPW
FT                   DKRFHVEQGRVTEQN"
FT   gene            3902..6319
FT                   /locus_tag="Fbal_0004"
FT   CDS_pept        3902..6319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit; InterPro
FT                   IPR001241: IPR000565: IPR002288: IPR006171: IPR 003594:
FT                   IPR013506: IPR018522: IPR011557; KEGG: vvy:VV0014 DNA
FT                   gyrase subunit B; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; PRIAM: DNA topoisomerase (ATP-hydrolyzing);
FT                   SMART: DNA topoisomerase II; ATP-binding region ATPase
FT                   domain protein; SPTR: O51859 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: Toprim domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; DNA gyrase
FT                   B; DNA gyrase B subunit, carboxyl terminus; TIGRFAM: DNA
FT                   gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74218"
FT                   /db_xref="GOA:E1SUL3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL3"
FT                   /protein_id="ADN74218.1"
FT                   /translation="MAENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGHCSDIVVTIHADGSVSVQDDGRGIPVDMHPEEGVSAAQVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSDKLELTVRRQGHIHEQEYSLGDPVAPLKAVGDTDK
FT                   TGTTIRFWPSSQIFSDTTFHYDILAKRLRELSFLNSGVSIRLVDERDAKEDHYCYEGGI
FT                   HAFVEFLNQNKTPVHQQVFHFTIEREDGIGVEVAMQWNDGFQENIYCFTNNIPQRDGGT
FT                   HLAGFRAALTRTLNNYMDKEGYSKKAKTSASGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQTMGEQLQDFLLENPGDAKTVVSKIIDAARAREAARKAREMTRRKGAL
FT                   DLAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKYQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITAMGCGIGRDEYNPDKTRYHNIIIMTDADVDGSHIRTLLLTFFYR
FT                   QMPELIERGYIYIAQPPLYKVKKGKQERYIKDEAALTEYLTSLALDNASLHVNQDAPGI
FT                   SGEHLERLVNQYREVQDVVERQSRRFPKSLLNKLVYVPGLSEGSLKDKAEITEWTERLV
FT                   SELNELDLEGATYRYELQEESERGLWLPKLVLRQHGVESNYLLTFDFINSSDYGRIVAL
FT                   GNAIGDLMEEGAYVRRGERTLPVDSFEKGLTWLMNESKRGLYIQRYKGLGEMNPDQLWE
FT                   TTMDPETRRMLRVTIEDAIGADQLFTTLMGDQVEPRRDFIEKNALLVANLDV"
FT   gene            complement(6487..7524)
FT                   /locus_tag="Fbal_0005"
FT   CDS_pept        complement(6487..7524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0005"
FT                   /product="guanosine monophosphate reductase"
FT                   /EC_number="1.7.1.7"
FT                   /note="COGs: COG0516 IMP dehydrogenase/GMP reductase;
FT                   InterPro IPR001093: IPR015875: IPR005993; KEGG:
FT                   gbm:Gbem_0096 guanosine monophosphate reductase; PFAM: IMP
FT                   dehydrogenase/GMP reductase; SPTR: A4SJY8 GMP reductase;
FT                   TIGRFAM: guanosine monophosphate reductase; PFAM: IMP
FT                   dehydrogenase / GMP reductase domain; TIGRFAM: guanosine
FT                   monophosphate reductase, eukaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74219"
FT                   /db_xref="GOA:E1SUL4"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL4"
FT                   /protein_id="ADN74219.1"
FT                   /translation="MHIEADLKLGFKDVLFRPKRSTLSSRSQVDIRRTFQFKHAEGSWT
FT                   GIPVIAANMDTVGTFEMAEALAQHLMLTAVHKHYTVEQWTAWLATQPETIFDHVMVSTG
FT                   TSQADFEKLSAILKANPKLRFICIDVANGYQQSFVDFVRRVREAQPTRVIVAGNVVTGE
FT                   MVEELIISGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGQIVSDGGC
FT                   TCPGDVAKAFGGGSDFVMIGGMFAGHEEAGGELVEKDGKPMMQFYGMSSDTAMNKHSGG
FT                   VATYRASEGKTVLVPFRGPVENTVQDILGGVRSTCTYVGASKLKELTKRTTFIRVQEQE
FT                   NRIFN"
FT   gene            complement(7749..9842)
FT                   /locus_tag="Fbal_0006"
FT   CDS_pept        complement(7749..9842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0006"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="COGs: COG0751 Glycyl-tRNA synthetase beta subunit;
FT                   InterPro IPR002311: IPR008909: IPR002114: IPR006194: IPR
FT                   015944; KEGG: esa:ESA_04169 glycyl-tRNA synthetase subunit
FT                   beta; PFAM: glycyl-tRNA synthetase beta subunit; DALR
FT                   anticodon binding domain protein; PRIAM: Glycine--tRNA
FT                   ligase; SPTR: A7MKS3 Glycyl-tRNA synthetase beta subunit;
FT                   TIGRFAM: glycyl-tRNA synthetase, beta subunit; PFAM:
FT                   Glycyl-tRNA synthetase beta subunit; DALR anticodon binding
FT                   domain; TIGRFAM: glycyl-tRNA synthetase, tetrameric type,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74220"
FT                   /db_xref="GOA:E1SUL5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL5"
FT                   /protein_id="ADN74220.1"
FT                   /translation="MEQQTFLVEIGTEELPPKALRTLAESFAANMVDSLNAAELPYGDL
FT                   TWFASPRRLAIKVSALAAQQADKIVEKRGPAVQAAFDADGNPTKAAEGWARSNGITVAE
FT                   AGRIATDKGEWLLHKAEVKGQSAAELLPQMVSEALAKLPIPKPMRWGAYDTQFIRPVQT
FT                   VTLMLGEHLLPATILGKASGNTLLGHRFMGEQVLTIEHAEQYPALLEEQGKVIADYERR
FT                   KAKIVADIQAAAAEIGGHADLDDELLEEVTSLVEWPVVLTASFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDAEGKLLPKFIFVSNLESKDPAVVIAGNEKVVRPRLADAEFFFETDKKQ
FT                   TLESLLPRLETVLFQKQLGTLKDKTDRIQALAEHIAGLIGADRAHAARAGQLSKCDLMT
FT                   NMVFEFTDTQGIMGMHYARHDGEAEAVAVALNEQYQPRFAGDELPSSGVAQALAIADKM
FT                   DSLVGIFGIGQPPKADKDPFALRRAAIGILRIAVDKALPLDLFDLAAFSYSLFAEQEKL
FT                   DADGKKGAEICNQVVDFMLGRFRAWYQEEGFPADVIQAVLAVRPTRPVDFDRRVKAVQH
FT                   FRSLDAAEALAAANKRVGNILAKVEGPIADQVDAALLQDDAEKVLADIVAQVAAKVEPM
FT                   FAAGDYQNALLALADLREPVDAFFEAVMVNAEDPALRANRQALLKQLRQLFMQVADISL
FT                   LQQ"
FT   gene            complement(9850..10761)
FT                   /locus_tag="Fbal_0007"
FT   CDS_pept        complement(9850..10761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0007"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="COGs: COG0752 Glycyl-tRNA synthetase alpha subunit;
FT                   InterPro IPR002310: IPR006194; KEGG: vcj:VCD_001489
FT                   glycyl-tRNA synthetase alpha chain; PFAM: glycyl-tRNA
FT                   synthetase alpha subunit; PRIAM: Glycine--tRNA ligase;
FT                   SPTR: A3GYE7 Glycyl-tRNA synthetase, alpha chain; TIGRFAM:
FT                   glycyl-tRNA synthetase, alpha subunit; PFAM: Glycyl-tRNA
FT                   synthetase alpha subunit; TIGRFAM: glycyl-tRNA synthetase,
FT                   tetrameric type, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74221"
FT                   /db_xref="GOA:E1SUL6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL6"
FT                   /protein_id="ADN74221.1"
FT                   /translation="MQKYDTKTFQGMILALQDYWAQQGCAVVQPLDKEVGAGTSHPLTC
FT                   LRALGPEPFAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQDLYLGSLRA
FT                   LGVDTQVHDIRFVEDNWENPTLGAWGLGWEVWLDGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGIERLAMYIQGVDNVYDLVWCDGPFGTITYGDVFLQNEIEQSTYNFEHADVDFLFAH
FT                   FDQSEKECQKLLALEKPLPLPAYERILDAAHAFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCKPAK"
FT   gene            10878..11447
FT                   /locus_tag="Fbal_0008"
FT   CDS_pept        10878..11447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0008"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="COGs: COG2818 3-methyladenine DNA glycosylase;
FT                   InterPro IPR005019: IPR004597; KEGG: maq:Maqu_0153
FT                   DNA-3-methyladenine glycosylase I; PFAM: methyladenine
FT                   glycosylase; PRIAM: DNA-3-methyladenine glycosylase I;
FT                   SPTR: A2V486 DNA-3-methyladenine glycosylase I; TIGRFAM:
FT                   DNA-3-methyladenine glycosylase I; PFAM: Methyladenine
FT                   glycosylase; TIGRFAM: DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74222"
FT                   /db_xref="GOA:E1SUL7"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL7"
FT                   /protein_id="ADN74222.1"
FT                   /translation="MSEGRCTWCGDDPQYVAYHDNQWGRPVYDKYELFEKLCLDGQQAG
FT                   LSWLIILRKTEHYRTAFDGFDPAKIAQYDEAKVEVLLQNPGIVRNRLKVNSIIRNAKAF
FT                   LAMEQQGIDFSAFLWDFVGGQPKLNHWQTTAELPATSAESDAMSKALKKAGFNFVGSTI
FT                   CYAFMQAVGMVNDHLVSCPQHAECQR"
FT   gene            complement(11502..14696)
FT                   /locus_tag="Fbal_0009"
FT   CDS_pept        complement(11502..14696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0009"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG1228 Imidazolonepropionase and related
FT                   amidohydrolase; InterPro IPR002469: IPR011659: IPR006680;
FT                   KEGG: shl:Shal_0010 amidohydrolase; PFAM: amidohydrolase;
FT                   WD40 domain protein beta Propeller; peptidase S9B
FT                   dipeptidylpeptidase IV domain protein; SPTR: A2V485
FT                   Amidohydrolase; PFAM: WD40-like Beta Propeller Repeat;
FT                   Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74223"
FT                   /db_xref="GOA:E1SUL8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL8"
FT                   /protein_id="ADN74223.1"
FT                   /translation="MFRTSPLAAALLGAGLLISTPILAADDKPTWDVNAPQGPMETIQI
FT                   NVSQGTWMNLDISPDGKTLVFDLLGDIYTMPIGGGDATPLVKGIAWHMQPRFSPDGTRI
FT                   AFTSDQDGGDNIWTVKLDGSDMQPVTKETFRLLNSPAWSPDGQYLVGRKHYTAQRSLGA
FT                   GEVWMYHISGGKGIQLTERPNDQKDLGEPAFSPDGRYIYFSQDATPGKTFHYSKDSVKG
FT                   IYKIQRYDRQTGEIEVLLEGSGGAIRPTPSPDGRQLAYIARDGFQSALYLYDLESGDKR
FT                   QVYADLDRDMQETWAIHGVYPTMAWTPDNDAILFWAGGEIRKLTLDSGEVEAIPFQVTV
FT                   DKQVQPALRFQQNLDEDRFDLKMLRQVQISPDGEQVAFEALGKIWLRSLPDGKPQRLTR
FT                   QDDTFELFPAWSRDGRKLAYVTWDDKEQGQVVVRDLRRKRNTVITVEPGKYVEPAFSPD
FT                   GEALVFRKSKGYYITPRSWNREPGIYWVDLDAKKAEPQRISRRGHTPHFGGQSDRVFFS
FT                   TMEGGKTALASVGTHGFEERVHFTSDHASEWHVSPDGKHLAFAERFKVFLTPFAQHGET
FT                   LHLGPDGGSLPVKQLSQRAGENISWRLDGQSLHWSLGPNLYQVSLDGLLDPGSELEAEP
FT                   SITNIGFKADADVPRGTIAFVGGQVITMEGDNVLQDAVVIVENNKIAAVGSRDEVAVPE
FT                   GAQVIDIQGKTLMPGIFDAHAHGSQGQDEIIPQQNWINYAGLALGVTAIHDPSNDTTEV
FT                   FAASEMQKAGIIAGPRIFSTGTILYGANSPGYTAHIDSYEDAKFHLERLKAVGAFSVKS
FT                   YNQPRRNQRQQVVAAARELEMMVVPEGGSLLQHNLSMIADGHTGIEHSLPAAKLYDDIK
FT                   QFWSQTEVGYTPTLVVAYGGIWGENYWYDKTEVWNHPRLSAYVPNDILRSRAMRRPTAP
FT                   DEHYNHFNVARGAKEVGDLGVHSNIGAHGQREGLGAHWEIWMFAQGGMSNLEALKTATL
FT                   NPAIHFGMDHQLGSVTPGKLADLVVIDGDPLANIRDSDKVQYTMVNGRLYDAATMDRID
FT                   SKGEERQAFFFEKTRL"
FT   sig_peptide     complement(14625..14696)
FT                   /locus_tag="Fbal_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(14814..15059)
FT                   /locus_tag="Fbal_0010"
FT   CDS_pept        complement(14814..15059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0010"
FT                   /product="SirA family protein"
FT                   /note="COGs: COG0425 redox protein regulator of disulfide
FT                   bond formation; InterPro IPR001455; KEGG: aha:AHA_0133
FT                   sulfur transfer protein SirA; PFAM: SirA family protein;
FT                   SPTR: A0KEK5 Sulfurtransferase tusA homolog; PFAM:
FT                   SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74224"
FT                   /db_xref="GOA:E1SUL9"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL9"
FT                   /protein_id="ADN74224.1"
FT                   /translation="MSELFVSAQHTLDAIGLRCPEPVMMVRKTVRNMADGETLLVTADD
FT                   PSTTRDIPSFCQFMDHTLVASETEQAPYRYLIRKGL"
FT   gene            complement(15214..16377)
FT                   /locus_tag="Fbal_0011"
FT   CDS_pept        complement(15214..16377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0011"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR002155: IPR001412: IPR012805; KEGG: shn:Shewana3_0023
FT                   3-ketoacyl-CoA thiolase; PFAM: Thiolase; PRIAM: Acetyl-CoA
FT                   C-acyltransferase; SPTR: Q0I0T4 3-ketoacyl-CoA thiolase;
FT                   TIGRFAM: acetyl-CoA C-acyltransferase FadA; acetyl-CoA
FT                   acetyltransferase; PFAM: Thiolase, C-terminal domain;
FT                   Thiolase, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   acetyltransferases; fatty oxidation complex, beta subunit
FT                   FadA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74225"
FT                   /db_xref="GOA:E1SUM0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM0"
FT                   /protein_id="ADN74225.1"
FT                   /translation="MNQAVIVDCIRTPMGRSKGGVFRNVRAETLSAHLMSQLLIRNPAL
FT                   DPNELEDVIWGCVQQTLEQGFNVARNASLLAGLPKSVGAVTVNRLCGSSMQALHDATRA
FT                   IAVGDGDAFIIGGVEHMGHVPMNHGVDFHPGLAKSVAKAAGMMGLTAEMLGKMHGITRA
FT                   QQDAFGARSHQRAHAATLEGRFDNEIVAIEGHDADGSLIQVRHDEVIRPETTVESLGAL
FT                   RPVFDPVNGTVTAGTSSALSDGAAAMLVMSEAKAKALGLPIRARIKSMAIAGCDPSIMG
FT                   YGPVPATQKALKRAGLTIQDIDLVELNEAFAAQSLPCVKDLGLMDQVDDKVNLNGGAIA
FT                   LGHPLGCSGARISTTLLNLMEHKDATLGLATMCIGLGQGIATVFERV"
FT   gene            complement(16389..18542)
FT                   /locus_tag="Fbal_0012"
FT   CDS_pept        complement(16389..18542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0012"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /EC_number="5.1.2.3"
FT                   /note="COGs: COG1250 3-hydroxyacyl-CoA dehydrogenase;
FT                   InterPro IPR001753: IPR006176: IPR006108: IPR006180: IPR
FT                   018376: IPR012799; KEGG: saz:Sama_0032 multifunctional
FT                   fatty acid oxidation complex subunit alpha; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; Enoyl-CoA
FT                   hydratase/isomerase; 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; SPTR: A1S1I8 Fatty acid oxidation complex subunit
FT                   alpha; TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase family;
FT                   3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD binding domain;
FT                   TIGRFAM: fatty oxidation complex, alpha subunit FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74226"
FT                   /db_xref="GOA:E1SUM1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM1"
FT                   /protein_id="ADN74226.1"
FT                   /translation="MIFESNALSVDWLEPGIAQMTFDAEGSVNKFDRNTLTHFHNALNV
FT                   LHDLPDLKGLVVASAKGAFIVGADITEFLTLFAEPESVLQHWLEETNLIFNKLEDLPVP
FT                   TIAAINGYALGGGCEAILACDLRVADSSARIGLPETKLGLIPGFGGTVRLPRVIGADNA
FT                   LEWITTGKEHRPDAALQVGAIDAVVAPDALSSAAVAMLKRAIAGEIDWQSRRARKQAPL
FT                   TLSKIEAAMSFTTAKGMVAMKAGPHYPAPHAAVALIEQVSGQGRAEALQGEHAAFIKLA
FT                   KTDVATALIGLFLNDQYVKGKAKKATKLAKPVEQAAVLGAGIMGGGIAYQSAVKGTPVV
FT                   MKDIAQPALDLGLNEAAKLLGKQVERGRLKPDGMAKVLNNIVPSLDYAPVAHADVVVEA
FT                   VVENPKVKGIVLAEVEGVVAEDAVLASNTSTISIDLLAQSLKRPENFCGMHFFNPVHRM
FT                   PLVEVIRGAKTSDETVAKVVAYAAKMGKTPIVVNDCPGFFVNRVLFPYFAGFSLLLKEG
FT                   ADFQQIDKVMSKQFGWPMGPAYLLDVVGIDTAHHCLDVMAAGFPERMGKMENDPVDLMF
FT                   KADRYGQKNGKGFFQYAPDRKGKPKKTVDDAALAMLTDAYGAPKSFDAETIIARTMVPM
FT                   INETVRCLEEGIVASPAEADMALLYGIGFPAFRGGIFRYLDTIGLDRFVAMADQYAHLG
FT                   PLYQVTDKLREMAAQGARFYQGQ"
FT   gene            18717..20036
FT                   /locus_tag="Fbal_0013"
FT   CDS_pept        18717..20036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0013"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000994: IPR001131; KEGG: spc:Sputcn32_0014 proline
FT                   dipeptidase; PFAM: peptidase M24; SPTR: A1RDW7 Xaa-Pro
FT                   dipeptidase; PFAM: Metallopeptidase family M24"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74227"
FT                   /db_xref="GOA:E1SUM2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM2"
FT                   /protein_id="ADN74227.1"
FT                   /translation="MERLAHTYPDHIQTLRQRADALLAEHELEGMIIHAGEPHRIFLDD
FT                   MDYPFKVNPHFKHWVPVVDNPHCYLVVKAGEKPTLLFYRPVDFWHKVPPLPTEYWVEQV
FT                   NLVAFAKLDEVAGLLPAERSRFAYIGEHSQRAAELGLNLINPQALMDALHFRRSIKTDY
FT                   EIACMDEANRIAVLGHIAARDAFLAGGSEFAIQQAYLTATEHGENDVPYGNIVALNEHS
FT                   AILHYTKLERQAPEESRSFLIDAGAAVNGYAADITRTYAKDPDSRFGRLVAAMDEAQLE
FT                   IIDAIRPGLRYTELHEMMHRKVAELMVRFELANATAEQVFESGLTRAFFPHGLGHPIGL
FT                   QVHDVAGFMQDEQGTHLAAPEAYPALRCTRVLEPGMVVTIEPGLYIIDTLIEALPAEAR
FT                   ALLNTAVIDELRPFGGIRIEDDVVVTENGILNLTRKHGLA"
FT   gene            20036..20656
FT                   /locus_tag="Fbal_0014"
FT   CDS_pept        20036..20656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0014"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="COGs: COG1739 conserved hypothetical protein;
FT                   InterPro IPR001498: IPR015269: IPR002198: IPR015796; KEGG:
FT                   kpn:KPN_04342 hypothetical protein; PFAM: protein of
FT                   unknown function UPF0029; Domain of unknown function
FT                   DUF1949; SPTR: P27862 IMPACT family member yigZ; PFAM:
FT                   Uncharacterized protein family UPF0029; Domain of unknown
FT                   function (DUF1949); TIGRFAM: conserved hypothetical protein
FT                   TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74228"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM3"
FT                   /protein_id="ADN74228.1"
FT                   /translation="MTEAFVVPAAPVQVEEIIKRSRFLTVIERIHNGAEARALQARLKA
FT                   QHPEASHHCLAFVAGPPGCTRDIGASDDGEPAGSAGRPMLNVLLGAEVGQLAAVSVRYY
FT                   GGTKLGVGGLVRAYAGGVKLALESLTTIPFVPMATARVRGGYGDVTLLEYLVAQHQGEV
FT                   VEQQFSTEVCLTLSLPQAALSAFEADLRQRSGGRLSLDKPSQG"
FT   gene            20710..22167
FT                   /locus_tag="Fbal_0015"
FT   CDS_pept        20710..22167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0015"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445: IPR004772; KEGG:
FT                   shm:Shewmr7_0019 TrkH family potassium uptake protein;
FT                   PFAM: cation transporter; SPTR: A2V478 Potassium uptake
FT                   protein, TrkH family; TIGRFAM: potassium uptake protein,
FT                   TrkH family; PFAM: Cation transport protein; TIGRFAM:
FT                   potassium uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74229"
FT                   /db_xref="GOA:E1SUM4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM4"
FT                   /protein_id="ADN74229.1"
FT                   /translation="MEYRTITRIIGLLVALFSTTMLPPALIAVIYKDGGGTTFVQAFVL
FT                   SLVLGLLLWYPNRDAKQELRSREGFLIVVLFWTVLGSIGAIPLVLADSPNLSFTDAMFE
FT                   AFSALTTTGATVITGLDNLPKAILFYRHLLQWLGGMGIIVLAVAVLPMLGVGGMQLYRC
FT                   ETPGPVKDNKMTPRIAETAKALWYIYLTLTIACALAYWLAGMNLFDAVGHAFSTVSIGG
FT                   FSSYDASMGHFDSRLINAICVVFLLIAGVNFSLHFTAFGRRGVNLKTYFRDTEVKVFLG
FT                   FQLGVTAICFLVLLNSGIYDSPESTLDHAMFQAVSISTTAGFATQSFSEWPLFLPILLI
FT                   LASFIGGCAGSTGGGMKVVRIVLLLKQGGREVKRLIHPRAMYAIRLNNKAVGDRVIDAV
FT                   WGFFAAYAGLFALFMVALIATGMDDITAFSATVACLNNLGPGLGAVASHFGDITDTAKW
FT                   LLVLAMLFGRLEIFTLLVLFSPAFWKS"
FT   sig_peptide     20710..20793
FT                   /locus_tag="Fbal_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            22181..22705
FT                   /locus_tag="Fbal_0016"
FT   CDS_pept        22181..22705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0016"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="COGs: COG4635 Flavodoxin; InterPro IPR008254; KEGG:
FT                   saz:Sama_0036 protoporphyrinogen oxidase; PRIAM:
FT                   Protoporphyrinogen oxidase; SPTR: A2V477 Protoporphyrinogen
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74230"
FT                   /db_xref="GOA:E1SUM5"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM5"
FT                   /protein_id="ADN74230.1"
FT                   /translation="MTRVLILYSTVDGQTRRIAQRIEAQLQAQGQQVTLADLSEGAALL
FT                   PQADKVVLGASIRYGKFRPELMAFIEANLAALSERPSAFYSVNLVARKANKNTPQTNPY
FT                   MLKFVARSPWQPTLLGVFAGKLNYPIYAFWDRQVIRFIMWMTKGPTAADAVVEYTDWEE
FT                   VERFAGRVAAL"
FT   gene            complement(22700..23017)
FT                   /locus_tag="Fbal_0017"
FT   CDS_pept        complement(22700..23017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0017"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845; KEGG: son:SO_0026 ArsR family
FT                   transcriptional regulator; PFAM: regulatory protein ArsR;
FT                   SMART: regulatory protein ArsR; SPTR: A2V476
FT                   Transcriptional regulator, ArsR family; PFAM: Bacterial
FT                   regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74231"
FT                   /db_xref="GOA:E1SUM6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM6"
FT                   /protein_id="ADN74231.1"
FT                   /translation="MALNIDISDMAENAEAASRLLKSIANGHRLMILCLLLEKELTVGE
FT                   LNDKVPLSQSALSQHLAVLRKEGLVSTRKEAQMVWYRLASREVEAILSTLHSIYCAPEA
FT                   L"
FT   gene            23212..23748
FT                   /locus_tag="Fbal_0018"
FT   CDS_pept        23212..23748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0018"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="COGs: COG4635 Flavodoxin; InterPro IPR001226:
FT                   IPR008254; KEGG: sse:Ssed_0029 protoporphyrinogen oxidase;
FT                   PRIAM: Protoporphyrinogen oxidase; SPTR: A2V475
FT                   Protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74232"
FT                   /db_xref="GOA:E1SUM7"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM7"
FT                   /protein_id="ADN74232.1"
FT                   /translation="MSRTLVLYMSRGGHTARVARTIMETLQEAGEPCDMMDLMEAEREG
FT                   IEWARYQRVVLGAPVLYGTYDKTVFAFIEANRAELEARPSSFFNVSVVARTPEKATVEG
FT                   NRYMQKFLELSPWRPTDLKVIAGKVDYPNWGFWDSLAIRLIMKMTNGPTDPKTVLDYTD
FT                   WDDVRDYARHLATLS"
FT   gene            complement(23750..25192)
FT                   /locus_tag="Fbal_0019"
FT   CDS_pept        complement(23750..25192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0019"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445: IPR004772; KEGG:
FT                   saz:Sama_0039 potassium uptake protein TrkH; PFAM: cation
FT                   transporter; SPTR: A2V474 Potassium uptake protein, TrkH
FT                   family; TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: Cation transport protein; TIGRFAM: potassium uptake
FT                   protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74233"
FT                   /db_xref="GOA:E1SUM8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM8"
FT                   /protein_id="ADN74233.1"
FT                   /translation="MINVRPLLLLLGLFLAVLAGLMLVPVGFSLYHNEGLVQDFMLSAA
FT                   LTGGVAFVALGSSWGCKVTLHTRDFYLFTTLTWFVVAMFAALPFTFFHAISYTDAFFET
FT                   MSGITTTGSTVLTGLDSAPWSILIWRSLLQWMGGIGFIAVGVAILPLLNVGGMRLFRTE
FT                   SSDWSDKSMPRTKEIGRALVKVYLLLTLLCGVGYYLSGMTVFEAINHAMTTVSTGGYST
FT                   SDSSMTHFSVAAHWNGTLFMFLSGLPMLLYVQSLYRRSWAPWRDQQVIGFTRFVIVASV
FT                   VLGIWLAREQDMAFFPALTLAAFNLVSVVTTTGFASTDYSQWGPAANIIFFLLMFVGAC
FT                   SGSTSGAIKIFRFQIAGAVVFKALRQHIHPHAVVPQRYNRRPINEDILRSLVAFTMLFM
FT                   ATIAVLALFLVLVGVDPVSSLTGAVTAVTNVGPGLGEVIGPAGNFASLPDAAKWALSVG
FT                   MLLGRLEIVTVAVLFLRTFWGY"
FT   sig_peptide     complement(25136..25192)
FT                   /locus_tag="Fbal_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(25219..26619)
FT                   /locus_tag="Fbal_0020"
FT   CDS_pept        complement(25219..26619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0020"
FT                   /product="TrkA-N domain protein"
FT                   /note="COGs: COG0569 K+ transport systems NAD-binding
FT                   component; InterPro IPR006036: IPR006037: IPR003148; KEGG:
FT                   saz:Sama_0040 potassium transporter peripheral membrane
FT                   component; PFAM: TrkA-N domain protein; TrkA-C domain
FT                   protein; SPTR: A2V473 TrkA-N; PFAM: TrkA-N domain; TrkA-C
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74234"
FT                   /db_xref="GOA:E1SUM9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM9"
FT                   /protein_id="ADN74234.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDNDIAALRALQDKLDL
FT                   RVVHGHAGFPHVLRDAGAEDADMLIAVTNSDDTNMVACHLAYTLYGTPTKIARIRSPAY
FT                   LSKRAELFQSGGADPDSRGRFFIDELIAPEQLVTNYIRRLVEYPGALQVLEFADGKASL
FT                   VAVKAYYGGSLVGSALSALKEHMPNIDTRVAAIFRQGRPIMPRGTTVIEADDEVFFVAD
FT                   SKHIRAVMSEMQKLESSYRNIMIAGGGNIGFGLAKALEPFHEVKLIERNAERASQLSEY
FT                   LEDTTVFHGDASDQELLSDEQISQVDVFIAVTNDDEANIMSALLAKRMGAKKVMVLIQR
FT                   EAYVDLVQDANIDIAISPQQATISALLTHVRQGDINNVYSLRRGAAEAIEAVAHGDPST
FT                   SKVVGRQVQEIKLPPGTTIGAIVRRDEVMMAHDRTVIEQDDHVILFLVDKKHIREVEKL
FT                   FQPSALFI"
FT   gene            complement(26616..27941)
FT                   /locus_tag="Fbal_0021"
FT   CDS_pept        complement(26616..27941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0021"
FT                   /product="16S rRNA m(5)C-967 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0144 tRNA and rRNA cytosine-C5-methylase;
FT                   InterPro IPR001678: IPR006027: IPR018314: IPR004573; KEGG:
FT                   shn:Shewana3_0033 sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; SPTR: A2V472 Sun protein;
FT                   TIGRFAM: sun protein; PFAM: NOL1/NOP2/sun family; NusB
FT                   family; TIGRFAM: ribosomal RNA small subunit
FT                   methyltransferase RsmB"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74235"
FT                   /db_xref="GOA:E1SUN0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUN0"
FT                   /protein_id="ADN74235.1"
FT                   /translation="MSQPNLRALAASVVIQVIDQGHSLSQALPKAQSKLRDARDKALLA
FT                   EIAYGVMRQLPQLDTQLRRCLQKPLSGKKRIIHGLLLAGLYQLKHTRVGSHAVVAESVN
FT                   ACREIGAPGMTGLVNGVLRALDRDMDALQAEQFDAPSVHYRHPGWFIKRLQQAYPDQWA
FT                   AILDANNEAPPLWLRNNALQQSRDAYLQQLADAGVEAVAGEEQEAIRLPKPRDVTGLPG
FT                   FPKGAVSVQDHSAQISGRLLNAQPGERVLDACAAPGGKSCHILEQQPQLAELVALDVDP
FT                   WRLTRVQQNLDRLGLTATLKCGDGTDPQSWWDGQAFDRILLDAPCSATGVIRRNPDSKW
FT                   LRRDEDIAQLAELQGKILRACWQMLKPGGTLVYATCSVLPDENVQQIQAFLQNTPDAML
FT                   DPIVAGEDDTTPGWQLLPTVEGGDGFYYARLIKRQDGATQTA"
FT   gene            complement(27938..28882)
FT                   /locus_tag="Fbal_0022"
FT   CDS_pept        complement(27938..28882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0022"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="COGs: COG0223 Methionyl-tRNA formyltransferase;
FT                   InterPro IPR005793: IPR002376: IPR001555: IPR005794; KEGG:
FT                   aha:AHA_0257 methionyl-tRNA formyltransferase; PFAM: formyl
FT                   transferase domain protein; SPTR: A0KEW9 Methionyl-tRNA
FT                   formyltransferase; TIGRFAM: methionyl-tRNA
FT                   formyltransferase; PFAM: Formyl transferase; Formyl
FT                   transferase, C-terminal domain; TIGRFAM: methionyl-tRNA
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74236"
FT                   /db_xref="GOA:E1SUN1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUN1"
FT                   /protein_id="ADN74236.1"
FT                   /translation="MTALKIVFAGTPDFAAQHLAALLDSHHQVVAVYTQPDRPAGRGKK
FT                   LTASPVKQLALQHDLPVYQPQSLRKAEAQAELSAIDFDLMVVVAYGLILPKAVLEMPRL
FT                   GCINVHGSLLPRWRGAAPIQRAIWAGDAETGVTIMQMDEGLDTGAMLHKAALPIEDTDT
FT                   SASLYTKLAELGPKALLDALTPLADGTAVAEVQDDTLANYAEKLSKEEAAVDWSKSALA
FT                   LWRECRAFDPWPVSHFQVAEQTIKLWACDVLEQQHDAAPGTIIGADKQGIRVATGDGVL
FT                   NLTNLQLPGKKAMAVADILNARKEWFEVGTQLS"
FT   gene            complement(28892..29407)
FT                   /locus_tag="Fbal_0023"
FT   CDS_pept        complement(28892..29407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0023"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COGs: COG0242 N-formylmethionyl-tRNA deformylase;
FT                   InterPro IPR000181; KEGG: sdn:Sden_0024 peptide
FT                   deformylase; PFAM: formylmethionine deformylase; PRIAM:
FT                   Peptide deformylase; SPTR: Q8EKQ8 Peptide deformylase 1;
FT                   TIGRFAM: peptide deformylase; PFAM: Polypeptide
FT                   deformylase; TIGRFAM: peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74237"
FT                   /db_xref="GOA:E1SV83"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV83"
FT                   /protein_id="ADN74237.1"
FT                   /translation="MAVREVLRFPDERLRTVAEPVTDFGPALQQLVDDMFDTMYEERGI
FT                   GLAATQINEHVQVIVMDHSEDRSEPKVFINPKIIEEKGHFTNEEGCLSVPGVYAKVERA
FT                   EHVVFEAQDREGNPFTVEADELLSICIQHEMDHLLGKLFVDYLSPLKRQRIKQKLEKQA
FT                   RLDAKHAS"
FT   gene            29544..30641
FT                   /locus_tag="Fbal_0024"
FT   CDS_pept        29544..30641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0024"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="InterPro IPR018392: IPR002482; KEGG: slo:Shew_3735
FT                   peptidoglycan-binding LysM; PFAM: Peptidoglycan-binding
FT                   lysin domain; SMART: Peptidoglycan-binding LysM; SPTR:
FT                   A2V469 Peptidoglycan-binding LysM; PFAM: LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74238"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV84"
FT                   /protein_id="ADN74238.1"
FT                   /translation="MRIAIIMLAALLSLPLAADTLTLKPGHPQTYVVKKGDTLWDISAL
FT                   FLDDPWRWPTLWGANPQIANPHLIYPGDRLNLVYLDGQPRLVRKPMKRMSPQMDVQQKG
FT                   GAIPALPLSMIEPYLSFQQILGEKALADTPQVIGGERDAVRYAKGDVVFINERLPLGEK
FT                   FGIYMLARRFVDPDTKEFLGQEALMTATGRVIESGTVSRIELLSMRQEVKTGHRVMALE
FT                   DDLLLPAYMMPTAAPHGADGRVIASDAMVREIGPLEVAIINRGSEDGAAAGQVYAISKE
FT                   GTEVVEQGDGEFVQPEDRRAYDEMVATLSDGRTIKQPEVYRGELMLFKTYDRVSLGLIV
FT                   NGRHPVRLLDVLSRPEPLVFGSDSD"
FT   sig_peptide     29544..29597
FT                   /locus_tag="Fbal_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            30628..31728
FT                   /locus_tag="Fbal_0025"
FT   CDS_pept        30628..31728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0025"
FT                   /product="DNA protecting protein DprA"
FT                   /note="COGs: COG0758 Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptake; InterPro IPR003488; KEGG:
FT                   sse:Ssed_0037 DNA protecting protein DprA; PFAM: SMF family
FT                   protein; SPTR: A2V468 DNA protecting protein DprA; TIGRFAM:
FT                   DNA protecting protein DprA; PFAM: DNA
FT                   recombination-mediator protein A; TIGRFAM: DNA protecting
FT                   protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74239"
FT                   /db_xref="GOA:E1SV85"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV85"
FT                   /protein_id="ADN74239.1"
FT                   /translation="MTPTNELARWLALDAVSRVSRVRKRALLERIPWRQLWTEAERGRI
FT                   PGWSAAQHRALLEPDSAAIDQALSWLNASPHHHLVTLSDSLYPSSLKHLPDAPILLFVA
FT                   GNPDLLQHSSIAMVGSRNASLAGRQLAERWASQLAELGWSVVSGLAEGIDGAAHRGALA
FT                   VGGVTISVEGCGLDRIYPRRHRTLAEQIEQQGARVSEFWPGIAPRPAHFPLRNRIVSGL
FT                   SLGTIVVEAGLRSGSLITARLAAEQGREVFAVPGSVQDPNRMGCHQLIQNGAKLVTDPV
FT                   DILEELMLQLPQAALERMISSSQGDVQSLPVPALLDSVDYDATPIDNVVARSQLPVEVV
FT                   LEQLTEMELDGWVAAVPGGYVRLRGK"
FT   gene            31725..32204
FT                   /locus_tag="Fbal_0026"
FT   CDS_pept        31725..32204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0026"
FT                   /product="protein of unknown function DUF494"
FT                   /note="COGs: COG2922 conserved hypothetical protein;
FT                   InterPro IPR007456; KEGG: cps:CPS_0023 smg protein; PFAM:
FT                   protein of unknown function DUF494; SPTR: Q48AU5 Protein
FT                   smg homolog; PFAM: Protein of unknown function (DUF494)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74240"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV86"
FT                   /protein_id="ADN74240.1"
FT                   /translation="MIMFDILMYLFETYVQSDVELLFDREELTDELSRAGFRSDEIGKA
FT                   LIWIEKLAALQDSDRHPYLTGVEPGSFRIYTAEEVARLDTESRGFLMFLEQIQVLSATT
FT                   REMVIDRVMELDGEPLSLDDLKWVVLMVLFNAPGNEQAYTQMEDLIFEEPEGLLH"
FT   gene            complement(32246..33934)
FT                   /locus_tag="Fbal_0027"
FT   CDS_pept        complement(32246..33934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0027"
FT                   /product="Microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="InterPro IPR002169: IPR013510; KEGG: slo:Shew_3732
FT                   collagenase; PFAM: Peptidase M9A collagenase domain
FT                   protein; PRIAM: Microbial collagenase; SPTR: A2PRY4
FT                   Collagenase; PFAM: Collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74241"
FT                   /db_xref="GOA:E1SV87"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV87"
FT                   /protein_id="ADN74241.1"
FT                   /translation="MRLLLPLALTGLLGACTTLPQPQPVTLTNWQQPDPAQLPLALDNL
FT                   SRGEAEPALDYLRAFSYFGDPDTLTEAQQQQLHSAMLAQGKSLDALAEPRLAEQWAVAF
FT                   YRYYGQEAMQPYAEALLPSLIRQLDRFAEQAPQTLAQEYALWELLRAPGLLMHQVRRKD
FT                   AENPLHAALTERELTEALTRYAASAGAHYQGQDWPLQNAYWVLAHQRLLLSEEKGEAQD
FT                   QAVAAIARQDLSQRGDAAKTAFTLGYLVNAFLGQEACKETYGDLCAIPEPEAVLPITHA
FT                   CTERLVIRTQDLNEAELAESCDKLTSQEDHFHQLLGTGMTPVVNDYNTALEVVVFKNWS
FT                   QYNAYGQLLFDISTDNGGMYIEGTPQAEGNQARFFAFRGWWLPEFNVWNLNHEYIHYLD
FT                   GRYIKYGGFGHFPGQMVWWAEGMAEYISKGEDNRQAQKLLQDTDPAEWPSLETIFATEY
FT                   DDGLDRTYRWSYMAVRYLAEQAPDSLVAITKPLKGDYAEGYATILSDTAEAHQAGFSQW
FT                   LTEWAAAPLPEEADASPYPRKLNRYGYRDYLRPAQLANSEGHLHF"
FT   gene            34048..34614
FT                   /locus_tag="Fbal_0028"
FT   CDS_pept        34048..34614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0028"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="COGs: COG0551 Zn-finger domain associated with
FT                   topoisomerase type I; InterPro IPR013498; KEGG:
FT                   shm:Shewmr7_0031 DNA topoisomerase type IA Zn finger
FT                   domain-containing protein; PFAM: DNA topoisomerase type IA
FT                   zn finger domain protein; SPTR: A2V466 DNA topoisomerase,
FT                   type IA, zn finger; PFAM: Topoisomerase DNA binding C4 zinc
FT                   finger"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74242"
FT                   /db_xref="GOA:E1SV88"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV88"
FT                   /protein_id="ADN74242.1"
FT                   /translation="MSKIDQQLFTTHEHALEREYGVCPECGSELAVRHGKHGAFLGCQS
FT                   YPTCEYHRPLVEKTTVEAEILEGTECPLCGHPLALKSGRYGFYIGCSDFPQCHYIAKDE
FT                   PETPATKVACPSCRSGELMERTNRFGKKFYACSGYPKCKYLLNFPPVAEPCPDCGWPLL
FT                   VEKNVRGQRRWVCPQRSCKYQSETI"
FT   gene            34665..35171
FT                   /locus_tag="Fbal_0029"
FT   CDS_pept        34665..35171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0029"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COGs: COG0041 Phosphoribosylcarboxyaminoimidazole
FT                   (NCAIR) mutase; InterPro IPR000031; KEGG: swp:swp_1396
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit, putative; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; PRIAM: Phosphoribosylaminoimidazole
FT                   carboxylase; SPTR: A0Y9A3 Hypothetical
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; PFAM: AIR carboxylase; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, PurE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74243"
FT                   /db_xref="GOA:E1SV89"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV89"
FT                   /protein_id="ADN74243.1"
FT                   /translation="MSTPFVAVLMGSDSDLPTMQSTLDVLKGFGIRYEAKVTSAHRTPA
FT                   ATHAYVQDAEARGCKVFICAAGLAAHLAGAVAGITTRPVIGVPIDNGPLQGHDALLSTV
FT                   MMPGGVPVATVAIGSAGAKNAGYLAAQMLAVGDDELAAAVKAERQKSAEAVQAKDAALQ
FT                   AKLAG"
FT   gene            35187..35750
FT                   /locus_tag="Fbal_0030"
FT   CDS_pept        35187..35750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0030"
FT                   /product="translation factor SUA5"
FT                   /note="COGs: COG0009 Putative translation factor (SUA5);
FT                   InterPro IPR006070: IPR004388; KEGG: ent:Ent638_3714
FT                   putative ribosome maturation factor; PFAM: SUA5/yciO/yrdC
FT                   domain; SPTR: A4WF91 Putative ribosome maturation factor
FT                   rimN; TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   yrdC domain; TIGRFAM: Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74244"
FT                   /db_xref="GOA:E1SV90"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV90"
FT                   /protein_id="ADN74244.1"
FT                   /translation="MSRMLTVSEGAALMAKGGVVAYPTEAVFGLGCDPSNEEAVSRLLD
FT                   IKQRPVEKGLILIAANYGQLLPFVNDSALPDARREAVMARWPGPTTWVMPAQPSVPGWV
FT                   TGQFDTLAVRVTDHAIAADLCRAFGGPVVSTSANLTGQPPCRSADEVLAALGDRVDGVV
FT                   MGDVGGRKDPSMILDAMTDQVFRT"
FT   sig_peptide     35187..35249
FT                   /locus_tag="Fbal_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            35775..36689
FT                   /locus_tag="Fbal_0031"
FT   CDS_pept        35775..36689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0031"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="COGs: COG0408 Coproporphyrinogen III oxidase;
FT                   InterPro IPR001260: IPR018375; KEGG: sbm:Shew185_0033
FT                   coproporphyrinogen III oxidase; PFAM: coproporphyrinogen
FT                   III oxidase; PRIAM: Coproporphyrinogen oxidase; SPTR:
FT                   A6WHB7 Coproporphyrinogen-III oxidase, aerobic; PFAM:
FT                   Coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74245"
FT                   /db_xref="GOA:E1SV91"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV91"
FT                   /protein_id="ADN74245.1"
FT                   /translation="MAPDVNAVKHYLLSLQNQICEALEGADGEARFQRDQWQREEGGGG
FT                   ESRVLRDGAVFEQAGVNFSHVMGAQMPASATAHRPELAGRRFEAMGVSLVIHPHNPHIP
FT                   TTHANVRFFIAEKDGEDPVWWFGGGFDLTPYYPVDEDIRHWHQVAHDLCAPFGDQVYDE
FT                   YKAWCDRYFFLKHRDETRGVGGLFFDDLNAPGFEQSFALMQAVGNGFLDAYLPIVARRK
FT                   DDAYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRWQYQYQP
FT                   EADSAEARLYDYLRPRDWLAELR"
FT   gene            complement(36691..37134)
FT                   /locus_tag="Fbal_0032"
FT   CDS_pept        complement(36691..37134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0032"
FT                   /product="globin"
FT                   /note="COGs: COG2346 Truncated hemoglobins; InterPro
FT                   IPR001486; KEGG: tgr:Tgr7_3147 conserved hypothetical
FT                   globin-like protein; PFAM: globin; SPTR: A2V463 Globin;
FT                   PFAM: Bacterial-like globin"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74246"
FT                   /db_xref="GOA:E1SV92"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV92"
FT                   /protein_id="ADN74246.1"
FT                   /translation="MLSLIRRHLSRKQPASAYERMGGEPTVRAIAHRFYQLMADDPDYA
FT                   DLRAIHPDDLSGSELKLFEFLSGWLGGPPLFEEKYGHPMLRARHLPFRVDKRQRNLWLH
FT                   CMKRALEQEVKDRQVRRAMLEALIPLADHMRNTEEGCPVRAPE"
FT   gene            37164..37988
FT                   /locus_tag="Fbal_0033"
FT   CDS_pept        37164..37988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0033"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="COGs: COG0169 Shikimate 5-dehydrogenase; InterPro
FT                   IPR013708: IPR006151: IPR011342; KEGG: avn:Avin_00230
FT                   shikimate/quinate 5-dehydrogenase; PFAM: Shikimate
FT                   dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase; SPTR: A4VFI4 Shikimate
FT                   dehydrogenase; TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate dehydrogenase substrate binding domain; Shikimate
FT                   / quinate 5-dehydrogenase; TIGRFAM: shikimate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74247"
FT                   /db_xref="GOA:E1SV93"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV93"
FT                   /protein_id="ADN74247.1"
FT                   /translation="MDQYAVFGHPIAHSQSPFIHQAFAGQTAQELEYRAILAPTDGFAE
FT                   AVRQFRQQGGLGANVTLPFKEQAAALCDQLTERARLAGAVNTLHWLADGSLLGDNTDGA
FT                   GMVADLHQHGVTLTNRRILILGAGGAVRGVLEPVLACQPRQLVIANRTASKAEALARDF
FT                   AGLGEVVGCGFDQIEGAFDLIINGTSASLSGDLPPLPPHCLIAGGITYDMAYGVNATPF
FT                   QCWGERHGGRLNLAGLGMLVNQAAESFYRWRGVRPDTGPVHQALLARLEEKQ"
FT   gene            37985..38260
FT                   /locus_tag="Fbal_0034"
FT   CDS_pept        37985..38260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0034"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="InterPro IPR009962; KEGG: vfi:VF_2534 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1488; SPTR:
FT                   P45795 Uncharacterized protein yrdB; PFAM: Protein of
FT                   unknown function (DUF1488)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74248"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV94"
FT                   /protein_id="ADN74248.1"
FT                   /translation="MNQQILFNDHVEIEWEQGWAKFHAMVAGQQVPCLVGLNVLANKLD
FT                   STLTSAEEAAAAFEQLRFDLEAEAEMLIEDEAYDAQGRIWLGHPPI"
FT   gene            complement(38262..38798)
FT                   /locus_tag="Fbal_0035"
FT   CDS_pept        complement(38262..38798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0035"
FT                   /product="carbonic anhydrase"
FT                   /note="COGs: COG0663 Carbonic anhydrase/acetyltransferase
FT                   isoleucine patch superfamily; InterPro IPR001451; KEGG:
FT                   asa:ASA_4193 carbonic anhydrase; SPTR: A0Y4V5 Putative
FT                   carbonic anhydrase/acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74249"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV95"
FT                   /protein_id="ADN74249.1"
FT                   /translation="MTIKPYQGQLPQLAQGVFVEPSAVLYGDITLAEDSSVWPLVAARG
FT                   DVNFIRIGARTNVQDASVLHVSRPGNGHPDGFPLIIGDDVTVGHKAMLHGCTIGDRVLV
FT                   GMGAIILDGVIVEDDVIIGAGALVPPGKRLESGYLYVGSPAKQARPLTEGEFAFLKESA
FT                   AHYVRLKDKYLAEAD"
FT   gene            39347..40888
FT                   /locus_tag="Fbal_R0001"
FT   rRNA            39347..40888
FT                   /locus_tag="Fbal_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            40981..41057
FT                   /locus_tag="Fbal_R0002"
FT   tRNA            40981..41057
FT                   /locus_tag="Fbal_R0002"
FT                   /product="tRNA-Ile"
FT   gene            41087..41162
FT                   /locus_tag="Fbal_R0003"
FT   tRNA            41087..41162
FT                   /locus_tag="Fbal_R0003"
FT                   /product="tRNA-Ala"
FT   gene            41442..44328
FT                   /locus_tag="Fbal_R0004"
FT   rRNA            41442..44328
FT                   /locus_tag="Fbal_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            44422..44535
FT                   /locus_tag="Fbal_R0005"
FT   rRNA            44422..44535
FT                   /locus_tag="Fbal_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            44678..45760
FT                   /locus_tag="Fbal_0036"
FT   CDS_pept        44678..45760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0036"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein; InterPro IPR020449: IPR000005:
FT                   IPR018060; KEGG: shl:Shal_2609 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain;
FT                   SPTR: A3LM78 Transcriptional regulator OruR"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74250"
FT                   /db_xref="GOA:E1SV96"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV96"
FT                   /protein_id="ADN74250.1"
FT                   /translation="MVTFFGTEAERLNDDPPSSHHFIQQHPALYGDLLYPAFDLRLLHR
FT                   YLVEQCGDEVGDALLRCVDIAPKELAQRQFILAWQMLKAMELAAQSLPPPAAGLIFGRT
FT                   FKASDLEGLQGPLSHSRTLAEAYHITRQNPNLTGSFTDNLERIEDGKLVVRGVNVAQIE
FT                   PATLQFVFEQGLGSMMAIAEELSGEALQLSWVRFPAPAPWPVDRTEYEDLLGCPVDFEG
FT                   DFFEWAIDLQELEAPVLWRPTDVALELEQEPPAQDTSLVNRIITLLLAVPENWPTQEQV
FT                   AEELMVSRRTLRRRLSEMGTSYQQILNQVRCQLAIEWLQQGESDILWIGERLGFRDVSN
FT                   FRHAFKRWIGKPPGAFLRRG"
FT   gene            complement(45766..46926)
FT                   /locus_tag="Fbal_0037"
FT   CDS_pept        complement(45766..46926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shl:Shal_2608 hypothetical protein; SPTR:
FT                   A3HYK0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74251"
FT                   /db_xref="InterPro:IPR022269"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV97"
FT                   /protein_id="ADN74251.1"
FT                   /translation="MKYLYLPLLLGLLSCGGGGESASEPPPPEPPAPPPTNPDPADPAT
FT                   PCDAATSEVNWDALMSENCELLSQYGLFVDPAVPTRDARVPGLRYQLTTALFSDYASKY
FT                   RFLFLPPGTQMTYHDSETFGLPVGTVLVKTFALPADTALSGDDNETVIETRLLIHRESG
FT                   WVALPYLWQGNDAEFTPAGTLVAHQMIHQDETLAFNYEVPSQPQCKMCHQLSDGTTARF
FT                   SPIGIKARLLNRPGDNGSNQLQHWLSQGWLDRVPESIPTAADLYDTTASLTERAKGYLD
FT                   VNCAHCHRAEGFASISGLRLGYFVDHTTMEYGICKQPPGYDGGAAGLDYDIVPGNGLAS
FT                   ILPYRMAHLEPKDKMPPVGRAVVHDYAVDLIRNWIDTLDPALGSCQ"
FT   sig_peptide     complement(46861..46926)
FT                   /locus_tag="Fbal_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(46976..49642)
FT                   /locus_tag="Fbal_0038"
FT   CDS_pept        complement(46976..49642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR006626: IPR010916; KEGG: slo:Shew_2404
FT                   hypothetical protein; SPTR: A1ZQZ9 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74252"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022269"
FT                   /db_xref="InterPro:IPR022442"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV98"
FT                   /protein_id="ADN74252.1"
FT                   /translation="MREKRSWLLPTLLASAVALNLAGCGSDDETVTVTPPPPTTTPPEP
FT                   EGPTFPEGAIMVEVGENLGANITEAFINAQSGDVIVLPEGEFKLDRTLLFDGDADGDGV
FT                   FAKNVTIMGYGQDKTILDFSEAASGDGIFVQNAVNITIQDLSVNEAKNNGIKLKNSNGI
FT                   ILRRLATIWAGELNEENGAYGLYPVECQNILIEDTYVRGSADAGIYVGQSEYIVVRRNV
FT                   AIENVAGIEIENSKYADVYDNHAVANTGGILVFDLPIGNHRYGSSVRIFDNLVEGNNTK
FT                   NFANASANPAGVHIVPPGTGIIILSTDDVEIFNNVIRDHDTLSITASSFFIAEPDVTGA
FT                   FAMNYAQPGGIIDDGWRAVPRNIHIHSNEITNSGSNPNGYLIEDIIGAYTQIHGVFPAI
FT                   LYDGLGEAVANSGLFAGPSAMIDYKEPPFAADGSDNVCVSNNGDVSLGQLYAGDHSPAT
FT                   LEVPDILFESSQDKLMNCTQVSLPVHTVTIGDEVFGCGIDDDTAGCDGGETVGNGGSIG
FT                   EGEGGLVGDGDLSLCEASGSEVNWSALLGANCANLSDYNLFADSANPKGAANSGGMPYD
FT                   LNSPLFTDYTSKYRYVFVPGGEAAAYDAQEVFDFPVGTVLVKTFAMPDDTATPGNENEE
FT                   ILETRLLIHREAGWSALPYVWNANKDEAVLAKPGSIMNQSVVHKGETIEFDYVVPSLNQ
FT                   CKQCHQYSGEDGIARFMPIGPKARHLNGNYEYADGSTNQLTAWTAHGILTGTPADLASI
FT                   PTVPAFELLGNGDLSGATDAEVMDLAKGYLDINCAHCHRPEGNASNTGLKLEYWRPYEG
FT                   NEQAHGECKSPVAYGGGSLGYDIVPGNPDESITHFRMAATEPGDRMPEIGRSLAHDAGV
FT                   DLIREWITRLPAATCSE"
FT   sig_peptide     complement(49574..49642)
FT                   /locus_tag="Fbal_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            49870..51423
FT                   /locus_tag="Fbal_0039"
FT   CDS_pept        49870..51423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0039"
FT                   /product="AbgT putative transporter"
FT                   /note="COGs: COG2978 Putative p-aminobenzoyl-glutamate
FT                   transporter; InterPro IPR004697; KEGG: swp:swp_1143 AbgT
FT                   putative transporter; PFAM: AbgT putative transporter;
FT                   SPTR: A0Y302 Putative transporter; PFAM: AbgT putative
FT                   transporter family; TIGRFAM: ATP synthase subunit 6
FT                   (eukaryotes),also subunit A (prokaryotes);
FT                   p-Aminobenzoyl-glutamate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74253"
FT                   /db_xref="GOA:E1SV99"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV99"
FT                   /protein_id="ADN74253.1"
FT                   /translation="MSSEAQAPQSENGRLARILDGIEKVGNKLPDPAILFLCLMLVVWG
FT                   VSALLSNMSFTEIDPRTGEAVVIKNLLTAESLTSFLTGMVKTFTAFAPLGVVLVAMLGV
FT                   GVAEHSGFINTALKKMLRITPVKLITPAVVAVGIISHTATDAGYVVVIPLAGVIFYAVG
FT                   RHPIAGIMAAFAGVSGGFCANFIPSAIDPLLQSFTQAAAQTLDADIQLNPLNNWFFAAS
FT                   STLPIIGIIWYLTDKVMEPRLMRSTPLDEGIDAPALDEIGERENKAFRWASLAMLGSMV
FT                   LVAVLAMPESSTLRDASGSLTNFSAPLMQAIVPLIFIFFVIPGVVFGYANGVFQSSADI
FT                   IKSMNKAMEGMGAYIVMAFFCSLFIAAFSQSDLGVLLAVKGANFLQSLGMPAGVTIVGM
FT                   VFLVGFVNLFMGSASAKWALIGPVLVPMLMQLNISPDLSQAAYRIGDSSTNIITPLMPY
FT                   FPLVVVYCQKYVKNTGIGTLIAAMLPYSMALLAAWTAWLLIYWGIGLPLGLGASYTYGL
FT                   "
FT   gene            complement(51763..51957)
FT                   /locus_tag="Fbal_0040"
FT   CDS_pept        complement(51763..51957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_03629 hypothetical protein; SPTR:
FT                   Q5V5C7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74254"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA0"
FT                   /protein_id="ADN74254.1"
FT                   /translation="MADKHTTNWPELAAALYDKLCERNAELTYDFANVEVQVPSHSEED
FT                   AQHARWRVNGQISIRARNQ"
FT   gene            complement(52016..53383)
FT                   /locus_tag="Fbal_0041"
FT   CDS_pept        complement(52016..53383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0041"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR020459:
FT                   IPR000873: IPR010192; KEGG: slo:Shew_3602
FT                   O-succinylbenzoate-CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; SPTR: A2V3Q7 O-succinylbenzoate-CoA
FT                   ligase; TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-binding enzyme; TIGRFAM: O-succinylbenzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74255"
FT                   /db_xref="GOA:E1SVA1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA1"
FT                   /protein_id="ADN74255.1"
FT                   /translation="MNLILCPLHSAARRWGDAIAVCGPEGSLSYEALDGRVTALAHHLA
FT                   GQGLQAGDHIGYLGQNRLEAILLLYAAMRLGAVFAPLSPRFPEAQRDQLIRELDIQWCW
FT                   SEGELPEGVRALSVTSASEAQRWQVDLDRPLTLILTSGSSGHPKAAMHGLAQHIAAAEG
FT                   SHDQTPLNRGDRWLLSLPLFHIGGLAILFRCLSCGATAVLPGHQDLASNLRQQRITHLS
FT                   LVATQLVRLLERDDADEVMRSITTLLLGGGAIPASLLERLKPYPIKVLTSYGMTEMGSQ
FT                   ITTGPANDQGLSGYPLAGRQVRLNEGLIEVRGDCRFLGYYANGTLTRPFDHEGWFATRD
FT                   LGQFVGEQLKVLGRADNMFVSGGENVQPEAIESVLKRCEGVEEAIIIPVEDEVFGHLPV
FT                   AVVKGAWQPEQWEKRVLKKLPRFMRPRRYLPWPEALNQTGLKVSRKAIAEYVHQQG"
FT   gene            complement(53380..54315)
FT                   /locus_tag="Fbal_0042"
FT   CDS_pept        complement(53380..54315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0042"
FT                   /product="o-succinylbenzoate synthase"
FT                   /note="COGs: COG1441 O-succinylbenzoate synthase; InterPro
FT                   IPR013342: IPR018110; KEGG: aha:AHA_0528 O-succinylbenzoic
FT                   acid (OSB) synthetase; PFAM: Mandelate racemase/muconate
FT                   lactonizing protein; PRIAM: o-succinylbenzoate synthase;
FT                   SPTR: B1JH91 o-succinylbenzoate synthase; PFAM: Mandelate
FT                   racemase / muconate lactonizing enzyme, C-terminal domain;
FT                   TIGRFAM: o-succinylbenzoic acid (OSB) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74256"
FT                   /db_xref="GOA:E1SVA2"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA2"
FT                   /protein_id="ADN74256.1"
FT                   /translation="MKLYPYALPLATPLRFAGQSLDQRHGLLIKLERDGHTGWGDCAPL
FT                   PGFSHESLAQCQSALQALASGQIDEAALPPAARFALDCARWQCEGPRRLTLPANIPLLV
FT                   GTPEQQLAQFDALTTPPGEVKLKLARAPLEQEIALVYALLERQPKLLLRIDANRGWSAE
FT                   QASHFAASVPPAALRYVEEPCANLNDSLRVAAQHRLPLALDETTQVADYQYESLPGVRA
FT                   LVLKPTLIGSLARLQQLVQQARLDGVEVVLSSSFESNIGLTHLAHLAAELTPDSVPGLD
FT                   TLAPLGADLLEANPWGLAKPVITESELTPL"
FT   gene            complement(54343..55062)
FT                   /locus_tag="Fbal_0043"
FT   CDS_pept        complement(54343..55062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0043"
FT                   /product="2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carbox
FT                   ylatesynthase"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073;
FT                   KEGG: slo:Shew_3600 alpha/beta hydrolase fold; PFAM:
FT                   alpha/beta hydrolase fold;
FT                   PRIAM:2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car
FT                   boxylatesynthase; SPTR: A2V3Q5 Alpha/beta hydrolase fold;
FT                   PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74257"
FT                   /db_xref="GOA:E1SVA3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA3"
FT                   /protein_id="ADN74257.1"
FT                   /translation="MLLLHGFLGDHRDWPDALGQQFDCLALDLPGHGLSRTLSVSATPA
FT                   FDEVVAQILATLDHHQINRFHLLGYSLGGRLALHLAHALAQHQPHRLLSLTLESTHPGL
FT                   TDATQRQQRLASDAAWHQRMATEANADWLDAWYRQPVFADLSEPRRAEMVQARLDNDPA
FT                   ALAALYLGTSLGHQHNLRHLTLACPVQLISGARDSKFRQLAEQWLQPGWQHQVIEGAGH
FT                   NVHRARPDAFLATLRPL"
FT   gene            complement(55109..56818)
FT                   /locus_tag="Fbal_0044"
FT   CDS_pept        complement(55109..56818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0044"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /EC_number="4.2.99.20"
FT                   /note="COGs: COG1165 2-succinyl-6-hydroxy-2
FT                   4-cyclohexadiene-1-carboxylate synthase; InterPro
FT                   IPR012001: IPR004433; KEGG: spl:Spea_3971
FT                   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
FT                   carboxylate synthase; PFAM: thiamine pyrophosphate protein
FT                   TPP binding domain protein;
FT                   PRIAM:2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
FT                   ene-1-carboxylic-acidsynthase; SPTR: A8H9P4
FT                   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
FT                   carboxylate synthase; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain;
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP binding
FT                   domain; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74258"
FT                   /db_xref="GOA:E1SVA4"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA4"
FT                   /protein_id="ADN74258.1"
FT                   /translation="MNTSHCAELNLLWARLMLEELHRLGVRHLCLAPGSRSTPLTLAAA
FT                   GHDGFQRHTHFDERGLGFAALGLAKASQSPVAIITTSGTAVANLYPAVIEAYQTGVPLV
FT                   VLSGDRPPELIACGANQAIIQPAIFANYARRLDLPTPSLEIPPQTLLAQLDQVMVDLDR
FT                   PLHINCMYREPLYPEGLDAPFETYLTPLSEWRKTAEPWAATPAMSRSALPSADDCCSFA
FT                   QGKGIIVVGTLGPHQQPEQILALARRLGWPILADAQSQLRQAEGVVHHIDQLMHHPKAL
FT                   KLLGKAEHLLLIGGRLLSKRLMSFIAQHPWQAFWHYMGHAENLDPAHLRKRRFVGSLPM
FT                   LAALPWPLLPGSGWADALESYSDEVERLAAEQHDQGALTELSAVRLLSRQLGADQQLFI
FT                   GNSLPIRLFDMLAAPGDAPAIFTNRGASGIDGLLATSCGVAMAEGKPTVLVVGDLSLLH
FT                   DLNSLALARSLTSPLVVMVLNNDGGSIFNMLPVPSDALRQQYYRLGHGFGFEGAASQFH
FT                   LPYQRPDSLDALQQALSEGLQRDGASVIEVVVPPNESAELIVEMARQIRGDD"
FT   gene            complement(56815..58125)
FT                   /locus_tag="Fbal_0045"
FT   CDS_pept        complement(56815..58125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0045"
FT                   /product="isochorismate synthase"
FT                   /note="COGs: COG1169 Isochorismate synthase; InterPro
FT                   IPR015890: IPR004561; KEGG: swp:swp_4972 isochorismate
FT                   synthase; PFAM: Chorismate binding-like; SPTR: A2V3I3
FT                   Isochorismate synthases; TIGRFAM: isochorismate synthase;
FT                   PFAM: chorismate binding enzyme; TIGRFAM: isochorismate
FT                   synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74259"
FT                   /db_xref="GOA:E1SVA5"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA5"
FT                   /protein_id="ADN74259.1"
FT                   /translation="MAQLECQPPGHLCLQLSEPLDAPPLIAWLANQSELPRIYWRGRRD
FT                   GEEIAAIGAALDLHFDTLPSAEELDRLYNKYLGAGQDTQLRLYGGHAFDTQQPAWPDFG
FT                   QARFVLPRIEIRRHGEQAQLLLNLCGQERPWQQELERARTALDAIQSAAPLSPLGPAHV
FT                   LARQDTPDQPRWRELVEQITDPAFLAATPKVVMARETRLTTSALPNHWTVLHAWQLLNP
FT                   GSYQFGFQFTDSHSFISCTPERLFHRHGRELSTEALAGTTTRGFTEAEDEALANALLAD
FT                   GKNSNENLLVRQLIEQQLGPLSDYVGSEETPTILKLNHIQHLHRSIRAELKAGVNDLQL
FT                   LGALHPTPAVGGLPRESAMSFIRQREGFARGWYAGACGYFGAHETEFAVAIRSARFESE
FT                   RVTLYAGAGIVAHSEADAEWQELNNKLTTVLGILNGL"
FT   gene            complement(58288..58725)
FT                   /locus_tag="Fbal_0046"
FT   CDS_pept        complement(58288..58725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74260"
FT                   /db_xref="GOA:E1SVA6"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA6"
FT                   /protein_id="ADN74260.1"
FT                   /translation="MANTADCPAARLHRWARPTTLVIAALGAWIQSIPVMLLGLTGLVV
FT                   LAVHLVRLKESRSFKLQSEQEMVAAQTHLEQAMMLALGVCGTMLTLHLLWLHQLNLALM
FT                   LVVTAAITKTVWNVIYLGRPGLGSSLITLTLTVSLLWTLTL"
FT   gene            complement(58884..60428)
FT                   /locus_tag="Fbal_0047"
FT   CDS_pept        complement(58884..60428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0047"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="COGs: COG0554 Glycerol kinase; InterPro IPR018484:
FT                   IPR018485: IPR018483: IPR005999; KEGG: saz:Sama_0341
FT                   glycerol kinase; PFAM: Carbohydrate kinase, FGGY-like;
FT                   SPTR: A1S2E6 Glycerol kinase; TIGRFAM: glycerol kinase;
FT                   PFAM: FGGY family of carbohydrate kinases, N-terminal
FT                   domain; FGGY family of carbohydrate kinases, C-terminal
FT                   domain; TIGRFAM: glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74261"
FT                   /db_xref="GOA:E1SVA7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA7"
FT                   /protein_id="ADN74261.1"
FT                   /translation="MMKTNPQAKPAMSSEQFILALDQGTTSSRALLFNRQGTILGSAQR
FT                   EFTQHYPQSGWVEHDAMEIWASQRAVLTEVLARCGVRHEQVAAIGITNQRETTVIWDAE
FT                   TGQPIHNAIVWQCRRTADLCEALKAKGLEQHVRDTTGLVLDPYFSGTKIAWLLDQVPGA
FT                   RERAERGELRFGTIDCWLLWQLTDGAVHATDRTNAARTLLWDIHQQRWDPTLLDALNIP
FT                   ASLLPEVKSSQELFGHAQIGRARIPVAGIAGDQQAALFGQLCTQPGMAKNTYGTGCFML
FT                   MHTGDQAVQSRHGLLTTIACSGPEQVEYALEGAVFMGGASVQWLRDELGLIRHASETQA
FT                   LAQSVPDTAGAYLVPAFTGLGAPYWDPYARGALVGLTRGCNRQHIVRATLESIAYQSRD
FT                   LLDAMQLDAALPLTELRVDGGAVANDFLMQFQADILATPVLRPHNRESTAAGAAYLAGL
FT                   TVGYWPDRASLAGLNQTERRFESTMDDTQRQQLYSGWQDAVGRTLVTKAPHPGSGQ"
FT   gene            complement(60479..61228)
FT                   /locus_tag="Fbal_0048"
FT   CDS_pept        complement(60479..61228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74262"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA8"
FT                   /protein_id="ADN74262.1"
FT                   /translation="MLRTITVFTAGALAGGLTGALVAHHWLTPQPPVCPPQVPCNADAD
FT                   ELAMLQWENRMLVAMVQAGLRGDISGHIQTFSAMQAPPKTNPTATPQPVTSPAAPAQPP
FT                   TGAAADALVERLTRADLKLQRQALAEGWATDERLVRERQALWDQARRQLSDHDYMNALH
FT                   RAGRPNRLLVDAVKRDIKGLQHGDVIWALDGRRILTRAEYRDYLATLPEQTLVTVEIRR
FT                   NGQSQQLSVSGLASGLSLIADSVPAPE"
FT   sig_peptide     complement(61160..61228)
FT                   /locus_tag="Fbal_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(61376..63967)
FT                   /locus_tag="Fbal_0049"
FT   CDS_pept        complement(61376..63967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA0992 hypothetical protein; SPTR: A3U4C3
FT                   Transcriptional regulator, AraC family with Parallel
FT                   beta-helix repeat (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74263"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA9"
FT                   /protein_id="ADN74263.1"
FT                   /translation="MKRTPSVPFKHPRTVLLVAMTAAGIALPSLAVVPEADNPIFNTPA
FT                   NSADSCMADAYIETGGKGLKDKVGQVINCTAEDVEIAEVTVKAVDGETSSTGDFTCTLG
FT                   DTIEVTADLRVRTNAAERYDTTFFVSRDLDSPQVVQQDEEACSILIPKNDFKGTGNAQN
FT                   LDADQCGDIAKSGLVNDEYTLVNAVFTMTCTASPGSERVEFNYCAAWDVQEDPANCSAT
FT                   GAAPGQEPSSKSKCNCDIIPLNIFIQPDPAKITKTLKSASNSGTEPMATFEYEVKIERG
FT                   STDADLVITDIDDLYRSVADSGSPKVGSSDAPILFDLDGTNSDTTIGNLTLLGADNKCY
FT                   DTVPVTLTAASPTFTCTFKVKVSDEDLPDALDPTEATPMPPAGEEEYQNFIRITSVDLN
FT                   GDNIGDNTCDVTDNLTSNDEGNCSNVIAVKITNVDPSIVITKTPVAGPGLQNIGGAWFV
FT                   EDQGLITYEITITNNSTVDALSLLALTDTSVTNLLNDSSGTPACNTYPASLSANGGKFT
FT                   CRYIVNVTLVDGASYPNTVNVDAKDNENRRTDDMAMVTITRATPSVVLVKKVAKSGDVG
FT                   IPTPAIDSASFMDSVTIDEPGGSAHPVVYRFTVTNNNTTTKEDLTLNSLEDNVLFGSVR
FT                   ATAAPVQRSDECAFPQTLVFGTPYVCTLVAYVDGNATNVSDTAYDDTQLVNTAFVKATS
FT                   TQGKQIQSQPDSATVLFKDVPPTVTGKYGLAGTIFIAVKNTSFEAIWLSELSIFNTPVK
FT                   DGNLFNGYRIVNDGGTLTGIDEDPTTPVSDAPLACEEPGYTLKLDPGEEYVCAFTVELA
FT                   DFNEGDFAEFQADILRGAPNRNVVVKFVDEEGTPVTTDAEVQVKTGDNIDQ"
FT   sig_peptide     complement(63875..63967)
FT                   /locus_tag="Fbal_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(64382..65761)
FT                   /locus_tag="Fbal_0050"
FT   CDS_pept        complement(64382..65761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0050"
FT                   /product="cytochrome c, putative"
FT                   /note="InterPro IPR011031; KEGG: slo:Shew_0514 cytochrome
FT                   c, putative; SPTR: Q64BJ9 Cytochrome c putative; PFAM:
FT                   Cytochrome c bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74264"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR024673"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB0"
FT                   /protein_id="ADN74264.1"
FT                   /translation="MKRHTILLLGLLGWPALASNPHAEFIEGPISTGPEATAQCLTCHE
FT                   QHAKDFMQSSHWTWSLQQELPGRTVDRGKKNVINNFCVAVSGNEPRCTSCHAGYGWEDN
FT                   QFDFTDMAKVDCLVCHDTTGTYVKDPAGAGAPLAKVNLLRVAQNVGEPVRDNCGSCHFY
FT                   GGGGDGVKHGDLDSSMGYPDRQTDVHMDVDGLDFQCQACHETPNHQISGQAMGVSPGGQ
FT                   NHFGCENCHDAAPHDNAKLDSHTASVACQTCHIPFFARNEPTKLTWDWSTAGQDKPETK
FT                   DEHGRKTYQRKKGDFTWGVMVEPEYAWYNGNGDAYVAGDKMNPEQVTKLAFPLGDISDP
FT                   SAKIYPFKVHRGEQIYDAEHRVFITPKVWGEGGYWKTFDWDQASRLGMAANAEMQKLGL
FT                   SYSGKHGFAPTEMWWRINHMVSPKEDALGCMDCHGSGDRLDWKALGYDGDPMKQGGRKT
FT                   D"
FT   sig_peptide     complement(65708..65761)
FT                   /locus_tag="Fbal_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(65801..67504)
FT                   /locus_tag="Fbal_0051"
FT   CDS_pept        complement(65801..67504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0515 hypothetical protein; PFAM:
FT                   Protein of unknown function (DUF3373)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74265"
FT                   /db_xref="InterPro:IPR021803"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB1"
FT                   /protein_id="ADN74265.1"
FT                   /translation="MMKTLVATLVSLALTAPALAAETSEQEALKLRLDELNEELEYLSD
FT                   RLDKAERHTATDRIQFSGDFRVRAHTLHYQDVTWNPAMLVDFNDFGAKAMSGQLGDPNN
FT                   PNSPLGALMASNPALAEAFMSGQLQGVMPMVLAPKQTYDVNNDILYNTRLRLNLKAQVW
FT                   DNVSFAGRLTMYKNWGDSTGVQVFDSWRSFTMDGTNSGNTSGDWLRVERAYFDWKNIAD
FT                   SNFYLSIGRRPSTYGPPTQYRENELRGGTPSGHLVNFNFDGATLGYRLGEITGIEGQVL
FT                   RFCYGQGFESQWGNGEMYGDIVTKDTHLGGFNIDALNDGTHFLQLTLFGAKDVNDGFKG
FT                   LMAFPTQLAGIFAPTMYQDMQKFDDFNFVTRVQPSSVIGDMYLGGIGYAYEGDSGFVGF
FT                   ASLGWTRTESNGNAGLFGGMLADARFEAALNADGTEILMVPVAAQDAGDHDGYGAYVGI
FT                   QIPAPGGKFGLEYNYGSEYWTPFTQAQDDPIGSKLATRGHVGEAYYIFDINPKMHIKLS
FT                   GLYYDYEYSGSGTPVGAPQKVEDILAGTAYSMLPVVDTAYDINATLALRF"
FT   sig_peptide     complement(67445..67504)
FT                   /locus_tag="Fbal_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(67531..67854)
FT                   /locus_tag="Fbal_0052"
FT   CDS_pept        complement(67531..67854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0052"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: shm:Shewmr7_0441 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74266"
FT                   /db_xref="GOA:E1SVB2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB2"
FT                   /protein_id="ADN74266.1"
FT                   /translation="MKTTSQTALAMLLLTLAAGAMAVDGGNPKKGKHEYKRECKACHTV
FT                   GAEGGEITPMSKTMGQWDRFFQRDKHKAKPEVFEQLDPQKLLNIHQFLYDHAADSEQPA
FT                   TCG"
FT   sig_peptide     complement(67789..67854)
FT                   /locus_tag="Fbal_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            68399..70399
FT                   /locus_tag="Fbal_0053"
FT   CDS_pept        68399..70399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0053"
FT                   /product="Protein of unknown function DUF1800"
FT                   /note="COGs: COG5267 conserved hypothetical protein;
FT                   InterPro IPR014917; KEGG: vpa:VPA0969 hypothetical protein;
FT                   PFAM: Protein of unknown function DUF1800; SPTR: A0XXJ2
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1800)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74267"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB3"
FT                   /protein_id="ADN74267.1"
FT                   /translation="MGLNLKPILLCQALCALVLLQGCGDTEPQIPESPGIDEKEPTPDP
FT                   TPDPTPDPDPTPDPDPTPDPDPTPDPDPDPDPDPDPDPTPDPDPTPEPEQNQAPLAMDY
FT                   VHPDTVRYGASVTLSLDQLGQDADGDALQLAQWVTDDDSTAISVNEQGELTLRPLKTGT
FT                   QQWAFQLSDGEAESEMATFTVTVDAPSKKQYQRLLLQSTFGPTPADVENYAGFEPVAWI
FT                   DEQLALSPSSHEPAELMGISHDDREDTWFYLSATAPDQLRQRVAFALSELFVVSRLGVL
FT                   SQREEALTRYYNNLVTGSFGNYRDLLEAVSLHPAMGAYLTLINSRKADEARGFQPDENY
FT                   AREVMQLFTIGLYELNADGTLKRDDSGLPIPSYTQQDVQEIARAFTGWQKSDAEYIEPM
FT                   SADESYHDTGSKAALGHSLPAGQTALEDMRQVLDILFEHHNTPPFFARHMIQRLVSSNP
FT                   SPEYVERVAQVFIDNGHGVRGDIGAVVKALLLDEEALGLNPDAPPRKIKEPLIALLNLV
FT                   RGMNGQLDDQTRKFSGSKYAYWAAGQGPLRATSVFNFFSPDYVIGSEQKTAPEAEILSW
FT                   TAYAGCANYMRAMLFESKDVDFEVSYFTEDFDDVDRAIDKIRFLFFGEDMNPTLEPHLR
FT                   ALIESASNPDVGMRETVGVLIANSDEFFIQD"
FT   gene            70404..71708
FT                   /locus_tag="Fbal_0054"
FT   CDS_pept        70404..71708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0054"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="COGs: COG4102 conserved hypothetical protein;
FT                   InterPro IPR010869: IPR019546: IPR006311; KEGG:
FT                   vvu:VV1_2853 hypothetical protein; PFAM: protein of unknown
FT                   function DUF1501; Twin-arginine translocation pathway,
FT                   signal sequence, subgroup; SPTR: A0XXJ1 Putative orphan
FT                   protein; PFAM: Protein of unknown function (DUF1501);
FT                   TIGRFAM: Tat (twin-arginine translocation) pathway signal
FT                   sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74268"
FT                   /db_xref="GOA:E1SVB4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB4"
FT                   /protein_id="ADN74268.1"
FT                   /translation="MPISRRTFLKGIGASALMSQVGWATASTAVSDYRALVCIYFNGGN
FT                   DGFNTLVPTDDTHYQEYANIRKHLAIPQANLLTTSLSGRDRAGNTVELGLHPSMEGLKA
FT                   LCDRGYVTGLLNCGVLKRPMTVADHGAEPDMLFSHNSQTYEWLRGDAINKSLSSGWGSR
FT                   LMAQLSQQSDIPPMYSFAGQSRLFRGPDKANSLSASGAQTITMRTFLKNRYIQTLDNER
FT                   PDPFREHFRGIMRDSIYASQTVNGVISGAANATLAADSDNPLSLQLDATLKFINSRESL
FT                   TQNRQIFFLNLGGFDTHANQVSSHEALLSQFSRAVKNFYDLLDEQGLSSKVTTVTLSDF
FT                   GRRIIPNATGTDHGWGNNQFVISGAPMAGTTVGTWPSLVPGGEDDFSAGRLLPTTSVDQ
FT                   IGATLARWMGVAEPDLQAVFPNIANFTPKALPLFS"
FT   sig_peptide     70404..70490
FT                   /locus_tag="Fbal_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(71773..73128)
FT                   /locus_tag="Fbal_0055"
FT   CDS_pept        complement(71773..73128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0055"
FT                   /product="NADPH-glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3); InterPro
FT                   IPR013027: IPR000103: IPR000815: IPR001327: IPR 004099:
FT                   IPR012999: IPR006322; KEGG: slo:Shew_3660 glutathione
FT                   reductase; PFAM: pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: A3UP40
FT                   Glutathione reductase; TIGRFAM: glutathione-disulfide
FT                   reductase; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase; Pyridine nucleotide-disulphide
FT                   oxidoreductase, dimerisation domain; TIGRFAM:
FT                   glutathione-disulfide reductase, animal/bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74269"
FT                   /db_xref="GOA:E1SVB5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB5"
FT                   /protein_id="ADN74269.1"
FT                   /translation="MAQQFDYIVLGAGSGGIASANRAAMRGAKVLLIEAQHLGGTCVNV
FT                   GCVPKKVMWFGAQVAEAIKLYGPDYGFDTTLNQFSWSKLVESREAYIERIHGGYNRGLD
FT                   ANGVTLVKGFGKFVDAKTVEVNGEHYTAPNILIATGGRPTIPAIPGAEHGIDSNGFFAL
FT                   TEQPKRVAVVGAGYIAVELAGVLHSLGSETHLLVRKHAPLRNFDPMIVDTLVKLMAAEG
FT                   PTLHTHSIPKAVEKEADGSLTLHLENGNSLNVDCLIWAIGREPATDKINIEASGVKVNE
FT                   RGFIPVDEYQNTNVPGIYTVGDIMEGGIELTPVAVKAGRALSERLFGGQPEAKMDYSLV
FT                   PTVVFSHPAIGTIGLTEPQAREQYGDDNVKVYTSSFAAMYTAVTAHRQATEMKLVCVGP
FT                   EEKIVGLHGIGFGMDEILQGFAVAIKMGATKADFDATVALHPTSAEEFVTMR"
FT   gene            73586..74278
FT                   /locus_tag="Fbal_0056"
FT   CDS_pept        73586..74278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0144 hypothetical protein; SPTR:
FT                   A2UXY0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74270"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB6"
FT                   /protein_id="ADN74270.1"
FT                   /translation="MMKRSLIALALCLPAIGAGAAEYEVDFGYDSKYISQGRDNLEQGG
FT                   IYWASGAAGFDNGIVLSAAYGYAADSDVDYDELNLGIEYGFELGDFAFYGSYTRLEFFK
FT                   DDEADNELGAGVAYGGLSWFEPFIDYVYSTESEGSFVEIGIQREFALNERLALTPYVIA
FT                   GLDYGYANPDHDGENHLAVGATLGYQLTEQLGLTLIAEHTEAHRQMAKDEGIETDQTWA
FT                   GIHLTMAF"
FT   sig_peptide     73586..73645
FT                   /locus_tag="Fbal_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(74618..76192)
FT                   /locus_tag="Fbal_0057"
FT   CDS_pept        complement(74618..76192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0057"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="COGs: COG0069 Glutamate synthase domain 2; InterPro
FT                   IPR018967: IPR002932: IPR006622; KEGG: vpa:VPA0765 putative
FT                   glutamate synthetase; PFAM: ferredoxin-dependent glutamate
FT                   synthase; Iron sulphur domain-containing, CDGSH-type;
FT                   SMART: zinc finger CDGSH-type domain protein; SPTR: A3UQB8
FT                   Glutamate synthase domain protein; PFAM: Iron-binding zinc
FT                   finger CDGSH type; Conserved region in glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74271"
FT                   /db_xref="GOA:E1SVB7"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB7"
FT                   /protein_id="ADN74271.1"
FT                   /translation="MTKPIIAAVRPAKVALKAGQSYWFCRCGRSATQPFCDGSHKGTDF
FT                   TPLAFSPEKDGDAYLCQCKRSQEQPYCDGSHARIPAEQVGTEGGENDAPKREAADGSSN
FT                   ANRPPQAEPTPEEPEVAFIHQLAREGLAGGHHGPMVAMGVPRHTLPQWDAIQVMVAQLA
FT                   RPPLLDDARVGTELVIGPRARKPLTLAMPLFVSDMSFGALSREAKIALAQGAELAGTGI
FT                   CSGEGGMLDAEQAACSRYFYELAAARFGFDEAKLKGVQALHFKAGQAAKTGTGGHLPAD
FT                   KVTEEIAAVRGLPAGQPAISPARFTDLTSPRDFRRCADRIREVTGGIPIGFKLSANHVE
FT                   QDIQFALEASADYLILDGRGGGTGAAPALFRDHISVATIPALARARRYLDAQGQRDITL
FT                   IITGGLRTPADFVKALALGADGIALANAAIQALGCVGARMCNSNRCPTGIATQDPTLRQ
FT                   RLDTQAGPQRVARYLQSACELMTVMARACGHAHLSDFSLADIATADRELVALAGVPYVG
FT                   VSKEVNS"
FT   gene            76359..78407
FT                   /locus_tag="Fbal_0058"
FT   CDS_pept        76359..78407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0058"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="COGs: COG0339 Zn-dependent oligopeptidase; InterPro
FT                   IPR001567: IPR006025: IPR019824; KEGG: saz:Sama_3546
FT                   oligopeptidase A; PFAM: peptidase M3A and M3B
FT                   thimet/oligopeptidase F; PRIAM: Oligopeptidase A; SPTR:
FT                   A2UXX9 Peptidase M3A and M3B, thimet/oligopeptidase F;
FT                   PFAM: Peptidase family M3"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74272"
FT                   /db_xref="GOA:E1SVB8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB8"
FT                   /protein_id="ADN74272.1"
FT                   /translation="MTNPLLEPHALPAFSQIQPEHVQPAVEHALKQCRETVERVLASGA
FT                   APTWDNLIAPIDEVEDTLSRLWSPVSHMNSVVSNDALRAAHDACLPALSEYGTWLGQNK
FT                   DLYEAYKALAASDGYADLSPARKKVIENGLRDFELSGIGLPEAEQKRYGEIVMRLSELS
FT                   SQYSNQLLDATNAWTKLVTDEAELAGLPESALEAAKQSATQRGLEGYLLTLEFPSYLAV
FT                   MTYADNAELRREVYTAFCTRASDQGPHAGQYDNGPLMSEILALRQELAQLLGFDSPAHK
FT                   SLATKMAQTPEQVISFLNELALASKGQGERELKELTEYAKAEHGVDSLNAWDITYFAEK
FT                   QKQHRYQISDEALRPYFPENKVLSGLFHTVERLFGVKVQEREGVDTWHKDVRFFDLLEA
FT                   DGSVRGSFYLDLYARQNKRGGAWMDDCQGRRVRADGSLQKPVAYLTCNFNGPVGDKPAL
FT                   FTHDEVVTLFHEFGHGIHHMLTRIEDAPGVAGINGVPWDAVELPSQFLENWCWESEALA
FT                   EISGHYQTGEPLPTEMLEKMLAAKNYQSAMMMLRQLEFALFDFRLHLEYSELQDADPIQ
FT                   NVLNQVRGQVAVIKAPEFNRFQHSFSHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGI
FT                   FNPQVGGDFLQHVLEMGGSEEPMALFTRFRGREPEIDALLRHSGIAQ"
FT   gene            78526..78747
FT                   /locus_tag="Fbal_0059"
FT   CDS_pept        78526..78747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74273"
FT                   /db_xref="GOA:E1SVB9"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB9"
FT                   /protein_id="ADN74273.1"
FT                   /translation="MGAFLQRWGWALVTTNLLGWGLALLGLYHYLFTATARASGLDPGL
FT                   VMGLGVVLMLPQTLRLLLRYWFADDRAP"
FT   sig_peptide     78526..78639
FT                   /locus_tag="Fbal_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            79131..79847
FT                   /locus_tag="Fbal_0060"
FT   CDS_pept        79131..79847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0060"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: tgr:Tgr7_1609
FT                   transcriptional regulator, TetR family; PFAM: regulatory
FT                   protein TetR; PFAM: Bacterial regulatory proteins, tetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74274"
FT                   /db_xref="GOA:E1SVC0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC0"
FT                   /protein_id="ADN74274.1"
FT                   /translation="MNKSELFKAREQRILSAALVTARGKGALDFRMADVARAAECSVGT
FT                   LYGHFLSKEDMMAALVQISLQQRHEWIARLNEMELTPMERFVTLLASERVRLLRDDVLA
FT                   QLELLVSHTELWRRAADQRQLALRALVEELVKALEGILQDARQQNLLAVGEAECSTLVA
FT                   RARALLLGFQLQSSRQTLAPTAELAETDGLLDALANLLAGAGLAEGHTEWRTRCREALR
FT                   QYPALPEVAIQAPNAA"
FT   gene            79911..80687
FT                   /locus_tag="Fbal_0061"
FT   CDS_pept        79911..80687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0061"
FT                   /product="protein of unknown function DUF548"
FT                   /note="InterPro IPR007536; KEGG: spc:Sputcn32_0100
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF548; SPTR: A1RQ25 UPF0341 protein Sputw3181_3966; PFAM:
FT                   Protein of unknown function (DUF548)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74275"
FT                   /db_xref="GOA:E1SVC1"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC1"
FT                   /protein_id="ADN74275.1"
FT                   /translation="MSTTIYLDPGSEQPARLAELAQRWQLHHCEDAPFRLTLEQDRLRL
FT                   YDRHQPKLGAIEVDLVGGAVAHRRKFGGGRGQAIAKAVGLKGGASPSVVDGTAGLGRDA
FT                   FVLASLGCDVTLVERHPVVAALLDDGLRRAYDDAEIGPWVSERMRLFHGNSLEALAELD
FT                   LQPDVVFLDPMYPHRAKSAQVKKEMRVFQELVGADMDADGLLAPALQLAQKRVVVKRPD
FT                   YAEPLADRAPTMVIDTKKNRFDVYVKAAMAELASER"
FT   gene            80863..81288
FT                   /locus_tag="Fbal_0062"
FT   CDS_pept        80863..81288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0062"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182; KEGG: cja:CJA_2433
FT                   acetyltransferase, GNAT family; PFAM: GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74276"
FT                   /db_xref="GOA:E1SVC2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC2"
FT                   /protein_id="ADN74276.1"
FT                   /translation="MNGISAHWLSPVQAPLASRFYAAEGQKERARRDERIAVLRDADGT
FT                   IIAAARLSPRGDAWLLRALQVARHCQGQGLARQLMQFVLSQPQPLWCFSLPHLQPFYRS
FT                   LGFVVPDAAGVPAAIADPFAAYCRTQPLVILYAPGAD"
FT   gene            81415..81945
FT                   /locus_tag="Fbal_0063"
FT   CDS_pept        81415..81945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0063"
FT                   /product="Ferroxidase"
FT                   /EC_number="1.16.3.1"
FT                   /note="COGs: COG1528 Ferritin-like protein; InterPro
FT                   IPR008331: IPR009040; KEGG: spl:Spea_0129 ferroxidase;
FT                   PFAM: Ferritin Dps family protein; PRIAM: Ferroxidase;
FT                   SPTR: A2UXU0 Ferritin and Dps; PFAM: Ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74277"
FT                   /db_xref="GOA:E1SVC3"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC3"
FT                   /protein_id="ADN74277.1"
FT                   /translation="MLSKAMVDKLNEQINLEFFSSNLYLQMSAWCEDKGFEGAALFLRA
FT                   HADEEMEHMRRLFTYVSEAGGLPMLGAIEAPEHEFDNLAALFAQTYEHEQLVTRKINEL
FT                   AHAAFTNQDYSTFNFLQWYVAEQHEEEKLFKSILDKLELVGNDGQGLYLVDKDLAKLAT
FT                   EEAASVMHEASEA"
FT   gene            81998..83326
FT                   /locus_tag="Fbal_0064"
FT   CDS_pept        81998..83326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0064"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2211 Na+/melibiose symporter and related
FT                   transporter; InterPro IPR011701; KEGG: tgr:Tgr7_1387 major
FT                   facilitator superfamily transport protein; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: A0YDP0 Major
FT                   facilitator superfamily MFS_1; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74278"
FT                   /db_xref="GOA:E1SVC4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC4"
FT                   /protein_id="ADN74278.1"
FT                   /translation="MSTSLPRRQLLLFGLLNLPLSMLMSPTAAMLPAFYLETTAVTAAG
FT                   LATATLVARLFDGLTDPILGWLSDRSGRRKVWMALGVVLVLLGIWPLFQPPEEAGVAYL
FT                   VGWYLLVTLGWTAVEIPHSALAAEMSNDYQERSRVVLWRQMLGFLGGLLFMASPMILLG
FT                   RSGFTDEVFALLAGFIAVALPLGLVLMWRAVPEPSHPSRARPGLRDLLGALSTIAPLRY
FT                   FLLTQVLFGLATGAVSSLFVIYASFYLGHADAIAKIAMPMTLAMAAGMPLWLQLLKRVD
FT                   KHRAWALSGVGMIVCLLAVLTLEPGPDSLKPMMALMTGFGFFLGLSSLALPSLLADVVD
FT                   YDRWKNRKDRAAILFAFQALITKFNQGIGGAIALGIPALYGFTGKGVLEGEAVTGLKLG
FT                   FVVWPCLLLVPMLLLAWRYPLTRHRQGVLARRLARRIATNPHP"
FT   sig_peptide     81998..82084
FT                   /locus_tag="Fbal_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            83422..84198
FT                   /locus_tag="Fbal_0065"
FT   CDS_pept        83422..84198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0065"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: she:Shewmr4_0298 TetR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   TetR; SPTR: A2UXH6 Transcriptional regulator, TetR family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74279"
FT                   /db_xref="GOA:E1SVC5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC5"
FT                   /protein_id="ADN74279.1"
FT                   /translation="MQCPSTEAQFERSQLILNATEWLIETQGLIAFKISDLSNHAGIAN
FT                   SSLYKLFESKEDLLVCCFLRNATSNHFAPFEAQYPDLTPIQRVLIPIMFTFEATHFAPT
FT                   FNLVRQVAVNPMVWRRASPEKVKAFETRINLFWRAIKGYVVEAVESGDLVATEEEVLEL
FT                   TQAITFYLSGALSAYQSQLINNTYLKEKRYTLFRQLQKVFLPYQWRQQMELADFERIGM
FT                   RVHLYYRQLGETFNRCERCQQAGQCGAGTSPSVATE"
FT   gene            complement(84202..84945)
FT                   /locus_tag="Fbal_0066"
FT   CDS_pept        complement(84202..84945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0066"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="InterPro IPR013096; KEGG: sse:Ssed_4188 cupin 2
FT                   domain-containing protein; PFAM: Cupin 2 conserved barrel
FT                   domain protein; SPTR: A2UXI1 Putative uncharacterized
FT                   protein; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74280"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC6"
FT                   /protein_id="ADN74280.1"
FT                   /translation="MMKPVALILTALLAGNAYAGHGEHAFKMEQRPYQQPTAIPYDYSP
FT                   YSPQTTMPEQCRDPLVEQYIADWEAGKIDFNTITANDSIAKDQRFCKGLDNDGNILEVK
FT                   GCDLNNAPVGYLWKELADYPLTIGITNGGKSDHEPHFHGQPECYYAVSGRARTLADGEY
FT                   KWMEKGMYFYIPGNTIHNTPITEEEGFGVLYWYPKNAHFDGFKYYWRKDVKNLRVAEEA
FT                   FDRVDIMRKAAMGLGPYGTNEARFK"
FT   sig_peptide     complement(84889..84945)
FT                   /locus_tag="Fbal_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(85016..85381)
FT                   /locus_tag="Fbal_0067"
FT   CDS_pept        complement(85016..85381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0067"
FT                   /product="tetraheme cytochrome c, putative"
FT                   /note="InterPro IPR011031; KEGG: sse:Ssed_4185 tetraheme
FT                   cytochrome c, putative; SPTR: A2UXH8 Tetraheme cytochrome
FT                   c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74281"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC7"
FT                   /protein_id="ADN74281.1"
FT                   /translation="MKQLLISLGLALALTSGAQAGELVAMKGKLEGRSNHAFLYEDGCN
FT                   GCHTGNAKKYVDDQSCIECHGTIDTIEITTELVLEEANPHKSIHYGNGASCLACHAEHE
FT                   TKAPVCSECHRTWFNER"
FT   sig_peptide     complement(85322..85381)
FT                   /locus_tag="Fbal_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(85393..86895)
FT                   /locus_tag="Fbal_0068"
FT   CDS_pept        complement(85393..86895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0068"
FT                   /product="flavocytochrome c"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR006076:
FT                   IPR003953: IPR019546: IPR002345: IPR 006311: IPR010960;
FT                   KEGG: sse:Ssed_4184 flavocytochrome c; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; Twin-arginine
FT                   translocation pathway, signal sequence, subgroup; SPTR:
FT                   A2UXH7 Flavocytochrome c; TIGRFAM: flavocytochrome c; PFAM:
FT                   FAD binding domain; TIGRFAM: flavocytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74282"
FT                   /db_xref="GOA:E1SVC8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC8"
FT                   /protein_id="ADN74282.1"
FT                   /translation="MSSRRSFLKYGAALTATGLTVSMPANAAKDAPQWDEEVDVLVIGS
FT                   GFAGLSCALNAKREGLGNILVLEKMQVIGGNSAINGGWFAVPRNPVQLAQGINDDSPEE
FT                   LVKDQLIAARGMGDEAKLRKIANHALDSYNLCVESGVKFKKDFNIQVGGHNKARAVRTQ
FT                   HGTGGDITSKLYEVAKAEGVDFRLQHFIEDLVVENDVVTGVVVRRGYRFPDEKTGHTLR
FT                   IKARKGVILASGGFTRNMKLRAMVDPSLDPTLDGTNHLGATGEAMLSAMGHGALAVHLN
FT                   MIQTGHWGSPDEGGFGWSNALLSIGWHQGISVSVLSGKRYMNERADRLYCSTRIMANRY
FT                   EDGSPAYPLVFINYDKYGNDERVTRALRDEMAWKVDSLEEMAEKFNVPVAELKKTVARW
FT                   NEQVKQGVDPDFDRKMDTAEELKAPFVVSRIWPKVHYCMGGLKTDIDGRVLSAKTLEPM
FT                   KGLYAAGEVSGGTHGEARLSSCACLEGLAMGFIVPKAIKADA"
FT   sig_peptide     complement(86815..86895)
FT                   /locus_tag="Fbal_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            87208..88662
FT                   /locus_tag="Fbal_0069"
FT   CDS_pept        87208..88662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0069"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="COGs: COG0790 FOG: TPR repeat SEL1 subfamily;
FT                   InterPro IPR006597; KEGG: slo:Shew_3592 Sel1
FT                   domain-containing protein; PFAM: Sel1 domain protein
FT                   repeat-containing protein; SMART: Sel1 domain protein
FT                   repeat-containing protein; SPTR: A2V3P3 Sel1-like repeat;
FT                   PFAM: Sel1 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74283"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC9"
FT                   /protein_id="ADN74283.1"
FT                   /translation="MNDLELVRRLDRRLVDDYRLARNYCLDVPTFALVHLRSIAHRLTT
FT                   WLGERAELEFHSKNLYDRIEQLARAKVIDMRLARKLHKLRGDGNKGAHPEKYHLSLEQL
FT                   VQLAGKSVKDTARLCAEVFPLLHPDEAVPEWQFEPVDVVAGRELCYRAVMEDDPEAQYL
FT                   VGLSLKARSLMQQERARSYALANDGQIPDLSDARRVLEQAAYWFRRAAQEHPAARFEHG
FT                   VALLNGYGGERDPQAAVRLIAEAAEQGVADALALVGYFYLAGSQGYGQDPLKAEHYLKL
FT                   AAEQDQPEAMANLGVLYYQGLLGQPDLAQARACSEQAALAGYPHAQYHLAVMLFAGEGG
FT                   DADPEAGLSWLRQAAAQHYPDALADLAQRTLDGDGVDTNPAAAVTLYQEAIQYGRLPRA
FT                   MFELALAHFDGEVPERDLATAGQLLHQAFLHAVPDSELAEAIWQLAPELVAQLDQALAQ
FT                   ESEQRDDLLQARARFDSAGYPLGNAP"
FT   gene            88659..89180
FT                   /locus_tag="Fbal_0070"
FT   CDS_pept        88659..89180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0070"
FT                   /product="ribosomal protein N-acetylase-like protein"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   sse:Ssed_2792 ribosomal protein N-acetylase-like protein;
FT                   SPTR: A2TTT1 Acetyltransferase, GNAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74284"
FT                   /db_xref="GOA:E1SVD0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD0"
FT                   /protein_id="ADN74284.1"
FT                   /translation="MTPLIRGPRLSLYRFAPRDAAGFMAMNADPRVVQHTGDRPFADEA
FT                   DALRFIQHYDHYQRHGFGRWSLYTHEGEYAGFCGLRRAAGEVDLGYRLPWRLWGRGLAT
FT                   EAAQLALQLGFERFDLGSIVGRARCANPGSIRVLEKVGMGLEGAFTEEGHDWLQYRIRS
FT                   HEWTGLPFLR"
FT   gene            89314..90636
FT                   /locus_tag="Fbal_0071"
FT   CDS_pept        89314..90636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0071"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011765: IPR007863; KEGG: slo:Shew_3581 peptidase M16
FT                   domain-containing protein; PFAM: peptidase M16 domain
FT                   protein; SPTR: A2V2M7 Peptidase M16-like; PFAM: Peptidase
FT                   M16 inactive domain; Insulinase (Peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74285"
FT                   /db_xref="GOA:E1SVD1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD1"
FT                   /protein_id="ADN74285.1"
FT                   /translation="MGIRLATLALGLALSPLSQANTADEVQTLDLANGMRILVLEDDTI
FT                   PNANMYLFWKVGSRNEVPGITGLSHFFEHMMFNGSEQFGPKMFDRTMEAAGGANNAYTT
FT                   ENLTVYTDWFPADAMETIFKLEADRIANLSIDPAMVESERGVVDSERRTGLENSNWRML
FT                   QEEVKGVAFRAHPYSAPVIGHQSDIHAWTQDDLVNFHRTYYAPNNAVVVISGAVTFEQV
FT                   NALAQQYFAPIPAQTPPPAVRTVEPEQKGERRVYVQKPSVSTPNLMLAYKIPATDSADY
FT                   HALDLAMSLLIDGNSSRLSRALVDKQLALGVDGYMPESFDPNLFYLYAVAAAGVDAAQL
FT                   EAAMIAEVNRLAAEPVTQAELDKVKNRKLMAFYDTMETINGKSNTLGTYELFFGDYRAL
FT                   FNAPQAYEAVTAEQIQQVAQKYLIKARRTVGVLAAEEDTDQ"
FT   sig_peptide     89314..89373
FT                   /locus_tag="Fbal_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            90633..92081
FT                   /locus_tag="Fbal_0072"
FT   CDS_pept        90633..92081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0072"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011765: IPR007863; KEGG: shw:Sputw3181_0448 peptidase
FT                   M16 domain-containing protein; PFAM: peptidase M16 domain
FT                   protein; SPTR: A2V2M6 Peptidase M16-like; PFAM: Peptidase
FT                   M16 inactive domain; Insulinase (Peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74286"
FT                   /db_xref="GOA:E1SVD2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD2"
FT                   /protein_id="ADN74286.1"
FT                   /translation="MKAKMMLMSALVMAGCSATQQPAQPAKTTNPTPAPVAVAPTPKFA
FT                   LPEYQVRTLDNGLTVYLMERHQVPLITVNAVVRAGAVNDSEPGLAALTAESLLLGTSKM
FT                   KKAELEALVDGLGASLTAGAGKEGTTVNARFLAKDTDTMLDLVADVLQHPSFPSDEVKK
FT                   ARDRYVAMLAQQKESPRTVIRQYFDMLYYGDHPYANTTVGDGARLSQLDAFDLRMFHGS
FT                   WFQPRNAAIVVAGDFDADAMARAIEQRFGTWRDGDTPTAPKLNQPVKVPQQARVLLVDK
FT                   PDARETTFLIGGPGVARDNPDYVGLQVINTILGGRFTSWLNDELRVNAGLTYGARSGFT
FT                   SYGEAGSFQISTFTATETTQEAIDLALKTYQRLWQQGIDEATLASAKAYVKGQFPPRYE
FT                   TSGQLAGLLGQMYLYDLSDAQVNAFQQQVDALTLEQAQALVAKYFPKADLQFVLVGQAD
FT                   AIRGVAAQYGEVAEVAISDHGFWF"
FT   sig_peptide     90633..90692
FT                   /locus_tag="Fbal_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            92105..92650
FT                   /locus_tag="Fbal_0073"
FT   CDS_pept        92105..92650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0073"
FT                   /product="NnrUfamily protein"
FT                   /note="COGs: COG4094 membrane protein; InterPro IPR009915;
FT                   KEGG: sse:Ssed_1389 hypothetical protein; PFAM: NnrUfamily
FT                   protein; SPTR: A0YFY7 Putative uncharacterized protein;
FT                   PFAM: NnrU protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74287"
FT                   /db_xref="GOA:E1SVD3"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD3"
FT                   /protein_id="ADN74287.1"
FT                   /translation="MLALTLGMAAFIVLHLVPGTALRDRLSGAMGEPLYKGLFTLLSAA
FT                   ALVLVVWGKGQASYHSVWVPPVWTRHLAPLLMLASCYLMVTYLLGGKLKGLTPNPMLWS
FT                   VVIWALAHLLANGDLASLVLFGGFIGYSLLAIWRSRSQRRNDYSGRHELLVAVVALALY
FT                   VAFLLAHPYLFGVAVMGR"
FT   sig_peptide     92105..92173
FT                   /locus_tag="Fbal_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(92710..93354)
FT                   /locus_tag="Fbal_0074"
FT   CDS_pept        complement(92710..93354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0074"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="COGs: COG0586 membrane-associated protein; InterPro
FT                   IPR015414; KEGG: shm:Shewmr7_0412 DedA family protein;
FT                   PFAM: SNARE associated Golgi protein; SPTR: A2UW95 DedA
FT                   family protein; PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74288"
FT                   /db_xref="GOA:E1SVD4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD4"
FT                   /protein_id="ADN74288.1"
FT                   /translation="MRFLPAPTVPMLHTLQTLVTDLSPYLHQYGYLLLALAIAVEGFGI
FT                   PAPGQALLMVSGVLAADGELALHWVLLVAAISAFGGNLVGYFLGQRGDRWLRQKGWLSA
FT                   ATEARLHQFIERHGIAVLLFSRFIEGLKQTMALGCGLARMPLRAFLLGNALATAVWVTL
FT                   FGLGPALLWHERQPLMQFYQAHHNLTWGVGAAAVLTLALTWRWRQRRQATL"
FT   gene            complement(93385..94410)
FT                   /locus_tag="Fbal_0075"
FT   CDS_pept        complement(93385..94410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0075"
FT                   /product="peptidase S58 DmpA"
FT                   /note="COGs: COG3191 L-aminopeptidase/D-esterase; InterPro
FT                   IPR005321; KEGG: plu:plu2239 hypothetical protein; PFAM:
FT                   peptidase S58 DmpA; SPTR: A0Z6P7
FT                   L-aminopeptidase/D-esterase; PFAM: Peptidase family S58"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74289"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD5"
FT                   /protein_id="ADN74289.1"
FT                   /translation="MKAWLALLAALALPLSAQNYDPNALFAIKQLKIGQISDHTGLTGV
FT                   TVLRFDQGATASVDVRGAAPGTRETDLLKPENLVDKVHAIVLSGGSAFGLDAMSGVARQ
FT                   LESEGIGFNTGVARVPIVTGAVLFDLVVGDPKARPDAAMGQAAAKAAKRSGLTEGNVGA
FT                   GTGASVGKIRGMEHATKSGLGVYSVQLDSGLVVGAVVAVNAWGDVVDRSGQLLAGTRDE
FT                   NGFIPGTALIFQGANEPGFVGKNTTIGAIVTNATLTKAEALKVAQMAHDGYARAIRPVH
FT                   TMNDGDAIFAAGTGELGPVNINTLGVIAAEVMETAIHRAVQAAESAGGLPAASDVAKMN
FT                   K"
FT   sig_peptide     complement(94354..94410)
FT                   /locus_tag="Fbal_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(94511..96541)
FT                   /locus_tag="Fbal_0076"
FT   CDS_pept        complement(94511..96541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0076"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="COGs: COG0480 Translation elongation factors
FT                   (GTPase); InterPro IPR000640: IPR004161: IPR000795:
FT                   IPR005517: IPR 005225; KEGG: saz:Sama_1118 elongation
FT                   factor G; PFAM: elongation factor G domain IV; protein
FT                   synthesis factor GTP-binding; elongation factor G domain
FT                   protein; elongation factor Tu domain 2 protein; SPTR:
FT                   Q9X1Y4 Elongation factor G-like protein; TIGRFAM: small
FT                   GTP-binding protein; PFAM: Elongation factor Tu domain 2;
FT                   Elongation factor G C-terminus; Elongation factor Tu GTP
FT                   binding domain; Elongation factor G, domain IV; TIGRFAM:
FT                   translation elongation factor EF-G; small GTP-binding
FT                   protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74290"
FT                   /db_xref="GOA:E1SVD6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD6"
FT                   /protein_id="ADN74290.1"
FT                   /translation="MPEHRIEQIRNAALMGHSGSGKSSLLEALLYGARAISQRGRVDDG
FT                   TNHADFTPQEKAHHHSLEASFLSLDHNDIHINLIDTPGLPDFFGRAQLAMPAVESVLLV
FT                   INASRGIEPIAQRAFEEARRQGKSILIVVNQMDGNEAQLESVLEQIQTQFGHGCLPLNL
FT                   PKADGTGVVDCYFSPDYDTPTRFGDVRSCHDALIDTVVEQDEALMEIYLEQEESLTPEQ
FT                   LHAPLETALRHGELVPVCFASAEQQMGINHLLQILAQVLPNPQEANPPNFVNGWGDEAK
FT                   PVKLTLDEAGHLLAHVFRVSIDPYVGRLGVFRIHQGVLRTGQKLFIGADRKPIKVAHLV
FT                   KLQGKDQVEVTSAGPGDICALAKIDGLEVGAILHDHHEEDNFHMVDQDLPQPLFGLAVR
FT                   PKRRGDEQKLAEVLHKLVAEDPSLQISHDGVDNETVLQGLGDMHVQIALEKAQQVFNLD
FT                   MDTQKPSVAYRETITNSAESRYRHKKQSGGAGQFGEVHLKVEPLPRGSGFEFTSKVVGG
FT                   AIPSQFIPAIEKGVKEAMREGILAGFPMQDIRVVVLDGKHHPVDSKEIAFHMAGKKAFL
FT                   EAVMASSPVLLEPIVDMHVQVHQDKMGDITGDLSAHRAMVCGTQALANQQVDINAEAPL
FT                   AALDDYATRLKAMTGGEGQLSMAFSRYEVVPPNVQQQLMAH"
FT   gene            96724..97407
FT                   /locus_tag="Fbal_0077"
FT   CDS_pept        96724..97407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG5587 conserved hypothetical protein;
FT                   InterPro IPR012808; KEGG: pat:Patl_1742 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: A2UVH2
FT                   Putative uncharacterized protein; PFAM: Conserved
FT                   hypothetical protein (DUF2461); TIGRFAM: conserved
FT                   hypothetical protein TIGR02453"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74291"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD7"
FT                   /protein_id="ADN74291.1"
FT                   /translation="MIPYIRPETLEFLEQLRVNNSRDWFQANKSRYEACVRGPALDLIA
FT                   SFAPRLASFAPRFRADAKKVGGSLMRPYRDTRFSHDKTPIKTNVGIQFRHDLGKDVHAP
FT                   GYYLHIEPGQCLLGVGCWRPDSPSLAAIREAIDRSPIRWLAARDDGEFCSRFSLSGTSL
FT                   VRPPKGYDKDHPQLEDLKRKDFIGVMPLADEQVMGEGLLDLMEEAYEGADPFMRFLCQA
FT                   MKVPF"
FT   gene            97555..99327
FT                   /locus_tag="Fbal_0078"
FT   CDS_pept        97555..99327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0078"
FT                   /product="Arylsulfotransferase"
FT                   /note="InterPro IPR010262; KEGG: eic:NT01EI_0602
FT                   hypothetical protein; PFAM: Arylsulfotransferase; PFAM:
FT                   Arylsulfotransferase (ASST)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74292"
FT                   /db_xref="GOA:E1SVD8"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD8"
FT                   /protein_id="ADN74292.1"
FT                   /translation="MLKRVVLAMAAMGIMGSAAAVSLPPAPAVGKLGAVVVDPYGTAPL
FT                   TAVIELAGKSISDVHVTVEGKGPEGVSIDYPVGRHSLLTHDGIPVFGLYANHLNNVTVR
FT                   YQMAGQPVEEHYRILTGSLQNRYIDNRSTSELQPVEVKTVAPGFEDRLYLVNSHTLLPQ
FT                   GSDLHWGALKDASSGLLDANPAGGSMPFDAIPMTYIIDTQGEYRWWLSQDALYDGKNHD
FT                   VDRRGYLMGINPTATGSYTFVQGQRWYEMDLMGRFAHDQKLPRGFIDASHESVETPQGT
FT                   VLLRVAKRNYLRDDGQMVHTVRDHIIEVDKSGNLLDVWDLPVILDPLRDDLIKALDASA
FT                   VCVSRNVDAEGQAVVLEPDAPFGDAVGVGAGRNWAHVNSIAYDPSDDSIIISPRHQASA
FT                   IKIGRDKQVKWILSASIGWSGELADKLLTPVDAKGNPLDCTVKGVCEGDFDFSYTQHTA
FT                   WLSDKGTLTVFDNGDGRHYRQPFFKTERYSRAVEYKIDEKAMTVQQLWEYGKERGYDWF
FT                   SPITSNAEYQSDRDTMFTFGGSIHLFEGASIIGKINEIDYDTKAVKVEIDVISDKTNSP
FT                   HYRALVVQPEQAFR"
FT   sig_peptide     97555..97614
FT                   /locus_tag="Fbal_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            99369..99788
FT                   /locus_tag="Fbal_0079"
FT   CDS_pept        99369..99788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3126 conserved hypothetical protein; KEGG:
FT                   vha:VIBHAR_01451 hypothetical protein; SPTR: A3LED1
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74293"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD9"
FT                   /protein_id="ADN74293.1"
FT                   /translation="MKWQLPALLAIGALLGGCGGEAPSSAPQQESASMETITGQALYRE
FT                   RILLTPGTTMLVALEDVSRADAPAEVVSENRFEIQGPPPFAFALQYDPAKLVENHRYGL
FT                   RIRIEEKGELRFINDTHIDPFGDGLDQIVLKGVGR"
FT   sig_peptide     99369..99443
FT                   /locus_tag="Fbal_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(99854..102040)
FT                   /locus_tag="Fbal_0080"
FT   CDS_pept        complement(99854..102040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_00117 hypothetical protein; SPTR:
FT                   A0XX35 Leucine rich repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74294"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVE0"
FT                   /protein_id="ADN74294.1"
FT                   /translation="MRLSKVALSLMAITALSGCSGSDDNTQITPPPEPTPPQILSFAIE
FT                   GIATDAPVANATITATLGDQTITTTADDDGLYTLDFEYEEGTLSGDEMVLLSAQGEGDQ
FT                   GHIELVSQLGSFESLNEQAGDDGVLAQDESSRTAITQVSTALHLLAEDTGVELNSDEAL
FT                   AEAEAQVETEALLELSAVIKVLADNPDYTPETGTILELLTPEGEESVEEAVNSYLADNG
FT                   LLDEEGELTDAFEAAFEEALQETVNDPAVTLAFTAEELLGTNVYTTSVTQGWVAQSGNV
FT                   LNFAADGTATLGDPGVYGYFLGTDVSAEWAVNEANRLVVNYGDNEQESYPYLTLADVTE
FT                   HWGQAAADTLAPIWQEGYLRVIESTDAVKFTKLTDGAESKVAVEISQTFTLDPTSAGLA
FT                   WEGELPSYQEIELESAGVLHLGNQVSTLWDSAPQGTWALPMVTSIQGFYDNQAYDYLVH
FT                   NEVTLAEGGSVLDKAGEARGQWSYADGVLTIASGDWTVSYQPYAQSDALYSAIVSISKG
FT                   EFEQSNVAWIAQYDQDNASLADDLIQEMPYVLGAWINSWIASEGDPTRPDFDTVYGYTF
FT                   AEDGSLSWTFGTYTDPTSGEYVEDQGYFETYYNAFQHWEQVGDHEYQLTGKEVWEGWAT
FT                   YSRERSWTVINTLADGRHLVLERSVRTLDYIDEGQQDQTGPFIFPRINVLSPVDLSQFE
FT                   EEYQRSEEYGTLTGVSSDRVDAVRIQMLDNAPRQ"
FT   sig_peptide     complement(101975..102040)
FT                   /locus_tag="Fbal_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(102258..102782)
FT                   /locus_tag="Fbal_0081"
FT   CDS_pept        complement(102258..102782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0081"
FT                   /product="Protein of unknown function DUF2058"
FT                   /note="COGs: COG3122 conserved hypothetical protein;
FT                   InterPro IPR018636; KEGG: ttu:TERTU_0971 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2058; SPTR:
FT                   A0YFM4 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2058)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74295"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVE1"
FT                   /protein_id="ADN74295.1"
FT                   /translation="MSLQDQLMKAGLVSKHDAKKANKDKHRARKAGKSVVNEAKAEAAQ
FT                   KRAEQAERDRQLNAERKAEAEKKALQAQIRQLITVNAQPRDKGDLAYNFSDQGSITKIY
FT                   VTPALQQGLINGQLAIAKLGQEYFLIAAAVAEKVAQRDASAIVLLNDKASDQPDEDDPY
FT                   ADYQIPDDLMW"
FT   gene            complement(102820..103284)
FT                   /locus_tag="Fbal_0082"
FT   CDS_pept        complement(102820..103284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0082"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0219 rRNA methylase (SpoU class); InterPro
FT                   IPR001537; KEGG: sbp:Sbal223_0213 RNA methyltransferase,
FT                   TrmH family, group 2; PFAM: tRNA/rRNA methyltransferase
FT                   (SpoU); SPTR: A2V2M1 RNA methyltransferase, TrmH family,
FT                   group 2; PFAM: SpoU rRNA Methylase family; TIGRFAM: rRNA
FT                   methylase, putative, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74296"
FT                   /db_xref="GOA:E1SVE2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVE2"
FT                   /protein_id="ADN74296.1"
FT                   /translation="MFEIALYEPEIAPNTGAIIRLCANNGCRLHLIEPLGFDMDEKKLR
FT                   RAGLDYAELTTVTRYPDYASFLEAMAGRRVFALTTKGSRPHTEPQYQAGDVLLFGPESR
FT                   GLPEAVREAIPTSQRIRIPMKADARSLNLANAVSIVSYEAWRQLDFDGAL"
FT   gene            103409..104245
FT                   /locus_tag="Fbal_0083"
FT   CDS_pept        103409..104245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0083"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG2897 Rhodanese-related sulfurtransferase;
FT                   InterPro IPR001763; KEGG: ppr:PBPRB0882 rhodanese-like
FT                   sulfurtransferase; PFAM: Rhodanese domain protein; SMART:
FT                   Rhodanese domain protein; SPTR: A3SLZ4 Thiosulfate
FT                   sulfurtransferase, putative; PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74297"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVE3"
FT                   /protein_id="ADN74297.1"
FT                   /translation="MAFPNLISVDELAQNLDHPDWRVLDGTWFLPGSTEDARQRHREER
FT                   IPGARWFDFDDALADPDSSLPHMLPTPEQFALELGKLGLKPEHKVVVYDRHGLFSAPRV
FT                   WWMLKAFGHQAVAVLNGGLPAWREADYPLEQGEAAAVEASHYPVPALPGQVIDAQTLHQ
FT                   QLIAGEIWLLDARAPGRFAGAEPEPRPGVRPGHMPGAVNLPFGQLLDQGKLRPVAELKA
FT                   RFAAVADGSKPWVFSCGSGVTACVLALAASEAGHHQWRVYDGSWAEWGADPALPLA"
FT   gene            complement(104242..105612)
FT                   /locus_tag="Fbal_0084"
FT   CDS_pept        complement(104242..105612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0084"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR004358: IPR003594: IPR003661: IPR003660: IPR
FT                   005467; KEGG: son:SO_4478 sensor protein CpxA; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SPTR: A2UXD1 Sensor protein; PFAM:
FT                   HAMP domain; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74298"
FT                   /db_xref="GOA:E1SVE4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVE4"
FT                   /protein_id="ADN74298.1"
FT                   /translation="MKLPNHLLFKLLLAFWITSSLVLGLVIGLPHLQKSFDREPLDPRL
FT                   ATVLNRTAERLAETPPQQWRQLSHKLRHYQDERGREFRMSFYLIDKDGRPVFRGDRRLP
FT                   REVRHFLLELDSYQQPMRYRFPDEVVFGPKEVQLNGETHYLIGKIRAPHQRPWLFFLMA
FT                   HPGAFLLVAIAFSGLVFGLLAWHLGKPLRHLKDTAGALARGDLEARVDGDTLSRRDELG
FT                   QLATSFNQMADSVTTMVKGQQRLLSGISHELRTPLTRLQLALALARKKGEDSAELQRIG
FT                   REAEQLDAMIRELLALSRLNMQITDSKHPLDLIDVLTDVIDDAGFEAEQMNKQLSVTMP
FT                   EHLPFKGIENLLRRAVENLLRNALRYAENQVSLEIVRQPNEVLIRISDDGPGVPETELE
FT                   TIFKPFYRVAEARDRDSGGWGLGLAITQGAVEAHQGRVRANNRTPHGLTMTVTLPLA"
FT   sig_peptide     complement(105541..105612)
FT                   /locus_tag="Fbal_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(105616..106302)
FT                   /locus_tag="Fbal_0085"
FT   CDS_pept        complement(105616..106302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0085"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: saz:Sama_3432
FT                   response regulator receiver protein; PFAM: response
FT                   regulator receiver; transcriptional regulator domain
FT                   protein; SMART: response regulator receiver; SPTR: A2UXD2
FT                   Two component transcriptional regulator, winged helix
FT                   family; PFAM: Response regulator receiver domain;
FT                   Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74299"
FT                   /db_xref="GOA:E1SVE5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVE5"
FT                   /protein_id="ADN74299.1"
FT                   /translation="MNRILLVEDDQGLCELLGQLLELEGFTLTVRQDGPSGLLEAQNGE
FT                   HDIVLLDVMLPGLNGFDVLRQLRQKSDVPVLMLTARGDDIDRVVGLEIGADDYLPKPFN
FT                   DRELIARIRAILRRTRDKESSSNGQDELVCDDLTLYPRRQEAWVNEALLPLTATEFSLL
FT                   LELTQNPGELISKDRLSEAVLGKKLMPFDRSLDMHLSNLRRKLPERSDNRPRVKTVRGK
FT                   GYIWLD"
FT   gene            106454..106969
FT                   /locus_tag="Fbal_0086"
FT   CDS_pept        106454..106969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0086"
FT                   /product="protein of unknown function Spy-related protein"
FT                   /note="InterPro IPR012899; KEGG: saz:Sama_3431 spheroplast
FT                   protein y precursor, putative; PFAM: protein of unknown
FT                   function Spy-related; SPTR: A2UXD3 Putative uncharacterized
FT                   protein; PFAM: LTXXQ motif"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74300"
FT                   /db_xref="GOA:E1SVE6"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVE6"
FT                   /protein_id="ADN74300.1"
FT                   /translation="MKPIAKLIAVGALTTTALVSTSFAVAAQGDGQRDCEMRGKGGHHG
FT                   MGYHHGKRGHHGGEVRKMLRGLDLTAEQKTQIKALIEAAHTDKPARDTADFEAKMAAHQ
FT                   ALMNNPNFDEAAARQMINERQAAHADRALARMKLQHDIIQLLTDEQKAKLEARHDKRMA
FT                   RFQAHHGE"
FT   sig_peptide     106454..106531
FT                   /locus_tag="Fbal_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            107014..107892
FT                   /locus_tag="Fbal_0087"
FT   CDS_pept        107014..107892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0087"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: saz:Sama_3430 cation efflux family
FT                   protein; PFAM: cation efflux protein; SPTR: A2UXD4 Cation
FT                   diffusion facilitator family transporter; TIGRFAM: cation
FT                   diffusion facilitator family transporter; PFAM: Cation
FT                   efflux family; TIGRFAM: cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74301"
FT                   /db_xref="GOA:E1SW01"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW01"
FT                   /protein_id="ADN74301.1"
FT                   /translation="MSSSTTPEQYAFWIRVATRASVATAVILILAKLLAWSFSGSASLL
FT                   ASLTDSMMDAMASLVNFYALRVALLPADQHHRFGHGKAEPLATLVQAGFILGSALLLLF
FT                   HGSERLINPTPLTNSTLGIGVSVFAMVATVVLLTIQKRAVAVTGSTAIAADALHYRTDL
FT                   LLNAAVLLALVLASQGLLWADGLFAVLIALYIGYGAWGLGSEAVQLLLDREAEPEVREQ
FT                   VEALAKADPGVQGLHDLRTRRSGNTLYVQMHLELDGDLPLREAHDLADAVECRIREAFP
FT                   GADVIVHQDPV"
FT   gene            complement(107939..109351)
FT                   /locus_tag="Fbal_0088"
FT   CDS_pept        complement(107939..109351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0088"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis family"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR020441: IPR002197: IPR002078: IPR001789: IPR
FT                   011704: IPR003593: IPR010114; KEGG: shw:Sputw3181_0221
FT                   nitrogen metabolism transcriptional regulator, NtrC, fis
FT                   family; PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; ATPase associated with various cellular
FT                   activities AAA_5; SMART: response regulator receiver; AAA
FT                   ATPase; SPTR: A2UXD6 Nitrogen metabolism transcriptional
FT                   regulator, NtrC, Fis Family; TIGRFAM: nitrogen regulation
FT                   protein NR(I); PFAM: Response regulator receiver domain;
FT                   Bacterial regulatory protein, Fis family; Sigma-54
FT                   interaction domain; TIGRFAM: nitrogen regulation protein
FT                   NR(I)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74302"
FT                   /db_xref="GOA:E1SW02"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW02"
FT                   /protein_id="ADN74302.1"
FT                   /translation="MSEQVWVLDDDSSIRWVLERALKRENLTSASFASAESLWQALEAS
FT                   QPQVIVSDIRMPGTDGLTLLERIKQHYPELPVIIMTAHSDLDSAVGAYQSGAFEYLPKP
FT                   FDIDEALALVRRALEHAAASAPQPQERGEAVPGIIGEAPAMQEVFRAIGRLSRSSISVL
FT                   INGQSGTGKELVAHALHKHSPRSAAPFVALNMAAIPKDLIESELFGHEKGAFTGAAGVR
FT                   QGRFEQANGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHSAIKVDVRIVAATHQD
FT                   LEQRVREGQFREDLFHRLNVIRIQLPPLSERAEDIPALTRHFLAAAADELGVEPKRLTK
FT                   EAEIRLSELPWPGNVRQLENACRWMTVMASGQEILADDLPPELKTAQTSSAFSGEPGQE
FT                   GDWTTLLASWASRALANGDTNLLEDAQPAFERTLLTTALSHTRGHKQEAARLLGWGRNT
FT                   LTRKLKELNMEE"
FT   gene            complement(109348..110403)
FT                   /locus_tag="Fbal_0089"
FT   CDS_pept        complement(109348..110403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0089"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.13.3"
FT                   /note="COGs: COG3852 Signal transduction histidine kinase
FT                   nitrogen specific; InterPro IPR004358: IPR013767:
FT                   IPR013656: IPR003594: IPR 003661: IPR000014: IPR005467;
FT                   KEGG: shw:Sputw3181_0222 signal transduction histidine
FT                   kinase, nitrogen specific, NtrB; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS domain containing protein; SPTR:
FT                   A2UXD7 Sensor protein; PFAM: Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74303"
FT                   /db_xref="GOA:E1SW03"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW03"
FT                   /protein_id="ADN74303.1"
FT                   /translation="MDRQSDPDYLHQLSTAVLVLTPQLQVRYANHAAEQLLGLGQRRLL
FT                   GQNAASLYSQLATDTALLRQTLEREQGQSLYAVSLVTLDGQHHTIDLIFTPLESAEILV
FT                   EARVVDHQQRISQELQHYAQQHAAQLLVRGLAHEIKNPLGGLRGAAQLLERELDDPELK
FT                   EFTTIIIEQSDRLRGLVDRLLGPQYPGTWAEGNVHRLLEQVARLCEMEATGTLVIERDY
FT                   DPSIPDFVMDAEQLQQALLNIVRNAVQALDGQGRIVLRTRSQGQTTIAGRRHRQVVAVS
FT                   VVDDGPGIDPSIQDTLFYPMVTNKADGSGLGLSIAQKIVSQHQGRIELESWPGHTEFTL
FT                   LLPMTFSKEAQ"
FT   gene            complement(110492..111031)
FT                   /locus_tag="Fbal_0090"
FT   CDS_pept        complement(110492..111031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_4470 hypothetical protein; SPTR: A2UXD8
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74304"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW04"
FT                   /protein_id="ADN74304.1"
FT                   /translation="MGSRYILLVAALLLAPQGFAKVYRWVDSNGQVHYSDKPQDGAEEI
FT                   AVDTSKANTIELAKPSPTTAPLQPVTAPEYRISLSAPEQGATVRDNNGQLNLNIALQPD
FT                   LLADHRIELLLNGEVVRTVGSGGSFALDNVDRGEHVLQARVIDENGKVLASSRKTKVYL
FT                   HRHSRLIAPPKPQPRS"
FT   sig_peptide     complement(110972..111031)
FT                   /locus_tag="Fbal_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(111177..112586)
FT                   /locus_tag="Fbal_0091"
FT   CDS_pept        complement(111177..112586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0091"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="COGs: COG0174 Glutamine synthetase; InterPro
FT                   IPR008146: IPR008147: IPR001637: IPR004809; KEGG:
FT                   vha:VIBHAR_00588 glutamine synthetase; PFAM: glutamine
FT                   synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; SPTR: A0XX56 Glutamine synthetase; TIGRFAM:
FT                   glutamine synthetase, type I; PFAM: Glutamine synthetase,
FT                   catalytic domain; Glutamine synthetase, beta-Grasp domain;
FT                   TIGRFAM: glutamine synthetase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74305"
FT                   /db_xref="GOA:E1SW05"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW05"
FT                   /protein_id="ADN74305.1"
FT                   /translation="MSIENVLKLIEENDVKFVDLRFTDTKGKEQHVSIPVSQIDADFFE
FT                   EGKMFDGSSIQGWKGINESDMILMPDPATAVLCPFTDEVTLNVRCDIIEPATMEGYDRD
FT                   PRSIAKRAKAYMQSTGIADDCFFGPEPEFFLFDDVKYKTDMSGSMYKIDAEEASWNSDK
FT                   DYEGGNKGHRPGVKGGYFPVSPVDSAQDIRSAMCLVLEEMGQVVEAHHHEVATAGQNEI
FT                   ATRFNSIVEKADELQVLKYVIHNVAHVYGKSATFMPKPLVGDNGSGMHCHQSLSKDGVN
FT                   LFAGDKYGGLSETALYYIGGIIKHARAINAFANASTNSYKRLVPGFEAPVMLAYSARNR
FT                   SASIRIPVVPNPKGRRIEVRFPDPTANPYLAFSAMLMAGLDGIINKIHPGDAMDKDLYD
FT                   LPAEEAAEIPTVASSLEQALDCLDADRAFLTAGGVFSDDFIDSYIGLKRGEVERLNMTT
FT                   HPVEFELYYSV"
FT   gene            113006..114832
FT                   /locus_tag="Fbal_0092"
FT   CDS_pept        113006..114832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0092"
FT                   /product="GTP-binding protein TypA"
FT                   /note="COGs: COG1217 membrane GTPase involved in stress
FT                   response; InterPro IPR000795: IPR000640: IPR004161:
FT                   IPR006298: IPR 005225; KEGG: vvy:VV0200 GTP-binding protein
FT                   TypA; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor G domain protein; elongation factor Tu
FT                   domain 2 protein; SPTR: A3GWI1 GTP-binding protein TypA;
FT                   TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: Elongation factor Tu domain 2; Elongation
FT                   factor G C-terminus; Elongation factor Tu GTP binding
FT                   domain; TIGRFAM: GTP-binding protein TypA/BipA; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74306"
FT                   /db_xref="GOA:E1SW06"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW06"
FT                   /protein_id="ADN74306.1"
FT                   /translation="MSIENLRNVAIIAHVDHGKTTLVDKLLSQSGTLDARVALDERVMD
FT                   SNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAQE
FT                   GPMPQTRFVTQKAFAQGLKPIVVINKIDKPGARPDWVMDQVFDLFDNLGATDEQLDFKV
FT                   VYASALNGWASAEEGETAEDMTALFQTIVDEVSPPSADPEGPFQMQISQLDYNSYVGVI
FT                   GVGRVSRGRVKVGQQVTVHGANGITRNGKVGQVLGYMGLERHEVGEAQAGDIIAISGLG
FT                   ELKISDTVCCPTEVEALPALSVDEPTVTMTFQVNTSPFAGQEGKYVTSRNILERLQKEL
FT                   VHNVALRVEETDDPDKFKVSGRGELHLGVLIENMRREGFELAVSRPEVIMRTVDGELQE
FT                   PYETVTVDVEEAHQGSIMEKLGLRKAELTDMSPDGKGRIRMDFIMPSRGLIGFQTEFMT
FT                   LTSGTGLLYHTFYEYGPHKGGNIGQRINGVLIANATGKALTNALFNLQERGRLMVGHGT
FT                   EVYEGMVIGIHSRDNDLTVNALKGKQLTNMRASGTDEAQVLTPPIQLTLERALEFIDDD
FT                   ELVEVTPESIRIRKKLLTESDRKRASREGKKG"
FT   gene            complement(114896..115978)
FT                   /locus_tag="Fbal_0093"
FT   CDS_pept        complement(114896..115978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_0782 hypothetical protein; SPTR:
FT                   A3JEK2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74307"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW07"
FT                   /protein_id="ADN74307.1"
FT                   /translation="MNIIIPIAGRSSRFPDMKPKWMLTHPQGDFMVVEAIKGLDLSNVR
FT                   RIVLVGLAQHEQEYGFVAALTAQFEALGIDDRVEFVLLEAQTRHQPETVARAIEQAHIE
FT                   GPIYIKDSDNYFVDTPRPGNLVACYDLHSLDNVNARNKSYLEVNADGHIINIVEKQIVS
FT                   STFCVGGYGFADAAQFMACFERLQAEPDLYLSHMIFQMVSDGETFGHQLVSDYVDWGTI
FT                   KEWNAYKAHYSTLFVDLDGTLVRNSAQFTEPKWGTTEAIADNVATLNALHASGTVQIII
FT                   TTSRKEAYRDVTVAQLERLGIRYDQLIMGLVHGRRIVINDYAKSNPYKSCDAINIKRNS
FT                   SDLKDKLEDSVGFHIDLGQR"
FT   gene            complement(115982..116836)
FT                   /locus_tag="Fbal_0094"
FT   CDS_pept        complement(115982..116836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0094"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="InterPro IPR002575; KEGG: maq:Maqu_0783 hypothetical
FT                   protein; PFAM: aminoglycoside phosphotransferase; PFAM:
FT                   Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74308"
FT                   /db_xref="GOA:E1SW08"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW08"
FT                   /protein_id="ADN74308.1"
FT                   /translation="MKPTVSGNSGCQLSLTQRNGVIVVQKRATTAAYAPRLRAQIDKQR
FT                   CAARRNRLPGVHIPAIVAEQPSPQGYCAWMEYLNYQDYSQFFATASLAKLDRLARHLID
FT                   FIEAELAEATLTEVPAQHFLDKLDAIARQLPGLANRDAKQAQLAALARRVKAQPVVLPL
FT                   GPNHGDLTLANLMVSQDASRIGLFDFLDSYLDSPLVDIAKVRQDTQFHWSRLMTRARID
FT                   RARYRIVMRYLDQQIDQHFHAYPWYRQHYTLIQGINIARIFPYEHQPQVSDFTHNTLTQ
FT                   LGF"
FT   gene            complement(117056..118075)
FT                   /locus_tag="Fbal_0095"
FT   CDS_pept        complement(117056..118075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0095"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="InterPro IPR020449: IPR000005: IPR018060; KEGG:
FT                   swp:swp_0094 transcriptional regulator, AraC family; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; SPTR: A3LIF0 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74309"
FT                   /db_xref="GOA:E1SW09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW09"
FT                   /protein_id="ADN74309.1"
FT                   /translation="MKRLALWQDKCMDGQLLPLGLWQLFRLRQLDGEALLRGTGLFATD
FT                   LQHPGLRVSPRQLCALLSNARKLWPGDDLAFLLGQHWLPSQSGALTNGLLCAPDLERAL
FT                   SFWGRYHWLSQPWLRPTRWHQDDHSHWQLQLDLGLQTHHQFLLELALSTLTATAKRLSP
FT                   QPLHFHIQLPYPAPAHPHHYWKYLGPEVQFGAAMTRISLPRVELQRPLPGADLAGFQLA
FT                   WRQCRQRLQAEPWQRGLPAAVLARLERPQHQGDALPQVAKDLATSPATLKRRLKAFGLA
FT                   FQPLQDQARLGQALYLLSIQGAANADVARQLQFADGGNFRRSFKRWTGLLPSQFSRLT"
FT   gene            complement(118076..118951)
FT                   /locus_tag="Fbal_0096"
FT   CDS_pept        complement(118076..118951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0096"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: swp:swp_0095 GGDEF domain protein; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein;
FT                   SPTR: A3WK31 Signaling protein with membrane-bound sensor
FT                   domain and GGDEF domain; TIGRFAM: diguanylate cyclase;
FT                   PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74310"
FT                   /db_xref="GOA:E1SW10"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW10"
FT                   /protein_id="ADN74310.1"
FT                   /translation="MERTRTLRIIGLWIALMLGISALVLARADAKPLAIWDWWDIALET
FT                   SLLVLISTWLVMVAQARPGGRITRWLLAGLLAFGCGSVVDLLDEFVRLDTLPTGFALLE
FT                   KGPVPLGLISLTIGLWGWRKEQLRINQQLRTREQFLREADHIDPLTQLCDARTFDAHLQ
FT                   RLAQKGTSCSVMMLDLDQFHRFNHDHGMAAGDELLHRFSHALANEVRHCDLICRYAGDR
FT                   FVVLLPRCPASLAAALAEHLRQQLPEPRISVTAVYLYRGEGPFEAQSLLAELNQRMIDA
FT                   KAHRQWAKAG"
FT   sig_peptide     complement(118874..118951)
FT                   /locus_tag="Fbal_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            119255..121981
FT                   /locus_tag="Fbal_0097"
FT   CDS_pept        119255..121981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0097"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR000531: IPR012910: IPR010104;
FT                   KEGG: swp:swp_0096 TonB-dependent receptor, putative; PFAM:
FT                   TonB-dependent receptor plug; TonB-dependent receptor;
FT                   SPTR: A3WK30 Outer membrane protein; TIGRFAM:
FT                   TonB-dependent receptor; PFAM: TonB dependent receptor;
FT                   TonB-dependent Receptor Plug Domain; TIGRFAM:
FT                   TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74311"
FT                   /db_xref="GOA:E1SW11"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW11"
FT                   /protein_id="ADN74311.1"
FT                   /translation="MWKLNTYLLLLGAGLCASVNAAGRVEGQVTDADSRLPLAGAQVKI
FT                   EELGLSQSAGRDGRFLFPQVAPGQYTLVVDYLGAGSARLVIDVVDEQTLRQSVTLTGPT
FT                   ERIEVVGQRGSLSRSLNRQRAADNLVSVISADALGQFPDTNVSEALQRVPGVSIERDQG
FT                   EGRFVRVRGMAPDYNAVSMNGARLPAPENDRRAVALDVIPSDLLETLEVTKTLTPDMDA
FT                   DSLGGAVEVKSLSAFDRDDTYLNLSAEGSYDSQTENTSPKLAATYSDRYADDKVGMALA
FT                   LSWYDREFGSDNVETGGKWDFDDAALLEEVEQRDYQIQRERLGVGVNLDFRPNDNNDLY
FT                   LRTLYSRFTDDETRNANVVEWEEGQPQDSAAPADVTRELKSRTEEQEIASLVGGGEWRG
FT                   ERWTLNYQGSWSRAEADKPRFIDGAKFEAGVEDVGYQGTRDIRLTAPDAFYDPAEFELA
FT                   EVEIGESAARDTLAEGKFDVSRDLGLNRYPGAIQFGGKYSAREKRNRETVWIYEDFEEQ
FT                   GVDPARLSMVGYAGSELDYQLGRFGPGIESAGVWELVNSLSADDALDEVESTINDFDID
FT                   EDLAAGYLMGHLDVGQLRLLAGVRYERVDRDARGYGYNDVTEAFEPVRVENDEEHWLPG
FT                   VHLKYQLGEKTQIRGAWSNTLVRPTFGQLAPGFLIEEDDGDLEVAFGNPELQSLESMNW
FT                   DLAIEHYLGGVSVLSANLFYKDIENFIYRADLGGWGAYTDFAVADTFVNGDDAELYGAE
FT                   LAYVQQFTFLPEPLQGLLFSANATWSDSTARIDWVDDGQRQGRDIPLPSQSDLTANVSL
FT                   GYENAYVSLRLSAAYKSEYLVEVDALDDAAFDIYEDEHLQWDLVAKGFVTTDFIVYFKA
FT                   INLTDEPFYTYTGQSSYNAQYEQYGRTFQLGVQYTNF"
FT   sig_peptide     119255..119317
FT                   /locus_tag="Fbal_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            121995..123776
FT                   /locus_tag="Fbal_0098"
FT   CDS_pept        121995..123776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0098"
FT                   /product="3-phytase"
FT                   /EC_number="3.1.3.8"
FT                   /note="COGs: COG4247 3-phytase (myo-inositol-hexaphosphate
FT                   3-phosphohydrolase); InterPro IPR003431; KEGG: swp:swp_0097
FT                   phytase, putative; PFAM: phytase; PRIAM: 3-phytase; SPTR:
FT                   A3WK29 3-phytase; PFAM: Phytase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74312"
FT                   /db_xref="GOA:E1SW12"
FT                   /db_xref="InterPro:IPR003431"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW12"
FT                   /protein_id="ADN74312.1"
FT                   /translation="MKWNAIGAAMLALWMSPAEAVEQGSQGARYQDGWLLASEREGLVW
FT                   QQGDQTRTVLPGRFEALAVAADLALTIELTEDRVVPVKLTATGAQALSPLPQRTFQVEW
FT                   LCLQRHADSDSLYAWIGGERGWAEQWLMQSGRHWQPTLMRTLPVPPDASACAVDSAAQQ
FT                   LLVVDASAGVWRYPAASHAPLERELLLAMPDAGLTAISIDEQRGLWLLDESGHLYDGDG
FT                   NRTGVRFDDHGEWEGLAVAAGQALAYDDERGRYVWQPLKTRGVTPLEPVDAIAEAPAWV
FT                   ESDVADRPGDTMDDPAIWVHPTHPERSRIIGTNKRWGLLSFDMAGNTVQALAVGRVNNV
FT                   DIRQGVKLGGQLRDVGVASNRDGDTLTPFLIDAEGELALLPDLPTDIEEIYGLCLYQPA
FT                   NDELHVIANGKSGEMVQYRLDWRDEVLRATELRRLWLPSQPEGCVADDRAHRLFAGEED
FT                   AGIWLFDARPDGDSQGVMIAEVGPNLVADVEGMDLYHGDKGYLVVSSQGNDSYVLYDSE
FT                   PPYAYRGRMRIGNHLKAGIDGSAETDGLAVTAAPVGSGGWASGMLVVQDGRNRMPDGFH
FT                   NFKWLPFSEVLKAAGIE"
FT   sig_peptide     121995..122054
FT                   /locus_tag="Fbal_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(123825..124457)
FT                   /locus_tag="Fbal_0099"
FT   CDS_pept        complement(123825..124457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_3911 hypothetical protein; SPTR:
FT                   A0XX50 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2959)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74313"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW13"
FT                   /protein_id="ADN74313.1"
FT                   /translation="MRVLPLLFVLALTGCQSAYYAAAEQVGYHKREILVDRVEDAQESQ
FT                   QEAQEQFSSALEQMKTLINFDGGDLEAAYDKVKGEYEDSADAAADVSSRINAVADVAEA
FT                   MFDEWEDELAQYQSASLRRDSESQLRDTRRRYDAMLRAMRQAEDKMEPVLKRLKDNELY
FT                   LKHNLNARAIGAVGKEFGVLEQEVERVIAEMNRAIAESDKFIQTLNP"
FT   sig_peptide     complement(124392..124457)
FT                   /locus_tag="Fbal_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(124468..124689)
FT                   /locus_tag="Fbal_0100"
FT   CDS_pept        complement(124468..124689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_3910 hypothetical protein; SPTR:
FT                   A2UXI7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74314"
FT                   /db_xref="GOA:E1SW14"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW14"
FT                   /protein_id="ADN74314.1"
FT                   /translation="MTQQGSAGNVLAAICSFFIAGLGQLVQGRILAAFLFFIFVGGFYA
FT                   LAAVLYVPFIIAIPLHIWCIVDAARYRG"
FT   gene            124801..125670
FT                   /locus_tag="Fbal_0101"
FT   CDS_pept        124801..125670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0101"
FT                   /product="tRNA-processing RNAse BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="COGs: COG1295 membrane protein; InterPro IPR004664:
FT                   IPR017039; KEGG: spl:Spea_3909 ribonuclease BN; PFAM:
FT                   ribonuclease BN; SPTR: A8H9I2 tRNA-processing ribonuclease
FT                   BN; TIGRFAM: ribonuclease BN; PFAM: Ribonuclease BN-like
FT                   family; TIGRFAM: YihY family protein (not ribonuclease BN)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74315"
FT                   /db_xref="GOA:E1SW15"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW15"
FT                   /protein_id="ADN74315.1"
FT                   /translation="MNRLQDWVRQLMQLSWREVLGFFPYLWRRVGENGLQVTAGHLAYV
FT                   SLLSLVPMLAVVLSVFSAFPGFAGVRADLEAFVYNNFVPTAGETVQLYLSQFVDNASRM
FT                   TAVGVLFLAVVALMLISNIDKALNRIWRVKTRRRAIYSFSMYWMILTLGPMLMGASIAV
FT                   TSYLVSMKLFSDTGLSGAYAFLIARLPFLLSVSAFALLYLLVPNTRVRFHHAVIGAFVA
FT                   ALLFEAGKRGFAWYVTQFPSYEAIYGALATIPILFLWVYLSWLIVLLGAEITAALPEHF
FT                   HLNDKESS"
FT   gene            125667..126197
FT                   /locus_tag="Fbal_0102"
FT   CDS_pept        125667..126197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spl:Spea_3907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74316"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW16"
FT                   /protein_id="ADN74316.1"
FT                   /translation="MKRSIAAVLLSTALLGGCASLTSSGTMLDLAGKTNQEATDALVTA
FT                   LTDKQYKVQRVSGQSLMVEYDNSHFMMQPKLTEDGLDRIVITKYYVLHPDLAQTPELLL
FT                   LIGQLNQRMDFAKFVLIEEGRGVEVRGAATFVDTISVEELTRFMDWTDAGLRALREAFP
FT                   QATPAAKEVRFGA"
FT   sig_peptide     125667..125741
FT                   /locus_tag="Fbal_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            126274..126711
FT                   /locus_tag="Fbal_0103"
FT   CDS_pept        126274..126711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0103"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="COGs: COG1490 D-Tyr-tRNAtyr deacylase; InterPro
FT                   IPR003732; KEGG: slo:Shew_3542 D-tyrosyl-tRNA(Tyr)
FT                   deacylase; PFAM: D-tyrosyl-tRNA(Tyr) deacylase; SPTR:
FT                   A3QIW0 D-tyrosyl-tRNA(Tyr) deacylase; TIGRFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; PFAM: D-Tyr-tRNA(Tyr)
FT                   deacylase; TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74317"
FT                   /db_xref="GOA:E1SW17"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW17"
FT                   /protein_id="ADN74317.1"
FT                   /translation="MIALIQRVSEARVVVAGETIGAIEGGLLVLLGVERDDDEARLRKL
FT                   ADKVMKYRIFSDADGKMNLNVQQAGGRLLVVSQFTLAADTEKGLRPSFSSAAHPSEAER
FT                   LYEAFVAYCRSQGMAVETGQFGADMKVSLTNDGPVTFSLRA"
FT   gene            complement(126713..127576)
FT                   /locus_tag="Fbal_0104"
FT   CDS_pept        complement(126713..127576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0104"
FT                   /product="response regulator receiver modulated CheW
FT                   protein"
FT                   /note="COGs: COG0835 Chemotaxis signal transduction
FT                   protein; InterPro IPR001789: IPR002545; KEGG: saz:Sama_2201
FT                   chemotaxis protein CheV; PFAM: CheW domain protein;
FT                   response regulator receiver; SMART: CheW domain protein;
FT                   response regulator receiver; SPTR: A2V174 Response
FT                   regulator receiver modulated CheW protein; PFAM: CheW-like
FT                   domain; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74318"
FT                   /db_xref="GOA:E1SW18"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW18"
FT                   /protein_id="ADN74318.1"
FT                   /translation="MDQGSAARQELLVFSLAHNQLFAFSTLKVREIVTLSQFNRLPGSH
FT                   PAIAGTLTLRGETLAVVDLNRAIGLTGEPPQSVVVCEIQGTLYGLLVGTIEAIHAVEIA
FT                   AIAALPKGLGQRTFSSAVFRDEQNRLVQLLDLERIVGEIHPGDTTIPALDPASLARIRA
FT                   QKILICDDSRFARKQMARALEAHQIDYLSAPNGRAALSVLKREADAGTPVQILVSDIEM
FT                   PELDGYQLALSVRADDHLRPAYVILHSSLNPVICERITQAAGANEGLTKFDPHALLAAI
FT                   GRGAGA"
FT   gene            127700..128140
FT                   /locus_tag="Fbal_0105"
FT   CDS_pept        127700..128140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0105"
FT                   /product="thioesterase domain protein"
FT                   /note="InterPro IPR012660; KEGG: amc:MADE_03531 fused GNAT
FT                   family acetyltransferase/PaaI-related uncharacterized
FT                   conserved domain; PFAM: Thioesterase putative; SPTR: A3WKL8
FT                   Acetyltransferase, GNAT family fused to PaaI related
FT                   uncharacterized conserved domain; TIGRFAM: thioesterase
FT                   domain protein; PFAM: Putative thioesterase (yiiD_Cterm);
FT                   TIGRFAM: thioesterase domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74319"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW19"
FT                   /protein_id="ADN74319.1"
FT                   /translation="MHTQWIQQLTALWHSTIPIAAQMGIRATDFDGDTLTTEADFAANQ
FT                   NLHGTMFAGSIYSHATLTGWGRVWLALQAQGLAGDIVLAEGQIHYRKPVTEAPQCRCTA
FT                   QAVDLSALREGRNARVSLTVTLGQAARFEGRFVVLPVVPSEP"
FT   sig_peptide     127700..127759
FT                   /locus_tag="Fbal_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(128181..129044)
FT                   /locus_tag="Fbal_0106"
FT   CDS_pept        complement(128181..129044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swd:Swoo_4593 hypothetical protein; SPTR:
FT                   A2UXM1 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3014)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74320"
FT                   /db_xref="GOA:E1SW20"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW20"
FT                   /protein_id="ADN74320.1"
FT                   /translation="MYQDDDAKRNGTNQMAMVLVILVILACGGAWYFFMRDSQAPTPTE
FT                   PVPALPAPEPTLPEQPLPAEPVPEPIPEPEPEPEPIPEPTPEPMPEPDPLPPLNDSDDF
FT                   AKEQINAVSDGMQLGGALQDDNLVRRFVVFVDNLAGGEVMRQQGPFTPLKDNFKALEMN
FT                   GKFYLDPEGYRRFDQYAEFLYRLDETKLRDHFMLVEPLMESAFQELGYGAGQFRSAIVD
FT                   GMDELLAAPEYDTPLELLSHSVNYQFADPAIEELSDAQKVMIRMGPDNARKVKSLLRRF
FT                   KAALNE"
FT   gene            complement(129114..131210)
FT                   /locus_tag="Fbal_0107"
FT   CDS_pept        complement(129114..131210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0107"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG1200 RecG-like helicase; InterPro
FT                   IPR001650: IPR011545: IPR004365: IPR014001: IPR 014021:
FT                   IPR019793: IPR004609; KEGG: vpa:VP0157 ATP-dependent DNA
FT                   helicase RecG; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; SMART: DEAD-like helicase ; helicase
FT                   domain protein; SPTR: A2PTP6 ATP-dependent DNA helicase
FT                   RecG; TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   Helicase conserved C-terminal domain; OB-fold nucleic acid
FT                   binding domain; DEAD/DEAH box helicase; TIGRFAM:
FT                   ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74321"
FT                   /db_xref="GOA:E1SW21"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW21"
FT                   /protein_id="ADN74321.1"
FT                   /translation="MTTSTPASVDKLNTLPVTTLKGVGDKLAEKLLRLGVRSVGDLLLH
FT                   LPLRYEDRTRIWPVAALTPGQNATVEGEVLSANVSYGRRRRMTVQLADGSGTISLHFFN
FT                   FALAQKDSFVVGARVRAFGEARAGMRHIEMVHPEYHVLGEHTHPLLEESLTPVYPTTEG
FT                   LKQAILRKLTDEALTLLRHHPLPELLPEGLYPHQLPLSDALHFIHRPPPDASLTQLESG
FT                   EHPAQQRLVMEELLAQNLSMLKLRADSGSHKALPLQPDTNLLQRFLAALPFQPTGAQQR
FT                   VVNEIAADLNQSEPMMRLVQGDVGSGKTLVAALAALHAISQGYQVALMAPTELLAEQHA
FT                   QAFANWFEPLGLPVAWLAGKLKGKAREAALERIASGEARMVVGTHAIFQSQVAFHHLAL
FT                   VIVDEQHRFGVHQRLTLREKGLKDGCYPHQLIMTATPIPRTLAMTAYADLDVSVIDELP
FT                   PGRTPITTVAIPDSRRDDVVERVRQACSNGRQAYWVCTLIEESEVLQCQAAEDTATELA
FT                   ERLPELNIGLVHGRMKADEKQQVMNAFKANELHLLVATTVIEVGVDVPNASLMIIENPE
FT                   RLGLAQLHQLRGRVGRGAVASHCVLLFHPPLSKTAQSRLGVLRESNDGFVIAQRDLEIR
FT                   GPGEVLGTRQTGLADLKIADLVRDAALIPQVQRLAQHLMDRYPSRVPAIIDRWLGGREI
FT                   YSQA"
FT   gene            complement(131279..132925)
FT                   /locus_tag="Fbal_0108"
FT   CDS_pept        complement(131279..132925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0108"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG1022 Long-chain acyl-CoA synthetase
FT                   (AMP-forming); InterPro IPR020459: IPR000873; KEGG:
FT                   shm:Shewmr7_0326 AMP-dependent synthetase and ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; SPTR: A2UYT5
FT                   AMP-dependent synthetase and ligase; PFAM: AMP-binding
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74322"
FT                   /db_xref="GOA:E1SW22"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW22"
FT                   /protein_id="ADN74322.1"
FT                   /translation="MTLQTPLQMLDHWCAVQGDTVFLRQPRERQLHDLTWAQTREAAYR
FT                   LAGALRQLGLKRGDKVAILSKNCAQWFITDLALQAGGFISIPIYPTANADTIRYVLKHS
FT                   EAKAIFIGKLDNPELQADAISQDLLRFDMSFPTLPVQYQWHQLLEMSEPLDDARPELDD
FT                   IMTIIYTSGSTGNPKGAVETYRAYSWAGTAVSNHLGATAQDRVISYLPLAHITERVYIE
FT                   GTAFYSGGTVYFVEALDTFVDDVKVAQPTFFLSVPRLWTLFQKNIIDKVGASKLDLLLK
FT                   LPIISALVARKIRTQLGLNAAKVLGCGSAPVSPALLHWYRKIGMDITEAWGMTENGAYA
FT                   TLNFPYRPDKVGTVGKPGTECEVKIGDNQELLFKSPGLFTEYYKNPEATAEAFTEDGFF
FT                   RTGDQATIDDEQFVTITGRVKDNFKTAKGKFVAPVPLERKLAQNNHIELVCVIGSGLPY
FT                   PVALVQLSEGASLMPRDEVRQSLAETADMVSGQMESHATLGGVLVVAEPWDVENEVLTP
FT                   TLKIKRHVLEQRFSDRVAGLKGNKVMWEAEL"
FT   gene            complement(133138..133845)
FT                   /locus_tag="Fbal_0109"
FT   CDS_pept        complement(133138..133845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0109"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro IPR001537;
FT                   KEGG: cps:CPS_4975 tRNA guanosine-2'-O-methyltransferase;
FT                   PFAM: tRNA/rRNA methyltransferase (SpoU); PRIAM: tRNA
FT                   guanosine-2'-O-methyltransferase; SPTR: P0AGJ4 tRNA
FT                   guanosine-2'-O-methyltransferase; PFAM: SpoU rRNA Methylase
FT                   family; SpoU, rRNA methylase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74323"
FT                   /db_xref="GOA:E1SW23"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW23"
FT                   /protein_id="ADN74323.1"
FT                   /translation="MSPERLARINAMLDMRQPDLTICLEDVHKPHNLSAMIRTADAIGV
FT                   PEVHAVFLGEDNRLRGGTATGSQQWVKVNRHQSIGDAVARMREQGMQVIATNLSEKAVD
FT                   FRSIDYTKPTAILMGQEKTGISQEALALADHDVIVPMVGMVQSLNVSVASALLLYEAQR
FT                   QRQAAGMYGQRRLDEAECQRLLFEGGHPIFARICRQKGLPYPRIDEEGQIQAPEAWWQK
FT                   VQMSPSAWQHLDD"
FT   gene            complement(133912..136017)
FT                   /locus_tag="Fbal_0110"
FT   CDS_pept        complement(133912..136017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0110"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /EC_number="3.1.7.2"
FT                   /note="COGs: COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase; InterPro IPR002912:
FT                   IPR004095: IPR006674: IPR007685: IPR 003607: IPR004811;
FT                   KEGG: swp:swp_0319 bifunctional (p)ppGpp synthetase
FT                   II/guanosine-3',5'-bis pyrophosphate
FT                   3'-pyrophosphohydrolase; PFAM: RelA/SpoT domain protein;
FT                   TGS domain protein; amino acid-binding ACT domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; PRIAM: GTP
FT                   diphosphokinase; SMART: metal-dependent phosphohydrolase HD
FT                   region; SPTR: A2UYT3 (P)ppGpp synthetase I, SpoT/RelA;
FT                   TIGRFAM: RelA/SpoT family protein; PFAM: HD domain; Region
FT                   found in RelA / SpoT proteins; TGS domain; TIGRFAM:
FT                   (p)ppGpp synthetase, RelA/SpoT family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74324"
FT                   /db_xref="GOA:E1SW24"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW24"
FT                   /protein_id="ADN74324.1"
FT                   /translation="MYLFEGLKELAASYLEPEQVEQLTQAYITARDAHDGQLRSSGDPY
FT                   ITHPVAVSRILAEMRLDHETLMAALLHDVIEDTELTQEDLAELFGAQVAELVEGVSKLD
FT                   KLKFRDRKEAQAENFRKMVMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIFAPLANRLGIHNIKNELEDLGFRALYPMRYRVLKEVVQAARGNRKELMQSIEAEIAG
FT                   RLEESGIPATVQGREKNLFSIYNKMVNKELQFQEVMDIYAFRITVANIDTCYRVLGAMH
FT                   TLYKPRPNRFKDYIAIPKANGYQSLHTSLFGPHGVPVEVQIRTEDMDQMADKGVAAHWL
FT                   YKNKGEAEATTTQVRARKWMQSLLELQQSAGNSFEFIESVKSDLFPDEIYVFTPTGKIL
FT                   ELPLGATAVDFAFAVHTDIGNSCVGARVNRHAYPLSMPLSSGQTVEIITAPGARPNAAW
FT                   LNFVVTAKARTKIRQVLKNLEQTESIALGKRLLNHALGELNLSDIPPAQLEQVISESRH
FT                   DSLDDMLAAIGLGDLMSLVVAQRLRGESASQANNPDSKLAIKGAEGMLVSFAKCCRPIP
FT                   GDDVVAHVSPGKGLVVHIDSCRNIRRNLEQEADKFLPVEWTDEPGAEYVTGLRIEIVNH
FT                   QGALAKLTSIIAGADANIHNLNTDEKDGRIYVINLTLTVQNRVHLANVLRKIRVMPEVL
FT                   KAARARS"
FT   gene            complement(136033..136311)
FT                   /locus_tag="Fbal_0111"
FT   CDS_pept        complement(136033..136311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0111"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="InterPro IPR006110: IPR003716; KEGG: saz:Sama_0265
FT                   DNA-directed RNA polymerase subunit omega; PFAM: RNA
FT                   polymerase Rpb6; SPTR: A1S270 DNA-directed RNA polymerase
FT                   subunit omega; TIGRFAM: DNA-directed RNA polymerase, omega
FT                   subunit; PFAM: RNA polymerase Rpb6; TIGRFAM: DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74325"
FT                   /db_xref="GOA:E1SW25"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW25"
FT                   /protein_id="ADN74325.1"
FT                   /translation="MARVTVEDAVDKIGNRFDLILVAARRARQLSVQGKEALVEVENDK
FT                   STVVALREIEQGLINSAALDEQERQAQREQEAAELAAVAAIAEGRTL"
FT   gene            complement(136371..136994)
FT                   /locus_tag="Fbal_0112"
FT   CDS_pept        complement(136371..136994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0112"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COGs: COG0194 Guanylate kinase; InterPro IPR008144:
FT                   IPR008145: IPR020590: IPR017665; KEGG: shm:Shewmr7_0330
FT                   guanylate kinase; PFAM: guanylate kinase; PRIAM: Guanylate
FT                   kinase; SMART: guanylate kinase/L-type calcium channel
FT                   region; SPTR: Q0HZX1 Guanylate kinase; TIGRFAM: guanylate
FT                   kinase; PFAM: Guanylate kinase; TIGRFAM: guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74326"
FT                   /db_xref="GOA:E1SW26"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW26"
FT                   /protein_id="ADN74326.1"
FT                   /translation="MARRGNLFILSAPSGAGKSSLISALLNDKPADMQVSVSHTTRAMR
FT                   PGEENGVHYHFVDVDEFKALIEQGAFFEWAEVFGNYYGTSRITIEQTLDRGIDVFLDID
FT                   WQGARQVKAQIPDAIGVFILPPSRAELERRLRSRGQDSDEIIAGRMAEAQSEISHYGEF
FT                   DYLLVNADFDTALSELRAIVCAERTRLARQVEAHGGMLDDLLAD"
FT   gene            137269..137748
FT                   /locus_tag="Fbal_0113"
FT   CDS_pept        137269..137748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0113"
FT                   /product="Ferritin Dps family protein"
FT                   /note="COGs: COG0783 DNA-binding ferritin-like protein
FT                   (oxidative damage protectant); InterPro IPR002177:
FT                   IPR008331; KEGG: ilo:IL2352 ferritin-like DNA-binding
FT                   protein; PFAM: Ferritin Dps family protein; SPTR: A0Y4D7
FT                   DNA-binding DPS protein; PFAM: Ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74327"
FT                   /db_xref="GOA:E1SW27"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW27"
FT                   /protein_id="ADN74327.1"
FT                   /translation="MNTNLIGLDKVGAEALAEQLNHLLANYQVLYMNVRGFHWNVQGAN
FT                   FFELHAKFEEIYDQLLLKVDEIAERILTLGHQPRHGFSDYLRMSQIDEVKGVRDGHVAI
FT                   EHILSAYTLLLSQQRKILSQASELGDEGTVSLMSDYISQQEKESWMLSAYQGRGA"
FT   gene            complement(137730..138698)
FT                   /locus_tag="Fbal_0114"
FT   CDS_pept        complement(137730..138698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74328"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW28"
FT                   /protein_id="ADN74328.1"
FT                   /translation="MKNVELNLHNLVRITGHLPQPLLTPLMERFGRFRGDASAAPWEIE
FT                   LGILDAPGYRLRSRPGWVFDEIGAHWLGRSRKRLVIQATERGFRLLVRAPHYGRLHFGL
FT                   LWALRILMARQGGALMHGAVLGNGQHTLMLLGAKRVGKTQLVLRLMEQQWQLLAEDKFL
FT                   FLHGQAYCLQDHFYLRAHHLHSHPWLPGMLGQPERPARRTGEAQWRAGVETLYPGQLAL
FT                   TLRPDRLAWLSPGEQWQHQPISPTALRQALVQQQRDAFAQFAALDQWQGDPVSLPDDLP
FT                   LTGARHYLVPQPIDITVGCQSLRQWLQAATPTEGDAQAPRP"
FT   gene            complement(138695..140110)
FT                   /locus_tag="Fbal_0115"
FT   CDS_pept        complement(138695..140110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0115"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /note="COGs: COG2244 Membrane protein involved in the
FT                   export of O-antigen and teichoic acid; KEGG: smd:Smed_4810
FT                   polysaccharide biosynthesis protein; PFAM: Polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74329"
FT                   /db_xref="GOA:E1SW29"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW29"
FT                   /protein_id="ADN74329.1"
FT                   /translation="MSRKTVAQLAASRGLRHALGVITAFLRPKLLGPEALGLYALLNLF
FT                   PTYSTYLHLGARSSLRYQVPQLQGQGQTDGIDSLKNSVYWGSLLLNALLALAIIGYAVW
FT                   GTDDGMTQFGLVCAAASVLLVWAFDHRLAELKSEQQFGVLARITAWRYLLQFVLTVGLL
FT                   LTLGLVGAFLALPLCLMLLFWSARQGSPAKRQPWQWQQFVDQVRLGFPILMLELVSLSL
FT                   RLVDKLLVSSLLGLEALGYYTLGTMLLGPLMNLPGAAREVSEPKLMQQQRENHRQQRLQ
FT                   RHYWRPMHRSAWLMPLLILPAVLLLPAVIQYGLPQYGPALHSAQWLAVGSFFLALGYPA
FT                   RGLIVAERWQASAARSAWLVVPLVVAATALAMQWWPRLETVSIGFSLGYAALALVLGRF
FT                   LCRRFDNAPMLSRSLALLLPFALMGLLWAGLDNLPLPGDWPLWATVSCQLLLVALAAPL
FT                   FWWRAHQPDRIHG"
FT   gene            complement(140107..141237)
FT                   /locus_tag="Fbal_0116"
FT   CDS_pept        complement(140107..141237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mei:Msip34_0093 hypothetical protein; SPTR:
FT                   Q54I47 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74330"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW30"
FT                   /protein_id="ADN74330.1"
FT                   /translation="MKAVFGALLLAVSTLAQADPTAVRPYHPDSPWNLPIGESPKIDRN
FT                   SAFYLDQMSGVFGIDPNQYTLPVYRIDADTPMKPVHLSGVFSQVTNDNRDLTLIKRTTL
FT                   EAPLPDGARAAKGSDGQIVLWDPVSGDEWGFWQARERADGSWEAVNGYRYNTRWSGIPP
FT                   SGFISRGAGVPYLIGLVRPWEIRQGHIDHAIALGINYPNPVHIAPATKSDGKRFEPHYL
FT                   PMGARLQLDPNLGEADFDRWQLTATERIIARALQRYGMILIDGSGHPKLYAEFEGTAHW
FT                   NGELHKRTLRRIPYQAFRLLDLTTQTPQVAPEARIEQGQLHWQAVDGANRYRIWFDDHT
FT                   EEVERGPVALPAGVKQVRLAALNHQGIGPVTEVTQP"
FT   sig_peptide     complement(141184..141237)
FT                   /locus_tag="Fbal_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(141234..142412)
FT                   /locus_tag="Fbal_0117"
FT   CDS_pept        complement(141234..142412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0117"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="InterPro IPR007833; KEGG: bph:Bphy_3272 capsule
FT                   polysaccharide biosynthesis protein; PFAM: Capsule
FT                   polysaccharide biosynthesis protein; SPTR: A3WGG3 Capsule
FT                   polysaccharide export protein; PFAM: Capsule polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74331"
FT                   /db_xref="GOA:E1SW31"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW31"
FT                   /protein_id="ADN74331.1"
FT                   /translation="MSAYLVHVDCLERYRFFRRLQQALPEHRWQLITGRLSLLQLARRD
FT                   GVPCHWLQRGAATMDDTLQSGIEVGLEAALNWRGPRHWLALQRAVWFALTQYCDPHTTL
FT                   LIWNGCRTIEQTMTAFARHHRLPVLYLELGNFPGKLFADPEGVNARSRLARQPQLLDAL
FT                   ADPVDQFESWRSAYLQRHQQPPQSAQVKQVNPQWWRDQLGYWLGGLSADQPLWQRAWRK
FT                   WQARRQPLTASATPPDAPFLLYPMQVSSDSQLCFNSDIDNRQAIAIAAEQARDAGLALC
FT                   IKPHPAEPDATVLQWLQQQSAAQGWHLCRAPMTQLLPQASQVVTINSTVGLEAMLLDKP
FT                   LRVLGRSHYADFTPRRLRQYLMSYLHPIDYFNDSAIEPADAERLLARAEVAR"
FT   gene            complement(142420..143511)
FT                   /locus_tag="Fbal_0118"
FT   CDS_pept        complement(142420..143511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0118"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: dvm:DvMF_0676 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A3JGG9
FT                   Glycosyltransferase, group 1 family protein; PFAM: Glycosyl
FT                   transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74332"
FT                   /db_xref="GOA:E1SW32"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW32"
FT                   /protein_id="ADN74332.1"
FT                   /translation="MRDAPRVLLLDLSRHFGGASSRVLGLLANYPPGRAWLGALTDSAV
FT                   YREAKARGLPVLGLGQHKADPRLLSRLCRACREHQIALIDSHNIQSQFWAHWASQRCGV
FT                   AHITTLNSWYADEYRQQWRGALYARLSRWLRPEGPLIVVSDAIGQALRQQGVAAERIHL
FT                   VANAVAPAPTLEVNRDELATSLALAPQRPWVLLVARLESAKRVDRFVDAMARLPEAQGI
FT                   VVGEGSLMATLQTQRRELGSDVVFTGTLPHSETQRLMAASDLLVLSSDTEGTPLVLLEG
FT                   AALAKPMVATAVGGIPELFDDGVEARLVAPDAAALAAGIQQLLTAPEQGATLGHAARTR
FT                   LLAQFSPQAQLQHTLAAYHAALE"
FT   gene            complement(143511..145661)
FT                   /locus_tag="Fbal_0119"
FT   CDS_pept        complement(143511..145661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0119"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="COGs: COG2319 FOG: WD40 repeat; InterPro IPR006664:
FT                   IPR020472: IPR006665: IPR005532: IPR 019781: IPR001680:
FT                   IPR019775: IPR019782: IPR017986; KEGG: dal:Dalk_2629
FT                   protein of unknown function DUF323; PFAM: OmpA/MotB domain
FT                   protein; protein of unknown function DUF323; WD40 repeat,
FT                   subgroup; SMART: WD-40 repeat protein; SPTR: B8LTB2 Pfs,
FT                   NACHT and WD domain protein; PFAM: Formylglycine-generating
FT                   sulfatase enzyme; WD domain, G-beta repeat; OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74333"
FT                   /db_xref="GOA:E1SW33"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR037783"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW33"
FT                   /protein_id="ADN74333.1"
FT                   /translation="MTSTPRWPRLSLLAASLMLVAGAQAAPLAGQWQADTDALISGQRQ
FT                   QITLNVHFDTDSATLSQADQQALTQLAAKLAPMLDGQMALAISGHTDSAGAEEYNLGLS
FT                   QRRAQSVAQFLTSLMPEQHIRIESRYFGETQPLQSNDSARGMAANRRVEITLAALYALG
FT                   AQGGQPAVGPATSFSPDGGLALASDPSGRLALWQLAEGCPQYTTEVNDSPVMASAISPN
FT                   GRLAASGHLDGTVRLWDLATGDLINTRYGHDDTVVDITFSQDGKWLFSASHDHSAALWD
FT                   LTDARQHKLDTEGALPLSALTANHNGRRLALGDIGGNLSLWNLATRTKVSEQKLLHGRI
FT                   NDMAYSSNDRFLAVAGGNGELVLLDTEAGESHTLSHPSAHGITALAFSPDGQRLATAWS
FT                   NQQLVVWDTASGRRLQQRPTEGTIHRLSFNANGHLLNGAGEATLSQWDSDRFELVRQQD
FT                   LARPDHQPQPGQAGEIWREPTTGVPFVWVEGGCYIQGCDSGSQSCAKDETPAHEVCVDG
FT                   FWMAQTELTQDQWQTLMPSNPSRYALGGDHPVEQVSWFDAQRFTCKLNATSEYEFRLPT
FT                   EAEFEYACRNGGQNTNFGNDEVAAAADELPSNPAKVKTGEAIHMPVSALPNNALGLSGL
FT                   NSHVWEWTLDVYDKAGYQAHRRHNPLFIGDNEYHFLSADTHRVERGGGWDTGGRFQSCQ
FT                   RRQYDLPETRAFFTGFRLVRRP"
FT   sig_peptide     complement(145587..145661)
FT                   /locus_tag="Fbal_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(145658..146812)
FT                   /locus_tag="Fbal_0120"
FT   CDS_pept        complement(145658..146812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0120"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   avn:Avin_05330 glycosyl transferase, family 2; PFAM:
FT                   glycosyl transferase family 2; SPTR: A1ZS81 Two-component
FT                   system sensor histidine kinase/response regulator, hybrid;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74334"
FT                   /db_xref="GOA:E1SW34"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW34"
FT                   /protein_id="ADN74334.1"
FT                   /translation="MMLLSLSLALLVLVLLGYPLWCLRQSRHAPQTIPAPTTWPSLSVL
FT                   IVVRNGADRIDAKLANTFGLHYPGPTPQVLVYDDGSSDDTAERVARWPATTLLRSTEHH
FT                   GKIAGLNALAEQASGEVLVFSDVDALLDDNALCALISPLCQPGIGGVCGQRRVQGSSAL
FT                   AQAQSDYIDWDSRIKLGESARGSLTSNDGKLYALWRRLYQPIPAAVTDDLYAALSVIAQ
FT                   RQRFVFAPGAIARVPLPVHRMAQEIPRRRRIVGASLNGLRHHRRLLNPWRYGQVATGLW
FT                   INKVGRRLLPLALLGLLLGSALLAPTHPIAALLLVLQLAGYGLAALHPWLGPRALQRVA
FT                   EQATYFILANIGMLLGWFDFITGRAAPKWEPEKGSAHTAKENDQ"
FT   sig_peptide     complement(146762..146812)
FT                   /locus_tag="Fbal_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(146809..148179)
FT                   /locus_tag="Fbal_0121"
FT   CDS_pept        complement(146809..148179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0121"
FT                   /product="O-antigen polymerase"
FT                   /note="InterPro IPR007016; KEGG: avn:Avin_05350 O-antigen
FT                   polymerase, Wzy protein; PFAM: O-antigen polymerase; SPTR:
FT                   A3VT52 Putative uncharacterized protein; PFAM: O-Antigen
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74335"
FT                   /db_xref="GOA:E1SW35"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW35"
FT                   /protein_id="ADN74335.1"
FT                   /translation="MGRLGNNLVLTTLLTGLLLATLGMLVTPYYWAAWVPAFALLLSLV
FT                   VARSPHWGFLLMVATIPFGAYRKILGDRIDIAWLVAALLIVIIAIDLLVRRRQLSDARA
FT                   RFWPLFALFLAVNLVSVVFSPYGSVAVKDLLLWLAGCVFIALPLFLLRREDLYRHLPNV
FT                   LIVSIGIGALLALLGSALGLEGLAAQKGDISRGLGGTRDPNNMGLMLLFGLPLLVHRVL
FT                   YSPLKRQKSLYVALIIVSLLAVASTYSRGAVLMLMICTAQLVWHYRHRLQVRLLGVVIA
FT                   LVALGGAATMMTLPQSFWERQLSITDSGDKSLSRRASYLVVGWDSLADAPLLGHGPGTF
FT                   PERYVRSDEAKEFSREGKSDRRFAHNSYMEVLVGSGLIGFALFLAIQYRGWQDLRFSER
FT                   RWQSLGQWAQADLVASYRIMFLTLLAYLMIFSDTHHKYWLLILPVAALLRRDAERAE"
FT   sig_peptide     complement(148084..148179)
FT                   /locus_tag="Fbal_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(148183..149184)
FT                   /locus_tag="Fbal_0122"
FT   CDS_pept        complement(148183..149184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0122"
FT                   /product="sugar transferase"
FT                   /note="COGs: COG2148 Sugar transferase involved in
FT                   lipopolysaccharide synthesis; InterPro IPR003362; KEGG:
FT                   dat:HRM2_32260 predicted glycosyltransferase; PFAM: sugar
FT                   transferase; SPTR: A3VTM1 Putative uncharacterized protein;
FT                   PFAM: Bacterial sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74336"
FT                   /db_xref="GOA:E1SW36"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW36"
FT                   /protein_id="ADN74336.1"
FT                   /translation="MSQIVSRSISALFPKQRWSRTLELTAAWLMLLCALPMGLVFALII
FT                   KLQDGGPVFYRGTRLGKDRKLFTLYKFRTLVPNAEAIIGANLLKPSQQLETPFGKFLRD
FT                   THLDELPQVLCVIKGDMALIGPRPERPAVYETMCREIPFYDHRFRVAPGMLGYSQLFTP
FT                   HGTDKRIRSFIDNVYINRRRLHSDLLFFFQASLVLTQRLVRHCWRLLKITGGRVMFGQQ
FT                   WSERRHTRRHKPRYAKVHIQCQPPVQGHIVNITYDAMLIALSHPLENPEAELELVLRTH
FT                   FIRKARFRTKLCRVRGTVISARSTPEEPHCYLVRIAEATPLNRYFLSKYFMS"
FT   sig_peptide     complement(149059..149184)
FT                   /locus_tag="Fbal_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(149181..150620)
FT                   /locus_tag="Fbal_0123"
FT   CDS_pept        complement(149181..150620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0123"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="COGs: COG3206 Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis; InterPro IPR003856; KEGG:
FT                   pfo:Pfl01_2020 lipopolysaccharide biosynthesis; PFAM:
FT                   lipopolysaccharide biosynthesis protein; SPTR: A3L961
FT                   Putative uncharacterized protein; PFAM: Chain length
FT                   determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74337"
FT                   /db_xref="GOA:E1SW37"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW37"
FT                   /protein_id="ADN74337.1"
FT                   /translation="MQNVSNASWERNAQGTENPLRELVTILFMQKWLIQRVAALVFLAV
FT                   LAVLLFWPSVYQIDSTVLLKSKQVETSPEMLEETMLRVNPVNEDDLNSEVAIITSQAVL
FT                   RRAVNKMVEQGLWQAPEEEADLVKATRGLEAKLTTQVVPSSKVIRISLAWSDPEEGNAL
FT                   LTAVINSYLSYRSTVFEPDTLRDLFTQQTEDYSSQLQQRRAEKMALIETHQAAAPAQEI
FT                   EQNLTLLRELKLQHSRLEQEAQSLNHREQKLTQALNENALHYFSFIDNVTVQKLTTEIQ
FT                   MLVARQTELEQVYLPESPPAEALDHQIEQTYQILRDEIGTLQQELADQVALLRADINSL
FT                   NQKMLTLSQRNVELQQVKLQMERLDQEIKLLGFSYETFYKRREQAQIQSRFSDEHLNAQ
FT                   VVVLVPPEAQLEPLFPRWKTMLPLGLLVALITGVCIGFINEFFDHSFKRAEDSERHLGL
FT                   PTLLSIPQIDAAPQPTAKGHR"
FT   gene            complement(150620..151639)
FT                   /locus_tag="Fbal_0124"
FT   CDS_pept        complement(150620..151639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0124"
FT                   /product="polysaccharide export protein"
FT                   /note="COGs: COG1596 Periplasmic protein involved in
FT                   polysaccharide export; InterPro IPR019554: IPR003715; KEGG:
FT                   pfl:PFL_3082 polysaccharide biosynthesis/export protein;
FT                   PFAM: polysaccharide export protein; Soluble ligand binding
FT                   domain; SPTR: A0ZMF4 Putative uncharacterized protein;
FT                   PFAM: Polysaccharide biosynthesis/export protein; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74338"
FT                   /db_xref="GOA:E1SW38"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW38"
FT                   /protein_id="ADN74338.1"
FT                   /translation="MASSNALFRTLLAALTLFVMSGCATNDFPIGEEVTLSQDTFSFTE
FT                   PEFQILSQYRIVPGDQLDVLFQIQTWSREKAYRISLGDTVSVRFVNAPELDQEQKILPD
FT                   GTVALPYIGAVNVYNKTTDELTAELRAAYSTILRDPQIYVTLPEYLTQIRELKKDLHTA
FT                   SRGLSRLVTVRPDGFVTFPMVGDLYVADRTIQQVNAELNDNYSKISNSLHVDLFLEKHA
FT                   GSQIYVLGEVGKPGAIKISKPTSVAQALAMAGSHSQSARLDHIVVVRRQGKKLVGTRVD
FT                   LDSALQLGAGSSHFYLMPDDVVYVPSTSLATASAVMRQLADVLLLYRGWGFSFRPSDN"
FT   sig_peptide     complement(151565..151639)
FT                   /locus_tag="Fbal_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(151626..152303)
FT                   /locus_tag="Fbal_0125"
FT   CDS_pept        complement(151626..152303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0125"
FT                   /product="ATPase involved in chromosome partitioning"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; KEGG: pfo:Pfl01_2022 ATPase involved in
FT                   chromosome partitioning-like; SPTR: A1XP86
FT                   Exopolysaccharide biosynthesis protein; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74339"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW39"
FT                   /protein_id="ADN74339.1"
FT                   /translation="MPNAIAESSGVLTDDARRILFASQRQLAPLRGNLFQPEKGALPDS
FT                   LLVTSARRGEGKTTTAIALAYALSQHSASKVLLVSADAATSPLARLFQLDGSKGLGQYL
FT                   LGDDSAQPHPSEFERLDVMPWGEGPRTLWQQSSESLKARWQALLAQYEVVVVDGPAVLD
FT                   TPETQAIHQHVAATLLVLQCEVTKWQVAQVALERLNSAGGHVIGTVMNQRRYYVPGRLY
FT                   GKF"
FT   gene            complement(152789..153649)
FT                   /locus_tag="Fbal_0126"
FT   CDS_pept        complement(152789..153649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0126"
FT                   /product="YicC domain protein"
FT                   /note="COGs: COG1561 Uncharacterized stress-induced
FT                   protein; InterPro IPR013551: IPR013527: IPR005229; KEGG:
FT                   slo:Shew_3489 hypothetical protein; PFAM: YicC domain
FT                   protein; domain of unknown function DUF1732; SPTR: A2UXM7
FT                   Putative uncharacterized protein; PFAM: YicC-like family,
FT                   N-terminal region; Domain of unknown function (DUF1732);
FT                   TIGRFAM: conserved hypothetical protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74340"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW40"
FT                   /protein_id="ADN74340.1"
FT                   /translation="MIHSMTAYGRGELKADWGTASWEIRSVNQRYLETYLRLPEQMRGL
FT                   EPVLRERLRQRLTRGKVEVTLRFDLAQQVDTLNMNESLARQLVEKAQQLHTMAGIGQIQ
FT                   LVDLLKWPGVLESGEQDMDQISQDLLAKFDDVVDDFVDARASEGQALEAMIQQRLEGIS
FT                   TQSAYVRERMPQIMEWQRQKLNDRLADIKEELDPARFEQEMILLAQKMDVAEELDRLDA
FT                   HVAETRKILKKGGACGRRLDFMMQEFNRESNTLASKSISADITAAAVELKVLIEQMREQ
FT                   IQNIE"
FT   gene            153802..154518
FT                   /locus_tag="Fbal_0127"
FT   CDS_pept        153802..154518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0127"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="COGs: COG0689 RNase PH; InterPro IPR015847:
FT                   IPR001247: IPR018336: IPR002381; KEGG: stm:STM3734
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2; PRIAM: tRNA
FT                   nucleotidyltransferase; SPTR: P0A2C3 Ribonuclease PH;
FT                   TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease family,
FT                   domain 1; 3' exoribonuclease family, domain 2; TIGRFAM:
FT                   ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74341"
FT                   /db_xref="GOA:E1SW41"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW41"
FT                   /protein_id="ADN74341.1"
FT                   /translation="MRSNGRAADQVRPVSITRNFTAHAEGSVLVAFGNTKVICTASVEE
FT                   SVPRFLRGKGQGWITAEYGMLPRATHSRNDREAARGKQSGRTMEIQRLIGRSLRAAVDL
FT                   EALGEVTITIDCDVIQADGGTRTAAITGACVALMDAIDHLKAKGVLKVSPLKQQIAAIS
FT                   VGVVGEHAVCDLDYVEDSSAETDMNVVMAEDGRIIEVQGTAEGEPFTYEQMLEMMALAK
FT                   TGIEQLIAAQKAAYNN"
FT   sig_peptide     153802..153873
FT                   /locus_tag="Fbal_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            154578..155219
FT                   /locus_tag="Fbal_0128"
FT   CDS_pept        154578..155219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0128"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="COGs: COG0461 Orotate phosphoribosyltransferase;
FT                   InterPro IPR000836: IPR002375: IPR004467; KEGG:
FT                   sfr:Sfri_3835 orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; PRIAM: Orotate
FT                   phosphoribosyltransferase; SPTR: A2UXM9 Orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain; TIGRFAM: orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74342"
FT                   /db_xref="GOA:E1SW42"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW42"
FT                   /protein_id="ADN74342.1"
FT                   /translation="MKAYQKAFIEFALERQVLRFGEFTLKSGRTSPYFFNAGLFNRGSD
FT                   LAKLGRFYAAALADSGIDFDLLFGPAYKGIPIATTTAVALADHHEMDLPYCFNRKEAKD
FT                   HGEGGNLVGAELKGKVMLVDDVITAGTAIRESMEIIQHNGAELAGVLIALDRQEKGKGE
FT                   LSAIQEVERDFGCQVVSIVTLSDLISFLAEQPGREAELAAVKAYREQYGI"
FT   gene            complement(155277..155870)
FT                   /locus_tag="Fbal_0129"
FT   CDS_pept        complement(155277..155870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0129"
FT                   /product="cell division inhibitor SlmA"
FT                   /note="InterPro IPR001647; KEGG: spl:Spea_3840 nucleoid
FT                   occlusion protein; PFAM: regulatory protein TetR; SPTR:
FT                   A8H9B3 HTH-type protein slmA; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74343"
FT                   /db_xref="GOA:E1SW43"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW43"
FT                   /protein_id="ADN74343.1"
FT                   /translation="MATNNKKNRREHILQCLARMLETSPGQRITTAKLAAEVGVSEAAL
FT                   YRHFPSKARMFEGLIEFIEESLLTRINLVMQEEKDTMVRCQLMLQLLLTFAERNPGITR
FT                   LLTGDALTGEQDRLRGRINLLFNKVETNLKQALREKSLREGQGFYLEEGMLANLLLSWA
FT                   EGRIAQFVRSEFKELPTKNFSEQWAFIQRQLLQS"
FT   gene            complement(155890..156348)
FT                   /locus_tag="Fbal_0130"
FT   CDS_pept        complement(155890..156348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0130"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="COGs: COG0756 dUTPase; InterPro IPR008180:
FT                   IPR008181; KEGG: shn:Shewana3_3772 deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase; PFAM: deoxyUTP
FT                   pyrophosphatase; SPTR: Q0HE54 Deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: dUTPase; TIGRFAM:
FT                   deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74344"
FT                   /db_xref="GOA:E1SW44"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW44"
FT                   /protein_id="ADN74344.1"
FT                   /translation="MKTPIELKILDPRLGTEWPLPDYATPGSAGMDLRAMLDAPLTLEP
FT                   GQTELVPTGLAIHIGDAGLAATILPRSGLGHKHGIVLGNLVGLIDSDYQGQLFVSCWNR
FT                   GQDSFTINPGERIAQLMFVPVVQAEFKLVDDFDASSRGEGGFGHSGTQ"
FT   gene            complement(156345..157547)
FT                   /locus_tag="Fbal_0131"
FT   CDS_pept        complement(156345..157547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0131"
FT                   /product="Phosphopantothenoylcysteine decarboxylase
FT                   ;Phosphopantothenate-cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="COGs: COG0452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase; InterPro IPR007085: IPR003382:
FT                   IPR005252; KEGG: aha:AHA_0159 phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein; PRIAM: Phosphopantothenate--cysteine ligase;
FT                   SPTR: A2UXN4 Phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA / pantothenate metabolism flavoprotein; Flavoprotein;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase,
FT                   prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74345"
FT                   /db_xref="GOA:E1SW45"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW45"
FT                   /protein_id="ADN74345.1"
FT                   /translation="MSLSNRNILLGVSGGIAAYKAPILVRRLREQGANVRVVLTKGAKA
FT                   FVTPMSLQAVSGHPVVDDILDPATESAMGHIDLARWADAVIIAPASANLIARMAAGMAD
FT                   DLLTTACLATSAPVYLAPAMNQQMYLHAATQANLATLQQRGVILWGPDSGDQACGEVGP
FT                   GRMWEPEAIAAATVEALNAGPKPLAGKKLLLTAGPTREALDPVRFMSNHSSGKMGFALA
FT                   EQAVALGAEVTLVSGPVSLATPAGVTRIDVESAEQMLEAVLAALPGQDIFIGCAAVADY
FT                   RPLAVADNKIKKSNERMVVELVRNPDILATVAQQQPRPFTVGFAAETDNVEQYARDKLA
FT                   RKGLDLIAANDVSKPDQGFNANHNALTLYWADGHKSLGHSDKGQQARLMLDTIADHLAC
FT                   Q"
FT   gene            157622..158305
FT                   /locus_tag="Fbal_0132"
FT   CDS_pept        157622..158305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0132"
FT                   /product="DNA repair protein RadC"
FT                   /note="COGs: COG2003 DNA repair protein; InterPro
FT                   IPR001405; KEGG: aha:AHA_0160 DNA repair protein RadC;
FT                   PFAM: DNA repair protein RadC; SPTR: A0KEM8 DNA repair
FT                   protein radC homolog; TIGRFAM: DNA repair protein RadC;
FT                   PFAM: Protein of unknown function (DUF2466); TIGRFAM: DNA
FT                   repair protein radc"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74346"
FT                   /db_xref="GOA:E1SW46"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW46"
FT                   /protein_id="ADN74346.1"
FT                   /translation="MDGKSIAQWPASERPRERLLKQGPEALSDAELLAIFLRTGVPGTS
FT                   AVALARQLLDEFGDLGHLLNASKQQFCAIRGLGEAKYVQLHATLELARRYLAVQWQRGE
FT                   PLTSPQAVRDYLRHRLQGLEEERFMLLLLDSQHRVLQTIELSRGTIDAAQVYPREVVKT
FT                   ALKANAAAVILAHNHPSGVAEPSQADRHITGRIQQALALVDVSVLDHLVVGRGQSCSFA
FT                   ERGWL"
FT   gene            158436..158672
FT                   /locus_tag="Fbal_0133"
FT   CDS_pept        158436..158672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0133"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="COGs: COG0227 Ribosomal protein L28; InterPro
FT                   IPR001383; KEGG: dze:Dd1591_3959 ribosomal protein L28;
FT                   PFAM: ribosomal protein L28; SPTR: A3UQS3 Ribosomal protein
FT                   L28; TIGRFAM: ribosomal protein L28; PFAM: Ribosomal L28
FT                   family; TIGRFAM: ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74347"
FT                   /db_xref="GOA:E1SW47"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW47"
FT                   /protein_id="ADN74347.1"
FT                   /translation="MSKVCQVTGKRPVTGNNRSHANNATKRRFLPNLQTHRFWVEGEKR
FT                   FVKLRVSTKGMRIIDKKGIEAVLTELRARGEKI"
FT   gene            158684..158854
FT                   /locus_tag="Fbal_0134"
FT   CDS_pept        158684..158854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0134"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="InterPro IPR001705: IPR018264; KEGG:
FT                   vha:VIBHAR_00655 50S ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; SPTR: Q87T84 50S ribosomal protein L33;
FT                   TIGRFAM: ribosomal protein L33; PFAM: Ribosomal protein
FT                   L33; TIGRFAM: ribosomal protein L33, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74348"
FT                   /db_xref="GOA:E1SW48"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW48"
FT                   /protein_id="ADN74348.1"
FT                   /translation="MAKKGIREKIRLVSSAGTGHFYTTDKNKRNMPEKFEIKKFDPTIR
FT                   QHVMYKEAKIK"
FT   gene            159137..159604
FT                   /locus_tag="Fbal_0135"
FT   CDS_pept        159137..159604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_3689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74349"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW49"
FT                   /protein_id="ADN74349.1"
FT                   /translation="MARSRRTYNNWLIFLVIGAGALLFSTGRLTGPNSNSFPLLPESAE
FT                   IEALVYGDLVVRAEADGVRSSPVVSEARLNALLAAWRSARLVPVGEPQPLPDSPVQVDV
FT                   YLDDGSAPQTALLYPQQAAVKMLGQSQWWRLVNQEMQHLLPPDNTAAPASK"
FT   sig_peptide     159137..159226
FT                   /locus_tag="Fbal_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            159614..160426
FT                   /locus_tag="Fbal_0136"
FT   CDS_pept        159614..160426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0136"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase
FT                   ;Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="COGs: COG0266 Formamidopyrimidine-DNA glycosylase;
FT                   InterPro IPR012319: IPR015886: IPR015887: IPR000214: IPR
FT                   000191; KEGG: shm:Shewmr7_3974 formamidopyrimidine-DNA
FT                   glycosylase; PFAM: Formamidopyrimidine-DNA glycosylase
FT                   catalytic domain protein; DNA glycosylase/AP lyase, H2TH
FT                   DNA-binding; PRIAM: DNA-formamidopyrimidine glycosylase;
FT                   SPTR: Q0HPK4 Formamidopyrimidine-DNA glycosylase; TIGRFAM:
FT                   formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase H2TH domain;
FT                   Formamidopyrimidine-DNA glycosylase N-terminal domain; Zinc
FT                   finger found in FPG and IleRS; TIGRFAM:
FT                   formamidopyrimidine-DNA glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74350"
FT                   /db_xref="GOA:E1SW50"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW50"
FT                   /protein_id="ADN74350.1"
FT                   /translation="MPELPEVEVTRLGIAPHLEGRVVEEVIVRNPRLRWPVDPLIQQLV
FT                   GQTILSVTRRAKYLLVDTEAGVLILHLGMSGSLRVLDPVPEPGKHDHLDLVLDSGAVLR
FT                   LNDPRRFGAAIWWQLPLDAQPLLNKLGPEPLTAAFNAEQLAAALKGKTSAIKTALMDNH
FT                   VVVGVGNIYANEALFAAGIHPKRAAGNLSKARLAKLVEEVKAVLARAIQQGGTTLKDFT
FT                   QADGKPGYFVQQLNVYGRGGQACVQCGAQLKEIKLGQRATVYCGHCQR"
FT   gene            complement(160431..160916)
FT                   /locus_tag="Fbal_0137"
FT   CDS_pept        complement(160431..160916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0137"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="COGs: COG0669 Phosphopantetheine
FT                   adenylyltransferase; InterPro IPR001980: IPR004820:
FT                   IPR004821; KEGG: amc:MADE_00059 phosphopantetheine
FT                   adenylyltransferase; PFAM: cytidylyltransferase; PRIAM:
FT                   Pantetheine-phosphate adenylyltransferase; SPTR: B4S2C7
FT                   Phosphopantetheine adenylyltransferase; TIGRFAM:
FT                   pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Cytidylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase, bacterial; cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74351"
FT                   /db_xref="GOA:E1SW51"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW51"
FT                   /protein_id="ADN74351.1"
FT                   /translation="MSQTAIYPGTFDPITNGHLDLIQRASRMFDRVIVGIAASPSKRPL
FT                   FTLEQRVELVNAVVAELGNVEVVGFSGLLADFAREQNARVLIRGLRAVSDFEYEFQLAN
FT                   MNRRLNPELESVFLTPSEENSFISSSLVKEVALHGGNVTEFLPEVVQNALKDALAKR"
FT   gene            complement(160941..161912)
FT                   /locus_tag="Fbal_0138"
FT   CDS_pept        complement(160941..161912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74352"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW52"
FT                   /protein_id="ADN74352.1"
FT                   /translation="MGEMKGMETHSAGNATSKATVLLLPPTGWQGEALLASYRALAMAL
FT                   AQHTEVTVQWAGYQQLPNQLAFKAIPHFLARHPGTTVISHCPLPPSWPLAGARVILTLL
FT                   PHQLANLPRRSQVDDIWLLDGAALPLLTRLKLALWHRPRPTTYSLWRPPVTGTTDALPG
FT                   YLFLLSQRLSPAERELVSEVAQVVSIQRQCPVYLWLNGSPPPGLRGVTLLPEQDETALQ
FT                   QHLNQARAIISDQWHWLLCGAHAERPTLALTEPGTPLQKGCHRLGIGTESVQRQALTQA
FT                   VLSLTEAPIGQPANQLDVAIKQLAQQWDGPLGSDAVSGYTSP"
FT   gene            complement(162095..163150)
FT                   /locus_tag="Fbal_0139"
FT   CDS_pept        complement(162095..163150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0139"
FT                   /product="glycosyl transferase family 8"
FT                   /note="COGs: COG1442 Lipopolysaccharide biosynthesis
FT                   protein LPS:glycosyltransferase; InterPro IPR002495; KEGG:
FT                   cju:C8J_1341 hypothetical protein; PFAM: glycosyl
FT                   transferase family 8; SPTR: A1XRC1 Glycosyltransferase;
FT                   PFAM: Glycosyl transferase family 8"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74353"
FT                   /db_xref="GOA:E1SW53"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW53"
FT                   /protein_id="ADN74353.1"
FT                   /translation="MTHPQMNIVLSGDDNYSKYMAVTMQNIVHFLAPGTKVNFLILDSG
FT                   IRPESKAKLQQFADTLDQVQIHIFDIVEHYADELAKLAPYRHGSKKNTITAGTYGLFFV
FT                   AEAFPEFDKALYIDVDVIVRQNLQPAFDTDIEDKYGAVVRMLTHAQLGSLKSSRSGKPF
FT                   PQNFQDLFGKSSENYFNAGVQLLNLKRMREEKVKDQLSDTLTNIPLEVFHTEVNYHNQD
FT                   IFNAVFAGKVAFLPTRYNCQVKNVNKIKRRFLRLGLDFSEFQPEFENPAIIHYSGRRKP
FT                   WNDKNLFASELWWDAASRTPFAEEINQKYQQDLSKKLKTAKGLLNWLFDFRLDKNQKHI
FT                   KLFGITLLRDH"
FT   gene            163406..164314
FT                   /locus_tag="Fbal_0140"
FT   CDS_pept        163406..164314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0140"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterPro IPR001173; KEGG: bac:BamMC406_4102 glycosyl
FT                   transferase family protein; PFAM: glycosyl transferase
FT                   family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74354"
FT                   /db_xref="GOA:E1SW54"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW54"
FT                   /protein_id="ADN74354.1"
FT                   /translation="MRIQDQLTIYIFSFNRGRFLSNAIDSCLRYAPGVPVHVIDDNSDD
FT                   PDTLAVLNNLPEGVSWVKPQARGDDRHGGLYNNMQQALDSVTSEWILFIQDDMQLVRPL
FT                   EQDDAQYIADFFQQFPEKGFLNPVFLKGQRHKRDNRITRVFEDFHGYYRHYPEKKNPRG
FT                   ISYADVVIGHAGRLKAKGWQFSASEQTNASQANEMFGGMGFMAHPFVMFLPQVPVYRGK
FT                   KKTAAVALAEKWSGMEPKRFVEQSAEHWAGFKRRPLTELPVAETYLQCVDPKVKTPYQY
FT                   SAVNAYWPLRAWHKLALLLNK"
FT   gene            164363..165220
FT                   /locus_tag="Fbal_0141"
FT   CDS_pept        164363..165220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0141"
FT                   /product="glycosyltransferase"
FT                   /note="KEGG: pmr:PMI3114 glycosyltransferase; SPTR: Q8PYT3
FT                   Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74355"
FT                   /db_xref="GOA:E1SW55"
FT                   /db_xref="InterPro:IPR029465"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW55"
FT                   /protein_id="ADN74355.1"
FT                   /translation="MIFYDFLNRILPGHLGTKLRFYKKLSYPLSLSDPKTFNEKVHWRK
FT                   IYDRNPLFTLCADKLLARDYVKEKIGEEYLIPLLYSGEHIDAETLKGLDGEFVVKANHN
FT                   SGPVHMVQANQPVDFDAIAANINKQLQKPYAVKNGEWWYKPIPRRVLVERLLRGEQGQW
FT                   AEDYKFFVFNRNGESEVVLQMTYGREKGATITFYDEQLEILPFEIHVKNDYVPFVKPKN
FT                   FDKMVELAKKLAEDFDFCRVDFYNVDGAIYFGEMTFAPSGGTAPFKPQEFDRWMGDKWQ
FT                   LPKR"
FT   gene            165324..166235
FT                   /locus_tag="Fbal_0142"
FT   CDS_pept        165324..166235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0142"
FT                   /product="glycosyltransferase"
FT                   /note="KEGG: ilo:IL2533 glycosyltransferase; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74356"
FT                   /db_xref="GOA:E1SW56"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW56"
FT                   /protein_id="ADN74356.1"
FT                   /translation="MTERHASEFTLGEKIVEASLRLAASGGIPGRWFNKALPEQSALTP
FT                   AEAPLTLEIVSHCWKYSEFQLYQLSSLVNYPPTALQVVHTVFYSEEDEDTVRLLDFFRT
FT                   MSVENVRWNFQPMAKEELFRRAIGRNRAAKATEADWVWFTDCDVVFHEGALDALAKQLE
FT                   GRQDYLVYPQQMLATELLSKDDPLILEAKRHPRLMELDLTRFSVRKFSRATGPIQIAHG
FT                   DVARACGYCPDLKVYQKPMPRWSKCYEDRAFRWLLGTQGTPIEVPNVLFIRHAEKGRYQ
FT                   QGSQLSLLRKTIRRIKSALIGR"
FT   gene            166332..167348
FT                   /locus_tag="Fbal_0143"
FT   CDS_pept        166332..167348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0143"
FT                   /product="CDP-glycerol:poly(glycerophosphate)glycerophosph
FT                   otransferase"
FT                   /note="COGs: COG1887 Putative glycosyl/glycerophosphate
FT                   transferase involved in teichoic acid biosynthesis
FT                   TagF/TagB/EpsJ/RodC; InterPro IPR007554; KEGG: cps:CPS_4206
FT                   CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase family protein; PFAM:
FT                   CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; SPTR: A2V3K3
FT                   CDP-glycerol:poly(Glycerophosphate)
FT                   glycerophosphotransferase; PFAM:
FT                   CDP-Glycerol:Poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74357"
FT                   /db_xref="GOA:E1SW57"
FT                   /db_xref="InterPro:IPR016886"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW57"
FT                   /protein_id="ADN74357.1"
FT                   /translation="MHRYLFYIEQPYSFSILRPLQAKIREQGGEVRWFLKGDKVQHSGL
FT                   ADDETALMSVAEVQAYQPRAVFVPGNVVPDFFPGVKVQVFHGLEWKKKGHFRIRGFFDL
FT                   YCTHGPITTDRFRKLGQQHGDYFEVIETGWPKMDPYLGQQSHQRTDPPTVIYAPTFSPA
FT                   LTSVPDLFPQIKSLSEQGTFRFVVKFHPKMDPEWVARYRAIEGPFLQVSNEADLLKVFG
FT                   EGDVVLSDTSSAVTEALMLGKVVVTYKNSQPQPCLLDFADPTQLASQLTQGLAPSAALN
FT                   AEIEQYLGQVHPQLDGGASERVLVAVEQVVAQGVRPKPWNLLRKWKIRRALGYYHWR"
FT   gene            167392..167790
FT                   /locus_tag="Fbal_0144"
FT   CDS_pept        167392..167790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0144"
FT                   /product="Glycerol-3-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.39"
FT                   /note="COGs: COG0615 Cytidylyltransferase; InterPro
FT                   IPR004820: IPR004821; KEGG: slo:Shew_3695
FT                   cytidyltransferase-like protein; PFAM:
FT                   cytidylyltransferase; SPTR: A0XZ77 Glycerol-3-phosphate
FT                   cytidyltransferase; TIGRFAM: cytidyltransferase-related
FT                   domain protein; PFAM: Cytidylyltransferase; TIGRFAM:
FT                   glycerol-3-phosphate cytidylyltransferase;
FT                   cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74358"
FT                   /db_xref="GOA:E1SW58"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW58"
FT                   /protein_id="ADN74358.1"
FT                   /translation="MRIITFGTFDMFHVGHLNILERARSMGDSLVVGVSSDALNFAKKG
FT                   RYPICNQDDRMRILAALACVDKVFVEESLEQKAEYIQRYGADCLVMGDDWSGKFDHLNT
FT                   LCQVQYLPRTPAISTTELIEVVRSAPPR"
FT   gene            complement(167787..168896)
FT                   /locus_tag="Fbal_0145"
FT   CDS_pept        complement(167787..168896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0145"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: maq:Maqu_0791 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A3JEJ2
FT                   Putative capsular polysaccharide biosynthesis protein;
FT                   PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74359"
FT                   /db_xref="GOA:E1SW59"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW59"
FT                   /protein_id="ADN74359.1"
FT                   /translation="MTPVRVLVIEREYRSNINPIRPEAAQIAALHQTGQVRVTVMCNPG
FT                   SILEDYYRERGIEVIPQPLERKLSLSAIRHIRRVIRSHRIQLLHLFSNTPVSNGATAAI
FT                   GLPVKVIAYRGQTGNIRRFDPSSYLSMLHPRIDKIICVAKAVEQDLARHVRQPEKRLAT
FT                   VYKGHDPSWYQNPPADLSALNLPEGAFTVSLVANLRPRKGLQVLMDATHIWPAGHNIHL
FT                   LLVGAEPDNPKIQQMIANSGCPNQIHPLGWRNDAPEVAAASDLTVLPTLKREGLCRAVL
FT                   EANSYGTPAVMSDTGGNAELVADGETGLIVPPGDARALAEAIYRLYQDPALTARFGAAA
FT                   KQRIIDKFNVEQGVEATLAIYKALAAELA"
FT   gene            complement(169010..170011)
FT                   /locus_tag="Fbal_0146"
FT   CDS_pept        complement(169010..170011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0146"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /EC_number="5.1.3.12"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR008089: IPR013120: IPR002225:
FT                   IPR003869: IPR 002198: IPR005913: IPR001509; KEGG:
FT                   kpn:KPN_02492 uridine diphosphate galacturonate
FT                   4-epimerase; PFAM: NAD-dependent epimerase/dehydratase;
FT                   3-beta hydroxysteroid dehydrogenase/isomerase; Male
FT                   sterility domain; polysaccharide biosynthesis protein CapD;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; SPTR: A0ZBU2 Capsular
FT                   polysaccharide biosynthesis protein I; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74360"
FT                   /db_xref="GOA:E1SW60"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW60"
FT                   /protein_id="ADN74360.1"
FT                   /translation="MKILVTGAAGFIGFYVSSRLLEQGHQVVGLDNLNDYYDVSLKEAR
FT                   LAQLTAQDNFEFSRTDLSDREAMAALFQNHQFDRVVHLAAQAGVRYSLDNPMAYVDSNL
FT                   TGMVTILEGCRQTKVPHLVYASSSSVYGMNKKVPFSEADAVDHPISLYAATKKSNELMA
FT                   HTYSHLYGIPTTGLRFFTVYGPWGRPDMAAFKFTKKILAGEPIDVYNYGKLSRDFTYID
FT                   DIVEGVLRVMEAIPSADAERDCDRPDRSTAPYALYNIGNHQPVELLTFIQTLEKALGVE
FT                   ANLNMMPMQPGDVYTTYADTDNLRDAVGFSPDTSLADGLQRFADWYRSFYQI"
FT   gene            complement(170014..171354)
FT                   /locus_tag="Fbal_0147"
FT   CDS_pept        complement(170014..171354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0147"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COGs: COG1004 UDP-glucose 6-dehydrogenase; InterPro
FT                   IPR014027: IPR014026: IPR001732: IPR017476; KEGG:
FT                   avn:Avin_27790 UDP-glucose 6-dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; PRIAM: UDP-glucose
FT                   6-dehydrogenase; SPTR: A3JJ75 Predicted UDP-glucose
FT                   6-dehydrogenase; TIGRFAM: nucleotide sugar dehydrogenase;
FT                   PFAM: UDP-glucose/GDP-mannose dehydrogenase family, NAD
FT                   binding domain; UDP-glucose/GDP-mannose dehydrogenase
FT                   family, central domain; UDP-glucose/GDP-mannose
FT                   dehydrogenase family, UDP binding domain; TIGRFAM:
FT                   nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74361"
FT                   /db_xref="GOA:E1SW61"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW61"
FT                   /protein_id="ADN74361.1"
FT                   /translation="MKVTVFGVGYVGLVQASVLADVGHEVCCVDVDQDKVDRLNQGLIP
FT                   IYEPGLEPMVRHNHDAGRLTFTTDAAAGVHHGKVQFIAVGTPPDEDGSADLQYVLAVAD
FT                   TIARHMDSPKVVVDKSTVPVGTADKVRQRIASVLKERGADVAFQVVSNPEFLKEGAAVA
FT                   DCMRPDRIVIGSDDEVAIEVMRELYEPFNRQQERTVIMDVRSAELTKYAANCMLATKIS
FT                   FMNEMANLAEKLGADIEAVRRGIGSDPRIGYHFIYPGCGYGGSCFPKDVQALIRAADGI
FT                   GHDAKILKAVEQVNDDQKTVLMRNIRRHFGDDLKGRTIALWGLAFKPNTDDMREAPSRV
FT                   LLAALWEAGARVQAYDPEAMEETQRIFGHRDNLVLMGTKEAALKGADALVICTEWQAFR
FT                   APDFDFIQQELRQPVIFDGRNLYDPERLAKRGFHYYGIGRGLSITQE"
FT   sig_peptide     complement(171295..171354)
FT                   /locus_tag="Fbal_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(171426..172478)
FT                   /locus_tag="Fbal_0148"
FT   CDS_pept        complement(171426..172478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0148"
FT                   /product="glycosyl transferase family 9"
FT                   /note="COGs: COG0859 ADP-heptose:LPS heptosyltransferase;
FT                   InterPro IPR002201; KEGG: saz:Sama_0102 glycosyl
FT                   transferase family protein; PFAM: glycosyl transferase
FT                   family 9; SPTR: A2V3L1 Glycosyl transferase, family 9;
FT                   PFAM: Glycosyltransferase family 9 (heptosyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74362"
FT                   /db_xref="GOA:E1SW62"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW62"
FT                   /protein_id="ADN74362.1"
FT                   /translation="MPQLPTLPESPRSIVVLRLSAIGDVCHAVAAVQAIQRRHPDAELT
FT                   WVVGKVEASLLAGLPGVELVPFDKSKGVQGYRELWQRLRGRQFDVLLHMQVALRASVAS
FT                   LGIRAKVKLGFDKSRAKEGQWLFTNQRIAAQHEPHVLEGFMGFARHLGVTDTQPRWQIP
FT                   VGEDDQAFALTQIPDDRPTAIICASASKAERNWLPERYAEVADQLVTQGYQVLLCGGPA
FT                   QHEHELARAIEAQARQPLLNLVGQTSLKSLLALLRRAKVVLAPDTGPAHMAVTQGTPVV
FT                   ALMAHSNPSRTGPYGQGDTTVSCYQQHVENQQGKPLSQLRWGTRAKGPELMASIDTASV
FT                   MAAINRALSR"
FT   gene            172548..173279
FT                   /locus_tag="Fbal_0149"
FT   CDS_pept        172548..173279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0149"
FT                   /product="Mn2+dependent serine/threonine protein kinase"
FT                   /note="InterPro IPR002575: IPR010440; KEGG: swd:Swoo_0068
FT                   3-deoxy-D-manno-octulosonic-acid kinase; PFAM:
FT                   lipopolysaccharide kinase; aminoglycoside
FT                   phosphotransferase; SPTR: A0XXW1 Putative
FT                   lipopolysaccharide kinase family protein; PFAM:
FT                   Lipopolysaccharide kinase (Kdo/WaaP) family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74363"
FT                   /db_xref="GOA:E1SW63"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW63"
FT                   /protein_id="ADN74363.1"
FT                   /translation="MKILNFPPHRVYLAEAAPATLDANWFEPAWLREQGWVTGSSDSSG
FT                   RNPAWFFQQDDRRYVLRHYWRGGLPGKLFKDGYLYLGEQRSRPWQELSLMVALKAKGLP
FT                   VATPVAARLTRTGLNYRADLLTEMLPQSQDMVKHLSGGAMAAARWQALGAVLARFHREG
FT                   VYHADLNARNILLSQGEFFLIDFDRGELRNPATDWQQANLARLRRSLLKEQGRVAGLHY
FT                   DDAADWAALMAGYNSELASAS"
FT   gene            complement(173249..174508)
FT                   /locus_tag="Fbal_0150"
FT   CDS_pept        complement(173249..174508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0150"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="COGs: COG1519 3-deoxy-D-manno-octulosonic-acid
FT                   transferase; InterPro IPR001296: IPR007507; KEGG:
FT                   sbl:Sbal_0060 3-deoxy-D-manno-octulosonic-acid transferase
FT                   domain-containing protein; PFAM:
FT                   Three-deoxy-D-manno-octulosonic-acid transferase domain
FT                   protein; glycosyl transferase group 1; SPTR: A2V3L3
FT                   Three-deoxy-D-manno-octulosonic-acid transferase-like;
FT                   PFAM: Glycosyl transferases group 1;
FT                   3-Deoxy-D-manno-octulosonic-acid transferase
FT                   (kdotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74364"
FT                   /db_xref="GOA:E1SW64"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW64"
FT                   /protein_id="ADN74364.1"
FT                   /translation="MNRLFYSLVLTLLLPVVLAYLLWRSRKAPAYRQRWGERLGLTLPK
FT                   VNDAIVVHCASMGETLAAVPLIEALRARYPDKPVLVTSFTPSGSEQVKQRFGDSVAHAY
FT                   LPLDLPFITRRFIRRVRPAMVVLMETELWPNLIHQCHRQRVPVMLSNARMSERSARGYA
FT                   RFPRLTRPMLGELDAVAAQSAEDGARLVTLGLDPAKLTICGSLKFDLDLSRANLADLRQ
FT                   AREQGFGQRKIWCAGSTHPGEFEQALSAHRALLRLHPDLLLLLVPRHPEQFDHAEALAQ
FT                   QAGFVTARRTGGDSVEESVQVVIGDTMGELLTLYGLADAAFVGGSLIERGGHNPLEPAA
FT                   LGKPVLMGPHFFNFQEIGQALLQAGGMTLVNNADELADQLEHLLSLRKQAEQMGHQGQR
FT                   VVDTNRGATERQLALASSLL"
FT   sig_peptide     complement(174452..174508)
FT                   /locus_tag="Fbal_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            174670..175305
FT                   /locus_tag="Fbal_0151"
FT   CDS_pept        174670..175305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0151"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: slo:Shew_3708 TetR family
FT                   transcriptional regulator; PFAM: regulatory protein TetR;
FT                   SPTR: A2V3L4 Transcriptional regulator, TetR family; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74365"
FT                   /db_xref="GOA:E1SW65"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW65"
FT                   /protein_id="ADN74365.1"
FT                   /translation="MKTKDRIIEASCELFNEHGERAVTTNHIAAHLGISPGNLYYHFRN
FT                   KEQIIRALFAQYEAYLEEAYGPSDDETAFGVMKRYLDGMFEGMWRFRFLYASLPEILAR
FT                   DPELHKRYLQAHHRVLETATNNLRMLKAQGMMVIDDAYLDEFAEGIKMVVTFWISHLYT
FT                   QALDKPITEQGVSQGVLQILAMFHGYIAEPARADFERLVAHYRALAHG"
FT   gene            175430..176626
FT                   /locus_tag="Fbal_0152"
FT   CDS_pept        175430..176626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0152"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="COGs: COG0156 7-keto-8-aminopelargonate synthetase;
FT                   InterPro IPR001085: IPR005814: IPR004839: IPR000192: IPR
FT                   001917: IPR011282; KEGG: saz:Sama_0098
FT                   2-amino-3-ketobutyrate coenzyme A ligase; PFAM:
FT                   aminotransferase class I and II; aminotransferase
FT                   class-III; glycine hydroxymethyltransferase;
FT                   aminotransferase class V; PRIAM: Glycine
FT                   C-acetyltransferase; SPTR: A2V3L5 2-amino-3-ketobutyrate
FT                   coenzyme A ligase; TIGRFAM: 2-amino-3-ketobutyrate coenzyme
FT                   A ligase; PFAM: Aminotransferase class I and II; TIGRFAM:
FT                   8-amino-7-oxononanoate synthase; 2-amino-3-ketobutyrate
FT                   coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74366"
FT                   /db_xref="GOA:E1SW66"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW66"
FT                   /protein_id="ADN74366.1"
FT                   /translation="MSTSAFYQQIRDQLEQVKADGLYKNERVITTAQQAAIEVASGEQV
FT                   INFCANNYLGLANHPALIEAAKAGLDDHGFGMASVRFICGTQDIHKVLEQKLSEFLGME
FT                   DTILYSSCFDANAGLFETLLGPEDAIVSDALNHASIIDGVRLCKAKRFRYANNDMAELE
FT                   SCLQQAREAGARNILIATDGVFSMDGVIAKLQAVCDLAEKYGALVMVDDSHAVGFVGEG
FT                   GRGTHEYCQVMDRVDIITGTLGKALGGASGGFTSGKKEVIDWLRQRSRPYLFSNSLAPA
FT                   IVSASIQVLDMMKEGDALRAQLWQNAAYFREQMSAAGFTLAGADHAIIPVMIGDAALAS
FT                   EFADRLLKEGIYVIGFSFPVVPKGQARIRTQMSAAHTREQLDKAIEAFTRIAKELGII"
FT   gene            176635..177663
FT                   /locus_tag="Fbal_0153"
FT   CDS_pept        176635..177663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0153"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="COGs: COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenase; InterPro IPR013154: IPR013149:
FT                   IPR002328: IPR004627; KEGG: shl:Shal_4216 L-threonine
FT                   3-dehydrogenase; PFAM: Alcohol dehydrogenase GroES domain
FT                   protein; Alcohol dehydrogenase zinc-binding domain protein;
FT                   SPTR: B0TNM4 L-threonine 3-dehydrogenase; TIGRFAM:
FT                   L-threonine 3-dehydrogenase; PFAM: Alcohol dehydrogenase
FT                   GroES-like domain; Zinc-binding dehydrogenase; TIGRFAM:
FT                   L-threonine 3-dehydrogenase; 2-desacetyl-2-hydroxyethyl
FT                   bacteriochlorophyllide A dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74367"
FT                   /db_xref="GOA:E1SW67"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW67"
FT                   /protein_id="ADN74367.1"
FT                   /translation="MMKALSKLHPEKGIWMVDVPKPELGHNDLLIKIKKTAICGTDMHI
FT                   YNWDEWSQKTIPVPMVVGHEYVGEVVAIGQEVRGFAVGDRVSGEGHITCGHCRNCRGGR
FT                   THLCRNTTGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL
FT                   VGEDVLITGAGPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGATRAVNVMNEKLE
FT                   DVMAELGMTEGFDVGLEMSGVPSAFNSMLSTMNHGGKIAMLGIPPSSMGVDWNQVIFKG
FT                   LVIKGIYGREMFETWYKMASLLQSGLDISPIITHRFPIDEFQQGFDVMGSGQSGKVILS
FT                   WD"
FT   gene            177809..178069
FT                   /locus_tag="Fbal_0154"
FT   CDS_pept        177809..178069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74368"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW68"
FT                   /protein_id="ADN74368.1"
FT                   /translation="MRRSLAMLLLLLSLPLCGLRVVECHVALPSERGISIETNTPETLT
FT                   APPFFLPSLTQPALTPRYPGLPLPTYLEPLPRAHFRPPIVA"
FT   sig_peptide     177809..177862
FT                   /locus_tag="Fbal_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            178132..178545
FT                   /locus_tag="Fbal_0155"
FT   CDS_pept        178132..178545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0214 hypothetical protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2057)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74369"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW69"
FT                   /protein_id="ADN74369.1"
FT                   /translation="MNKSLVMMGLVALMMAPAGAAATLTLAEGLLPTAIDGVPLLGDEQ
FT                   QLEMAGGERVLSLRYHHVFADPFAPTAVSSPVWLMKLNLPQEGRFQLAVEAPERVSDWP
FT                   QFIRMPRLFLVDELGQRTALEARTVEQWMATLL"
FT   sig_peptide     178132..178191
FT                   /locus_tag="Fbal_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            178641..178958
FT                   /locus_tag="Fbal_0156"
FT   CDS_pept        178641..178958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0156"
FT                   /product="Thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="COGs: COG0607 Rhodanese-related sulfurtransferase;
FT                   InterPro IPR001763: IPR001307; KEGG: shw:Sputw3181_0048
FT                   rhodanese domain-containing protein; PFAM: Rhodanese domain
FT                   protein; PRIAM: Thiosulfate sulfurtransferase; SMART:
FT                   Rhodanese domain protein; SPTR: A2V3L7 Rhodanese-like;
FT                   PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74370"
FT                   /db_xref="GOA:E1SKX6"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKX6"
FT                   /protein_id="ADN74370.1"
FT                   /translation="MSQYQCLPLPQFDALLAERPAQIVDIRDPNAFAAGHIPGAQHLHN
FT                   GNLAEFILNAEFDEPLVVCCYHGISSQSAAAYLAEQGFEEVYSLDGGYEGYAKAKGLMA
FT                   P"
FT   gene            178955..179776
FT                   /locus_tag="Fbal_0157"
FT   CDS_pept        178955..179776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0157"
FT                   /product="Rhomboid family protein"
FT                   /note="COGs: COG0705 membrane protein; InterPro IPR002610;
FT                   KEGG: slo:Shew_3712 rhomboid family protein; PFAM: Rhomboid
FT                   family protein; SPTR: A2V3L8 Rhomboid-like protein; PFAM:
FT                   Protein of unknown function (DUF3582); Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74371"
FT                   /db_xref="GOA:E1SKX7"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKX7"
FT                   /protein_id="ADN74371.1"
FT                   /translation="MTEVGVLGDPRAAQALVDYLRSQGIEARLLAAEDGYAVMVEDAQH
FT                   HRGREEFERFVADPHNKRYLAASWQSGDAKVQFQYGGGGSLWRSFLSGAGPLTLSLLVV
FT                   VSAIWVFWILGFDQLIFSWTHFFPSWDAMGEGQWWRLFTPSLIHFSAMHVIFNLLWWWY
FT                   LGGRIERVRGTGTLLILLLVAGTLPNLAQFAFSGPNFGGLSGVVYALVGYCWISGRLDP
FT                   RSPLALPPAYVGFLLLWLVMGFAGFMNMANAAHLGGLLVGMAQAVFDRRRQ"
FT   gene            complement(179812..180201)
FT                   /locus_tag="Fbal_0158"
FT   CDS_pept        complement(179812..180201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0158"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="COGs: COG1580 Flagellar basal body-associated
FT                   protein; InterPro IPR005503; KEGG: shn:Shewana3_0126
FT                   flagellar basal body-associated protein FliL-like protein;
FT                   PFAM: flagellar basal body-associated protein FliL; SPTR:
FT                   A2UXU5 Flagellar basal body-associated protein FliL; PFAM:
FT                   Flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74372"
FT                   /db_xref="GOA:E1SKX8"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKX8"
FT                   /protein_id="ADN74372.1"
FT                   /translation="MLAALLGAGSAVAAQEGGEIAHDNYGYYGLEPEIVTNYVSPRKRL
FT                   GYVRVSVELMLKDADTVEMVEHHAPLIRATIVEILGQQPEEKIKSLSGREEIRRDCFET
FT                   VNNLLAKEVGQPLVANLLFTRYLYD"
FT   gene            180348..180881
FT                   /locus_tag="Fbal_0159"
FT   CDS_pept        180348..180881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0159"
FT                   /product="Chorismate lyase"
FT                   /note="COGs: COG3161 4-hydroxybenzoate synthetase
FT                   (chorismate lyase); InterPro IPR007440; KEGG: sdn:Sden_0095
FT                   chorismate lyase; PFAM: Chorismate lyase; SPTR: Q12T34
FT                   Probable chorismate--pyruvate lyase; PFAM: Chorismate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74373"
FT                   /db_xref="GOA:E1SKX9"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKX9"
FT                   /protein_id="ADN74373.1"
FT                   /translation="MQALIAAMEQPLPPALASWLQDRNSLTLRLKTQCRQFDVQRLAEG
FT                   RELALDSGPGWQVGDPLWQREVLLLLDGVPWVYALTEVPLATLAAGDIDFPSLGERPLG
FT                   ELLFTNDRLSRGELHLTRHDHKSRAGRVALELGQNFSEPLWGRSRQFTLSGRPLRVNEI
FT                   FLPAAEQALKAGLD"
FT   gene            181023..181451
FT                   /locus_tag="Fbal_0160"
FT   CDS_pept        181023..181451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0285 hypothetical protein; SPTR:
FT                   A2UXS0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74374"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY0"
FT                   /protein_id="ADN74374.1"
FT                   /translation="MDMKLSPMRLFSTLMLVVALISQGAVARVHLMPDMSPAEMSAMHA
FT                   HHEMAASTSQHDGMAHCKAQSVATHDCCESMAQPDDCHDANAPCNGECGMCKVFSPAGV
FT                   ALLTTALQPWQPSPERALPQPKFFHSVALSQDSKPPIA"
FT   sig_peptide     181023..181103
FT                   /locus_tag="Fbal_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            181581..182132
FT                   /locus_tag="Fbal_0161"
FT   CDS_pept        181581..182132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0161"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR007087; KEGG: sse:Ssed_0212 hypothetical
FT                   protein; SPTR: A3T2Y6 Copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74375"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY1"
FT                   /protein_id="ADN74375.1"
FT                   /translation="MTKLYSRAVAVFALALSLTLSPLALANMGHHGDHAAHQAQEAQHC
FT                   PHGKQDGERKGCCGQAKGESCPHAGKGHAAHQGDTHACPMHPKVTGVAGDDCPKCGMKL
FT                   EQVAQADTHVCPMHPKVTGVAGDDCPKCGMKLEQMAQADTHVCPMHPKVTGVAGDDCPK
FT                   CGMKLEPKRGQGGHGHHAHH"
FT   sig_peptide     181581..181658
FT                   /locus_tag="Fbal_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            182150..183895
FT                   /locus_tag="Fbal_0162"
FT   CDS_pept        182150..183895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0162"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COGs: COG0845 Membrane-fusion protein; InterPro
FT                   IPR006143; KEGG: spl:Spea_3988 RND family efflux
FT                   transporter MFP subunit; SPTR: A2UXS2 Efflux transporter,
FT                   RND family, MFP subunit; TIGRFAM: efflux transporter, RND
FT                   family, MFP subunit; TIGRFAM: RND family efflux
FT                   transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74376"
FT                   /db_xref="GOA:E1SKY2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY2"
FT                   /protein_id="ADN74376.1"
FT                   /translation="MCNKCSCGGQDRQTKRKTQVATAIVIALALTPVIWTLAQAAPGQA
FT                   PQVTQSAAEHAAHTHACPMHPEQTGVEGDRCPICNMFLTEVEGEGHADHGAVTHTHACP
FT                   MHPQETGVEGDRCPICNMFLTEVEGDHADHGAATHTHACPMHPEETGVEGDRCPICNMF
FT                   LTEMEEEEQVDPHAGHTMQLDPLPSAPALEQAVSGGEATIKYVCPMHPQIVSDEPGTCP
FT                   ICGMNLEKVEMGAASEEVVVGVSGGLQQALGVRTETVERGTLWRYIKTLGTVQYNEDAI
FT                   SHIHTRVTGWVEKLAVNSVGQQVAQGQLLYELYSPELVNAQDDYLQALDYLGQDPVRGK
FT                   ELLRKAKLRLELLGISDKVIQRLEKTRQSLYRVPFYAPHSGVVSTMDIRDGMYIEPGKT
FT                   QIELVDLSTVWVIADVFENEQSWLEVGRPADVTAAAQGLFEIEGEIDYIYPELDPVTRS
FT                   LQVRVKLPNPENRPGGQLRPGSLVDVELYGGPRRGLLTVPAEALILTGRENRVVVQRAD
FT                   NSFASVPVRLGMMSQGKAEILEGLNEGDRVVVSGQFLIDSEASIQGSLRRMSQPAADAH
FT                   SGHQH"
FT   sig_peptide     182150..182269
FT                   /locus_tag="Fbal_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            183908..187054
FT                   /locus_tag="Fbal_0163"
FT   CDS_pept        183908..187054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0163"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="COGs: COG3696 Putative silver efflux pump; InterPro
FT                   IPR001036: IPR017871: IPR004763; KEGG: spl:Spea_3989 CzcA
FT                   family heavy metal efflux protein; PFAM: acriflavin
FT                   resistance protein; SPTR: A2UXS3 Heavy metal efflux pump,
FT                   CzcA family; TIGRFAM: heavy metal efflux pump, CzcA family;
FT                   PFAM: AcrB/AcrD/AcrF family; TIGRFAM: heavy metal efflux
FT                   pump (cobalt-zinc-cadmium)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74377"
FT                   /db_xref="GOA:E1SKY3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY3"
FT                   /protein_id="ADN74377.1"
FT                   /translation="MLEKIISASLRQRAMVLVITAVLAIYGWQAMRTTPLDALPDLSDV
FT                   QVIIKTAYPGQAPQLVEDQITYPLSTAMLAVPGAQTVRGFSMFGDSFVYVIFEDGTDIY
FT                   WARSRVLEYLSQIQGQLPPGVTPSLGPDASGVGWVFQYALVDRTGHQDLAQLRSLQDWF
FT                   IKLELQSVAGVSEVATVGGMEKAYQIVVDPHKLALYQLDLMAVKQALDNANASVGGSVI
FT                   EMAEAEYMITASGYRQTLQDFEEIPLGIVSESGTPVLMKDVAQLRTGPAARRGIAELDG
FT                   QGEVVGGIVVMRYGENALATIDNVKAKLAEIESGLPEGVELVITYDRSQLILNAVDNLK
FT                   NKVIEEMVVVALVCLVFLLHARSTLVAVITLPLSILASFIVMGWMGVNANIMSLGGIAI
FT                   AIGAVVDAAIVMVENAHKHLEHYREEHGKAPEGDAHWQLIKEAAVEVGPALFFSLLIIT
FT                   LSFIPVFALEAQEGRLFHPLAYTKTFAMAASAILAITLIPVLMGYFVRGKIPDEQKNPI
FT                   SRFLIALYQPVLKLVLRFPKVTLMLAVVALASAYYPMSKMGSEFMPELEEGDLLYMPTT
FT                   LPGVSAGKAGEILQQTDRLIKTIPEVARVFGKVGRADTATDPAPLTMLETTIMLKPRSE
FT                   WREGQTMEGIIADLQRTVKVPGITNAWVQPIKTRIDMLSTGVRTPVGVKISGADVEELQ
FT                   RIGAEVEAILAPLPGTTSAFAQRTGGGRYLDIDPKLTVAARYGMTLRDVQDVVQMAIGG
FT                   MTMGESIQGQERYPINIRYPRELRDDIEKLRNLPVLTKTGKYVPLQTLADLSIRDGAPM
FT                   LASENGRLISWVFVDIDSSVLSIGEYITQAREAMNQQLQLPPRYSVSFAGQYEYMQRVE
FT                   AKMEMVIPMMLAVIFLLLMMTFGSVVQASIIMLSLPFALVGSAWLLFGLGYNLSVAVAV
FT                   GMIALAGVAAEFGVVMQVYLNNTIKAHEKKGLMRHEQDLKDALIEGAVMRIRPKAMTVA
FT                   TIFFGLLPIMWGSGTGNEVMQKIAAPMVGGMVTAPLLSLFVIPAIYLLIYRRGLAKADA
FT                   "
FT   gene            187179..187601
FT                   /locus_tag="Fbal_0164"
FT   CDS_pept        187179..187601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0164"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR000551: IPR015358; KEGG: sse:Ssed_1484 MerR
FT                   family transcriptional regulator; PFAM: Transcription
FT                   regulator MerR DNA binding; regulatory protein MerR; SMART:
FT                   regulatory protein MerR; SPTR: A3TUU1 Transcriptional
FT                   regulator; PFAM: MerR family regulatory protein; MerR, DNA
FT                   binding; TIGRFAM: Cu(I)-responsive transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74378"
FT                   /db_xref="GOA:E1SKY4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY4"
FT                   /protein_id="ADN74378.1"
FT                   /translation="MKIGQVARETGLSVKAIRYYHDIGLVVAQRGDNGYRAYSAAQLEQ
FT                   LRFVARSKALGFSLEQCAELLSLQSRSDRTAAQVKALAVDQLALVREKIAQLQALEARL
FT                   NGLVNQCQGGNTPECPILDSLCGESGKTANAPCCKE"
FT   gene            187605..188210
FT                   /locus_tag="Fbal_0165"
FT   CDS_pept        187605..188210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_4292 hypothetical protein; SPTR:
FT                   A3IDJ3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74379"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY5"
FT                   /protein_id="ADN74379.1"
FT                   /translation="MKKLTLTALLVLGLSACGQSETAKQAEAFSALDHKAAVLQGHQWY
FT                   KNNDGIVVRVHPDRVNATFSDGTEADVAIPNGEFYLSIAPWATFTHPCGNHVPTGCTGE
FT                   LIGQPMHVSAVDVDSGEEVINKMITTQHDGFIDFWVPAQRQLAFTFHFDHPKYGMLEAK
FT                   EVLPTFEDSRTCITTMQLKPMDGGAIEAPGQGGHSGHH"
FT   sig_peptide     187605..187673
FT                   /locus_tag="Fbal_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            188379..189362
FT                   /locus_tag="Fbal_0166"
FT   CDS_pept        188379..189362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3086 hypothetical protein; SPTR:
FT                   A0Y618 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74380"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY6"
FT                   /protein_id="ADN74380.1"
FT                   /translation="MGGRMKRAMWLMAVLLAGCGGGDGDSPAPSPEPTPAEGLSIGLSD
FT                   APADGVSHLILQMHSLELTPGGHMGGHHGGGDPIVLDMSHHRVDMLAYQGDDAYPLLHQ
FT                   HQLEPGRYQLRLHWTPGTGDHGSYVDDGEGRHPLHGDHPYFDLGEVTIHEGLHHNFTLE
FT                   MDLRQGLHHNGEHYALEHHGMRWVDNDTMGHLKGTVDASWIADCEADNASLAGPDSQFV
FT                   HAAYLYPDGTTLAQMDDIAPAAADGQVAPLATSWVHQDHNGDWVFGVGFLPAGRYQVGY
FT                   TCLGHLDQPDSNEAADGDFALYRDGGVVIIESGEGGGHHNTHRCGG"
FT   sig_peptide     188379..188450
FT                   /locus_tag="Fbal_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            190016..190510
FT                   /locus_tag="Fbal_0167"
FT   CDS_pept        190016..190510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74381"
FT                   /db_xref="GOA:E1SKY7"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY7"
FT                   /protein_id="ADN74381.1"
FT                   /translation="MQVMAKYLQNVQSRMVISLVMARVLGLMLLALSAMELYRSLGDGD
FT                   VALALMAFTQLYHLTLGLMLLTLAIRLVKQVGQMRLFSVACRQMMVMLARLGLLAAFLV
FT                   KPCGLIVISAVQPELAMDITFLKFVMLVDWPVVVLAGLLHLMAGLQKLGSEMNAEQELT
FT                   I"
FT   gene            190510..190734
FT                   /locus_tag="Fbal_0168"
FT   CDS_pept        190510..190734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0168"
FT                   /product="transcriptional regulator"
FT                   /note="COGs: COG3655 transcriptional regulator protein;
FT                   InterPro IPR001387; KEGG: swp:swp_4005 helix-turn-helix
FT                   motif protein; PFAM: helix-turn-helix domain protein;
FT                   SMART: helix-turn-helix domain protein; SPTR: A3I7K2 YozG;
FT                   PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74382"
FT                   /db_xref="GOA:E1SKY8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY8"
FT                   /protein_id="ADN74382.1"
FT                   /translation="MPIVIHLDVMLAKRKMKLNELAAQIGITPQNLSVLKAGRAKAIRF
FT                   STLEAICDALGCQPGDILEFEQGEEDGTD"
FT   gene            190721..191242
FT                   /locus_tag="Fbal_0169"
FT   CDS_pept        190721..191242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_2025 choline/carnitine/betaine
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74383"
FT                   /db_xref="GOA:E1SKY9"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY9"
FT                   /protein_id="ADN74383.1"
FT                   /translation="MGPIEIQREIAGHDVKVEVSMWSGRERVLIDGEEVSNTLSWRFTT
FT                   LHQLVLDGRPFEVEVSIQNLWDGRLGVVFRLDGETVGVTRWALSSEASEESDEETNWLA
FT                   DWRLPGWLSALFWLPYLGLIVADMVATFTDQEALLGTVIPPALLLLGALGVALSLTTWI
FT                   RGMTLPTGPN"
FT   gene            complement(191239..192189)
FT                   /locus_tag="Fbal_0170"
FT   CDS_pept        complement(191239..192189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0170"
FT                   /product="ferredoxin"
FT                   /note="COGs: COG2871 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase subunit NqrF; InterPro IPR001041: IPR005625;
FT                   KEGG: sse:Ssed_2277 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase, subunit NqrF; PFAM: ferredoxin;
FT                   PepSY-associated TM helix domain protein; SPTR: A3WJN9
FT                   Na+-transporting NADH:ubiquinone oxidoreductase, subunit
FT                   NqrF; PFAM: 2Fe-2S iron-sulfur cluster binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74384"
FT                   /db_xref="GOA:E1SKZ0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ0"
FT                   /protein_id="ADN74384.1"
FT                   /translation="MMRWHKWAALAVGLQMMVWIGTGLYFNLVDHQRIGGHQYHQQAAE
FT                   PTWSLTQLVDPTPLLEQYAPVIRLTLVDRAGHPYYQLEHQRQLYRRQAQTLTLVDAIRG
FT                   DAVTVDRAMASAVARASYRGPGAVSEITALPPHSAELPKEENPAWRVAFADDLATVVFV
FT                   EARSGRLIGHQNRHSREAALMLKLHFMDYANTGGFNHPLMWTFALFSLALSLSGLTLLI
FT                   RRLGSNLSHWRARRVTLHTPAGAQKLRLAPRQSVLEGMQREGLAVRSECGGGGSCGRCR
FT                   IRLEPGSPISAAEQRFLSQRHLEQGWRLACQQYGD"
FT   gene            complement(192186..192887)
FT                   /locus_tag="Fbal_0171"
FT   CDS_pept        complement(192186..192887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swd:Swoo_2335 hypothetical protein; SPTR:
FT                   A3WJP0 Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74385"
FT                   /db_xref="GOA:E1SKZ1"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ1"
FT                   /protein_id="ADN74385.1"
FT                   /translation="MTRSLSPIIQTRRWHRLLMWVIGLQMVIWAISGSYFALMNIHFIH
FT                   GDHLVTPPARALSAESYRVPFNDLRARYPDATGFSLTRIAEQPVIQMTIQGQLRLLDPQ
FT                   TGALLPPVSESLAKRIGQQAYQGSGTLSAAPLLTDTAPSELSPRHLPAWRLDYDDWGQT
FT                   SLYISQLSGELVTKRHRYWRWFDQLWYLHILDYDDGEDLNNLLLRTAACLALAGTLSGA
FT                   LLLWFRLRRRS"
FT   gene            complement(192998..193426)
FT                   /locus_tag="Fbal_0172"
FT   CDS_pept        complement(192998..193426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0214 hypothetical protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2057)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74386"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ2"
FT                   /protein_id="ADN74386.1"
FT                   /translation="MKTLTAIAATLTLFASLSQAAEIQLDRNLTLLSHNGEAHTQYGGE
FT                   LDLAAGKQVLELRYNAIFQLSAEDHESVLSPAFYLVFDASDEGQYQLSWPEVNTLSDAK
FT                   KRAAEPVVTLSNAEGDAIPFELQSHDQLIYQLLLSQTR"
FT   sig_peptide     complement(193367..193426)
FT                   /locus_tag="Fbal_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(193943..196348)
FT                   /locus_tag="Fbal_0173"
FT   CDS_pept        complement(193943..196348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0173"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="COGs: COG2217 Cation transport ATPase; InterPro
FT                   IPR000695: IPR001757: IPR006121: IPR008250: IPR 005834:
FT                   IPR018303: IPR017969: IPR006416: IPR006403; KEGG:
FT                   abo:ABO_2353 Cu(I)-exporting ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: Q8Z8S4 Copper-exporting
FT                   P-type ATPase A; TIGRFAM: copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC; PFAM:
FT                   E1-E2 ATPase; Heavy-metal-associated domain; haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: copper-(or
FT                   silver)-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74387"
FT                   /db_xref="GOA:E1SKZ3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ3"
FT                   /protein_id="ADN74387.1"
FT                   /translation="MTTQLRIEGARCASCVSKIEAALTPIAGVSGVQVNLADQSVEVTG
FT                   EAEPAHLIRALDAIGYPAQLQVENRETIAVPGMRCAGCVSKIEGALRALPGMAQVQVNL
FT                   AEKTVLLTGHYDLANALEALASIGYPGELQETDPTEADAEHLTGFRQQMMQSALALTLG
FT                   LLMMVWGWVDGMTVESWTDQWLWGSAGALTLVMMIYAGGHYFRGAWQALKHGSATMDTL
FT                   IALGTGTAWLFSMGVVLMPEAFPAASRHLYFEASAMIIGLINLGQALEHRAKSKTNTAL
FT                   RQLMALRPKTARVIRDGEEQDIPIRLVQAGDQLRLRPGEQVPVDGVVLEGRSLVDESML
FT                   TGEPMPVEKVPGGDLSAGTLNKQGSLIMSAQRVGADTALAQIIELVRHAQSSKLPIANL
FT                   ANRISAVFVPAVVVIALLSATVWFLWGPDPRLSHALVVLTTVLIIACPCALGLATPMSV
FT                   INGVGKAAQLGLLVREGSALQTATDLTALVVDKTGTLTEGRPSVTDQIPVPGIESPRLL
FT                   IQAAALEQGSEHPLAEAILRAAQKEKLPPLDAFEAHTGLGVEGQVDGQHLILGNHAMMT
FT                   QWQVDTRPLDAEVARLASEGKTPVYLAAEGQLQGVLAIADPIREDAGSAIERLHRQGIK
FT                   VVMLTGDHPDTAAAVARQLGIDQFEAQMRPEDKVRILTSLQQSGDKVAMAGDGINDAPA
FT                   LAQADVGFAIGSGTDIAKASADIILIRSSLHGVADAIALSRATLRNIKQNLFGAFIYNS
FT                   LGIPIAAGVLYPLTGTLLNPVVAGAAMALSSLTVVTNANRLRWFTPRR"
FT   gene            complement(196424..196846)
FT                   /locus_tag="Fbal_0174"
FT   CDS_pept        complement(196424..196846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_1734 hypothetical protein; SPTR:
FT                   A3JX60 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74388"
FT                   /db_xref="InterPro:IPR024331"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ4"
FT                   /protein_id="ADN74388.1"
FT                   /translation="MPRTFVALLALLISAIASAEVVEKGLFANDNHDAPLLLASERVPA
FT                   KLGTLFGFRFLPEPDWDQSRPLQVVVQHPPMPPLGHEASGWTQYLQPGQPNTVVWEFEF
FT                   QEELLPGEWVIFLMQDDEPLFMERFEVILLPEAQFL"
FT   sig_peptide     complement(196790..196846)
FT                   /locus_tag="Fbal_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            196955..197644
FT                   /locus_tag="Fbal_0175"
FT   CDS_pept        196955..197644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0175"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="COGs: COG0625 Glutathione S-transferase; InterPro
FT                   IPR004045; KEGG: avn:Avin_05780 glutathione
FT                   S-transferase-like protein; PFAM: Glutathione S-transferase
FT                   domain; SPTR: A3L9S6 Putative uncharacterized protein;
FT                   PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74389"
FT                   /db_xref="GOA:E1SKZ5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ5"
FT                   /protein_id="ADN74389.1"
FT                   /translation="MIDLHYWPTPNGHKITLFLEEAGLEYRIIPVNIGAGDQFKPEFLA
FT                   ISPNNRMPAIVDHAPNDGGAPLSVFESGAILEYLADKVGQFLPKLTRPRMEVLQWLYWQ
FT                   MGGLGPMAGQNHHFNHYAPEVIPYAQQRYIKETARLYGVLDKQLEGKEYVAGEYSIADM
FT                   AIFPWAKLWEGQGQDLSQFPNMAAWLARIDARPAVQKAYAVAEQIQDAKPANELSEEDK
FT                   KRLFNLD"
FT   gene            complement(197683..198018)
FT                   /locus_tag="Fbal_0176"
FT   CDS_pept        complement(197683..198018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0176"
FT                   /product="late embryogenesis abundant protein"
FT                   /note="KEGG: pat:Patl_3865 late embryogenesis abundant
FT                   protein; SPTR: A3JEX6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ6"
FT                   /protein_id="ADN74390.1"
FT                   /translation="MKARISVMAALILMGLTACSEQNKEDLQDAMDKAAAKAEQMKDDA
FT                   QQAANDALDEAKAQADDAYNDAKDAANDAYEDAKGAAQDAVDEAKVQAEEMTEEAKKEA
FT                   EELLEKQ"
FT   sig_peptide     complement(197959..198018)
FT                   /locus_tag="Fbal_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            198157..199077
FT                   /locus_tag="Fbal_0177"
FT   CDS_pept        198157..199077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0177"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001972:
FT                   IPR001107: IPR018080; KEGG: ttu:TERTU_1892 SPFH/band 7
FT                   domain protein; PFAM: band 7 protein; SMART: band 7
FT                   protein; SPTR: P0AA56 Protein qmcA; PFAM: SPFH domain /
FT                   Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74391"
FT                   /db_xref="GOA:E1SKZ7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ7"
FT                   /protein_id="ADN74391.1"
FT                   /translation="MFGSEIVALVLVGLAVILVATGVKMVPQGFQYTVERFGKFTRTLS
FT                   PGLNLIVPLVDTIGKKQNMMEQVLDIMPQEVISADNAQVTTDAVCFYQVQDPVRASYEV
FT                   NNLELAMQNLVMTNIRAVLGAMELDEMLSNRDRINAELLIKVDEATDPWGVKVTRIEIR
FT                   DISPPRDLVDAMARQMKAEREKRAAILEAEGEREAAIKVAEGEKQSAILKAEGQLEAAK
FT                   REAEARERLAEAEAAATTMVSKAIAEGDMQAINYFVAQKYVEAVKEVASAENSKLVMMP
FT                   LEAGNLIGAVGGISELLKETGKRSV"
FT   gene            199077..199526
FT                   /locus_tag="Fbal_0178"
FT   CDS_pept        199077..199526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0178"
FT                   /product="protein of unknown function DUF107"
FT                   /note="COGs: COG1585 Membrane protein implicated in
FT                   regulation of membrane protease activity; InterPro
FT                   IPR002810; KEGG: cja:CJA_1077 hypothetical protein; PFAM:
FT                   protein of unknown function DUF107; SPTR: A3H0N8 Putative
FT                   uncharacterized protein; PFAM: NfeD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74392"
FT                   /db_xref="GOA:E1SKZ8"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ8"
FT                   /protein_id="ADN74392.1"
FT                   /translation="MAVLEALEAWHWLVLGLILLGLEALGAGGFLLGAAAAGILLSLLM
FT                   WIWPEMGWSLQLMVFALSAVLFTVIYWRGFRRFNQATEQPQLNDRAAQLVGRVLVLEHD
FT                   LLPGEGKIQVGDTLWRARTEQPLAAGSRVRIVASEGMVLQLEAAQ"
FT   gene            199523..200533
FT                   /locus_tag="Fbal_0179"
FT   CDS_pept        199523..200533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0179"
FT                   /product="protein of unknown function DUF898 transmembrane"
FT                   /note="COGs: COG4269 membrane protein; InterPro IPR010295;
FT                   KEGG: azo:azo3559 hypothetical protein; PFAM: protein of
FT                   unknown function DUF898 transmembrane; SPTR: A0Y6C8
FT                   Predicted membrane protein; PFAM: Bacterial protein of
FT                   unknown function (DUF898)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74393"
FT                   /db_xref="GOA:E1SKZ9"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ9"
FT                   /protein_id="ADN74393.1"
FT                   /translation="MTTTFRFHGHGTEYFKIWIVNLGLTLITLGFYSPWAKVRNRQYLY
FT                   GHTELAGHRFAYTADPLKILYGRLLALLIFGAYLFAGMNPMLSAIMGLVMLFFWPWAMT
FT                   RGLMFNARYSEYRGIHFSFSGSAVEVFILFFLLPPLTALTLGLVLPYLLAKQKEFVVGH
FT                   HWYGKQQFELTLPAGPVYLFCLVAGTLFLLCLFAGFFGLGLVSTLMDLENNPLMVLAVL
FT                   APFYLLVVVFWPLFKAGLMELALRHSKLESLTFSSTLQWWRMSWILISNQLAIIATLGL
FT                   FIPYAKVRWAQYRAETLSVAPATALDEMVALQEEELAAAGAEASEIFDVDLALGL"
FT   gene            200533..201531
FT                   /locus_tag="Fbal_0180"
FT   CDS_pept        200533..201531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0180"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="COGs: COG4783 Putative Zn-dependent protease
FT                   contains TPR repeats; InterPro IPR001915; KEGG:
FT                   har:HEAR0989 hypothetical protein; PFAM: peptidase M48
FT                   Ste24p; SPTR: A3RU87 Zinc metalloprotease; PFAM: Peptidase
FT                   family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74394"
FT                   /db_xref="GOA:E1SL00"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL00"
FT                   /protein_id="ADN74394.1"
FT                   /translation="MQLSGQWLDGQQSRSAHGVLRVAADGALYRDGQGQPFAELAELTI
FT                   PARLGSMPRTLVLANGWRFVCDQHEALDQLMQRQGRQGLRLVDRMERSGRAVLIGTLLV
FT                   IGGAFGAYQYGVPALAQSTAEALPDDLLDEMSQQALYELPLDRSELPLARQQQIRDGFV
FT                   RLLRANELNPSDFRLHLRSAPKIGPNAFALPSGDIVLLDQLVALTDHDDQWLGVLAHEL
FT                   VHVEARHGLRGVLQGAYGALLVTLMTGDASAATGPLVELPRILLESGYSRDMEREADAL
FT                   GAEMLRRAGGDPAQLAVMFERLAEQGSSELPGWLRSHPDHDERIKALRESN"
FT   gene            complement(201528..202244)
FT                   /locus_tag="Fbal_0181"
FT   CDS_pept        complement(201528..202244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0181"
FT                   /product="DTW domain containing protein"
FT                   /note="COGs: COG3148 conserved hypothetical protein;
FT                   InterPro IPR005636; KEGG: pfs:PFLU1193 hypothetical
FT                   protein; PFAM: DTW domain containing protein; SPTR: A3LE64
FT                   Putative uncharacterized protein; PFAM: DTW domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74395"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL01"
FT                   /protein_id="ADN74395.1"
FT                   /translation="MTQPNAVLTLRTERLALASKPFAARGATVPRCPRCQIAVEHCCCA
FT                   WARPGQSHLRFCLLMHHKEPMKPTNTGRLIAEILPDTAAFCWDRTEPDPALLTLLADPQ
FT                   YQPMIVFPGQYSTPERVHETIDAPKGKTPLLILLDGTWKQARRMFQSDYLAGLPVLSIT
FT                   PEALSRYKLRSAAHDHQLATAEVAAQVLAIGGDQRNAQVLDAFFQVFSQRYYAGKRQLP
FT                   VTADTEPFAYLENLVD"
FT   gene            complement(202300..204711)
FT                   /locus_tag="Fbal_0182"
FT   CDS_pept        complement(202300..204711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0182"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="COGs: COG2937 Glycerol-3-phosphate
FT                   O-acyltransferase; InterPro IPR002123; KEGG: slo:Shew_3530
FT                   glycerol-3-phosphate acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; PRIAM:
FT                   Glycerol-3-phosphate O-acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR: A3QIU8
FT                   Glycerol-3-phosphate acyltransferase; PFAM:
FT                   Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74396"
FT                   /db_xref="GOA:E1SL02"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL02"
FT                   /protein_id="ADN74396.1"
FT                   /translation="MSQNIFPAWQQPLRWAQKALVTSKAVPQDPIAELDLDPNRPLVYV
FT                   LPQESFSDRLALHECCEKLGLPSPFEPLVIKGETVSRIIALEPAQLLFSQGRTTDFKAR
FT                   FERLLSLHREHDDLDVQVVPVSLLWGRNPGKEEESVKATLLNKKNPTWLRKTFILAMLG
FT                   RDNFIRFSRAVSLRHMADNHGTDATIANKLARVARVHFGRQRTVATGPRLPDRQALFHG
FT                   LLASEVIKDAIADEAKSKKISEAKARERALEYLEEISADYSDSLMRIGDRVLTWLWNKL
FT                   YSGINVRGAEQIRQLSQDGHEIVFVPCHRSHMDYLLLSYVIYRQGMVPPHIAAGVNLNF
FT                   WPAGPIFRRGGAFFIRRSFKGNKLYSAVFREYLDQLFKRGYSVEYFCEGGRSRTGRLLP
FT                   PKTGMIAMTVNSVLRGLERPVTLVPVYLGYDHVMEVSTYHKELAGKKKQKESAWQVFSA
FT                   IRNLKDYGQGYVNFGAPITVHQFLNEHAPSWRTDTADGDLKHGWMTPTVNKLANQLMTR
FT                   INDAAAASAMTLTTSILLATEQHAMPRRALEKQLDFYLDLLRAVPYTPLATAPEGDGEA
FT                   VLKQVLDLNKFDVSEDAMGEIVSIHEGNAVTMTYYRNNTLHLLVLPGLMASLLLRKGCM
FT                   TRDAILDEIRALYPLLEAELFMGLSNGELDCYLNALLNELVRLEMVEDCKEGLVPRQSR
FT                   RAELYNLANQVQETLQRYAIVLSRLMKEPEIERGTLEKESQVLAERLARLHGISAPEFF
FT                   DKKGFTILTNCLKEMGCLGDDADQDKVKALAKTVLGLIPASIHSSIVNND"
FT   gene            204987..205610
FT                   /locus_tag="Fbal_0183"
FT   CDS_pept        204987..205610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0183"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="COGs: COG1974 SOS-response transcriptional
FT                   repressors (RecA-mediated autopeptidase); InterPro
FT                   IPR006197: IPR006199: IPR019759: IPR006200; KEGG:
FT                   slo:Shew_0127 LexA repressor; PFAM: LexA DNA-binding domain
FT                   protein; Peptidase S24/S26A/S26B, conserved region; PRIAM:
FT                   Repressor lexA; SPTR: A3Q951 LexA repressor; TIGRFAM: LexA
FT                   repressor; PFAM: LexA DNA binding domain; Peptidase
FT                   S24-like; TIGRFAM: SOS regulatory protein LexA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74397"
FT                   /db_xref="GOA:E1SL03"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL03"
FT                   /protein_id="ADN74397.1"
FT                   /translation="MKPLTPRQNQVFDLVRQHMQDTGMPPTRAEIARQLGFKSANAAEE
FT                   HLKALARKGFIEIVPGTSRGIRLLYNEPEPEQLGLPLIGRVAAGEPILAQEHVETHYQM
FT                   DGNLFRPSANYLLRVRGDSMKEIGILDGDLLAVHQTQDARNGQVVVARVGEDEVTVKRF
FT                   ERRGNVVYLHAENAEYEPIVVDLEDTALAIEGLAVGVVRNGGWQ"
FT   gene            205610..206065
FT                   /locus_tag="Fbal_0184"
FT   CDS_pept        205610..206065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3863 hypothetical protein; SPTR:
FT                   A2V2G6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74398"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL04"
FT                   /protein_id="ADN74398.1"
FT                   /translation="MKTRQGVRREHPGLWQQPGLDWQQVQTAPQGDDAGRLALARLAPQ
FT                   LADYSRAPRWLLLINPPAFDWKTVLADAGVDLSRVLQVRCDDDVAAQWALEQAVSGTTC
FT                   AVALAWVPQLDARDRRRLELVSRRAHCPAFLFEVGQGSPLEIPSALH"
FT   gene            206441..207565
FT                   /locus_tag="Fbal_0185"
FT   CDS_pept        206441..207565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0185"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="COGs: COG1622 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 2; InterPro IPR002429: IPR011759:
FT                   IPR003088: IPR001505: IPR 009056: IPR014222; KEGG:
FT                   she:Shewmr4_3791 cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome C oxidase
FT                   subunit II transmembrane region; cytochrome c class I;
FT                   SPTR: A2V2G7 Cytochrome c oxidase subunit 2; TIGRFAM:
FT                   cytochrome c oxidase, subunit II; PFAM: Cytochrome C
FT                   oxidase subunit II, periplasmic domain; Cytochrome c;
FT                   Cytochrome C oxidase subunit II, transmembrane domain;
FT                   TIGRFAM: cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74399"
FT                   /db_xref="GOA:E1SL05"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL05"
FT                   /protein_id="ADN74399.1"
FT                   /translation="MKYKLLGGLATLVAMPSMADPSLWNMTPGVTEISQQVYGLHMTIF
FT                   YICCAIAAVVFGVMIWALIRHRKSKGAVPAHFHESTKVEILWTVIPFLILIGMAVPATS
FT                   TLIAMEDPSDADLTIQVTGSQWKWHYKYFNHEVEFYSLLSTPADQIANAEAKGENYLLE
FT                   VDKPLVIPANRKVRFLLTSDDVIHSWWVPAFAVKKDANPGFINEAWTKVDEPGTYRGQC
FT                   AELCGKDHGFMPVVVEVLPEAEFDQWLAEQEQASAAAAQAEQDSLAQTLTLEESMALGE
FT                   QVYNGRCAACHQPNGMGLQGVFPAISGSPVATGPVDAHVDIVVHGKPGTAMQAFASQLT
FT                   LKELAAVVTFQRNAWDNQTGDVVQTAEVAKALGQ"
FT   sig_peptide     206441..206497
FT                   /locus_tag="Fbal_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            207582..209213
FT                   /locus_tag="Fbal_0186"
FT   CDS_pept        207582..209213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0186"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="COGs: COG0843 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 1; InterPro IPR000883: IPR014241; KEGG:
FT                   spl:Spea_4000 cytochrome c oxidase subunit I type; PFAM:
FT                   cytochrome c oxidase subunit I; PRIAM: Cytochrome-c
FT                   oxidase; SPTR: A2V2G8 Cytochrome c oxidase, subunit I;
FT                   TIGRFAM: cytochrome c oxidase, subunit I; PFAM: Cytochrome
FT                   C and Quinol oxidase polypeptide I; TIGRFAM: cytochrome c
FT                   oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74400"
FT                   /db_xref="GOA:E1SL06"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL06"
FT                   /protein_id="ADN74400.1"
FT                   /translation="MNTVVTDRPVDELERPGVIEEEHHGHDDHHPHPTGIKRWLLTTNH
FT                   KEIGTLYLWFSFIMFLTGGAMAMVIRAELFQPGMQLVDPHFFNQMTTVHGLIMVFGAVM
FT                   PAFTGLANWMIPMMIGAPDMALPRMNNWSFWILPFAFALLLGSLFMEGGGPAFGWTFYA
FT                   PLSTTFSGDSTALFVFSVHIMGISSIMGAINVIVTIVNLRAPGMTWMKLPLFVWTWLIT
FT                   AFLLIAVMPVLAGVVTMVLTDKYFGTSFFDAAGGGDPVMFQHIFWFFGHPEVYIMILPA
FT                   FGVISAIVPAFSRKKLFGYASMVYATASIAGLSFIVWAHHMFTTGMPVAAELFFMYCTM
FT                   LISVPTGVKVFNWVATLWRGSISFEAPMLFSLAFIVLFTIGGLSGLMLAITPVDFQYHD
FT                   TYFVVAHFHYVLVTGAVFSIMAAAYYWLPKWTGHMYSETLARWHFWTSIISVNVLFFPM
FT                   HFLGLAGMPRRIPDYGLQFADINQVVSIGGFAFGLSQLIFLALVIKCIRGGEKAAAKPW
FT                   DGAEGLEWTVPSPAPLHTFDTPPKVA"
FT   gene            209221..209760
FT                   /locus_tag="Fbal_0187"
FT   CDS_pept        209221..209760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0187"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="COGs: COG3175 Cytochrome oxidase assembly factor;
FT                   InterPro IPR007533; KEGG: swd:Swoo_0176 cytochrome c
FT                   oxidase assembly protein; PFAM: cytochrome c oxidase
FT                   assembly protein CtaG/Cox11; SPTR: A2V2G9 Cytochrome c
FT                   oxidase assembly protein CtaG/Cox11; PFAM: Cytochrome c
FT                   oxidase assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74401"
FT                   /db_xref="GOA:E1SL07"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL07"
FT                   /protein_id="ADN74401.1"
FT                   /translation="MANAQENRRLITTLIGVVVGMFGFGFALVPLYDVFCEITGINGKT
FT                   SGEVAAQSRTVDEQRVVTVEFIARVQGDMPWEFKPVVNRLKVHPGESRQVAFYARNLSA
FT                   EATVGQAIPSVSPGLGALYFSKVECFCFNQQPLAAGEEAELGLLFYLDPELPPEIQTVT
FT                   LSYTLYNITDKVSERG"
FT   sig_peptide     209221..209301
FT                   /locus_tag="Fbal_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            209771..210643
FT                   /locus_tag="Fbal_0188"
FT   CDS_pept        209771..210643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0188"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="COGs: COG1845 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 3; InterPro IPR000298; KEGG: swp:swp_4826
FT                   cytochrome c oxidase, subunit III; PFAM: cytochrome c
FT                   oxidase subunit III; PRIAM: Cytochrome-c oxidase; SPTR:
FT                   A0Y469 Cytochrome c oxidase subunit III; PFAM: Cytochrome c
FT                   oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74402"
FT                   /db_xref="GOA:E1SL08"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL08"
FT                   /protein_id="ADN74402.1"
FT                   /translation="MSQHERYYVPAQSPWPIVGAVGLFLIALGAGNYVASLSKGGGMGG
FT                   YVLLAGIAVILFMMVGWFRNVIDESMSGLYSRQMDRSFRQGMSWFIFSEVMFFAAFFGA
FT                   LFYARMVAIPWLGGAGNNAMTSEVLWPAFEAVWPLETTPDGTQTQAMGWSGLPLYNTII
FT                   LVISSVTLHVAHVGLEQNKRKVLTGWLGLTILLGAAFLFLQVEEYVHAYNEMGLTLDAG
FT                   IYGNTFFLLTGFHGMHVTLGTIMLIVMFFRVLKGHFTPENHFGFQATSWYWHFVDVVWI
FT                   CLFVFVYVL"
FT   gene            complement(210692..210901)
FT                   /locus_tag="Fbal_0189"
FT   CDS_pept        complement(210692..210901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_3487 hypothetical protein; SPTR:
FT                   A2V2H1 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2909)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74403"
FT                   /db_xref="GOA:E1SL09"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL09"
FT                   /protein_id="ADN74403.1"
FT                   /translation="MITAFKTVIVLLLLFILFSLGRAGFAMIRGEEGGMTRHLGRRVGL
FT                   SALVLVLLVVAMAAGWLPVNPRPY"
FT   sig_peptide     complement(210824..210901)
FT                   /locus_tag="Fbal_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            210935..211672
FT                   /locus_tag="Fbal_0190"
FT   CDS_pept        210935..211672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3346 conserved hypothetical protein;
FT                   InterPro IPR002994; KEGG: saz:Sama_3488 hypothetical
FT                   protein; SPTR: A2V2H2 Putative uncharacterized protein;
FT                   PFAM: SURF1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74404"
FT                   /db_xref="GOA:E1SL10"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL10"
FT                   /protein_id="ADN74404.1"
FT                   /translation="MSQPVRPAIWAALIATVLAIGVLVKLGFWQLDRAEEKRHLMAQLA
FT                   QRAEQTLHWPLPDWPGEQLAGYRLAGTVEPVTERTLLLDNQTLDGQVGYRWLQPARFDG
FT                   GAWILLDLGFVPVARGDRTLPTLPTLPERLSVSGRLYRPGHNPLNAHLLPEAGSVTRIQ
FT                   ALELAQLSDHWQQPVAPVVWLVEQPELVGFARSWQPINLSPEKHQGYALQWFGLAVALV
FT                   IILLRMIQIGRLQRSAQADRLET"
FT   gene            211730..212284
FT                   /locus_tag="Fbal_0191"
FT   CDS_pept        211730..212284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swd:Swoo_0172 hypothetical protein; SPTR:
FT                   A2V2H3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74405"
FT                   /db_xref="GOA:E1SL11"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL11"
FT                   /protein_id="ADN74405.1"
FT                   /translation="MNSHNNGTAKRTLWLLLGAFILPVVLAYLYLTQGWYQSGATNKGQ
FT                   LLNNLSYQSLAVSNPAERQWQVITLLPAHCDSNCQDRLATLRQTHIALGREQDRVVPLV
FT                   YLTDQSDPDIRGELASQALRAAGAEMPVQQALADVAMVVVDPLGQWVMAYPAVQGTEAQ
FT                   IQQGRDLLSDLRKLLKLSRIG"
FT   sig_peptide     211730..211810
FT                   /locus_tag="Fbal_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            212293..213249
FT                   /locus_tag="Fbal_0192"
FT   CDS_pept        212293..213249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0192"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="COGs: COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly; InterPro IPR003780; KEGG:
FT                   swp:swp_4835 cytochrome oxidase assembly; PFAM: cytochrome
FT                   oxidase assembly; SPTR: A2V2H4 Cytochrome oxidase assembly;
FT                   PFAM: Cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74406"
FT                   /db_xref="GOA:E1SL12"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL12"
FT                   /protein_id="ADN74406.1"
FT                   /translation="MKKLTFATLCLTFVVILLGAFTRLTDAGLGCPDWPGCYGFLTVPS
FT                   AEHVEVAEARFPERPVEVAKAWAEMVHRYVAGTLGLFIFALALLSLKSNGPKGLPWLLV
FT                   GLVLFQAALGMWTVTLNLLPVVVMGHLMGGFAIFSLLFLLWLRQSDNAIELSPLRVLAT
FT                   VALVVLLGQIMLGGWTSANYAALVCTQLPICEGDWMGNLAPLDAFHPLPPPAESYEFGV
FT                   LDYPARMTIHVSHRIGAVITALVLLWLWWRLRQSGANRVAAVLGTVLLVQVALGVTNVV
FT                   GSLPLPVAVAHNGVAALLLLTLVWINHLAWQRPAKEG"
FT   sig_peptide     212293..212367
FT                   /locus_tag="Fbal_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            213250..214155
FT                   /locus_tag="Fbal_0193"
FT   CDS_pept        213250..214155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0193"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="COGs: COG0109 Polyprenyltransferase (cytochrome
FT                   oxidase assembly factor); InterPro IPR000537: IPR006369;
FT                   KEGG: shl:Shal_0251 protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; SPTR: B0TNS4 Protoheme IX
FT                   farnesyltransferase; TIGRFAM: protoheme IX
FT                   farnesyltransferase; PFAM: UbiA prenyltransferase family;
FT                   TIGRFAM: protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74407"
FT                   /db_xref="GOA:E1SL13"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL13"
FT                   /protein_id="ADN74407.1"
FT                   /translation="MAKLILALTHAPSWPWRDYLEMTKPKVVALMLVTALVGMALATPG
FT                   WIPLTALIFGLTGIGMMAGSAAAINHLVDRRIDTIMARTHNRPLPKGRVAPRQALIFAA
FT                   VLGVAGFTLLYALVNPLTAWLTCASLVGYAVIYTGFLKRATPQNIVIGGLAGAMPPLLG
FT                   WTAVTGDFHGHGMLLVIIIFAWTPPHFWALAIHRKEDYARAGLPMLPVTHGVEYTKTHI
FT                   LLYSFLLALACLLPVLVGMSGPLYLLGSTVLSGWFVWRAWQLKFQPERYEPIKLFLFSI
FT                   WQLLALFVLLLVDHYLELLL"
FT   sig_peptide     213250..213375
FT                   /locus_tag="Fbal_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            214152..214796
FT                   /locus_tag="Fbal_0194"
FT   CDS_pept        214152..214796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0194"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="COGs: COG1999 Uncharacterized protein SCO1/SenC/PrrC
FT                   involved in biogenesis of respiratory and photosynthetic
FT                   systems; InterPro IPR003782; KEGG: pat:Patl_4237 electron
FT                   transport protein SCO1/SenC; PFAM: electron transport
FT                   protein SCO1/SenC; SPTR: A2V2H6 Electron transport protein
FT                   SCO1/SenC; PFAM: SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74408"
FT                   /db_xref="GOA:E1SL14"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL14"
FT                   /protein_id="ADN74408.1"
FT                   /translation="MKASNQWIVLLGLVALVAGLSLSLKGPAPRPEVSALWLEQARPLP
FT                   EFSLTDHNGQPFDRARLEGQWSLFFVGYTSCPDVCPTTMSDLARVYPKLEERLGEKPVQ
FT                   VVLLSVDPGRDDPEKLGQYVEFFRPGFMAVTGEHAQLFPFTQSLGLVYALVDNPNGGEY
FT                   LVDHSADLVLINPEGAIEAFFRPSGELGTLRKVSMAQLEQDLPVIIGAYSG"
FT   sig_peptide     214152..214226
FT                   /locus_tag="Fbal_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(214858..215907)
FT                   /locus_tag="Fbal_0195"
FT   CDS_pept        complement(214858..215907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0195"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COGs: COG0726 xylanase/chitin deacetylase; InterPro
FT                   IPR002509; KEGG: sbp:Sbal223_4122 polysaccharide
FT                   deacetylase; PFAM: polysaccharide deacetylase; SPTR: A2V2H7
FT                   Polysaccharide deacetylase; PFAM: Polysaccharide
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74409"
FT                   /db_xref="GOA:E1SL15"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL15"
FT                   /protein_id="ADN74409.1"
FT                   /translation="MKKTIIRLLTWLPLWCAVLPVQAAVILQYHHVSENTPASTSVTPA
FT                   QFEQQMAYLADNQFNVVSLQTVVDAIRTKTDLPPKTVAITFDDGYQNIFENGHPILKRY
FT                   GFPYTLFINPEPVGRANMMDWDTLSQLSQEGATIANHSYRHGHLIRKQEGENQAQWEAR
FT                   IRADIEKTEAIIAEKTGHNVKMLAYPYGEYNQALRQLLDNMGFVGIGQHSGAAGPYSSL
FT                   TAVPRYPVAGPYADMATLKVKLHSLNMPVAAVDGEESELIGRNRPTLTVTLAGDDVRTK
FT                   ELMCFIQGQGAKAPTWLDANTFTIQADLPLPAGRSRYNCTAPSRSQNGYYWYSQPWIQA
FT                   NPDGSWPAE"
FT   sig_peptide     complement(215839..215907)
FT                   /locus_tag="Fbal_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            215928..217265
FT                   /locus_tag="Fbal_0196"
FT   CDS_pept        215928..217265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0196"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: swd:Swoo_0160 MATE efflux family
FT                   protein; PFAM: multi antimicrobial extrusion protein MatE;
FT                   SPTR: A2V2H8 MATE efflux family protein; TIGRFAM: MATE
FT                   efflux family protein; PFAM: MatE; TIGRFAM: putative efflux
FT                   protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74410"
FT                   /db_xref="GOA:E1SL16"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL16"
FT                   /protein_id="ADN74410.1"
FT                   /translation="MTVTAILRQWEGHRRTFMLALPMILSNVTIPLLGLVDTAVIGHLS
FT                   DAYYLGGVAVGAMIITFLFWILGFLRMATTGLVAQSFGAGDALGQLRVLYQAGVMALGL
FT                   AALLLLLQAPILSMALTLVGGSSEVQHYAAVYFEVRIWSAPAALLNLVLLGYLLGRQNP
FT                   RAAMWLLLCTNGVNIALDLLFVVGFGWGVAGAAGASVIADYGALLLALALVWHSLPDEL
FT                   RQRATLAQLSLEGSGRLLALNRDIFIRTLCLQLCMAFVTAQGARLGDAVVAANSVLMNF
FT                   TLLMAYALDGFAYAAEAEVGRSSGARDRDGIRRAVVLGGFWSALTALAFTLVFAGAGEG
FT                   IIAMLTSIDSVRSTAAEYLPWVVIYPLLAFTCFLFDGVYIGAARGAAMRNSMLCSALGF
FT                   FALWWLVRDSLPGNHALWLAFCGFITLRSLSLPGHFLWSWRRGQWG"
FT   gene            complement(217314..217892)
FT                   /locus_tag="Fbal_0197"
FT   CDS_pept        complement(217314..217892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0197"
FT                   /product="IscR-regulated protein YhgI"
FT                   /note="COGs: COG0694 Thioredoxin-like protein and domains;
FT                   InterPro IPR001075: IPR000361: IPR017726; KEGG:
FT                   spl:Spea_4010 putative DNA uptake protein; PFAM:
FT                   HesB/YadR/YfhF-family protein; nitrogen-fixing NifU domain
FT                   protein; SPTR: A8H9T3 Fe/S biogenesis protein nfuA;
FT                   TIGRFAM: IscR-regulated protein YhgI; PFAM: Iron-sulphur
FT                   cluster biosynthesis; NifU-like domain; TIGRFAM:
FT                   IscR-regulated protein YhgI"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74411"
FT                   /db_xref="GOA:E1SL17"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL17"
FT                   /protein_id="ADN74411.1"
FT                   /translation="MITITEAAQAHFAKLLSSQPEGTNIRVFVINPGTPQAECGVSYCP
FT                   PDAVEADDIELPFEGFNAMVDEKSAPFLDDALIDYVTDQLGSQLTLKAPNAKMRKVADD
FT                   APLRDRVEYVIQSQVNPQLAGHGGFITLMELTDDGIAVIQFGGGCNGCSMVDVTLKDGI
FT                   EKQLLEEFSGELTAVKDVTEHEHGEHSYF"
FT   gene            218058..220568
FT                   /locus_tag="Fbal_0198"
FT   CDS_pept        218058..220568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0198"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="InterPro IPR006025; KEGG: swd:Swoo_0158 peptidase
FT                   M14 carboxypeptidase A; SPTR: A0Y488 Putative
FT                   uncharacterized protein; PFAM: Zinc carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74412"
FT                   /db_xref="GOA:E1SL18"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL18"
FT                   /protein_id="ADN74412.1"
FT                   /translation="MKKLISIGALLLALAIPSVTASPLATLAPDTPYLDTLPTPTQHFG
FT                   GSVGERHLRYDEVSAYFHRLANNSGRVTLENIGFSHQGRPQWAAIITSEANHQRLDDLL
FT                   AQRARAAAGDRVDGPVVIWLAYSIHGDEASGLHASPLFAYHLAAGQSVEVKNWLEDAIV
FT                   VITPSQNPDGNDRFSNWVNGYRGSVPSGHNYHREHFQGWPSGRVNHFWADLNRDWLYQA
FT                   HPESRGRVAFFQRWLPHVVSDYHEMGHQSSYFFQPGVPDRTHPLTPAENQALTARIAKH
FT                   HARALDALYQPYFSRESFDDFYYGKGSTYPDINGSVGILFEQATARGLHRDSDYGEVTL
FT                   ALGVRNHLATSFSTVRGAIAEADALREYQRQFFRDALDKADDRRGAGYLVSARGDRARL
FT                   NAFADILRSHRVQFQYLTAAVQQDEIAFAAGDLFIPFEQPQYRLIEALFDQRTAFADNT
FT                   FYDVSAFSAELAFDLTRAEVRRAPRTQPMAPALPKIDYQQPALQWLIPWQDRLAPAALN
FT                   RLLEAGFRVRFAETGGQVMARQGALDYQAGALTLLGNQPGLAQALSQIEAELGVQAHPL
FT                   VSGQALAGSDLGSRRFHAATAVKPAILIGRDVSQYEAGMLWFYLDQVLGIETVLLDGEY
FT                   FTRAPLQEFTHLFLVDGAYSKLTGAKAAIEPFVRQGGTVVAWKRGVARLAQWGLVDVTV
FT                   RQRSYFAPEFAHAGEQLAFAQRNSEHARRTIGGAIVNWQLDTTHPLGFGLSAELPMMKN
FT                   RELSLAAKESKGRSVAHYPEALLRSGYMAPEYQKALAGEVAAQVMGQGAGQYILMADNP
FT                   LFRNFWLGSERLVANSLFMVPALN"
FT   sig_peptide     218058..218120
FT                   /locus_tag="Fbal_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(220561..221256)
FT                   /locus_tag="Fbal_0199"
FT   CDS_pept        complement(220561..221256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0199"
FT                   /product="competence protein ComF"
FT                   /note="COGs: COG1040 amidophosphoribosyltransferase; KEGG:
FT                   spl:Spea_4012 competence protein ComF; SPTR: A2V2I6
FT                   Competence protein ComF; TIGRFAM: comF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74413"
FT                   /db_xref="GOA:E1SL19"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL19"
FT                   /protein_id="ADN74413.1"
FT                   /translation="MMERSLPNRCLLCQQTCLQGRGLCDVCLADGEPGPLCLGCSKPLP
FT                   APVPWRCGSCLGKKRWRPLVCAYPYHHPLGYLAGAIKIQRRMSLLSPLCDALAQRLEGL
FT                   WQLGALPRPDALLAVPMHRRKLVQRGFNHSALIAVALGERLHLPVLNERVIKVRPTRDQ
FT                   HGLNGAERRRNLRGCFQVIPGARMHNLALVDDVVTTGTTFASLAATLRRDGHSVSQYWA
FT                   LASALNTVS"
FT   gene            221291..222085
FT                   /locus_tag="Fbal_0200"
FT   CDS_pept        221291..222085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0200"
FT                   /product="carboxylesterase BioH (pimeloyl-CoA synthesis)"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073:
FT                   IPR012908: IPR008262: IPR010076; KEGG: vsa:VSAL_I0199
FT                   carboxylesterase BioH; PFAM: alpha/beta hydrolase fold;
FT                   PGAP1 family protein; SPTR: B6EPQ0 Carboxylesterase bioH;
FT                   TIGRFAM: bioH protein; PFAM: alpha/beta hydrolase fold;
FT                   TIGRFAM: putative pimeloyl-BioC--CoA transferase BioH"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74414"
FT                   /db_xref="GOA:E1SL20"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL20"
FT                   /protein_id="ADN74414.1"
FT                   /translation="MSIEPTLAQPDLHIHWQGEGAPLMLLHGWGMNGAVWQEMASELVA
FT                   LGFRVGAVDLPGFGHSGALPQTTLSGLAHAVLAAESEPVHLLGWSLGGLVATQAALMAP
FT                   QRVRSLVTLASSPCFQAGPDWPGIKPEVLAQFADQLALDLPRTVERFFALQAMGSPSAK
FT                   ADVRQLKAAVTARPQPAPSALADGLTILASADLRLQLNQLTMPWLRLYGRLDGLVPART
FT                   VSQVDALAPQSQSVVLAKAAHAPFISHRADTLAQLKRFYLSH"
FT   gene            222121..222585
FT                   /locus_tag="Fbal_0201"
FT   CDS_pept        222121..222585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swd:Swoo_0155 hypothetical protein; SPTR:
FT                   A2V2I8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74415"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL21"
FT                   /protein_id="ADN74415.1"
FT                   /translation="MFLVSNFPNVPIATSNPATESAQREAALRVPISRPEPLLKSAAER
FT                   ALDPERERSRIDPRQQSQQRQSGEEQEQSDQPPPQQGREGPLSWREALAQARPVMERPG
FT                   SRRSHVASSVDHHPAQDLDKAAYARFEQIVRHHYEGVAEPRTPPAFEART"
FT   gene            complement(222582..223160)
FT                   /locus_tag="Fbal_0202"
FT   CDS_pept        complement(222582..223160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0202"
FT                   /product="OmpA domain protein transmembrane
FT                   region-containing protein"
FT                   /note="InterPro IPR000498; KEGG: pha:PSHAa1621
FT                   TonB-dependent receptor protein; PFAM: OmpA domain protein
FT                   transmembrane region-containing protein; SPTR: A0Y209
FT                   Putative TonB-dependent receptor protein with OmpA-like
FT                   transmembrane domain; PFAM: OmpA-like transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74416"
FT                   /db_xref="GOA:E1SL22"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL22"
FT                   /protein_id="ADN74416.1"
FT                   /translation="MRTLFAITLLVFTASTQASWLEGKMMGVHVGQISYDTDGLYDDYR
FT                   FDDRASSWGLYTAAPVNDWLDLEVHYNYLGGYEIKDSVFHYWKDRFHSLTTTARFHTHL
FT                   TPQWSIYARAGFGVVLLDQQAIIWEGGSRLDTASGGGDIHLGAGLAWQFHSKLALTLDY
FT                   QLHSFLMESGYSDYLQTLSGFNAGLRYTF"
FT   sig_peptide     complement(223107..223160)
FT                   /locus_tag="Fbal_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(223243..224196)
FT                   /locus_tag="Fbal_0203"
FT   CDS_pept        complement(223243..224196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0203"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847: IPR005119; KEGG: vfm:VFMJ11_2114 transcriptional
FT                   regulator; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; SPTR: A3UYP2 Transcriptional regulators,
FT                   LysR family; PFAM: Bacterial regulatory helix-turn-helix
FT                   protein, lysR family; LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74417"
FT                   /db_xref="GOA:E1SL23"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL23"
FT                   /protein_id="ADN74417.1"
FT                   /translation="MAKDRFNNLDLNLLRTFVVLAQEGNMRRAAARLHVTQPAVSHALQ
FT                   RLRHHFEDELFIKVPGGMTPTQFARTLQERLKPVLVGLAEAVNDNNAFNPAELDTTLRI
FT                   ALPPHLNHYIGATLYRRLNRDAPNASVELMEWGGHTPVLLLNGELDVGVNIPFPHRSKE
FT                   LIAAPVGQDSGVMMVHHDHPYKGRSITPEQLSRWGLACLFNPGITDQQPIIQRVLEAHG
FT                   HSAKIRFRSASLPTIFSVLRQHDYFFPHTAALADSHAPEFRPVQLEVAPHYLTVDMFAY
FT                   YHRGHQHPAVTLWLVEHLAEALRGYLKPLLLSDKWD"
FT   gene            224505..225248
FT                   /locus_tag="Fbal_0204"
FT   CDS_pept        224505..225248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74418"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL24"
FT                   /protein_id="ADN74418.1"
FT                   /translation="MKPIAAVLTLLAPAAMATPLPYTFEAGQAAKANEVNANFSILAQA
FT                   QAGTDEQLSMVSAEVSDLQSALATLQEQVDALLPDFESRFCTSVETGSELVFSGVPFVS
FT                   SAFTLMDADGTTRRLNLMVPKAPMVTPQYQAALTGSDVAGYSKAFYFCDQPARLENVLK
FT                   VDYDLSDINEVAAYFYTETRLTVRHPAHDSEWFSNATRLELGKVALPRDGSGDYQLAPQ
FT                   DLPSVEAIKASLLGGYQVYFHSSLR"
FT   sig_peptide     224505..224555
FT                   /locus_tag="Fbal_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            225258..225425
FT                   /locus_tag="Fbal_0205"
FT   CDS_pept        225258..225425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74419"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL25"
FT                   /protein_id="ADN74419.1"
FT                   /translation="MKPLWIAAVALMLAACGSDHSDSENGHTPTQPIEPPGTDVVLIWD
FT                   DGQWDNSDWQ"
FT   sig_peptide     225258..225320
FT                   /locus_tag="Fbal_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(225475..227802)
FT                   /locus_tag="Fbal_0206"
FT   CDS_pept        complement(225475..227802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0206"
FT                   /product="Tex-like protein"
FT                   /note="COGs: COG2183 Transcriptional accessory protein;
FT                   InterPro IPR003029: IPR018974: IPR006641; KEGG:
FT                   ecf:ECH74115_4713 putative transcriptional accessory
FT                   protein; PFAM: Tex-like protein-like; RNA binding S1 domain
FT                   protein; SMART: Resolvase RNase H domain protein fold;
FT                   SPTR: A2P4I2 Putative uncharacterized protein; PFAM:
FT                   Tex-like protein N-terminal domain; S1 RNA binding domain;
FT                   TIGRFAM: glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type; competence
FT                   protein ComEA helix-hairpin-helix repeat region"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74420"
FT                   /db_xref="GOA:E1SL26"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL26"
FT                   /protein_id="ADN74420.1"
FT                   /translation="MEPISHLIAQELGVRPQQVQAAITLLDDGATVPFIARYRKEVTGT
FT                   LDDTQLRTLETRLGYLRELSDRRQSILKSIDEQGKLSDSLRAAIEAADTKTALEDLYLP
FT                   YKPKRRTKGQIAIEAGLLPLADSLFENPSQDPEQSASAYLNAEAGFDTTKAVLDGARAI
FT                   LMERFAEDATLLAKIRQHLQQNAHLKSQVISGQESNGAKFQDYFDHAEPWAKVPSHRTL
FT                   AMLRGRNEGVLALSLEADPNKEEGDRSSYCEQIIAQHFAIPTGNQPGERWLQQLCQWTW
FT                   RVKISLAMETELLGDLRERAEADAIKVFAENLSDLLMAAPAGMRPTLALDPGLRTGCKV
FT                   AVVDGTGKLVATDTIYPHAPQKRWNDALTVLAKLVNQHQVELIAVGNGTASRETDKLAG
FT                   ELIKALKKPGLTKVMVSEAGASVYSASETAALEFPTLDVALRGAVSIGRRLQDPLAELV
FT                   KIEPKSIGVGQYQHDVSQTQLARSLDAVVEDCVNGVGVDLNTASVPLLTRVAGLSRTLA
FT                   QNIVQFRDEHGRFTNRKQLLKVARLGPKAYEQCAGFLRIAGGDNPLDGSGVHPEAYPVV
FT                   KKISAHTGVAVAELVGNSGVLQSLRAGDFTDERFGLPTVNDILKELDKPGRDPRGQFET
FT                   AAFAEGVEKVSDLEPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALSNKFVEDPRTV
FT                   VKAGDVVKVKVMEVDVPRQRIGLSMRLDDQPGEARSQRSGGQDRPTRQPRKESRPARQS
FT                   DPAGGGLSGAFADAFANAKKRR"
FT   gene            227906..228391
FT                   /locus_tag="Fbal_0207"
FT   CDS_pept        227906..228391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0207"
FT                   /product="transcription elongation factor GreB"
FT                   /note="COGs: COG0782 Transcription elongation factor;
FT                   InterPro IPR001437: IPR018151: IPR006358; KEGG: yen:YE4003
FT                   transcription elongation factor GreB; PFAM: transcription
FT                   elongation factor GreA/GreB domain protein; SPTR: Q8ZJH2
FT                   Transcription elongation factor greB; TIGRFAM:
FT                   transcription elongation factor GreB; PFAM: domain;
FT                   Transcription elongation factor, GreA/GreB, C-term;
FT                   TIGRFAM: transcription elongation factor GreA;
FT                   transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74421"
FT                   /db_xref="GOA:E1SL27"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL27"
FT                   /protein_id="ADN74421.1"
FT                   /translation="MKKADLITKDGWNALEAELKYLWKEERPRVTQSVSEAAALGDRSE
FT                   NAEYIYGKKRLREIDRRVRFLSKRMEVLRVVEPDPRQEGKVYFGAWVELENDDGDKKRY
FT                   RLVGPDEFDVKVGKISIDSPLARALLGKAVDDEVKVRTPNGDQLFYINEIRYRAFED"
FT   gene            228404..229126
FT                   /locus_tag="Fbal_0208"
FT   CDS_pept        228404..229126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0208"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: sse:Ssed_0168
FT                   osmolarity response regulator; PFAM: response regulator
FT                   receiver; transcriptional regulator domain protein; SMART:
FT                   response regulator receiver; SPTR: A2V2J2 Two component
FT                   transcriptional regulator, winged helix family; PFAM:
FT                   Response regulator receiver domain; Transcriptional
FT                   regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74422"
FT                   /db_xref="GOA:E1SL28"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL28"
FT                   /protein_id="ADN74422.1"
FT                   /translation="MNQETTKVLVVDDDMRLRNLLERYLVEQGFQVRSAADSEQMDRHL
FT                   ERENFHLLVLDLMLPGEDGLSICRRLRQKGNEIPIVMLTAKGDEVDRIIGLELGADDYL
FT                   PKPFNPRELLARIKAVLRRRPAEVPGAPSQEEAEVVFGQYRLNLATREMYKGDEPVSLT
FT                   SGEFAVLKVLVSNPREPMSRDKLMNQARGRDYSALERSIDVQVSRLRRLIEDDPSNPRY
FT                   IQTVWGLGYVFVPDGSAR"
FT   gene            229126..230439
FT                   /locus_tag="Fbal_0209"
FT   CDS_pept        229126..230439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0209"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR004358: IPR003594: IPR003661: IPR003660: IPR
FT                   005467; KEGG: slo:Shew_3638 osmolarity sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; SPTR: A2V2J3 Sensor
FT                   protein; PFAM: HAMP domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74423"
FT                   /db_xref="GOA:E1SL29"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL29"
FT                   /protein_id="ADN74423.1"
FT                   /translation="MRWRLLPRSNFGQTVLLIGCLLLINQLVSYVSVAVYVIKPSTQQI
FT                   NQLLARQVELVFRDLQLDLDTLTPLDAIREKLTEDQHMDAFSVPEARAEGLNDATYYRI
FT                   LSDQMSEYLGGEAEVRIAGGEQYQIWIRPPQAPQIWLRVPLSGFDESKVNPLTIYLMVI
FT                   GALSVLGGWWFARLQSRPLRRLQRAALQVSRGRFPKPLPLSGSAEVMEVTKAFNQMARS
FT                   MAELEADRNLLLAGVSHDLRTPLTRIRLSTEMMSQQDDFLKEGIEADIDDMNAIIDQFI
FT                   AFIRGHQDEEMQVMSVDELLQDVAQQEEVRGQQIELALADTPTIKLQPVAIKRVITNLV
FT                   ENGLRYGNGWLRLSSGVERGWVWFKVEDNGEGIPLDRLDELFQPFQQGDSARGGAGSGL
FT                   GLAIVRRIVDAHGGEIHVANRPQGGLEAKIRLPLDSGE"
FT   gene            complement(230502..232031)
FT                   /locus_tag="Fbal_0210"
FT   CDS_pept        complement(230502..232031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0210"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="COGs: COG1866 Phosphoenolpyruvate carboxykinase
FT                   (ATP); InterPro IPR001272: IPR015994; KEGG: pha:PSHAa0228
FT                   phosphoenolpyruvate carboxykinase; PFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP); PRIAM:
FT                   Phosphoenolpyruvate carboxykinase (ATP); SPTR: A0Y6N4
FT                   Phosphoenolpyruvate carboxykinase; TIGRFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP); PFAM:
FT                   Phosphoenolpyruvate carboxykinase; TIGRFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74424"
FT                   /db_xref="GOA:E1SL30"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL30"
FT                   /protein_id="ADN74424.1"
FT                   /translation="MSVIWQNLTSAELVEAALARQEGILADNGALVVETGHRTGRSPKD
FT                   RFIVQEPTTADDIEWGNVNRPFDASKFDALWQRVEAHLDGQDHFLSELEVGADDDHYLP
FT                   LSVRTETAWHQLFARNLFIVPEHYNRANKPVWQILNVPSFQCDPERDGTHSDGVVIINF
FT                   AERKVLLAGMRYAGEMKKSMFSVQNFLLPAKGVLPMHCSANVGEAGDTTLFFGLSGTGK
FT                   TTLSADPKRFLIGDDEHGWAPGGVFNIEGGCYAKCIDLSQKNEPVIWDAIRFGSVLENV
FT                   VLDAKRTPDYRDSSKTQNSRAAYPLEHIEQRIEANRGAEPSAVVFLTCDVSGVLPPVAK
FT                   LSKEAAAYHFLSGYTAKVGSTEIGSSAAIESTFSTCFGAPFFPRPAGVYAELLMERIEQ
FT                   FGSQVYLVNTGWTGGPYGEGQRFDIPTTRAIVDAIVSGELAEVETEALPILNLSVPKAI
FT                   PGVDSRLLNPKQTWADAAKYDEYARQLASEFQQNFAKYDVSDAIVKAGPGA"
FT   gene            complement(232214..233074)
FT                   /locus_tag="Fbal_0211"
FT   CDS_pept        complement(232214..233074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0211"
FT                   /product="Hsp33 protein"
FT                   /note="COGs: COG1281 Disulfide bond chaperones of the HSP33
FT                   family; InterPro IPR000397; KEGG: swd:Swoo_4737 HSP33-like
FT                   chaperonin; PFAM: Hsp33 protein; SPTR: B1KN30 33 kDa
FT                   chaperonin; PFAM: Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74425"
FT                   /db_xref="GOA:E1SL31"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL31"
FT                   /protein_id="ADN74425.1"
FT                   /translation="MTDKLYRYLFDQADVRGELVQLNDTYQQMLSGHDYPAPVQRLLGE
FT                   MVAATSLLTAILKFEGEIAVQIQGEGPLRLLVVNGTHTQALRGVARFDGEVVEGDLQQM
FT                   VGKGHLVITITPKEGERYQGVVGLTEPTLAGCLEQYFAQSEQLRTRLWLHANGEKAAGM
FT                   LLQEMPASNVDADVEFEHLESLTDTIKAEELFGLDPEEVLHRLYHQESVQVFEPSDVEF
FT                   RCTCSRERSLAALATIDRAELDSIVEEQGEIAMHCDYCGAHYRFDAVDIGALGQGSGDV
FT                   SSTQH"
FT   gene            complement(233079..233486)
FT                   /locus_tag="Fbal_0212"
FT   CDS_pept        complement(233079..233486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0212"
FT                   /product="heat shock protein Hsp15"
FT                   /note="COGs: COG1188 Ribosome-associated heat shock protein
FT                   implicated in the recycling of the 50S subunit (S4
FT                   paralog); InterPro IPR002942; KEGG: aha:AHA_0567 heat shock
FT                   protein 15; PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; SPTR: Q44264 Heat shock
FT                   protein 15 homolog; PFAM: S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74426"
FT                   /db_xref="GOA:E1SL32"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL32"
FT                   /protein_id="ADN74426.1"
FT                   /translation="MSKPSPKEIASAVRLDKWLWAARFYKTRALAQEMISGGKVQVNGQ
FT                   RCKPGRKIEVGATLTLWQGNDEKELVIVGLSEKRLSAPLAQALYEETEASITRRTERAE
FT                   QRRLMADADPRASRPDKKQRRALLRFKNQDE"
FT   sig_peptide     complement(233394..233486)
FT                   /locus_tag="Fbal_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            233698..234627
FT                   /locus_tag="Fbal_0213"
FT   CDS_pept        233698..234627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0213"
FT                   /product="general secretion pathway protein C"
FT                   /note="COGs: COG3031 Type II secretory pathway component
FT                   PulC; InterPro IPR001639; KEGG: slo:Shew_3620 general
FT                   secretion pathway protein C; SPTR: A2V2N5 General secretion
FT                   pathway protein C; TIGRFAM: general secretion pathway
FT                   protein C; TIGRFAM: general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74427"
FT                   /db_xref="GOA:E1SL33"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL33"
FT                   /protein_id="ADN74427.1"
FT                   /translation="MDYSIAIQRLLAKVPQAALAKALTLGLALYALYLAALITWQLVPV
FT                   PEQTGPAWRPTAVTSSGGGESASLDGLLGLSLFGTPDKDPSANQPAQPVQRDLITDAPK
FT                   TTLRILLTGLVASSVEERGIAIIESGGSQETYGIGDKIKGTNASLHEVYADRAIILNQG
FT                   RYETLMLDGVEYTREMTSETQRLRETPQAEVDMRDDAETTQALEEAREAMLEDPGKLQD
FT                   YLAISPVKDRESGELRGYRLNPGKNRELFMQSGLQPNDLAVSMNGYDLTNMGESMQILS
FT                   QLADLEEVSLMVEREGQLTEVLFALPSQ"
FT   gene            234652..236823
FT                   /locus_tag="Fbal_0214"
FT   CDS_pept        234652..236823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0214"
FT                   /product="general secretion pathway protein D"
FT                   /note="COGs: COG1450 Type II secretory pathway component
FT                   PulD; InterPro IPR001814: IPR001775: IPR004846: IPR005644:
FT                   IPR 004845: IPR013356; KEGG: shm:Shewmr7_0151 general
FT                   secretion pathway protein D; PFAM: type II and III
FT                   secretion system protein; NolW domain protein; SPTR: A2V2N6
FT                   General secretion pathway protein D; TIGRFAM: general
FT                   secretion pathway protein D; PFAM: Bacterial type II/III
FT                   secretion system short domain; Bacterial type II and III
FT                   secretion system protein; TIGRFAM: general secretion
FT                   pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74428"
FT                   /db_xref="GOA:E1SL34"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL34"
FT                   /protein_id="ADN74428.1"
FT                   /translation="MTNLQRRLPWVRNSIAAGLLAGMAAFGGQALAAEAQYAANFKGTD
FT                   IQEFINIVGKNLNRTIIVDPTVRGKINVRSYDLLSEEQYYQFFLSVLQVYGYAVVEMPG
FT                   TNIIKVVKDKDAKDSNIRVADDAYPGEGDEMVTRIVPLYNVEAKQLAPLLRQLNNNAGG
FT                   GNVVNYDPSNVLMITGRAAVVNKLVEIVKRVDLQGDTKVEVVRLAYASAGEMVRIIDAL
FT                   YRGGGQQAATGTGSVPKVVADERTNSVVISGDERARQRAAALVRELDQEMQNSGNTKVV
FT                   YLKYAKAEDLQEVLSGFAESLQTEEGGSAQTQRRRNNEITIMAHADSNALVINAQPDQI
FT                   QTLESVIRQLDIRRAQVLVEAIIVEIAEGDEVGFGVQWGSADGGLIQYNTFGTTIGEVG
FT                   AGIWDARDVPGTEVCSPEGVCTTNPDQDGDITTLAAALSKVNGMAWGVAMGDFGALIQA
FT                   VAADSNSNVLATPSITTLDNQEASFIVGDEVPVITGSTSGSNNDNPFTTVERKEVGIKL
FT                   KVTPQINEGNAVQLEIEQEVSNVNGRTAVDVTFGKRTLTTTVLADSGETVVLGGLLNED
FT                   VQESVSKVPLLGDIPVIGHLFSSTSSKKTKRNLMIFIKPTIIRDGPSMTGIAGRKYNYF
FT                   RAQQLEQAERGINLMPNTDVPVLDEWVVPDGMSPEIHDILMRHQSGQSMSTPIRDQNEW
FT                   MQKALDGSAQPGDNATDAKEQPVEEKQND"
FT   sig_peptide     234652..234747
FT                   /locus_tag="Fbal_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            236816..238360
FT                   /locus_tag="Fbal_0215"
FT   CDS_pept        236816..238360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0215"
FT                   /product="type II secretion system protein E (GspE)"
FT                   /note="COGs: COG2804 Type II secretory pathway ATPase
FT                   PulE/Tfp pilus assembly pathway ATPase PilB; InterPro
FT                   IPR001482: IPR003593: IPR013369; KEGG: saz:Sama_0170
FT                   general secretion pathway protein E; PFAM: type II
FT                   secretion system protein E; SMART: AAA ATPase; SPTR: A2V2N7
FT                   General secretory pathway protein E; TIGRFAM: general
FT                   secretory pathway protein E; PFAM: Type II/IV secretion
FT                   system protein; TIGRFAM: general secretory pathway protein
FT                   E"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74429"
FT                   /db_xref="GOA:E1SL35"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL35"
FT                   /protein_id="ADN74429.1"
FT                   /translation="MTEAERQELLTELPEVPEQAEEILPGRLPKLPFAFARRFGVMLVP
FT                   QDEQLVLWYSPSARPKALLEARRLAGGPVALNGVDSNAFDIKLTELYQQDSSEAQQLME
FT                   DIGKDDDLASLADELPETEDLLDADDDAPIIRLINALLSESIKLGASDIHVETYEKELV
FT                   VRFRIDGVLQEVLKQQRKIAPLLVSRIKVMAKLDIAEKRVPQDGRISLRIGGRAVDVRV
FT                   STMPSSRGERVVMRLLDKNQSVLNLEQLGMAEGIRGQFNSLIRRPHGILLVTGPTGSGK
FT                   STTLYAGLTEINSRDRNILTVEDPIEYELEGIGQTQVNTKVDMTFARGLRAILRQDPDV
FT                   VMVGEIRDLETGQIAVQASLTGHLVLSTLHTNTASGAITRLQDMGIEPFLISSSLLGVL
FT                   AQRLVRTLCPECKSPYTPNARERSFLELGQGEQPTIYKAVGCEHCNFSGYKGRTGIHEL
FT                   LVVDDTIRELIHGGRGELAIEKHVRQTAPSIRQDGCGKVLAGMTTLEEVLRVTREE"
FT   gene            238364..239587
FT                   /locus_tag="Fbal_0216"
FT   CDS_pept        238364..239587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0216"
FT                   /product="general secretion pathway protein F"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR003004: IPR018076: IPR001992: IPR011850;
FT                   KEGG: shn:Shewana3_0153 general secretion pathway protein
FT                   F; PFAM: Type II secretion system F domain; SPTR: A2V2N8
FT                   General secretion pathway protein F; TIGRFAM: general
FT                   secretion pathway protein F; PFAM: Bacterial type II
FT                   secretion system protein F domain; TIGRFAM: general
FT                   secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74430"
FT                   /db_xref="GOA:E1SL36"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL36"
FT                   /protein_id="ADN74430.1"
FT                   /translation="MAAFEYQALDTRGRQVKGIIEADTARQARAQLREKQMMPLEVSPA
FT                   AQKEQRSKASSGGFTLFKPKIGATALALITRQLSTLVAGGLPLEECIKAVAEQSEQPRL
FT                   KSMLMAVRAKVVEGYGLAESMAEYPQVFDELYVAMVASGEKSGHLEVVLERLADYTERR
FT                   QELNAKLTQALVYPIILTVVAISVVVFLLTSVVPDVVSQFDHLGQALPATTQFLIDISD
FT                   FLQHYGLYMLIAIALFFVGFKQALRSPKFKLSWHETLLKLPVVGKVSRGLNTARFARTL
FT                   STLSSSGVPMLEAMKIASDVLLNLKVKNAVSEATGKVREGASLRASLQQTKLFPPMMLH
FT                   MIASGEKSGELDDMLARAADNQDREFEAQVSVALAVLQPLIVVVMAGIVLFIVISILQP
FT                   MLAMNQMI"
FT   gene            239609..240055
FT                   /locus_tag="Fbal_0217"
FT   CDS_pept        239609..240055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0217"
FT                   /product="general secretion pathway protein G"
FT                   /note="COGs: COG2165 Type II secretory pathway pseudopilin
FT                   PulG; InterPro IPR002416: IPR000983: IPR013545: IPR012902:
FT                   IPR 001120: IPR010054; KEGG: sse:Ssed_4355 general
FT                   secretion pathway protein G; PFAM: type II secretion system
FT                   protein G; SPTR: A2V2N9 General secretion pathway protein
FT                   G; TIGRFAM: general secretion pathway protein G; PFAM:
FT                   Prokaryotic N-terminal methylation motif; Bacterial type II
FT                   secretion system protein G; TIGRFAM: general secretion
FT                   pathway protein G; prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74431"
FT                   /db_xref="GOA:E1SL37"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL37"
FT                   /protein_id="ADN74431.1"
FT                   /translation="MKRRTPSRTAQRGFTLLEVMVVLVIIGILASIVAPNLIGSRDTAN
FT                   VQKAVTDISGLESALGMYYIHNNRFPTTDQGLEALVSRPNSGPEPRNYQEGGYIQRLPT
FT                   DPWGNNYSLVSPGERGRYDLCSAGPDMQLGSEDDICNYNLGDYQ"
FT   gene            240055..240672
FT                   /locus_tag="Fbal_0218"
FT   CDS_pept        240055..240672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0218"
FT                   /product="general secretion pathway protein H"
FT                   /note="InterPro IPR002416: IPR012902: IPR001120: IPR010053;
FT                   KEGG: shl:Shal_4170 general secretion pathway protein H;
FT                   SPTR: A2V2P0 General secretion pathway protein H; TIGRFAM:
FT                   general secretion pathway protein H; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain; general secretion
FT                   pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74432"
FT                   /db_xref="GOA:E1SL38"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL38"
FT                   /protein_id="ADN74432.1"
FT                   /translation="MVHAKPRQQASRQRGFTLLEILLVLVVMGLAAMSVTLVLGGDPRQ
FT                   EAMEKAGNEFRVVVGMALEEATLSGEQLGIVMEEDHYYFVRWNLDTEKWEPVGGDALYR
FT                   DRNWPEGVEASLELEGMPLVQEDEDTESEFGLDESLFELSEEEKRKNPEPQLLLMPSGE
FT                   MTGFTLLLLSDVPGQRDLELEMVGDPLGRINWLTELEEDPWQ"
FT   sig_peptide     240055..240174
FT                   /locus_tag="Fbal_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            240669..241037
FT                   /locus_tag="Fbal_0219"
FT   CDS_pept        240669..241037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0219"
FT                   /product="general secretion pathway protein I"
FT                   /note="InterPro IPR002416: IPR003413: IPR012902: IPR001120:
FT                   IPR 010052; KEGG: spl:Spea_0149 general secretion pathway
FT                   protein I; PFAM: type II secretion system protein I/J;
FT                   SPTR: A2V2P1 General secretion pathway protein I; TIGRFAM:
FT                   general secretion pathway protein I; PFAM: Prokaryotic
FT                   N-terminal methylation motif; Bacterial type II secretion
FT                   system protein I/J; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain; general secretion pathway
FT                   protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74433"
FT                   /db_xref="GOA:E1SL39"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL39"
FT                   /protein_id="ADN74433.1"
FT                   /translation="MKRSRGFTLLEVLVAMTVFATAAIAVINTANIQLSSIPILRERTL
FT                   AGYVAHNRMVDAQLENAFPEIGSRNGRTEMAERQWYWRQQVIKASDENLRLIRVSVSLD
FT                   DRFEGILAEVETYVAKPD"
FT   sig_peptide     240669..240743
FT                   /locus_tag="Fbal_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            241018..241761
FT                   /locus_tag="Fbal_0220"
FT   CDS_pept        241018..241761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0220"
FT                   /product="general secretion pathway protein J"
FT                   /note="COGs: COG4795 Type II secretory pathway component
FT                   PulJ; InterPro IPR012902: IPR001120: IPR010055; KEGG:
FT                   slo:Shew_3613 general secretion pathway protein J; SPTR:
FT                   A2V2P2 General secretion pathway protein J; TIGRFAM:
FT                   general secretion pathway protein J; PFAM: Prokaryotic
FT                   N-terminal methylation motif; Pseudopilin GspJ; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain;
FT                   general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74434"
FT                   /db_xref="GOA:E1SL40"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL40"
FT                   /protein_id="ADN74434.1"
FT                   /translation="MWPSRTDAVRGFTLLEMLLAIAIFAVIGVASATILQQVTKVDGVS
FT                   QGAQDDLKSLQLAMSMMERDFGQMIPRTSRSATTENRSALFEAGENLYDSDSEAMRFYR
FT                   LGWLNPQGQLPRGSIQQVVYRIKEEKLQRLYTLYPDPVEGEEAQELDLLDGVISLKFAF
FT                   YIDDKWQNKVDGNAFPKAVTVELETLDMGIIQRKFLLADGYGGITSDEDDNGSGNGSGS
FT                   GSGNGSGSGSGSGSSGGGTGGEEQN"
FT   sig_peptide     241018..241113
FT                   /locus_tag="Fbal_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            241761..242756
FT                   /locus_tag="Fbal_0221"
FT   CDS_pept        241761..242756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0221"
FT                   /product="General secretion pathway protein K"
FT                   /note="COGs: COG3156 Type II secretory pathway component
FT                   PulK; InterPro IPR005628; KEGG: sfr:Sfri_0112 general
FT                   secretion pathway protein K; PFAM: General secretion
FT                   pathway protein K; SPTR: A2V2P3 General secretion pathway
FT                   protein K; PFAM: General secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74435"
FT                   /db_xref="GOA:E1SL41"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL41"
FT                   /protein_id="ADN74435.1"
FT                   /translation="MRRSQSGMALLTVLLVLAVITALAAGMTQRSQMSVRRTTNMADFE
FT                   QAYWYARSSEALAKRVLKQDFEDSDGTIHLQQYWATANVVYPVEHGQIAGTIDDMRTCF
FT                   NLNALSQGLTEEERNRDPYQKPLAGRQFMAMLEALEIDNYYAEMVADRVRDFTDEDDRQ
FT                   DGTFGAEDAEYESRPVPYRTPNQLMAHHSELRAVLGVNKNLYRTLQDYVCAIPGEDTQQ
FT                   LNVNTLPVERAALLVGMLEGKISLSEAESVLQARPADGWDDVQKFWEEPAMQRLQVDAQ
FT                   AKSTLAVDSKYFRLRGAAKVENAVFRLESVMRRGGGDGLTVLTRQYGGQQ"
FT   sig_peptide     241761..241832
FT                   /locus_tag="Fbal_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            242753..243943
FT                   /locus_tag="Fbal_0222"
FT   CDS_pept        242753..243943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0222"
FT                   /product="general secretion pathway protein L"
FT                   /note="COGs: COG3297 Type II secretory pathway component
FT                   PulL; InterPro IPR007812; KEGG: saz:Sama_0177 general
FT                   secretion pathway protein L; PFAM: General secretion
FT                   pathway L; SPTR: A2V2P4 General secretion pathway protein
FT                   L; TIGRFAM: general secretion pathway protein L; PFAM:
FT                   General secretion pathway protein L (GspL); TIGRFAM:
FT                   general secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74436"
FT                   /db_xref="GOA:E1SLN7"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLN7"
FT                   /protein_id="ADN74436.1"
FT                   /translation="MSERLVIRLGSQAQQPIPWITWSEEQQTVISSGVLAGADGLASLS
FT                   ERAGGRPVEVLVDSSALTLTDVNLPAKAQRQAMKALPFMLEDELSEDVDKLHFVPGPRH
FT                   GDQLSVMVVAHAQLQLWLGWLAEAGLPVKKIVPDVLALARVEDTELSLMQLEQQLLVRT
FT                   GEGSGMVLDADWLPMMAESLQGEGRPWALFTPVALPEGIEAAEQPLELPMQALAQGFVR
FT                   TPANLLTGPYAPAKELSKLVSTWTKVGVAAAILLALVLVHRGVSWYQLEQERTALRAEG
FT                   ERIYRQLFPQEQRVPNPRGQLEAKVRALGGAGAGGQLLPMMAGLENAFAELPELRPTSI
FT                   RFDGNRSEIRLQLVGKDFAQFERFKELASGRFDVESGAINNDADGVSGIMTLRAKG"
FT   gene            243940..244431
FT                   /locus_tag="Fbal_0223"
FT   CDS_pept        243940..244431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0223"
FT                   /product="General secretion pathway M protein"
FT                   /note="COGs: COG3149 Type II secretory pathway component
FT                   PulM; InterPro IPR007690; KEGG: sse:Ssed_4349 general
FT                   secretion pathway M protein; PFAM: General secretion
FT                   pathway M protein; SPTR: A2V2P5 General secretion pathway M
FT                   protein; PFAM: General secretion pathway, M protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74437"
FT                   /db_xref="GOA:E1SLN8"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLN8"
FT                   /protein_id="ADN74437.1"
FT                   /translation="MNKYWQQAQQWWSDRTDQEQRLLTLLAPVLVIGLFYWLVWAPISN
FT                   GLDQAERAVQAERVALGQIKDNANRYISLQRGSGQRPGGGNLNQIASRTAAQAGLTIAR
FT                   MQPQGDKLQLWLEDTQFETLMGWLTELQQRQGVAVEALDITAANEPGLIQVRRLQLSQP
FT                   "
FT   gene            244442..245197
FT                   /locus_tag="Fbal_0224"
FT   CDS_pept        244442..245197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0224"
FT                   /product="type II secretion system protein N"
FT                   /note="InterPro IPR000645; KEGG: slo:Shew_3609 type II
FT                   secretion system protein N; PFAM: type II secretion system
FT                   protein N; SPTR: A2V2P6 Type II secretion system protein N;
FT                   PFAM: Bacterial type II secretion system protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74438"
FT                   /db_xref="GOA:E1SLN9"
FT                   /db_xref="InterPro:IPR000645"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLN9"
FT                   /protein_id="ADN74438.1"
FT                   /translation="MRVVKYTLLGVVLYLLFLVINVPAALVWQFAPVPNGIKASGLNGT
FT                   LWQGQAEQLTVAGRQLEQVSWELHPSQLLTGQAGLSFRLDGGVARGQGSVSYGLSGLAV
FT                   DNLRLSAPLPWLLGNTRLPFRTKVGGNATLSLNDSAQGTPWCDRLSGRVLVDGLDVNNQ
FT                   FGQYPLGNLAGTLSCDQGNLKLVMDEAENTIGVQGEALLLADNQVKVAAQIKPTDSQPS
FT                   DLRQALTFLGKPNADGAYPINYNGPIPGL"
FT   sig_peptide     244442..244513
FT                   /locus_tag="Fbal_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            245205..245759
FT                   /locus_tag="Fbal_0225"
FT   CDS_pept        245205..245759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0225"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR020476: IPR000086: IPR020084; KEGG:
FT                   swd:Swoo_4718 ADP-ribose diphosphatase NudE; PFAM: NUDIX
FT                   hydrolase; SPTR: A2V2Q2 NUDIX hydrolase; PFAM: NUDIX
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74439"
FT                   /db_xref="GOA:E1SLP0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP0"
FT                   /protein_id="ADN74439.1"
FT                   /translation="MSKSRKPQILDARVVAQSRLFTVEQLDLRFANGAQRQYERMRGGN
FT                   RGAVMVVPMLDEHTMLLVREYAAGTHSYELGFPKGLIDPGEAMLVAANRELQEEIGYAA
FT                   RDLTHLMQVSLAPGYFASKMEILLARDLYPSQLIGDEPEPLELVPWSIHEADKLLAQED
FT                   FSESRSISALFLALKQLKLTR"
FT   gene            245788..246621
FT                   /locus_tag="Fbal_0226"
FT   CDS_pept        245788..246621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0226"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="COGs: COG1218 3'-Phosphoadenosine 5'-phosphosulfate
FT                   (PAPS) 3'-phosphatase; InterPro IPR000760: IPR006240; KEGG:
FT                   ppr:PBPRA3469 putative CysQ protein; PFAM: inositol
FT                   monophosphatase; SPTR: A3EJE2 CysQ protein; TIGRFAM:
FT                   3'(2'),5'-bisphosphate nucleotidase; PFAM: Inositol
FT                   monophosphatase family; TIGRFAM: 3'(2'),5'-bisphosphate
FT                   nucleotidase, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74440"
FT                   /db_xref="GOA:E1SLP1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP1"
FT                   /protein_id="ADN74440.1"
FT                   /translation="MVTPLHTLLEPVITIARDAGQQIRTIYEAGQYQSLTKSDNTPVTS
FT                   ADLAAHEWIVTALRTLTPDTPILSEEDADIPLSTRQHWNEYWLIDPLDGTQEFIAGSGE
FT                   FAVNIALVRDHQPVLGVIYAPMSEVWYYACQGHGAYKRHGDQTEAIHSRDVGPGDALKI
FT                   AVSRRQRREAVMSRLDEQREYLLLPFGSASLKSCMVAEGTADCYLRLGPTGEWDTGASQ
FT                   CIVEEAGGRIVDTCYQPLSYNERESLENPNYMVLGCQSLPWQEILPPGPECYSAE"
FT   gene            complement(246656..247756)
FT                   /locus_tag="Fbal_0227"
FT   CDS_pept        complement(246656..247756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0227"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="COGs: COG2603 ATPase; InterPro IPR001763: IPR017582;
FT                   KEGG: sfr:Sfri_0119 tRNA 2-selenouridine synthase; SMART:
FT                   Rhodanese domain protein; SPTR: Q089T3 tRNA 2-selenouridine
FT                   synthase; TIGRFAM: tRNA 2-selenouridine synthase; PFAM:
FT                   Rhodanese-like domain; TIGRFAM: tRNA 2-selenouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74441"
FT                   /db_xref="GOA:E1SLP2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP2"
FT                   /protein_id="ADN74441.1"
FT                   /translation="MSEMIPQSEYRRLLLDDVPMIDLRAPVEFAKGAFPGSVNCPLMTD
FT                   SEREAVGTRYKEQGQNAAIALGHQLVNGAVKQSRVDAWVSQVTARPDTVLYCFRGGLRS
FT                   QLSQGWLAEAGYQRPYIEGGYKGMRGFLINQTDKVAEQADLLILGGMTGCGKTDFLNER
FT                   RDSVDLEGLANHRGSSFGRRIGGQPSQIDFENRLAIELMRHQDAGHRQLLLEDESRLIG
FT                   RESIPLTLFDAMTQAPRVMLEVSNEARIAQITKDYVTTMANDYLAQDAEQGFAEFENYL
FT                   LGSLDRIRRRLGGALHQDLRQRMTDALAEQARSGNVDGHSGWISLMLSHYYDPMYRYQL
FT                   EKMTAPVLFQGSPEAVHQFLNERGAR"
FT   gene            complement(247753..248787)
FT                   /locus_tag="Fbal_0228"
FT   CDS_pept        complement(247753..248787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0228"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /note="COGs: COG0709 Selenophosphate synthase; InterPro
FT                   IPR010918: IPR000728: IPR004536; KEGG: sfr:Sfri_0120
FT                   selenide, water dikinase; PFAM: AIR synthase related
FT                   protein; AIR synthase related protein domain protein; SPTR:
FT                   Q0I0C9 Selenide, water dikinase; TIGRFAM: selenide, water
FT                   dikinase; PFAM: AIR synthase related protein, N-terminal
FT                   domain; AIR synthase related protein, C-terminal domain;
FT                   TIGRFAM: selenium donor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74442"
FT                   /db_xref="GOA:E1SLP3"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP3"
FT                   /protein_id="ADN74442.1"
FT                   /translation="MSHIKLTEYSHGAGCGCKISPKVLDTILASQLPSFTDPRLVVGNA
FT                   SRDDAAVYALDDQTGIISTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGTPMMAIAIL
FT                   GWPVNLLAPEIAQQVVEGGRAACRDAGILLAGGHSIDAPEPIFGLAVTGQVPLSRLKRN
FT                   DTAKVGDKLYLTKPLGIGILTTAQKQKKLADEDSQIAIDAMCQLNTIATKLAPIAGVNA
FT                   LTDVTGFGLAGHLIEVCQGAKLHARIDFDALPRLDQVDHYLARGCVPGGTGRNFDSYGQ
FT                   HIGPLSDDQRALLCDPQTSGGLLVAVNAEAEAEVVACLRDAGLPHQCIGELYQGGDAPL
FT                   VTLR"
FT   gene            248964..250283
FT                   /locus_tag="Fbal_0229"
FT   CDS_pept        248964..250283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_3284 succinyl-CoA synthetase, alpha
FT                   subunit; SPTR: A3WP26 Uncharacterized conserved secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74443"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP4"
FT                   /protein_id="ADN74443.1"
FT                   /translation="MQFKTLGLALCALLLSACSDSSSTKNFTGTLRFATFHVDMAYDDS
FT                   QGYFTLLQQTGATGDQQDPRLANLAAILQQTYQERQPDVLLLTGFSTSVGEGGRADDTA
FT                   AVQFEQNYLSQPQASDLTGLSYPYRYVASTNSGQFIPYDIDGDGKLSLPEDAQGPGHFH
FT                   GQNSFVLLSKYALDAEQARTFRQFKWQDVNGVSKPKRDDGTELDDDAWAALSVMDTNFV
FT                   DIAMRLPDGRQISLLLTQLVDQQPAEGALRSGWAQQRNGAQLDFIADYISDRNDGDYLV
FT                   DDAGRRGGANLNRPFVLMGNLNNDEDPFRLTVQTDWADTYEINSSAIRKVLSDSYLLGS
FT                   NGRFNTDSLTPASFGAEEYKMGVGSSHIHPQVWTSLSGMRFSYVLPHKDLHIADSGVFW
FT                   PAIGESGFQWLYDDSGASDPALSSHERLVWVDVDFGRSVN"
FT   sig_peptide     248964..249026
FT                   /locus_tag="Fbal_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            250441..253038
FT                   /locus_tag="Fbal_0230"
FT   CDS_pept        250441..253038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0230"
FT                   /product="peptidase S45 penicillin amidase"
FT                   /note="COGs: COG2366 Protein related to penicillin acylase;
FT                   InterPro IPR002692; KEGG: shm:Shewmr7_3263 peptidase S45,
FT                   penicillin amidase; PFAM: peptidase S45 penicillin amidase;
FT                   SPTR: A2UWX6 Peptidase S45, penicillin amidase; PFAM:
FT                   Penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74444"
FT                   /db_xref="GOA:E1SLP5"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP5"
FT                   /protein_id="ADN74444.1"
FT                   /translation="MTRKYPLILAGILTSLTLSGCSDDKDDVAVTPPPPPVVPEPEPEP
FT                   KPELVVFAPEGALEARIRRTEFGVPHITADNLESLAFGSGYAQATDHLCLLADGFIKAN
FT                   SERSKYFGPHKRIDYATGLPLVEDNQNLINDFGHLALGVRASAEAKFDALPDRSRAMLN
FT                   GFAQGYNLYLTDLASGAIETPNLPCAGQPWVKPVEGVDLLTYLFSIAHLPGSANFFDLI
FT                   FFANPGDGNEYLPVPVTPMTAATTAQYQDLTARAQRQAAQLTTPVLNERDLGSNGWGLG
FT                   ADVTENGKGIVLGNPHFPHTGQLRFWQSHLTIPDQMDVMGGSLVGMPGAINIGFNEHLA
FT                   WTHTFSTAEHFVLYQLALAEGDRMTYLLDGEPMPITATPHQIEVNVGGGQTMVLEKTLY
FT                   TTAKGPMVEAPPQAAPFTWNDNVAFFVQDANTANVDVLEHWLSMNLATDLESFQQAFRD
FT                   YDGVIFNNTMYADAEGNAFYIDDSTVPHLSETAKVALTSDRVLITLKEQAGFTILPGYD
FT                   STYGFDGAVPYEEAPKLLRSDFVQNSNNSFWSTNPAAPIEGISPLYGPERGEQSLRTRM
FT                   ALTLMSDARGDDDKFNRDEVEAALLNNRAYLAELVLDDLLSQCEAQGTTPVVVNESLSV
FT                   NVAPACAALAQWNGAQNLDSVAGALLREFGYQFNSGLLSVPFDYTDPMNTPNTLVTDGR
FT                   ALVALAVASENLTRNGFALDATLGSLQFVEKSLPDGSASGARFPWSGANNFEGGFNVFS
FT                   YSASGGDDTLLPQHAYAPAIDVVTGAPMRSRLSTEGYHVRYGSSWMMVVGFEDDGPVAR
FT                   GLLSYSESNNPLSPHWNDQTRYYSENTALRPLRFTEDAIAEALLSDQTIRHQQ"
FT   sig_peptide     250441..250506
FT                   /locus_tag="Fbal_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(253097..253978)
FT                   /locus_tag="Fbal_0231"
FT   CDS_pept        complement(253097..253978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0231"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073;
FT                   KEGG: sfr:Sfri_3624 alpha/beta hydrolase fold; PFAM:
FT                   alpha/beta hydrolase fold; SPTR: A0Y5R6 Hydrolase,
FT                   alpha/beta fold family protein; PFAM: alpha/beta hydrolase
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74445"
FT                   /db_xref="GOA:E1SLP6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP6"
FT                   /protein_id="ADN74445.1"
FT                   /translation="MTGSAPTLPPTLDQWQAAGATFHWRGHALFYRYQPNPGKPVLLLV
FT                   HGFPSASWDWWALWPTLSQHYQLLSADMLGFGLSDKPHPHRYCIADQARMLLDLMAELG
FT                   LGAAHILAHDYGDTVTQELLAQQLEGSTGVHWHSVTLLNGGLFPEAHRPLPIQRLMAGP
FT                   VGPLLARLLGERRFKASLRRIWGETPPTEAELDTLWQLLCLKRGQRVIPGLIQYMAERR
FT                   QHRTRWVDALQRTEGPLTLIDGLADPISGQTLVDRFRQLCPHGRVVTLPGVGHYPQLEA
FT                   PQAVLEAMALSD"
FT   gene            complement(253984..255105)
FT                   /locus_tag="Fbal_0232"
FT   CDS_pept        complement(253984..255105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0232"
FT                   /product="Delta-9 acyl-phospholipid desaturase"
FT                   /EC_number="1.14.19.1"
FT                   /EC_number="1.14.19.-"
FT                   /note="COGs: COG1398 Fatty-acid desaturase; InterPro
FT                   IPR015876: IPR005804; KEGG: aha:AHA_0366 fatty acid
FT                   desaturase family proteiin; PFAM: fatty acid desaturase;
FT                   PRIAM: Stearoyl-CoA 9-desaturase; SPTR: A2V2R0 Fatty acid
FT                   desaturase; PFAM: Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74446"
FT                   /db_xref="GOA:E1SLP7"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP7"
FT                   /protein_id="ADN74446.1"
FT                   /translation="MTDNKPRLILVNSAIFALTFLTALIAVPLYGLWQGYQSEALWVAL
FT                   LFWAWSGLSITAGYHRLWSHKAYSTHPVVQWVLAIGGAMAMQNSILHWASDHRRHHKHV
FT                   DDNERDPYSAGRGFWYSHIGWMLREYQQVTPDIYNNVRDLQKNPIVMNQHNHYGKWVFA
FT                   TNIALPAFIGWLTGDILGMLLLAGVLRLVLVHHGTFFINSLAHIWGSQPYSDKHSSRDN
FT                   GFIALATFGEGYHNFHHTFEYDYRNGIRWWHFDPTKWLIRGLAKLGLAKDLRRVPTERI
FT                   ESARLAMQLQSSQRLLAEHHSASEWLAKLEEEYERLLAELQRYYGEKQRQLKLHKHELD
FT                   RSTRARLNELRQTFQQQKRQWQALRAQLHAQVA"
FT   sig_peptide     complement(255013..255105)
FT                   /locus_tag="Fbal_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            255247..255840
FT                   /locus_tag="Fbal_0233"
FT   CDS_pept        255247..255840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0233"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: shl:Shal_4155 DNA-binding
FT                   transcriptional repressor FabR; PFAM: regulatory protein
FT                   TetR; SPTR: A2V2R1 Transcriptional regulator, TetR family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74447"
FT                   /db_xref="GOA:E1SLP8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP8"
FT                   /protein_id="ADN74447.1"
FT                   /translation="MGIRAQQKEKTRRALVDAAFNQLSAERSFSSLSLREVAREAGIAP
FT                   TSFYRHFKDMEELGLTMVDEGGLTLRQLMRKGRQRAAEGGSIVRVSIETFIEFIDSNPN
FT                   VFRLLLRERSGTSAAFRSAVQREIEHFTAELIEYLQATTDLTPEVAHAQAEAMVILVFS
FT                   AGAEAMDMNPKKRKVLAERLVLQLRMIIKGGSAL"
FT   gene            complement(255880..256677)
FT                   /locus_tag="Fbal_0234"
FT   CDS_pept        complement(255880..256677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0234"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; KEGG: sfr:Sfri_3687 hypothetical protein; SPTR:
FT                   A2UY70 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74448"
FT                   /db_xref="GOA:E1SLP9"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP9"
FT                   /protein_id="ADN74448.1"
FT                   /translation="MVRAVSLNAGMKEKATIFFPGKVDDSILTFFLTHGESVNLAKGDT
FT                   VPKKTLINSFVFLREGLLFYTTRTNNYSKPKFITVIFPNRLADYHLLFDDNCTCCKGIF
FT                   AARDSEIIVINKQKIRELVQTRPDLFSQFTLDAAYYTERQTTLAVFLLTSSPEDKLLKF
FT                   LFDTLVVLDTDFSQQWLTVHLKLTRQEIADILHISVIKLDLMLGELKKQGLVRRVGNKL
FT                   QVRVDYFHPLSPCPLGREDANGCQSNNMSKFRAGNLITLNNGG"
FT   gene            257111..259657
FT                   /locus_tag="Fbal_0235"
FT   CDS_pept        257111..259657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0235"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /note="COGs: COG0243 Anaerobic dehydrogenase typically
FT                   selenocysteine-containing; InterPro IPR006656: IPR006963:
FT                   IPR006657: IPR006655: IPR 011888: IPR006311; KEGG:
FT                   sbn:Sbal195_2228 anaerobic dimethyl sulfoxide reductase
FT                   subunit A; PFAM: molybdopterin oxidoreductase;
FT                   molybdopterin oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region; SPTR: A2UY67 Anaerobic
FT                   dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family;
FT                   TIGRFAM: anaerobic dimethyl sulfoxide reductase, A subunit,
FT                   DmsA/YnfE family; PFAM: Molybdopterin oxidoreductase;
FT                   Molydopterin dinucleotide binding domain; Molybdopterin
FT                   oxidoreductase Fe4S4 domain; TIGRFAM: anaerobic dimethyl
FT                   sulfoxide reductase, A subunit, DmsA/YnfE family;
FT                   molybdopterin guanine dinucleotide-containing S/N-oxide
FT                   reductases; Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74449"
FT                   /db_xref="GOA:E1SLQ0"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ0"
FT                   /protein_id="ADN74449.1"
FT                   /translation="MERRNFLKLSAAFGATATVSGCGNSGSDKPTEPPKPPVESGEVLN
FT                   WSACLVNCGSNCPIKVYSQDGIITRIEADHETTDEYGVNHQVRACPRGRSLRQRTYATD
FT                   RLRTPMKRVGKRGSGEFVAISWEQAHSEVGAKLKQISENYGPEAIYMHYGTGAYYGFSS
FT                   NVATWGRLLNLNGGFLDHHWDYSWAGIYAACMATYGDQWDSLVGSSLSDIVHSDLFVGF
FT                   GFNPNEIRMSGSGEGYDFVKALEQNQKGIKVWMVEPRYTDSMRGNEDEWLAIRPGTDAA
FT                   LVEAVIYEMIQSGWVDQNAKSFLDRYAVGYDRASLVQTKAAIEQNDDAFIASHAQYIDP
FT                   DQNYHDYIMGQGAFAADGAKTPQWAAAICGVPETRIKQLAQAIMAADAPYIIAGAGISR
FT                   HANGDQATRAVYTLAIMTGKIGQAGVNSGAMPLTYGFGVAGMPTGTNPVDITIPVFTWS
FT                   EAVVRGETFTGTNKGVRYKVSGTQERVDNNPAALGTNIKAIINCAGNALINQHSDSNAT
FT                   AAILEDESLCELIVVSDCWMTPSAKFADYLLPDSTWLESEDYASDSYAAGQMAYATFMS
FT                   TSLKPLGESRSMFDICAGIADAMGVGEQFTEGLTGKQWCEKLYQKTREMHPDVDMPESY
FT                   EAAQKVGVFRKYMPAPYVAYQAYIQDPEANPRPTLSGKFEIFSLSLARKAATWELPSGD
FT                   QITPLPQYVVTWEGYEDQEAIDAGYPLQLCGYHTKGRTHSSFHNVPWLREAVEDAVWLN
FT                   PLDAAERGINDGDRVHVYNPRGTIELPARLTPRVTPGVCALGQGAWYQPDPSGKLGPSG
FT                   HVVDIGGCINTLTKVHPSPVTKGNPQHTNRVQVQKA"
FT   sig_peptide     257111..257191
FT                   /locus_tag="Fbal_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            259670..260347
FT                   /locus_tag="Fbal_0236"
FT   CDS_pept        259670..260347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0236"
FT                   /product="dimethylsulfoxide reductase, chain B"
FT                   /note="COGs: COG0437 Fe-S-cluster-containing hydrogenase
FT                   components 1; InterPro IPR001450: IPR017900: IPR014297;
FT                   KEGG: sbn:Sbal195_2227 dimethylsulfoxide reductase, chain
FT                   B; PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: A2UY66 4Fe-4S ferredoxin, iron-sulfur
FT                   binding; TIGRFAM: dimethylsulfoxide reductase, chain B;
FT                   PFAM: 4Fe-4S binding domain; TIGRFAM: DMSO reductase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74450"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ1"
FT                   /protein_id="ADN74450.1"
FT                   /translation="MSNSTQYGFYFDSSKCTGCKTCHIACKDRMVGITRNKDDVVNAGV
FT                   ADLPGMLWRRVYEYGGGSWSQNSDNSYNQNVFAYYASLGCNHCSEPVCVKTCPTGAMHK
FT                   REQDGLVLVDESLCIGCQSCAQACPYDAPQIDAARKIMTKCDGCHDRLEQGRKPICVES
FT                   CPLRALDFDTMENLRHRYGEGDGHFAPLPAASITQPNLIVKAPKHAQASGSSAGKVLNV
FT                   REV"
FT   gene            260415..261077
FT                   /locus_tag="Fbal_0237"
FT   CDS_pept        260415..261077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0237"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="COGs: COG3381 Uncharacterized component of anaerobic
FT                   dehydrogenase; InterPro IPR010395; KEGG: shm:Shewmr7_0264
FT                   cytoplasmic chaperone TorD family protein; PFAM:
FT                   cytoplasmic chaperone TorD family protein; SPTR: A2UY65
FT                   Cytoplasmic chaperone TorD; PFAM: Nitrate reductase delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74451"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ2"
FT                   /protein_id="ADN74451.1"
FT                   /translation="MLAKSQLEGLEAGAHLFHSIFMKAPERHTVNQLQDKSLISAWSEI
FT                   GGAGERTETGLALLLQFVEQWQASDMQLVALKLDFSRLFIGPGQPLAPPWGSVYLDASS
FT                   LLNSESTLAFAEFLRQNDIRVAQQSNEPLDHIGIQFVVLAFLLSQLAEKPGCDTALNRS
FT                   KTLLSDFMLPWADRCLELAEYQANTQYYKGFVVLARQYLLHLRRLFGVGDTAVPLFH"
FT   gene            261077..261544
FT                   /locus_tag="Fbal_0238"
FT   CDS_pept        261077..261544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0630 hypothetical protein; SPTR:
FT                   A2UWL2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74452"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ3"
FT                   /protein_id="ADN74452.1"
FT                   /translation="MSFIGAVGQQWQKAQLSQRLQLALMPRPSLNYLFTGATDRETLSH
FT                   LVAALVFSEGKPDWLVLDAEHERQPLSAWDTMDCLLLSCTLLSTRACSPEGLSQAEQLV
FT                   MTLAEVWASELERHVDHGDAKRDGCEALLRLIAALKVQQQVRRQRSRNMTG"
FT   gene            complement(261576..262670)
FT                   /locus_tag="Fbal_0239"
FT   CDS_pept        complement(261576..262670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0239"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="COGs: COG2265 SAM-dependent methyltransferase
FT                   related to tRNA (uracil-5-)-methyltransferase; InterPro
FT                   IPR010280: IPR011869; KEGG: vpa:VP2939 tRNA
FT                   (uracil-5-)-methyltransferase; PFAM:
FT                   (Uracil-5)-methyltransferase; PRIAM: tRNA
FT                   (uracil-5-)-methyltransferase; SPTR: Q8DD43 tRNA
FT                   (uracil-5-)-methyltransferase; TIGRFAM: tRNA
FT                   (uracil-5-)-methyltransferase; PFAM: tRNA
FT                   (Uracil-5-)-methyltransferase; TIGRFAM: tRNA
FT                   (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74453"
FT                   /db_xref="GOA:E1SLQ4"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ4"
FT                   /protein_id="ADN74453.1"
FT                   /translation="MDLAALDPRQYQTQLDEKCERMRALFAPFNAPELEVFPSEPEHYR
FT                   MRAEFRVWHDGDDLNYIMFDQTQQAKVEVTQYLPASALINEYMPRLIEALKPDPVLRRK
FT                   LFQVDFLSTLSGELVISLLYHRQLDDAWCDAIRELRARWDNKVHFIGRARKQKVTLEQD
FT                   YVDEVLHVHGQPYHYRQIENAFTQPNGKVAEKMLEWAVDATRNSDGDLLELYCGNGNFS
FT                   LALAQNFERVLATELAKPSVEAAQYNIAKNNIDNVTILRMSAEDFTDAINGVREFRRLK
FT                   GIDLSGYRCNTIFVDPPRAGLDPATEKMVQGYDRILYISCNPETLLENLKTLSQTHKLS
FT                   RLALFDQFPYTHHMEAGVLLERIK"
FT   gene            262841..263617
FT                   /locus_tag="Fbal_0240"
FT   CDS_pept        262841..263617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0240"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="COGs: COG0796 Glutamate racemase; InterPro
FT                   IPR015942: IPR018187: IPR004391; KEGG: asa:ASA_0077
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase;
FT                   PRIAM: Glutamate racemase; SPTR: Q12SP7 Glutamate racemase;
FT                   TIGRFAM: glutamate racemase; PFAM: Asp/Glu/Hydantoin
FT                   racemase; TIGRFAM: glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74454"
FT                   /db_xref="GOA:E1SLQ5"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ5"
FT                   /protein_id="ADN74454.1"
FT                   /translation="MGAILLFDSGLGGLTIYQHIRQALPNRRYRYLADNARFPYGELAP
FT                   DELVQGCVDLIRAQMAEEPIDLVVIACNSASTLVLEPLRAAIDCPVVGVVPAIKPAAAM
FT                   SHRKVIGLLATPGTVRRPYTDELAAQFAADCELVRLGSSELVWLAEQKLAGQPVSCSQL
FT                   EPILGEFLQRQPDVVVLGCTHFPLLREEIGQVLGPQVRLIDSGAAIARRVSQLLGGEEK
FT                   EGAVFAASFFHTGEAPAPSATVYLREQGFSNVEKWR"
FT   gene            264030..265570
FT                   /locus_tag="Fbal_R0006"
FT   rRNA            264030..265570
FT                   /locus_tag="Fbal_R0006"
FT                   /product="16S ribosomal RNA"
FT   gene            265863..268749
FT                   /locus_tag="Fbal_R0007"
FT   rRNA            265863..268749
FT                   /locus_tag="Fbal_R0007"
FT                   /product="23S ribosomal RNA"
FT   gene            268843..268956
FT                   /locus_tag="Fbal_R0008"
FT   rRNA            268843..268956
FT                   /locus_tag="Fbal_R0008"
FT                   /product="5S ribosomal RNA"
FT   gene            268970..269046
FT                   /locus_tag="Fbal_R0009"
FT   tRNA            268970..269046
FT                   /locus_tag="Fbal_R0009"
FT                   /product="tRNA-Asp"
FT   gene            270212..271240
FT                   /locus_tag="Fbal_0241"
FT   CDS_pept        270212..271240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0241"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="COGs: COG0812 UDP-N-acetylmuramate dehydrogenase;
FT                   InterPro IPR006094: IPR011601: IPR003170; KEGG:
FT                   tau:Tola_2793 UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase domain protein; FAD linked oxidase domain
FT                   protein; PRIAM: UDP-N-acetylmuramate dehydrogenase; SPTR:
FT                   P57952 UDP-N-acetylenolpyruvoylglucosamine reductase;
FT                   TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine reductase;
FT                   PFAM: FAD binding domain;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal
FT                   domain; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74455"
FT                   /db_xref="GOA:E1SLQ6"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ6"
FT                   /protein_id="ADN74455.1"
FT                   /translation="MPASVIFDADLAEHHTFGISVRSRALMVVDSVAALANAYQAEAWR
FT                   ALPKLVVGGGSNLLFTEDFDGLVILNRIAGREVSESADHFHLHLGAGENWHEVVAWSLE
FT                   SGMPGLENLALIPGTVGAAPVQNIGAYGVELADFCEYVDYWDCESAERVRLSAEQCHFG
FT                   YRESVFKAGLKGRAVVVAVGLKLSKHWQPKLGYGPLSALGVDTTPQAIFDEVCRVRASK
FT                   LPDPSALGNAGSFFKNPVISETLFSHLQQGHPQIPSYPAGEGQIKVPAGWLIDNAGLKG
FT                   YQVGDAAVHTEQALVLVNRDKASSAEVTALARHVVATVSERYGIELEPEVRILDAQGKA
FT                   GW"
FT   gene            271244..272206
FT                   /locus_tag="Fbal_0242"
FT   CDS_pept        271244..272206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0242"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="COGs: COG0340 Biotin-(acetyl-CoA carboxylase)
FT                   ligase; InterPro IPR003142: IPR013196: IPR004143:
FT                   IPR004408; KEGG: aha:AHA_4040 BirA bifunctional protein;
FT                   PFAM: biotin/lipoate A/B protein ligase; Helix-turn-helix
FT                   type 11 domain protein; biotin protein ligase domain
FT                   protein; PRIAM: Biotin--[acetyl-CoA-carboxylase] ligase;
FT                   SPTR: P37416 Bifunctional protein birA; TIGRFAM:
FT                   biotin/acetyl-CoA-carboxylase ligase; PFAM: HTH domain;
FT                   Biotin protein ligase C terminal domain; Biotin/lipoate A/B
FT                   protein ligase family; TIGRFAM: birA,
FT                   biotin-[acetyl-CoA-carboxylase] ligase region; BirA biotin
FT                   operon repressor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74456"
FT                   /db_xref="GOA:E1SLQ7"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ7"
FT                   /protein_id="ADN74456.1"
FT                   /translation="MLSTIRQQLIAALADGQFHSGAHLAEQLGVSRAAIHNHIEALSTL
FT                   GLDLYRVKGKGYRLAQPLSLLSADHIGVAERPAPLHLLWQVDSTNAFLLARAKQCRNGE
FT                   ACLAEMQTGGRGRRGRTWVSPIASHLYLSYFWRLEQGLAAAGGLSLAVGVMLCEALESL
FT                   GVSGLTLKWPNDIYLNGRKLAGILVEVSGQQGEACELVIGCGVNVTMPESMAALIDQPW
FT                   ADLAGEGIAPSRSELARRVLEHLDAGMRDFELEGLTPFVARWLARDQFADTPVKLLLGN
FT                   QEVIGVARGIDPQGHLLLALPDGTVKRFAGGELSLRPRD"
FT   gene            complement(272203..273141)
FT                   /locus_tag="Fbal_0243"
FT   CDS_pept        complement(272203..273141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0243"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COGs: COG1072 Panthothenate kinase; InterPro
FT                   IPR004566; KEGG: slo:Shew_0143 pantothenate kinase; SPTR:
FT                   A3Q967 Pantothenate kinase; TIGRFAM: pantothenate kinase;
FT                   PFAM: Phosphoribulokinase / Uridine kinase family; TIGRFAM:
FT                   pantothenate kinase, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74457"
FT                   /db_xref="GOA:E1SLQ8"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ8"
FT                   /protein_id="ADN74457.1"
FT                   /translation="MNAQTKLGAYQGFSRREWAALRDAVPLPLSEEELERLRGINESVS
FT                   LEEVEAVYLPLSRLLNLYVHSSQRRGDVLQQFLGRRPSKGPYIISVAGSVAVGKSTTAR
FT                   ILQALLQRWPEHPQVELVTTDGFLYPLEELKRRDLLKRKGFPESYDIRMLLDFVKEVKS
FT                   GRRTAAPLYSHLSYDRIENTQQEINNPDILILEGLNVLQSGMDYPDGDRPFVSDFVDFS
FT                   IYVDAPESLLKSWYIDRFISFRDGAFKDPNSYFHHYAQLSEGEARKTASKIWDDINGPN
FT                   LNNNILPTRERATLILSKGEHHRIEKIRLRG"
FT   gene            273365..273440
FT                   /locus_tag="Fbal_R0010"
FT   tRNA            273365..273440
FT                   /locus_tag="Fbal_R0010"
FT                   /product="tRNA-Thr"
FT   gene            273446..273530
FT                   /locus_tag="Fbal_R0011"
FT   tRNA            273446..273530
FT                   /locus_tag="Fbal_R0011"
FT                   /product="tRNA-Tyr"
FT   gene            273564..273638
FT                   /locus_tag="Fbal_R0012"
FT   tRNA            273564..273638
FT                   /locus_tag="Fbal_R0012"
FT                   /product="tRNA-Gly"
FT   gene            273648..273723
FT                   /locus_tag="Fbal_R0013"
FT   tRNA            273648..273723
FT                   /locus_tag="Fbal_R0013"
FT                   /product="tRNA-Thr"
FT   gene            273822..275006
FT                   /locus_tag="Fbal_0244"
FT   CDS_pept        273822..275006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0244"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="COGs: COG0050 GTPase - translation elongation
FT                   factors; InterPro IPR000795: IPR004160: IPR004161:
FT                   IPR005225: IPR 004541; KEGG: slo:Shew_0156 elongation
FT                   factor Tu; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain protein; elongation factor Tu
FT                   domain 2 protein; SPTR: A3Q980 Elongation factor Tu 2;
FT                   TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: Elongation factor Tu C-terminal
FT                   domain; Elongation factor Tu domain 2; Elongation factor Tu
FT                   GTP binding domain; TIGRFAM: small GTP-binding protein
FT                   domain; translation elongation factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74458"
FT                   /db_xref="GOA:E1SLQ9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ9"
FT                   /protein_id="ADN74458.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITNVLAKAHGGQAR
FT                   AFDQIDNAPEERERGITIAASHVEYDTDTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCAATDGPMPQTREHILLSRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDTPVIQGSALKALEGDAQWEAKILELADALDTYIPEPERAVDGAFLLPIEDVFSIQ
FT                   GRGTVVTGRVERGIVKVGDEVEIVGIKETAKTTCTGVEMFRKLLDEGRAGENCGVLLRG
FT                   TKREEVERGQVLAQPGSITPHTKFTSEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITG
FT                   TIELPEGVEMVMPGDNIQMTVTLIAPIAMEEGLRFAIREGGRTVGAGVVAKIVE"
FT   gene            275229..275600
FT                   /locus_tag="Fbal_0245"
FT   CDS_pept        275229..275600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0245"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="COGs: COG0690 Preprotein translocase subunit SecE;
FT                   InterPro IPR005807: IPR001901; KEGG: swp:swp_1996
FT                   preprotein translocase subunit SecE; PFAM: protein
FT                   secE/sec61-gamma protein; SPTR: A0XWY6 Preprotein
FT                   translocase, membrane component, transport across inner
FT                   membrane (General Secretory Pathway); TIGRFAM: preprotein
FT                   translocase, SecE subunit; PFAM: SecE/Sec61-gamma subunits
FT                   of protein translocation complex; TIGRFAM: preprotein
FT                   translocase, SecE subunit, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74459"
FT                   /db_xref="GOA:E1SLR0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR0"
FT                   /protein_id="ADN74459.1"
FT                   /translation="MSTNTENQGSSMDTLKWGLVVVILAAAVVGNHYFAAESVLIRAIG
FT                   VVVAIAIALFVAAQTEKGKAAWAFAQESRNEVRKVVWPTRQETVQTTLIVFAATAFMAF
FT                   CLWLLDMGLVWIVNLITGV"
FT   gene            275605..276150
FT                   /locus_tag="Fbal_0246"
FT   CDS_pept        275605..276150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0246"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="COGs: COG0250 Transcription antiterminator; InterPro
FT                   IPR001062: IPR005824: IPR006645: IPR015869; KEGG:
FT                   vch:VC0323 transcription antitermination protein NusG;
FT                   PFAM: NGN domain protein; KOW domain protein; SMART: NGN
FT                   domain protein; KOW domain protein; SPTR: A2PNH8
FT                   Transcription antitermination protein nusG; TIGRFAM:
FT                   transcription termination/antitermination factor NusG;
FT                   PFAM: Transcription termination factor nusG; KOW motif;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74460"
FT                   /db_xref="GOA:E1SLR1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR1"
FT                   /protein_id="ADN74460.1"
FT                   /translation="MSEQPKMRWYVVQAFSGFEARVAQSLKEHIQMHGMEEFFGEVLVP
FT                   TEEVVEMRAGQRRKSERKFFPGYVLVQMVMNDQSWHLVRNVPRVMGFIGGTSDRPAPIT
FT                   EKEANAILNRLQEATESPRHRTIFEPGEVVRVTDGPFADFNGTVEEVDYEKSRLKVSVM
FT                   IFGRSTPVELDFGQVEKS"
FT   gene            276275..276703
FT                   /locus_tag="Fbal_0247"
FT   CDS_pept        276275..276703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0247"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="COGs: COG0080 Ribosomal protein L11; InterPro
FT                   IPR000911: IPR006519; KEGG: vpa:VP2926 50S ribosomal
FT                   protein L11; PFAM: ribosomal protein L11; SMART: ribosomal
FT                   protein L11; SPTR: Q87KQ0 50S ribosomal protein L11;
FT                   TIGRFAM: ribosomal protein L11; PFAM: Ribosomal protein
FT                   L11, RNA binding domain; Ribosomal protein L11, N-terminal
FT                   domain; TIGRFAM: 50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74461"
FT                   /db_xref="GOA:E1SLR2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR2"
FT                   /protein_id="ADN74461.1"
FT                   /translation="MAKKVQAYIKLQVAAGAANPSPPVGPALGQHGVNIMEFCKAFNAR
FT                   TEKLEKGLPIPVVITVYADRSFTFVTKTPPASVLLKKAAGLKSGSSRPNTEKVGTITMA
FT                   QVKEIAETKAADMTGADIDAMARSIAGTARSMGLVVED"
FT   gene            276707..277408
FT                   /locus_tag="Fbal_0248"
FT   CDS_pept        276707..277408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0248"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="COGs: COG0081 Ribosomal protein L1; InterPro
FT                   IPR002143: IPR005878; KEGG: saz:Sama_0203 50S ribosomal
FT                   protein L1; PFAM: ribosomal protein L1; SPTR: A1S208 50S
FT                   ribosomal protein L1; TIGRFAM: ribosomal protein L1; PFAM:
FT                   Ribosomal protein L1p/L10e family; TIGRFAM: ribosomal
FT                   protein L1, bacterial/chloroplast"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74462"
FT                   /db_xref="GOA:E1SLR3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR3"
FT                   /protein_id="ADN74462.1"
FT                   /translation="MAKISKRMRVIREKVDATREYDINEAVALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRDVRVAVFTQGANADAAKEAGADLVGMDELAAQV
FT                   KAGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFDAAKLKENLESLLVALKKAKPASAKGTFVKKVTISTTMGAGV
FT                   AVDQATLEAQA"
FT   gene            277650..278153
FT                   /locus_tag="Fbal_0249"
FT   CDS_pept        277650..278153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0249"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="COGs: COG0244 Ribosomal protein L10; InterPro
FT                   IPR001790: IPR002363; KEGG: sse:Ssed_4326 50S ribosomal
FT                   protein L10; PFAM: ribosomal protein L10; SPTR: A8G1F7 50S
FT                   ribosomal protein L10; PFAM: Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74463"
FT                   /db_xref="GOA:E1SLR4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR4"
FT                   /protein_id="ADN74463.1"
FT                   /translation="MAMNLEGKKAIVAEVNEAAKGALSAVVADCRGVTVGKMTSLRKQA
FT                   REAGVVMRVVRNTLAKRAVEGTSYECLSDAFVGPTLIAFSIEHPGAAARLFKDFAKEEQ
FT                   AFEVKALAYEGELIPAEQIDRLAKLPTYDEAIAQLMMTMKEASAGKLVRTLAALRDQKE
FT                   EQAA"
FT   gene            278202..278570
FT                   /locus_tag="Fbal_0250"
FT   CDS_pept        278202..278570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0250"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="COGs: COG0222 Ribosomal protein L7/L12; InterPro
FT                   IPR013823: IPR000206; KEGG: saz:Sama_0205 50S ribosomal
FT                   protein L7/L12; PFAM: Ribosomal protein L7/L12; SPTR:
FT                   A1S210 50S ribosomal protein L7/L12; TIGRFAM: ribosomal
FT                   protein L7/L12; PFAM: Ribosomal protein L7/L12 C-terminal
FT                   domain; TIGRFAM: ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74464"
FT                   /db_xref="GOA:E1SLR5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR5"
FT                   /protein_id="ADN74464.1"
FT                   /translation="MSITKDQIIEAVAAMSVMEVVELIEAMEEKFGVSAAAAVVAGGAG
FT                   DAAAAEEKTEFDVILAEAGSNKVGAIKAVRGATGLGLKEAKALVESAPAAIKEGISKEE
FT                   AEALKKDLEEAGCKVELK"
FT   gene            278792..282817
FT                   /locus_tag="Fbal_0251"
FT   CDS_pept        278792..282817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0251"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0085 DNA-directed RNA polymerase beta
FT                   subunit/140 kD subunit; InterPro IPR007642: IPR007645:
FT                   IPR007641: IPR007644: IPR 019462: IPR007120: IPR007121:
FT                   IPR010243; KEGG: slo:Shew_0151 DNA-directed RNA polymerase
FT                   subunit beta; PFAM: RNA polymerase Rpb2 domain 6; RNA
FT                   polymerase Rpb2 domain 7; RNA polymerase Rpb2 domain 3; RNA
FT                   polymerase Rpb2 domain 2; RNA polymerase beta subunit;
FT                   DNA-directed RNA polymerase, beta subunit, external 1
FT                   domain; PRIAM: DNA-directed RNA polymerase; SPTR: A3Q975
FT                   DNA-directed RNA polymerase subunit beta; TIGRFAM:
FT                   DNA-directed RNA polymerase, beta subunit; PFAM: RNA
FT                   polymerase Rpb2, domain 3; RNA polymerase Rpb2, domain 6;
FT                   RNA polymerase beta subunit external 1 domain; RNA
FT                   polymerase Rpb2, domain 2; RNA polymerase beta subunit; RNA
FT                   polymerase Rpb2, domain 7; TIGRFAM: DNA-directed RNA
FT                   polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74465"
FT                   /db_xref="GOA:E1SLR6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR6"
FT                   /protein_id="ADN74465.1"
FT                   /translation="MVYSDFEKKRIRKDFGKRPKVLDVPYLLSIQLDSFQNFLEQDPDG
FT                   ERGLEAAFRSVFPIKSFSGYSELQYVSYKLGEPVFDVKECQIRGVTYSAPLRVKLRLVL
FT                   MDKEAGGAVKDIKEQEVYMGDIPLMTENGTFVINGTERVIVSQLHRSPGVFFDHDKGKT
FT                   HSSGKVLYNARVIPYRGSWLDFEFDPKDNLFVRIDRRRKLPASIILRALGYSTQEILDL
FT                   FFEKVQFSLKKDKLVMDLVPDRLRGETALFDIKDNNGDLIVEKGRRVTARHIRQLEKGD
FT                   VKQLEVAVEYLVGKVAAQDYIDDATGEVVVHANQELSLEDVAKLSQAGIKSFETLYTND
FT                   LDHGPYISTTLQVDNTSDRMEALVEIYRMMRPGEPPTREAAEALFENLFFSEDRYDLST
FT                   VGRMKFNRRLGRDESTGVGILTKEDIVDVMRKIIEIRNGNDEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVRERLSLGDLDALMPQDLINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHVTHYGRLCPIETPEGPNIGLINSLS
FT                   TFARTNEYGFLETPFRRVIDGKVTEEVEYLSAIEEGNFVIAQANAQLDDDGNLTDELVA
FT                   ARQKGESIFASADQVDFMDVSPQQIISVAASLIPFLEHDDANRALMGANMQRQAVPTLK
FT                   ADKPLVGTGIERAVAVDSGVTVVAKRGGVVDYVDASRIVIKVSEDELMAGEAGIDIYNL
FT                   TKYTRSNQNTCINQRPVCAVGEPVTRGDVLADGPSTDLGDLALGQNLRVAFMTWNGYNF
FT                   EDSILLSERVVQEDRLTTIHIQELSCIARDTKLGPEEITADIPNVGESALSKLDESGIV
FT                   YVGAEMKPGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVYGTVID
FT                   VQVFTRDGVEKDKRAVDIENMQLRDAKKDLTEEFSILENGIYNRARTLLLGAGFSEAQL
FT                   DKLSRDKWLEQPLDDEGKQTELEQLADQYEELKAEFDKKFEIKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRRIQPGDKMAGRHGNKGVISTIVPVEDMPHDENGVPVDIVLNPLGVPSRM
FT                   NIGQILEVHLGMAAKGIGDKINGMLEQQRKVEELREFMQKAYDLGNTQQKVDLATFSDA
FT                   EVLRLADNLKGGLPVATPAFDGAAEAEIKEMLRLAELPDSGQFTLYDGRTGNAFERPVT
FT                   VGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALQAYGAAY
FT                   TLQEMLTVKSDDVNGRTQMYKNIVDGNYQMQPGMPESFNVVLKEIRSLGINIELDQE"
FT   gene            282908..287116
FT                   /locus_tag="Fbal_0252"
FT   CDS_pept        282908..287116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0252"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0086 DNA-directed RNA polymerase beta'
FT                   subunit/160 kD subunit; InterPro IPR007081: IPR007066:
FT                   IPR000722: IPR007083: IPR 007080: IPR006592: IPR012754;
FT                   KEGG: saz:Sama_0207 DNA-directed RNA polymerase subunit
FT                   beta'; PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 3; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein; SPTR: A1S212
FT                   DNA-directed RNA polymerase subunit beta'; TIGRFAM:
FT                   DNA-directed RNA polymerase, beta' subunit; PFAM: RNA
FT                   polymerase Rpb1, domain 2; RNA polymerase Rpb1, domain 4;
FT                   RNA polymerase Rpb1, domain 1; RNA polymerase Rpb1, domain
FT                   5; RNA polymerase Rpb1, domain 3; TIGRFAM: DNA-directed RNA
FT                   polymerase, beta' subunit, predominant form"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74466"
FT                   /db_xref="GOA:E1SLR7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR7"
FT                   /protein_id="ADN74466.1"
FT                   /translation="MKDLLQFLKKQNASEEFNGIKIGLASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFESYVVIEPGMTALERGQMLTEE
FT                   EYLDALEEHGDEFDARMGAEAVQQLLKDIDLESEIAVMREELPQTNSETKRKKLTKRLK
FT                   LMEAFYNSGNKPEWMIMGVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNRRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYGKLEARGLATTIKAAKK
FT                   MVEREVAEVWDVLDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPASGDPIIVPSQDVVLGLYYMTREK
FT                   VNGKGEGMVLSSVEEAEKVYRAGLVDLHARVKVRITDSYKTEEGEIVEERKIIDTTIGR
FT                   AILSMILPKGLPFALINQDMGKKPISAVLNSCYRILGLKSTVIFADQLMYTGFHFATVS
FT                   GTSVGINDMVIPDAKKEIVASAEEEVAEISEQFQAGLVTAGERYNKVIDIWASANEKVS
FT                   KAMMENLKTDTVINRDGAEEEQKSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPIVANFREGLNVQQYFISTHGARKGLADTALKTANSGYLTRRLVDVSQDLVIVEQ
FT                   DCGSVEGISVKPLIEGGDVVEPLRERVLGRVVAQDVIKPGTEDEVLIPRNTLLDEKWCD
FT                   LIEAHSVDEILVRSVITCQTDFGVCAHCYGRDLARGHLVAEGEAIGVVAAQSIGEPGTQ
FT                   LTMRTFHIGGAASRASAESNVQVKNSGILKLQNAKYVTNADGKIVVTSRSTELAVIDDL
FT                   GREKERYKLPYGAVLDKSEGAAVAAGDIVANWDPHTHPIITEVEGRIQFVDMVEGVTMT
FT                   KQTDELTGLSSIVILDVAQRTSAGKEMRPMVKLIDESGNDILIPGTEVPAQYFLGGHAI
FT                   VSIDDGTMVRVGDALARIPQESGGTKDITGGLPRVADLFEARKPKEPAILAEITGTISF
FT                   GKETKGKRRLVITPHDGGQPYEEMIPKWRNLNVFEGEKVERGEVIADGPEAPHDILRLR
FT                   GIHAVANYIVNEVQDVYRLQGVKINDKHIEVVIRQMLRKCIILNGGDSEFLAGEQVEVA
FT                   RVHQANRLLEEQGKQPATYERELLGITKASLATESFISAASFQETTRVLTDAATYGKRD
FT                   DLRGLKENVTVGRLIPAGTGYAYHRSRQQQAQEAAPAVTASEAEQNLADLLNAAGPNDQ
FT                   "
FT   gene            287307..287681
FT                   /locus_tag="Fbal_0253"
FT   CDS_pept        287307..287681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0253"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="COGs: COG0048 Ribosomal protein S12; InterPro
FT                   IPR005679: IPR006032; KEGG: vha:VIBHAR_00057 30S ribosomal
FT                   protein S12; PFAM: ribosomal protein S12/S23; SPTR: Q87L43
FT                   30S ribosomal protein S12; TIGRFAM: ribosomal protein S12;
FT                   PFAM: Ribosomal protein S12; TIGRFAM: ribosomal protein
FT                   S12, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74467"
FT                   /db_xref="GOA:E1SLR8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR8"
FT                   /protein_id="ADN74467.1"
FT                   /translation="MATVNQLVRKPRKDKVKKTNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDT
FT                   AGVNDRRQGRSKYGAKRPKS"
FT   gene            287761..288231
FT                   /locus_tag="Fbal_0254"
FT   CDS_pept        287761..288231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0254"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="COGs: COG0049 Ribosomal protein S7; InterPro
FT                   IPR000235: IPR005717; KEGG: pat:Patl_0601 30S ribosomal
FT                   protein S7; PFAM: ribosomal protein S7; SPTR: Q3ILP6 30S
FT                   ribosomal protein S7; TIGRFAM: ribosomal protein S7; PFAM:
FT                   Ribosomal protein S7p/S5e; TIGRFAM: ribosomal protein S7,
FT                   bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74468"
FT                   /db_xref="GOA:E1SLR9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR9"
FT                   /protein_id="ADN74468.1"
FT                   /translation="MPRRRVVGQRKILPDPKFGSELLAKFVNVVMLDGKKSTAEKIIYG
FT                   GLAAASEKAGKSELEIFETALDNIRPTVEVKSRRVGGSTYQVPVEVRPVRRNTLAMRWL
FT                   VEAARKRSEKSMALRLAGELLDASENKGSAVKKREDVHRMAEANKAFAHYRW"
FT   gene            288310..290409
FT                   /locus_tag="Fbal_0255"
FT   CDS_pept        288310..290409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0255"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="COGs: COG0480 Translation elongation factors
FT                   (GTPase); InterPro IPR000795: IPR000640: IPR004161:
FT                   IPR005517: IPR 005225: IPR004540; KEGG: slo:Shew_0155
FT                   elongation factor G; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   SPTR: Q0I0A8 Elongation factor G 1; TIGRFAM: translation
FT                   elongation factor G; small GTP-binding protein; PFAM:
FT                   Elongation factor Tu domain 2; Elongation factor G
FT                   C-terminus; Elongation factor Tu GTP binding domain;
FT                   Elongation factor G, domain IV; TIGRFAM: translation
FT                   elongation factor EF-G; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74469"
FT                   /db_xref="GOA:E1SLS0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS0"
FT                   /protein_id="ADN74469.1"
FT                   /translation="MARTTPIERYRNIGICAHVDAGKTTTTERVLFYTGLSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWRGMEAQFPEHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGSSGVEPQSETVWRQADKYHVPRLVFVNKMDRAGANFDRVVEQIRNRLG
FT                   ATCVPIQMNVGAEDEFKGVIDLIKMKYISWNEADQGMSFDYLDIPAELADKAAEMREYL
FT                   VESAAEASEELMDKYLEGEELSEEEIKKALRQRTLNNEIVLATCGSAFKNKGVQAVLDA
FT                   VVEFLPAPVDVPAIKGVDMDDNEVSRESDDNAPFAALAFKIATDPFVGTLTFMRVYSGV
FT                   ANTGDAVFNSVKQKRERLGRMVQMHANDRKEIKEVRAGDIAAAIGLKDVTTGDTLCDQD
FT                   HKVVLERMEFPEPVIQIAVEPRTKADQEKMGIALGKLAAEDPSFRVETDDESGQTLISG
FT                   MGELHLDIIVDRMKREFSVECNVGKPQVAYRETIRSAVEVEGKFVRQSGGRGQFGHVWL
FT                   KLEPREAGAGYEFVNEVVGGVVPKEYIPAVDKGIQEQMAQGVLAGFPVLDVKVTLFDGS
FT                   YHDVDSNEMAFKIAGSMGFRKGALAANPVLLEPMMKVEITTPEDWMGDVVGDVNRRRGI
FT                   IEGMDDGAAGLKIVRARVPLAEMFGYATDLRSATQGRASYSMEFSEYAEAPQNVAQAVI
FT                   EARGY"
FT   gene            290492..291676
FT                   /locus_tag="Fbal_0256"
FT   CDS_pept        290492..291676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0256"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="COGs: COG0050 GTPase - translation elongation
FT                   factors; InterPro IPR000795: IPR004160: IPR004161:
FT                   IPR005225: IPR 004541; KEGG: swd:Swoo_4704 elongation
FT                   factor Tu; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain protein; elongation factor Tu
FT                   domain 2 protein; SPTR: A3Q968 Elongation factor Tu 1;
FT                   TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: Elongation factor Tu C-terminal
FT                   domain; Elongation factor Tu domain 2; Elongation factor Tu
FT                   GTP binding domain; TIGRFAM: small GTP-binding protein
FT                   domain; translation elongation factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74470"
FT                   /db_xref="GOA:E1SLS1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS1"
FT                   /protein_id="ADN74470.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITNVLAKANGGQAR
FT                   AFDQIDNAPEERERGITIAASHVEYDTETRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCAATDGPMPQTREHILLSRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDTPVIQGSALKALEGDAQWEAKILELAEALDTYIPEPERAVDGAFLLPIEDVFSIQ
FT                   GRGTVVTGRVERGIVKVGDEVEIVGIKDTAKTTCTGVEMFRKLLDEGRAGENCGVLLRG
FT                   TKREEVERGQVLAQPGSITPHTKFTSEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDITG
FT                   TIELPEGVEMVMPGDNIQMTVTLIAPIAMEEGLRFAIREGGRTVGAGVVAKIVE"
FT   gene            291841..292719
FT                   /locus_tag="Fbal_0257"
FT   CDS_pept        291841..292719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0257"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   ppd:Ppro_3338 glycosyl transferase family protein; PFAM:
FT                   glycosyl transferase family 2; SPTR: B8GDZ0 Glycosyl
FT                   transferase family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74471"
FT                   /db_xref="GOA:E1SLS2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS2"
FT                   /protein_id="ADN74471.1"
FT                   /translation="MQVERTDEHPPAESAAPICNEQRCQISVLIASLGRPSLITALQSI
FT                   FGRSSVRFEVVLVLDDPDVSAERLLAEIPPARRRAIRVIQNPENLGLTRSLNRGLAQCR
FT                   GEFIARLDDDDRFSPERLDQVVERFQAHPEVGVIVSDTRVIDGERHYQLTVPAEHDAIA
FT                   EALQHRNILVHSAFNIRRTVLQRVGGYNEAYRYAQDYELYLRLLRHGVRFMGVNQPLAE
FT                   RNEEEGTITVSRRQHQALFSLSALCLHHASTWRGDGDQVRAICTAFARFVAPKSLRKGV
FT                   RWLRAVSRGEG"
FT   gene            292719..293852
FT                   /locus_tag="Fbal_0258"
FT   CDS_pept        292719..293852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0258"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: rec:RHECIAT_PC0000842 putative
FT                   glycosyltransferase protein; PFAM: glycosyl transferase
FT                   group 1; SPTR: A3CTC6 Glycosyl transferase, group 1; PFAM:
FT                   Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74472"
FT                   /db_xref="GOA:E1SLS3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS3"
FT                   /protein_id="ADN74472.1"
FT                   /translation="MGQSNVVLVIFSYGMSATRWKQMGILSKEKVIFEAYLNSGLAEQV
FT                   VWFTYHPDDPALVAEEQKAGRLHPGITVLPAPAWAGTGLGKLFYSVAGPWLQRDAFTQA
FT                   TAMINHQTSGCWTGLTARLLLGGRFVYRYGHSLWRRHLDRKQYARLAFSWPLDRLALAC
FT                   SDHALVCTESDYRATSGGPNVSHCPNFIELESTARAHDAPSQRPNRGVYVGRLMSFKNL
FT                   FNLIEACAKRQLPLDLYGDGPLRGELEAHAAKVGAECRFLGVRPNHEVRDALTQYRWFF
FT                   LVSNYEAMPKALLEGMAAGCVCVAAPNYGCAEVIEDGVDGVLSADWEADSIADAMARAD
FT                   GPHMDGMASRAMTKVRDQYSLERVLSLHRKALLGGDQ"
FT   gene            293849..295144
FT                   /locus_tag="Fbal_0259"
FT   CDS_pept        293849..295144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PC0000848 hypothetical protein;
FT                   PFAM: O-Antigen ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74473"
FT                   /db_xref="GOA:E1SLS4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS4"
FT                   /protein_id="ADN74473.1"
FT                   /translation="MSAVIATERTHPLAMLALAIFALFWCLAVTMVKLEAGLPVRVWVL
FT                   LLGLGWLATLYRVPWADLTRGNVHLSTLAGIAAVGMITTLWGTLDWPGTLLMVVKWVLQ
FT                   PALAFLFTVLIAHLYGVRVVVRIFFAVVALTAFVAVLQGLDFQPAWDLKYRFEQWQGLD
FT                   RAQIFAIEQESGGGAYQDQYRSRGLSYSPIHLGYQITLVVGLLYYASQRAPALNPLSPR
FT                   WTWALIALLFAAAVFSGTRSTIGGLLLLLPLHYLVCHKHRGVGVLLVTGLLLLAPVLFA
FT                   LASQLLDLRIFSTTDSSMQARVPLTMLGLKLFWDNPLGHGWLIEASDLADQYWHRLYHI
FT                   NNAEVVVYRGIHNHAVKMLFVYGLVGAGLLIYYLATLKRMFGVALLVALAPYGFHALFH
FT                   NDGIFLGGNYIWVWLGILHCYWMEQRRNDAAT"
FT   gene            295128..296243
FT                   /locus_tag="Fbal_0260"
FT   CDS_pept        295128..296243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0260"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: gur:Gura_2587 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A3HV85
FT                   Glycosyltransferase-like protein; PFAM: Glycosyl
FT                   transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74474"
FT                   /db_xref="GOA:E1SLS5"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS5"
FT                   /protein_id="ADN74474.1"
FT                   /translation="MTQRLKVAWLGGRGYHSSYGGVENAIRELAKESVRIPDIEPWVAG
FT                   RGKGWWFQRTEQDGVHLLEAPKWLGRLGHALCTLGLLLYTIVRIRPDTLFLFASGPSLL
FT                   SVIGRLFGAHTVACLRAIDSQRDGWRGLNQKVLELGEYAATHIAHQCTVNSLAMQRYFA
FT                   ARQLDTIYIPNGITPLAEPIPGYLERLGLEPEGYLLYAGRLDPVKRLDVLLQAHRQLPP
FT                   ESRPMLVVAGGKCKSQEYQTKLEQMASDDVLFLGHVGQRELSTLMASCSLFVLPSVLEG
FT                   MSNSLLTAMGAGRPVLCADVPENADVVASDPRVLFEADNVADLLAQLQAHLDQAERRVE
FT                   VAKTIKSLSANYSWRQSAAAFCQLAREGRGG"
FT   gene            296240..297112
FT                   /locus_tag="Fbal_0261"
FT   CDS_pept        296240..297112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0261"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: amc:MADE_02455
FT                   glycosyltransferase; PFAM: glycosyl transferase family 2;
FT                   SPTR: Q8PZ42 Glycosyltransferase; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74475"
FT                   /db_xref="GOA:E1SLS6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS6"
FT                   /protein_id="ADN74475.1"
FT                   /translation="MNTPKLITVVITTYNRPERLAKAIASVAAQDYPNIELLVVDDCSS
FT                   EDYTEALREPPMALRYLRQPENRGACAARNRGIQEAQGHWVAFLDDDDQWVPDKLSRQV
FT                   EAIGDAELCLCGYRVIENGHVQVLPLKRISPQRLYRYNRICGTSGVLGRTDVLREEGFD
FT                   ETLVCSQDWDLFLRYALRQPLQYVAEPLCLFSDGSHGRISNSAKELSIPQIERRLRAVE
FT                   KHRAVIGEECYRSKVAATALAYIGSRQDKWQAIRFALDRAGWRASIGYLLGKARRRSSA
FT                   SRPIKLAEE"
FT   gene            297156..298586
FT                   /locus_tag="Fbal_0262"
FT   CDS_pept        297156..298586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0262"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="COGs: COG2244 Membrane protein involved in the
FT                   export of O-antigen and teichoic acid; InterPro IPR002797;
FT                   KEGG: ecx:EcHS_A2184 putative polysaccharide biosynthesis
FT                   protein; PFAM: polysaccharide biosynthesis protein; SPTR:
FT                   A0YR13 Probable polysaccharide transport protein; PFAM:
FT                   Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74476"
FT                   /db_xref="GOA:E1SLS7"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS7"
FT                   /protein_id="ADN74476.1"
FT                   /translation="MSLLRKTVHAVSWTLGGRQLQQLATLFITAVLAKLLTPEDFGLMG
FT                   MVTVLSGMAMILSDTGFSAAVIQRNNLTQVHYSTLFWVNLGIGLTVSCLFFLAAPLIAA
FT                   FYQRPELTLISQILSVSFTLSALSTIPQALMRRAMRFKRLTIIDTVVHLSTGTAVVVMA
FT                   LNGYGIWALVAQPLIQQTFKAVMMWWHCPWRPSLVLSVPALKDVFNFSANILGLHYLQY
FT                   FMNNLDYLLVGRFLGAEALGYYTLAYKLMFVPIRNICQEIVKVLFPALSRLQDDPKALL
FT                   DGIGKALRSTCYIVFPMLMGMFMVADIFIETIFGEQWAPTIEVLQVLCLVGLVQAVITV
FT                   LSVVFRATGQPQRELRIHVARLVVMSVVLLSTIQLGLVPFTWSLLVVTLLFMVVYLRAV
FT                   AVLLQAPLTPLFAALWPALGISSVMALCLWWLRDLLAKAAVGGAHELALLIVSGAGLYG
FT                   AGLGLLWLYYRRYDQSLI"
FT   sig_peptide     297156..297254
FT                   /locus_tag="Fbal_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            298867..303123
FT                   /locus_tag="Fbal_0263"
FT   CDS_pept        298867..303123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0263"
FT                   /product="Kelch repeat protein"
FT                   /note="InterPro IPR011498: IPR006652; KEGG: actin binding
FT                   protein ; K10442 kelch-like protein 1/4/5; PFAM: Kelch
FT                   repeat protein; Kelch repeat-containing protein; SMART:
FT                   Kelch repeat-containing protein; SPTR: A9A4Q1 Kelch repeat
FT                   protein; PFAM: Kelch motif"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74477"
FT                   /db_xref="GOA:E1SLS8"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS8"
FT                   /protein_id="ADN74477.1"
FT                   /translation="MLSLFRGRFGALLALLFLSFSLHAELRVSQLPDKSVSEPLNGAEI
FT                   SGTVYIFYQPSQPLSQVKFYLDTAVGGKTFQTENIAPYDFAGTASGGAGNPFDADSLSG
FT                   GSHTIAVLVTPQSGSAFEASATFTVGDGGGGTTPTLNFASDSQSFSVTGEQQQTGSVAL
FT                   SLSDGSSATANLSSSASWLTLDSSTQAVPGSVGFQVDSTGLGVGSYSATITASVTGYPS
FT                   VSHGVSLTVLSSGSSGYSLLVSTQPDRSGAVPLGGQSLSGPVYIFTSPDNGVSKVRFYL
FT                   DNPGLSGSSTKTEGVAPYDFAGTAPDRTAYPFNVDGLSDGLHTIDVELVTTNGSQYTQG
FT                   SFVVGEEVVSLLASPTSISLSGEIDSGILSATAQVTASDGSNLVFSEEHDAAWLSLDLG
FT                   GDSTPATVTFSVDTNGLSAGSYSDTVTLFSTGVGSAQVTVALTLTDPNGGGGGGGGGTG
FT                   ELCGPVLCSDVKVTLPYVLEFDDSVEGYLDGNGIGTGFTYLQPTSKGSGYLPDNLDVNT
FT                   STERLVVTTTKGLQHQSINNLDNALGVGYAGPNHIARISTVLVEPPAGSGKYEQAGLWF
FT                   GYDEDHFIKLVYNSAGGGPVVEFIYESAGSVQGKFDANVGDLSSDTLTLALVANPETQS
FT                   ISARYSINGGSETNLGSFDIAPEFFSFDAAGIDPVIGTRTFTGIMASHRNGASALVYQF
FT                   ESFSVESLGAPGSGGGGSGGGGSGGGSADWSFSKVSSHPLDFPTAMVWGPDNRLYVTEL
FT                   FGTIHALTFDDQLRVVDDQVITGLTDRHGSRMTLGIEVYHDDPSDPNGFSLWVNHSSAS
FT                   TNNGIINSGEVTRLFGDNFAESEVVISGLPRAKANHGPNSLHFGPDNRLYIAIGGITGA
FT                   GAAVDPNVANTEFGDRAEQPLSAAILVADVFAAGFDGTCDNSPDIFGPNPCDVVTWVTG
FT                   LRNTYDFVFHSNGQAYATDNGLGVKGAYPPKPTPDCSGFGDPAPYDEGGDNPGTQPDLL
FT                   LKLEAGEYYGHPNPTRDECVFKDGSYQNVAPLPNYQPEIFSLGNNKSANGIVELRSNRA
FT                   CGALNGDLMVTYYSKDDGVTRLQLNADGDQVVLAEKLFADLVDPLPLAARNGDIYVGEF
FT                   GAGVVSVLALASTPCWDAGADAPAELLDSGSAILNGKLHVVGGKTASGHVNTHYAYDIG
FT                   ADSWQTLAAKPGTAVENGAVAAYNGALYVFGGSSGPFNGAVTESYRYDPGSNSWQALAP
FT                   MPVALGGIRAEAIGDEIYIAGGMNGSGASVASLLVYDPGSNSWRTGPSMSQVRDNPGTA
FT                   VLNGELYVLGGRHRLADGTSLDGQLNTMEIYNPSSNQWRRGPDLLTGRRTFAVGTINGR
FT                   IQVLGGEYASGVTNNVFPQYEEFDPGSNQWQYLGDALFPTHGAAFGTFGDQLILSTGGP
FT                   IGGTSFSNDTYRVSGQ"
FT   sig_peptide     298867..298938
FT                   /locus_tag="Fbal_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            303208..304617
FT                   /locus_tag="Fbal_0264"
FT   CDS_pept        303208..304617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0264"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /note="COGs: COG2148 Sugar transferase involved in
FT                   lipopolysaccharide synthesis; InterPro IPR003362:
FT                   IPR017475: IPR017473; KEGG: vpa:VPA1403 putative capsular
FT                   polysaccharide biosynthesis glycosyltransferase; PFAM:
FT                   sugar transferase; SPTR: A0XZW2 UDP-glucose lipid carrier
FT                   transferase; TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: Bacterial
FT                   sugar transferase; TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74478"
FT                   /db_xref="GOA:E1SLS9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS9"
FT                   /protein_id="ADN74478.1"
FT                   /translation="MTQSEFPSGVNGGMPVGLARVFDVVAVLAGLGLVYLFDGPVYMPV
FT                   KELVLWGVIAALLMVYLSEIFSLYRSWRLAPFSEVVLVTLLVWVSVTILLVLGLYFLKL
FT                   GENFGRIGFAYWCTIVAVLLVSWRWACRQYLTRQRAQGKNTKTALVVGATSLGIQLAEA
FT                   LERQPGLGVRVQGFYDDRERHRLDPMVQTKVMGDVDDAIELAARGGIDQIFVALPLKAE
FT                   DRISAILQRCANTTSQVHIVPNFFVYNLVNAAWCDVGGMRTLSVYESPIRGPWGALKRA
FT                   EDLTIASVALLVFAIPMLLIAAGIRLESRGPVLFKQVRYGVDGRRIEVWKFRSMTCVEN
FT                   GTTIKQATRNDSRITRIGAFIRRTSLDELPQFINVLQGRMSVVGPRPHAVAHNEQYRAL
FT                   IQGYMLRHKVKPGITGWAQVNGWRGETDTLDKMAKRVEHDMHYITHWSVVLDIQILFLT
FT                   LRKGFVHDNAY"
FT   gene            304623..305819
FT                   /locus_tag="Fbal_0265"
FT   CDS_pept        304623..305819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1383 hypothetical protein; SPTR:
FT                   A2TM16 EpsU; PFAM: Uncharacterized protein conserved in
FT                   bacteria (DUF2320)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74479"
FT                   /db_xref="InterPro:IPR018759"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT0"
FT                   /protein_id="ADN74479.1"
FT                   /translation="MGWRVKQHWGWILAALATGVSATEFEPARLRLGEGVQFQPTMGLE
FT                   YGYDDNLLHTSAESLDSQYLRITPELQFVWGRRISHLKAGYVLDAASYFDSSDDNYIDH
FT                   DLNLIGHHEFTARHRVDATYDYIKGHQARGTGIAEFSETDEPVEFTEHDAYGAYEFGAQ
FT                   TARMQLGVNLGYYQRTYDNFRERSQYRDYDTFRYGATAKWRVGARTKLLLDLSDSDISY
FT                   DRVEPGQLSRDSNVTRGLVGVIWEATAKSEGRAAFGVEDKRFDDSGREDFTGFAWDVAF
FT                   IWRPTTYSTLELISARESKDPFTNGDYVEESSYELGWEHYWQERWATNLELLYADKDYT
FT                   GDDREDEVTKIRVGVIYEFRRWLKFEPFYSYWDNSSTRTDPQLNYDKNQFGLVMTLAL"
FT   sig_peptide     304623..304688
FT                   /locus_tag="Fbal_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            305829..306350
FT                   /locus_tag="Fbal_0266"
FT   CDS_pept        305829..306350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0266"
FT                   /product="polysaccharide export protein"
FT                   /note="COGs: COG1596 Periplasmic protein involved in
FT                   polysaccharide export; InterPro IPR019554: IPR003715; KEGG:
FT                   amc:MADE_02478 periplasmic protein involved in
FT                   polysaccharide export; PFAM: polysaccharide export protein;
FT                   Soluble ligand binding domain; SPTR: A3GYZ0 Capsular
FT                   polysaccharide synthesis enzyme CpsC polysaccharide export;
FT                   PFAM: Polysaccharide biosynthesis/export protein; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74480"
FT                   /db_xref="GOA:E1SLT1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT1"
FT                   /protein_id="ADN74480.1"
FT                   /translation="MKWWIACLWLVCSAVSANDAAGYLLGPGDQIRIQVFGEPDLSISE
FT                   IRLGESGSISYPYLGQIRLSGLRLSQVEQLIHKGLKGDYLINPSVSVSIVEYRPFFING
FT                   EVRRPGGYPFQPGLTVRKAVALAGGLTERASSRDISLTRKTPNGERIIEVSMASEVQPG
FT                   DSIYIEDSFF"
FT   sig_peptide     305829..305879
FT                   /locus_tag="Fbal_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            306378..308627
FT                   /locus_tag="Fbal_0267"
FT   CDS_pept        306378..308627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0267"
FT                   /product="capsular exopolysaccharide family"
FT                   /note="COGs: COG3206 Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis; InterPro IPR003856:
FT                   IPR003593: IPR005702; KEGG: vco:VC0395_A0461 putative
FT                   exopolysaccharide biosynthesis protein; PFAM:
FT                   lipopolysaccharide biosynthesis protein; SMART: AAA ATPase;
FT                   SPTR: A2PUD0 Exopolysaccharide biosynthesis protein,
FT                   putative; TIGRFAM: capsular exopolysaccharide family; PFAM:
FT                   Chain length determinant protein; CobQ/CobB/MinD/ParA
FT                   nucleotide binding domain; TIGRFAM: capsular
FT                   exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74481"
FT                   /db_xref="GOA:E1SLT2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT2"
FT                   /protein_id="ADN74481.1"
FT                   /translation="MNRDAGVRQEPGLKMEWVGISGRMAVLARYRWWILLATLVTTIVA
FT                   ALYVTRLPAIYASTATLLLENTPSKVVSIEGVYGVDSSRDEYFQTQYEIIQSRKIAETV
FT                   IDELRLTEQKEFVPVQSSGFGLAMVKGWVQQQLGRLFGSADAGPPPTAEEQAYRLRQQV
FT                   IGEYYQRLTLKPVRNTQLVSIQFEAQDPQLAAEVANAIGQAYIESYMEDKLVATQEATG
FT                   WMRERLEKLKSNLRASEESLQQFREDAGLVDVEGLLTLESQELEKIANRLSEARERRSA
FT                   AESVARTVSSSGGGDIEELASLPEINRHPSVQRLRDAESQAEQKVAQLSKRYGPKHKAM
FT                   ITAEAELNEVRVALRRQIRELVSGIQQEYRSARSQEATLSDELAAARQNYQGLSKNESQ
FT                   YRELQREVETNRQLYDTFMTRIKETGVAGDFNEAIARFTDKALPALLPSRPQKGAILAL
FT                   VLVASLLLFSFMALLHARYVDVISRASEVESELSAKLLGIVPEVRSLNDKSTVKTYFDK
FT                   RQPEFGEAWRSVRTAFTLQHMNSTGLAMAISSALPGEGKTTSAISLALSLQQVKRVLLI
FT                   DCDLRKPKVGKAFELPSYQPGLTNALCGTHSLEQCMYQDEDSGLTLLSAGTVLSNPLEA
FT                   LSGDSFRRVLQQARAQFDVVLLDTPPVHAVSDALVVARTAGSMLFIVRADHTRARLAQN
FT                   ALERVLENKILLEGVVLNRAGKGAMKAQYGRGYDTYYGHGYEQTSPASAPRESAA"
FT   gene            308904..309215
FT                   /locus_tag="Fbal_0268"
FT   CDS_pept        308904..309215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0268"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="COGs: COG0051 Ribosomal protein S10; InterPro
FT                   IPR001848: IPR018268: IPR005731; KEGG: tau:Tola_0098
FT                   ribosomal protein S10; PFAM: ribosomal protein S10; SPTR:
FT                   B1JIW0 30S ribosomal protein S10; TIGRFAM: ribosomal
FT                   protein S10; PFAM: Ribosomal protein S10p/S20e; TIGRFAM:
FT                   ribosomal protein S10, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74482"
FT                   /db_xref="GOA:E1SLT3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT3"
FT                   /protein_id="ADN74482.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERYTVLISPHVNKDARDQYEIRTHKRLVDIVEPTDKTVDALMRLDLAAGVDVQISLG"
FT   gene            309250..309888
FT                   /locus_tag="Fbal_0269"
FT   CDS_pept        309250..309888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0269"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="COGs: COG0087 Ribosomal protein L3; InterPro
FT                   IPR000597: IPR019926: IPR019927; KEGG: saz:Sama_0213 50S
FT                   ribosomal protein L3; PFAM: ribosomal protein L3; SPTR:
FT                   A1S218 50S ribosomal protein L3; TIGRFAM: 50S ribosomal
FT                   protein L3; PFAM: Ribosomal protein L3; TIGRFAM: 50S
FT                   ribosomal protein L3, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74483"
FT                   /db_xref="GOA:E1SLT4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT4"
FT                   /protein_id="ADN74483.1"
FT                   /translation="MAIGLVGRKVGMTRIFTPEGVSIPVTVIEVEPNRVTQVKTLDTDG
FT                   YSALQVTAGAKKANRVTKPEAGHFAKAGVEAGRGTWEFRLGEGEGEGIELGAELKVDIF
FT                   TDVAKVDVTGQSKGKGFQGAIKRWNFRSQDMTHGNSLSHRAPGSIGQNQSPGKVFKGKK
FT                   MAGHMGAERVTTQNLDVVRVDVERNLLLVKGAIPGANGGNVIVKPAVKA"
FT   gene            309906..310511
FT                   /locus_tag="Fbal_0270"
FT   CDS_pept        309906..310511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0270"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="COGs: COG0088 Ribosomal protein L4; InterPro
FT                   IPR002136; KEGG: pay:PAU_04214 50S ribosomal protein L4;
FT                   PFAM: ribosomal protein L4/L1e; SPTR: A0KF22 50S ribosomal
FT                   protein L4; PFAM: Ribosomal protein L4/L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74484"
FT                   /db_xref="GOA:E1SLT5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT5"
FT                   /protein_id="ADN74484.1"
FT                   /translation="MELVMKDAQSALEVSETTFGREFNEALVHQVVVAYAANARQGTRA
FT                   QKTRAEVTGTGKKPWRQKGTGRARSGTVKSPIWRSGGVSFAAKPQDHGQKVNKKMYRAA
FT                   LRSILSELVRQDRLIVVEKFAVEAPKTKELVGKLKELELNDVLIVTGEVDENLFLASRN
FT                   LYKVDVRDADGIDPVSLIAFDKVLMTADAVKQIEEKLA"
FT   gene            310508..310810
FT                   /locus_tag="Fbal_0271"
FT   CDS_pept        310508..310810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0271"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="COGs: COG0089 Ribosomal protein L23; InterPro
FT                   IPR013025: IPR001014; KEGG: pha:PSHAa0146 50S ribosomal
FT                   protein L23; PFAM: Ribosomal protein L25/L23; SPTR: Q3IF23
FT                   50S ribosomal protein L23; PFAM: Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74485"
FT                   /db_xref="GOA:E1SLT6"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT6"
FT                   /protein_id="ADN74485.1"
FT                   /translation="MIREERLLKVLLAPHISEKSTMAAELNNTMVFKVAKDATKAEIKA
FT                   AVEKLFEVQVTGVRTSVVKGKVKRHGARFGRRSDWKKAYVTLAEGADIDFVGGAE"
FT   gene            310829..311653
FT                   /locus_tag="Fbal_0272"
FT   CDS_pept        310829..311653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0272"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="COGs: COG0090 Ribosomal protein L2; InterPro
FT                   IPR002171: IPR005880; KEGG: vch:VC2593 50S ribosomal
FT                   protein L2; PFAM: ribosomal protein L2; SPTR: A3H4S9 LSU
FT                   ribosomal protein L2p (L8e); TIGRFAM: ribosomal protein L2;
FT                   PFAM: Ribosomal Proteins L2, RNA binding domain; Ribosomal
FT                   Proteins L2, C-terminal domain; TIGRFAM: ribosomal protein
FT                   L2, bacterial/organellar"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74486"
FT                   /db_xref="GOA:E1SLT7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT7"
FT                   /protein_id="ADN74486.1"
FT                   /translation="MAIVKCKPTSAGRRHVVKVVNNELHKGKPHAALLDKKSKTGGRNN
FT                   AGRITTRHIGGGHKQHYRIIDFKRNKDGITAKVERLEYDPNRSANIALVLYADGERRYI
FT                   LAPKGLQAGDTIVSGQEADIKVGNALPMRNIPVGSTVHNVELKPGKGGQIARSAGAYAQ
FT                   IVARDGAYVTLRLRSGEMRKVLAEGRATLGEVGNSEHMLRQLGKAGAMRWRGVRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVTPWGVPTKGKKTRSNKRTDKYIVRRRTK"
FT   gene            311669..311947
FT                   /locus_tag="Fbal_0273"
FT   CDS_pept        311669..311947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0273"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="COGs: COG0185 Ribosomal protein S19; InterPro
FT                   IPR002222: IPR005732; KEGG: aha:AHA_0313 30S ribosomal
FT                   protein S19; PFAM: ribosomal protein S19/S15; SPTR: A4ST02
FT                   30S ribosomal protein S19; TIGRFAM: ribosomal protein S19;
FT                   PFAM: Ribosomal protein S19; TIGRFAM: ribosomal protein
FT                   S19, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74487"
FT                   /db_xref="GOA:E1SLT8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT8"
FT                   /protein_id="ADN74487.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPVKTWSRRSMIIPDMI
FT                   GLTIAVHNGRQHVPVFVTEDMIGHKLGEFAPTRTYRGHAADKKAKKR"
FT   gene            311958..312290
FT                   /locus_tag="Fbal_0274"
FT   CDS_pept        311958..312290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0274"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="COGs: COG0091 Ribosomal protein L22; InterPro
FT                   IPR001063: IPR018260: IPR005727; KEGG: saz:Sama_0218 50S
FT                   ribosomal protein L22; PFAM: ribosomal protein L22/L17;
FT                   SPTR: A1S223 50S ribosomal protein L22; TIGRFAM: ribosomal
FT                   protein L22; PFAM: Ribosomal protein L22p/L17e; TIGRFAM:
FT                   ribosomal protein L22, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74488"
FT                   /db_xref="GOA:E1SLT9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT9"
FT                   /protein_id="ADN74488.1"
FT                   /translation="MEVLAKHRFARTSPQKARLVADQIRGLPVDRALDILAFSPKKAAS
FT                   LVKKVLESAIANAEHNEGLDIDDLKVAKIYVDEGPTMKRIMPRAKGRADRILKRSSHIT
FT                   VVVADK"
FT   gene            312302..312991
FT                   /locus_tag="Fbal_0275"
FT   CDS_pept        312302..312991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0275"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="COGs: COG0092 Ribosomal protein S3; InterPro
FT                   IPR004044: IPR001351: IPR008282: IPR004087: IPR 004088:
FT                   IPR018280: IPR005704; KEGG: pin:Ping_3518 ribosomal protein
FT                   S3; PFAM: ribosomal protein S3- domain protein; KH type 2
FT                   domain protein; Ribosomal protein S3 domain; SMART: KH
FT                   domain protein; SPTR: A1T0D6 30S ribosomal protein S3;
FT                   TIGRFAM: ribosomal protein S3; PFAM: KH domain; Ribosomal
FT                   protein S3, C-terminal domain; Ribosomal protein S3,
FT                   N-terminal domain; TIGRFAM: ribosomal protein S3, bacterial
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74489"
FT                   /db_xref="GOA:E1SLU0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU0"
FT                   /protein_id="ADN74489.1"
FT                   /translation="MGQKVHPNGIRLGITKPWSSTWYAEKKDYADNLFSDHEVRQFLKQ
FT                   ELKNASVSRITIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRLKVAKLAGVPAQINIS
FT                   EVRKPELDAQLVGDSVASQLERRVMFRRAMKRAVQNAMRLGAKGIKIEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEAHTTYGVIGIKVWIFKGEVLGGMPVVAEEPKAQP
FT                   KRKGRGK"
FT   gene            313003..313416
FT                   /locus_tag="Fbal_0276"
FT   CDS_pept        313003..313416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0276"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="COGs: COG0197 Ribosomal protein L16/L10E; InterPro
FT                   IPR000114: IPR016180; KEGG: aha:AHA_0316 50S ribosomal
FT                   protein L16; PFAM: Ribosomal protein L10e/L16; SPTR: A0XX78
FT                   50S ribosomal protein L16; TIGRFAM: ribosomal protein L16;
FT                   PFAM: Ribosomal protein L16p/L10e; TIGRFAM: ribosomal
FT                   protein L16, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74490"
FT                   /db_xref="GOA:E1SLU1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU1"
FT                   /protein_id="ADN74490.1"
FT                   /translation="MLQPKRMKFRKMHKGRNRGVATSGDKVSFGSFGLKATTRGRLTAR
FT                   QIEAARRAMTRHIKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVAQIQPGRVLY
FT                   EMDGVAEELAREAFSLAAAKLSVQTTFVTRKVM"
FT   gene            313416..313607
FT                   /locus_tag="Fbal_0277"
FT   CDS_pept        313416..313607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0277"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="InterPro IPR001854; KEGG: vha:VIBHAR_00738 50S
FT                   ribosomal protein L29; PFAM: ribosomal protein L29; SPTR:
FT                   A7N0I5 50S ribosomal protein L29; TIGRFAM: ribosomal
FT                   protein L29; PFAM: Ribosomal L29 protein; TIGRFAM:
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74491"
FT                   /db_xref="GOA:E1SLU2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU2"
FT                   /protein_id="ADN74491.1"
FT                   /translation="MKAQDLREKSVEELNAELLNLLREQFNLRMQNATGQLKATHEMKK
FT                   VRRNIARVKTVLTQKAGA"
FT   gene            313607..313855
FT                   /locus_tag="Fbal_0278"
FT   CDS_pept        313607..313855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0278"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COGs: COG0186 Ribosomal protein S17; InterPro
FT                   IPR000266: IPR019979: IPR019984; KEGG: eum:ECUMN_3784 30S
FT                   ribosomal protein S17; PFAM: ribosomal protein S17; SPTR:
FT                   Q5E8A6 30S ribosomal protein S17; TIGRFAM: 30S ribosomal
FT                   protein S17; PFAM: Ribosomal protein S17; TIGRFAM: 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74492"
FT                   /db_xref="GOA:E1SLU3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU3"
FT                   /protein_id="ADN74492.1"
FT                   /translation="MSDKIRTLQGRVISDKMDKSITVAIERKVKHPIYGKFMKRTTKLH
FT                   VHDETNQCGIGDLVEIRECRPLSKTKSWTLVNILEKA"
FT   gene            314019..314387
FT                   /locus_tag="Fbal_0279"
FT   CDS_pept        314019..314387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0279"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="COGs: COG0093 Ribosomal protein L14; InterPro
FT                   IPR000218: IPR019972: IPR005745; KEGG: sfr:Sfri_0158 50S
FT                   ribosomal protein L14; PFAM: ribosomal protein L14b/L23e;
FT                   SPTR: Q089P4 50S ribosomal protein L14; TIGRFAM: ribosomal
FT                   protein L14; PFAM: Ribosomal protein L14p/L23e; TIGRFAM:
FT                   ribosomal protein L14, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74493"
FT                   /db_xref="GOA:E1SLU4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU4"
FT                   /protein_id="ADN74493.1"
FT                   /translation="MIQMQSVLDVADNSGARSVQCIKVLGGSHRRYAGIGDIIKVSVKE
FT                   SIPRGKAKKGDVYNAVVVRTKKGVRRPDGSVIRFDRNAAVLLNANLQPIGTRIFGPVTR
FT                   ELRNDKFMKIVSLAPEVL"
FT   gene            314399..314713
FT                   /locus_tag="Fbal_0280"
FT   CDS_pept        314399..314713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0280"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="COGs: COG0198 Ribosomal protein L24; InterPro
FT                   IPR005824: IPR005825: IPR003256; KEGG: swp:swp_2022 50S
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   domain protein; SPTR: B8CNE4 50S ribosomal protein L24;
FT                   TIGRFAM: ribosomal protein L24; PFAM: KOW motif; TIGRFAM:
FT                   ribosomal protein L24, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74494"
FT                   /db_xref="GOA:E1SLU5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU5"
FT                   /protein_id="ADN74494.1"
FT                   /translation="MAAKIRRNDEVIVLAGKDKGKRGKVSQVLTTGKIVVEGVNLVKKH
FT                   QKPNPQLGVQGGIVEKEAPIHASNVALFNPATGKADRVGFRFEDGKKVRFFKSNDEIVK
FT                   "
FT   gene            314728..315267
FT                   /locus_tag="Fbal_0281"
FT   CDS_pept        314728..315267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0281"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="COGs: COG0094 Ribosomal protein L5; InterPro
FT                   IPR002132; KEGG: asa:ASA_4075 50S ribosomal protein L5;
FT                   PFAM: ribosomal protein L5; SPTR: A4SSZ4 50S ribosomal
FT                   protein L5; PFAM: ribosomal L5P family C-terminus;
FT                   Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74495"
FT                   /db_xref="GOA:E1SLU6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU6"
FT                   /protein_id="ADN74495.1"
FT                   /translation="MAKLHDYYKEAVVKELMQQFGYKSIMQVPRIEKITLNMGVGEAVA
FT                   DKKVLENAVADMAAISGQKPLVTKARKSVAGFKIREGYPIGCKVTLRGERMWEFFERLV
FT                   SIAVPRIRDFRGLNPKAFDGRGNYSMGVREQIIFPEIDYDKIDKLRGMDITITTSAGSD
FT                   EEGRALLAAFNFPFRK"
FT   gene            315279..315584
FT                   /locus_tag="Fbal_0282"
FT   CDS_pept        315279..315584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0282"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="COGs: COG0199 Ribosomal protein S14; InterPro
FT                   IPR001209: IPR018271; KEGG: amc:MADE_00951 30S ribosomal
FT                   protein S14; PFAM: ribosomal protein S14; SPTR: B4RT41 30S
FT                   ribosomal protein S14; PFAM: Ribosomal protein S14p/S29e"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74496"
FT                   /db_xref="GOA:E1SLU7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU7"
FT                   /protein_id="ADN74496.1"
FT                   /translation="MAKLSMKAREAKRAKLVAQYAEKRAALKAIIKDVNVSEEERWDAV
FT                   LKLQQLPRDSSASRQRNRCNITGRPHGVLRKFGLSRIKLREAAMRGEVPGLKKASW"
FT   gene            315602..315994
FT                   /locus_tag="Fbal_0283"
FT   CDS_pept        315602..315994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0283"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="COGs: COG0096 Ribosomal protein S8; InterPro
FT                   IPR000630; KEGG: eic:NT01EI_3580 hypothetical protein;
FT                   PFAM: ribosomal protein S8; SPTR: A1JS16 30S ribosomal
FT                   protein S8; PFAM: Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74497"
FT                   /db_xref="GOA:E1SLU8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU8"
FT                   /protein_id="ADN74497.1"
FT                   /translation="MSMQDPIADMLTRIRNGQSANKVAVTMPSSKLKVAIANVLKAEGY
FT                   VADFAVSGDVKPTLEVTLKYFQGKPVVESIARASRPGLRIYKKKDELPTVMGGLGIAIV
FT                   STSQGVMTDRAARNLGLGGEIICYVA"
FT   gene            316007..316540
FT                   /locus_tag="Fbal_0284"
FT   CDS_pept        316007..316540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0284"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="COGs: COG0097 Ribosomal protein L6P/L9E; InterPro
FT                   IPR019906: IPR020040: IPR002358; KEGG: vvy:VV0390 50S
FT                   ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain; SPTR: Q7MPH3 50S ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein L6;
FT                   TIGRFAM: ribosomal protein L6, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74498"
FT                   /db_xref="GOA:E1SLU9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU9"
FT                   /protein_id="ADN74498.1"
FT                   /translation="MSRVAKAPVAIPAGVEVSLNGQEITIKGGKGTLVREIHEAVVVTK
FT                   EENEITFGPREGAANAWAQAGTARALVNNMVIGVTEGFTKKLELLGVGYRAAVKGNAVN
FT                   LTLGFSHPVEYVLPEGVKAECPSQTEIVLTGSDKQSVGQAAANIRAYRAPEPYKGKGVR
FT                   YADEQVRRKEAKKK"
FT   gene            316550..316900
FT                   /locus_tag="Fbal_0285"
FT   CDS_pept        316550..316900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0285"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="COGs: COG0256 Ribosomal protein L18; InterPro
FT                   IPR005484: IPR004389; KEGG: vpa:VP0273 50S ribosomal
FT                   protein L18; PFAM: ribosomal protein L18P/L5E; SPTR: A1XWW7
FT                   Ribosomal protein L18; TIGRFAM: ribosomal protein L18;
FT                   PFAM: Ribosomal L18p/L5e family; TIGRFAM: ribosomal protein
FT                   L18, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74499"
FT                   /db_xref="GOA:E1SLV0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLV0"
FT                   /protein_id="ADN74499.1"
FT                   /translation="MDKKAARLRRATRVRKQIQEMGATRLVVHRTPRHIYAQVIAADAS
FT                   VVATASTVEKAIKEQLTGTGNTDAAKAVGKAVAERALEKGVKAVSFDRSGFQYHGRVAA
FT                   LADAAREAGLQF"
FT   gene            316915..317415
FT                   /locus_tag="Fbal_0286"
FT   CDS_pept        316915..317415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0286"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="COGs: COG0098 Ribosomal protein S5; InterPro
FT                   IPR013810: IPR005324: IPR018192: IPR005712; KEGG:
FT                   sfr:Sfri_0165 30S ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5 ; ribosomal protein S5 domain protein; SPTR:
FT                   Q089N7 30S ribosomal protein S5; TIGRFAM: ribosomal protein
FT                   S5; PFAM: Ribosomal protein S5, N-terminal domain;
FT                   Ribosomal protein S5, C-terminal domain; TIGRFAM: ribosomal
FT                   protein S5, bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74500"
FT                   /db_xref="GOA:E1SLV1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLV1"
FT                   /protein_id="ADN74500.1"
FT                   /translation="MANIENQAGDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRNMYTVSLKNGTLHHPVKGRHSGSKVYMQPASEGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKAYGSTNPINIVRSTVDALVNMKSPEQIAAKRGLPVDE
FT                   IRG"
FT   gene            317422..317601
FT                   /locus_tag="Fbal_0287"
FT   CDS_pept        317422..317601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0287"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="COGs: COG1841 Ribosomal protein L30/L7E; InterPro
FT                   IPR000517: IPR018038: IPR005996; KEGG: yen:YE3905 50S
FT                   ribosomal protein L30; PFAM: ribosomal protein L30; SPTR:
FT                   B1JIX9 50S ribosomal protein L30; TIGRFAM: ribosomal
FT                   protein L30; PFAM: Ribosomal protein L30p/L7e; TIGRFAM:
FT                   ribosomal protein L30, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74501"
FT                   /db_xref="GOA:E1SLV2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLV2"
FT                   /protein_id="ADN74501.1"
FT                   /translation="MAKTIKVTQTKSSIGRLPKHKATLVGLGLRKIGHTVELEDTASVR
FT                   GMINKVSYMVKVEE"
FT   gene            317603..318037
FT                   /locus_tag="Fbal_0288"
FT   CDS_pept        317603..318037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0288"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="COGs: COG0200 Ribosomal protein L15; InterPro
FT                   IPR001196: IPR005749; KEGG: swd:Swoo_4671 50S ribosomal
FT                   protein L15; PFAM: ribosomal protein L15; SPTR: B1KMW4 50S
FT                   ribosomal protein L15; TIGRFAM: ribosomal protein L15;
FT                   PFAM: Ribosomal protein L18e/L15; TIGRFAM: ribosomal
FT                   protein L15, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74502"
FT                   /db_xref="GOA:E1SLV3"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLV3"
FT                   /protein_id="ADN74502.1"
FT                   /translation="MRLNTLSPAAGSKTAAKRVGRGIGSGLGKTGGRGHKGQKSRSGGS
FT                   VRPGFEGGQMPLKQRLPKFGFTSRKSLVSAEVRLSELAKVEGDVVSLATLKDAGVISAN
FT                   IQFAKVVLSGKIERPVTVTGLKATKGAREAIEAAGGKIEE"
FT   gene            318052..319371
FT                   /locus_tag="Fbal_0289"
FT   CDS_pept        318052..319371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0289"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="COGs: COG0201 Preprotein translocase subunit SecY;
FT                   InterPro IPR002208; KEGG: saz:Sama_0233 preprotein
FT                   translocase subunit SecY; PFAM: SecY protein; SPTR: A1XWX1
FT                   Preprotein translocase secY subunit; TIGRFAM: preprotein
FT                   translocase, SecY subunit; PFAM: eubacterial secY protein;
FT                   TIGRFAM: preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74503"
FT                   /db_xref="GOA:E1SME8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E1SME8"
FT                   /protein_id="ADN74503.1"
FT                   /translation="MAKPGLELKSAKGGLSELKARLWFVLGAIIVFRAGSFVPIPGIDA
FT                   AVLAELFKQQQGTIVSMFNMFSGGALERASIFALGIMPYISASIIMQLLTVVHPAMAEL
FT                   KKEGESGRRKINQYTRWGTLVLATFQSIGIATGLPSMLPGLVVNPGFGFYFVAVVSLVT
FT                   GTMFLMWLGEQITERGIGNGISILIFSGIVAGLPSAIGQTAEQARQGEMHLILLLGLVV
FT                   IVSLITAFVVFMERGQRRIVVNYAKRQQGRRVFAAQSTHLPLKVNMAGVIPPIFASSII
FT                   LFPGTLAQWFDKNQGGILSDISLALSPGQPLYVMIYAVAIVFFCFFYTALVFNPRETAD
FT                   NLKKSGAFIPGIRPGEQTARYIDKVMTRLTLAGAAYITFICLVPEFMMITTNVPFYFGG
FT                   TSLLIMVVVIMDFMAQVQTHLMSSQYESVLKKANLKGYGR"
FT   gene            319396..319509
FT                   /locus_tag="Fbal_0290"
FT   CDS_pept        319396..319509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0290"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="InterPro IPR000473; KEGG: vsp:VS_2810.1 50S
FT                   ribosomal protein L36; PFAM: ribosomal protein L36; SPTR:
FT                   A3V0F4 50S ribosomal protein L36; TIGRFAM: ribosomal
FT                   protein L36; PFAM: Ribosomal protein L36; TIGRFAM:
FT                   ribosomal protein L36, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74504"
FT                   /db_xref="GOA:E1SME9"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:E1SME9"
FT                   /protein_id="ADN74504.1"
FT                   /translation="MKVRASVKKMCRNCKVIKRNGVVRVICSEPKHKQRQG"
FT   gene            319649..320005
FT                   /locus_tag="Fbal_0291"
FT   CDS_pept        319649..320005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0291"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="COGs: COG0099 Ribosomal protein S13; InterPro
FT                   IPR001892: IPR018269: IPR019980; KEGG: tau:Tola_0121
FT                   ribosomal protein S13; PFAM: ribosomal protein S13; SPTR:
FT                   A4SSY4 30S ribosomal protein S13; TIGRFAM: 30S ribosomal
FT                   protein S13; PFAM: Ribosomal protein S13/S18; TIGRFAM: 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74505"
FT                   /db_xref="GOA:E1SMF0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF0"
FT                   /protein_id="ADN74505.1"
FT                   /translation="MARIAGINIPEHKHAVVALTAIFGIGQTRAKAICVEAGIAEDVKF
FT                   KDLDEATIDKVREVVGQFTVEGDLRREISMNIKRLMDLGCFRGLRHRRSLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            320019..320408
FT                   /locus_tag="Fbal_0292"
FT   CDS_pept        320019..320408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0292"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="COGs: COG0100 Ribosomal protein S11; InterPro
FT                   IPR001971: IPR018102: IPR019981; KEGG: hso:HS_0082 30S
FT                   ribosomal protein S11; PFAM: ribosomal protein S11; SPTR:
FT                   Q0I139 30S ribosomal protein S11; TIGRFAM: 30S ribosomal
FT                   protein S11; PFAM: Ribosomal protein S11; TIGRFAM: 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74506"
FT                   /db_xref="GOA:E1SMF1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF1"
FT                   /protein_id="ADN74506.1"
FT                   /translation="MAKTPSRTRKKVRKQVADGIAHVHASFNNTIVTITDRQGNALAWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEIAKEYGLKNLEVEVKGPGPGRESSIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            320437..321057
FT                   /locus_tag="Fbal_0293"
FT   CDS_pept        320437..321057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0293"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="COGs: COG0522 Ribosomal protein S4 and related
FT                   protein; InterPro IPR001912: IPR002942: IPR018079:
FT                   IPR005709; KEGG: aha:AHA_0332 ribosomal protein S4; PFAM:
FT                   ribosomal protein S4; RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; SPTR: A0KF44 30S ribosomal
FT                   protein S4; TIGRFAM: ribosomal protein S4; PFAM: Ribosomal
FT                   protein S4/S9 N-terminal domain; S4 domain; TIGRFAM:
FT                   ribosomal protein S4, bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74507"
FT                   /db_xref="GOA:E1SMF2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF2"
FT                   /protein_id="ADN74507.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKIDTVPGQHGARR
FT                   ARLSDYGVQLREKQKVRRMYGVLEKQFRNYYKEAARLKGNTGENLLQLLESRLDNVVYR
FT                   MGFGATRAEARQLVSHKAIKVNGRVVNIPSFSVSPNDVIAVREKAQKQARIKGALEVAE
FT                   QREKPTWVEVDGAKMEGTFKRLPERSDLSADINEQLIVELYSK"
FT   gene            321083..322075
FT                   /locus_tag="Fbal_0294"
FT   CDS_pept        321083..322075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0294"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0202 DNA-directed RNA polymerase alpha
FT                   subunit/40 kD subunit; InterPro IPR011260: IPR011262:
FT                   IPR011261: IPR011263: IPR 011773; KEGG: slo:Shew_0183
FT                   DNA-directed RNA polymerase subunit alpha; PFAM: RNA
FT                   polymerase insert; RNA polymerase alpha subunit domain
FT                   protein; RNA polymerase dimerisation; SMART: RNA polymerase
FT                   RpoA/D/Rpb3-type; SPTR: Q9S0Q8 DNA-directed RNA polymerase
FT                   subunit alpha; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase Rpb3/Rpb11 dimerisation
FT                   domain; RNA polymerase Rpb3/RpoA insert domain; Bacterial
FT                   RNA polymerase, alpha chain C terminal domain; TIGRFAM:
FT                   DNA-directed RNA polymerase, alpha subunit, bacterial and
FT                   chloroplast-type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74508"
FT                   /db_xref="GOA:E1SMF3"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF3"
FT                   /protein_id="ADN74508.1"
FT                   /translation="MQGSVTEFLKPRLVDIDQVSPYRAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDVLEILLNLKGLAVKLEGKDEAILTLSK
FT                   SGAGPVTAADITHDGDVEIVNPEHLICTLTGADAEISMRIKVELGRGYIPASARAQVEE
FT                   DERPIGRLLVDASFSPVVRIAYNVEAARVEQRTDLDKLIIDMHTDGTLDPEEAIRRSAT
FT                   ILAEQLEAFVDLRDVSEPEEKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASLADNM"
FT   gene            322114..322515
FT                   /locus_tag="Fbal_0295"
FT   CDS_pept        322114..322515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0295"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="COGs: COG0203 Ribosomal protein L17; InterPro
FT                   IPR000456; KEGG: ilo:IL1890 50S ribosomal protein L17;
FT                   PFAM: ribosomal protein L17; SPTR: Q5QXV0 50S ribosomal
FT                   protein L17; TIGRFAM: ribosomal protein L17; PFAM:
FT                   Ribosomal protein L17; TIGRFAM: ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74509"
FT                   /db_xref="GOA:E1SMF4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF4"
FT                   /protein_id="ADN74509.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEVIKTTLPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDQFVVGKLFNELGPRYQERAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRPAAEEVAEEAQASAE"
FT   gene            complement(323098..323580)
FT                   /locus_tag="Fbal_0296"
FT   CDS_pept        complement(323098..323580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0296"
FT                   /product="CcmE/CycJ protein"
FT                   /note="COGs: COG2332 Cytochrome c-type biogenesis protein
FT                   CcmE; InterPro IPR004329; KEGG: ppr:PBPRA0951 cytochrome
FT                   c-type biogenesis protein CcmE; PFAM: CcmE/CycJ protein;
FT                   SPTR: Q6LTL4 Cytochrome c-type biogenesis protein ccmE;
FT                   PFAM: CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74510"
FT                   /db_xref="GOA:E1SMF5"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF5"
FT                   /protein_id="ADN74510.1"
FT                   /translation="MNPRRKKRLVFASALIGGVAAIASLLIYALNSNLDLFFTATEVVQ
FT                   GRQDGLKPEVGQRIRIGGMVVEGSVERDPNSLKIAFQVADTGPAVTVLYDGMLPDLFRE
FT                   GQGIVAQGTLVDSTTLEASEVLAKHDENYMSPEIAEAMGKSHEQMEYSESQTGGGY"
FT   sig_peptide     complement(323494..323580)
FT                   /locus_tag="Fbal_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(323577..323789)
FT                   /locus_tag="Fbal_0297"
FT   CDS_pept        complement(323577..323789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0297"
FT                   /product="heme exporter protein CcmD"
FT                   /note="COGs: COG3114 Heme exporter protein D; InterPro
FT                   IPR007078; KEGG: slo:Shew_0187 heme exporter protein D
FT                   (CcmD); PFAM: Heme exporter protein D (CcmD); SPTR: A1XWY0
FT                   Cytochrome c biogenesis protein CcmD; TIGRFAM: heme
FT                   exporter protein CcmD; PFAM: Heme exporter protein D
FT                   (CcmD); TIGRFAM: heme exporter protein CcmD"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74511"
FT                   /db_xref="GOA:E1SMF6"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF6"
FT                   /protein_id="ADN74511.1"
FT                   /translation="MNLTFQFASAAEFFEMGGYAFYVWLSYGVGALALAALVVNSLRKR
FT                   KTVLKNIAKQQAREERLRQHRSKAA"
FT   gene            complement(323786..324538)
FT                   /locus_tag="Fbal_0298"
FT   CDS_pept        complement(323786..324538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0298"
FT                   /product="heme exporter protein CcmC"
FT                   /note="COGs: COG0755 ABC-type transport system involved in
FT                   cytochrome c biogenesis permease component; InterPro
FT                   IPR003557: IPR002541; KEGG: shw:Sputw3181_0186 heme
FT                   exporter protein CcmC; PFAM: cytochrome c assembly protein;
FT                   SPTR: A1XWY1 Cytochrome c biogenesis protein CcmC; TIGRFAM:
FT                   heme exporter protein CcmC; PFAM: Cytochrome C assembly
FT                   protein; TIGRFAM: heme exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74512"
FT                   /db_xref="GOA:E1SMF7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF7"
FT                   /protein_id="ADN74512.1"
FT                   /translation="MWKWLHPYAHPERAYHLAGAMLPWFAALATLLIATGTIWGLGFAP
FT                   VDYQQGDSYRIIFLHVPAASMSMAAYTAMAICAFIGLVWQLKLADIAAAAIAPVGAVLT
FT                   FIALLTGAAWGKPMWGTWWVWDARLTSELVLLFLYLGVIALYASFEDKVMAAKAAGILA
FT                   IVGVINLPIIKYSVEWWNTLHQPNAITVGQSNNMPPEMLIPLLCNIFGFAVLIGALSIL
FT                   RFRAEVLARNSMRPWVRAMVEAEEKKSA"
FT   gene            complement(324540..325223)
FT                   /locus_tag="Fbal_0299"
FT   CDS_pept        complement(324540..325223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0299"
FT                   /product="heme exporter protein CcmB"
FT                   /note="COGs: COG2386 ABC-type transport system involved in
FT                   cytochrome c biogenesis permease component; InterPro
FT                   IPR003544; KEGG: swd:Swoo_4660 heme exporter protein CcmB;
FT                   PFAM: cytochrome c-type biogenesis protein CcmB; SPTR:
FT                   A1XWY2 Cytochrome c biogenesis protein CcmB; TIGRFAM: heme
FT                   exporter protein CcmB; PFAM: CcmB protein; TIGRFAM: heme
FT                   exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74513"
FT                   /db_xref="GOA:E1SMF8"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF8"
FT                   /protein_id="ADN74513.1"
FT                   /translation="MRQINYRQAFTTVLKRDLQIAFRHSGDIFNPLMFFVMVVTLFPLG
FT                   IGPEPNTLTRIAPGIIWVAALLSAMLSLERLFKSDYSDGALEQMMLSPQPLALMVLAKV
FT                   LAHWLVTGVPLILAAPLLAVLLHLDENSYGALMATLAVGTPILSLLGAIGVALTVGLRK
FT                   GGVLLSLLILPLYIPVLIFATSAIDAASMNMPFTGHLAILAAMLVGSLVLAPVAIGASL
FT                   RVSTN"
FT   gene            complement(325235..325882)
FT                   /locus_tag="Fbal_0300"
FT   CDS_pept        complement(325235..325882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0300"
FT                   /product="heme exporter protein CcmA"
FT                   /EC_number="3.6.3.41"
FT                   /note="COGs: COG4133 ABC-type transport system involved in
FT                   cytochrome c biogenesis ATPase component; InterPro
FT                   IPR003439: IPR003593: IPR005895; KEGG: sbp:Sbal223_4024
FT                   heme exporter protein CcmA; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: Q0HNQ5 Cytochrome c biogenesis
FT                   ATP-binding export protein ccmA; TIGRFAM: heme exporter
FT                   protein CcmA; PFAM: ABC transporter; TIGRFAM: heme ABC
FT                   exporter, ATP-binding protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74514"
FT                   /db_xref="GOA:E1SMF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF9"
FT                   /protein_id="ADN74514.1"
FT                   /translation="MTEASRTPLLTAQALTCIREERILFDELSFDIHPGDIIQIEGPNG
FT                   AGKSSLLRILAGLSRPYAGQVHYCGERIEDVRDDYHADLLFLGHLPGVKGELTAEENLE
FT                   FNLKIAGYADAPIHDTLAKVNLTGFEEHPAGHLSAGQHRRIALARLWHTQSKIWILDEP
FT                   LTAIDKRGVQELEQLFMQHADNGGCVILTTHQDLQLVSGDRLRKLRLDYQFV"
FT   gene            326215..326508
FT                   /locus_tag="Fbal_0301"
FT   CDS_pept        326215..326508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0301"
FT                   /product="cytochrome c class I"
FT                   /note="COGs: COG3245 Cytochrome c5; InterPro IPR002323:
FT                   IPR009056; KEGG: spl:Spea_0216 cytochrome c class I; SPTR:
FT                   A1XWY4 Cytochrome c; PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74515"
FT                   /db_xref="GOA:E1SMG0"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG0"
FT                   /protein_id="ADN74515.1"
FT                   /translation="MKKIVALAAVASLTMASNVMAQDGEAVYQKACKTCHEMGIAGAPK
FT                   VKDAAAWEPRLGKGMDALVSSVKTGLNAMPPGGMCMDCTDEDLKAAIEYMAK"
FT   sig_peptide     326215..326277
FT                   /locus_tag="Fbal_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(326573..327823)
FT                   /locus_tag="Fbal_0302"
FT   CDS_pept        complement(326573..327823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0302"
FT                   /product="cytochrome c-type biogenesis protein CcmI"
FT                   /note="COGs: COG4235 Cytochrome c biogenesis factor;
FT                   InterPro IPR019734: IPR013026: IPR017560; KEGG:
FT                   shm:Shewmr7_0228 TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat; SPTR: A2UXA3 TPR repeat; TIGRFAM:
FT                   cytochrome c-type biogenesis protein CcmI; PFAM:
FT                   Tetratricopeptide repeat; TIGRFAM: cytochrome c-type
FT                   biogenesis protein CcmI"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74516"
FT                   /db_xref="GOA:E1SMG1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG1"
FT                   /protein_id="ADN74516.1"
FT                   /translation="MTTFWFGIAVLSALALFTIWLPFWRRQKALAAASDAQVRKQTNLS
FT                   LFNERLKELETDLAEGRINEQEFEDFKKELQLNLLQNTEQEDHVLDAKKPSILWPAIMS
FT                   VALLAVAGYTYHDLGRYSDWQNAQVGGNDPHAGMNPDQLMQMRLAQMEQAVQADPSNSQ
FT                   AWFSLGHAYISASQYTKAIEAFDTVMSLVGEHAELLGPKATAMYYLNGQKMNPEIQGIV
FT                   EKALADDNKDPSTRLLLGMDAFFNANYETAIEHWEIILTSPREDVDRQAILGAISQARM
FT                   HLEQSGAAMGGETAAPEQAATTGKTLTVTVELADAVKAQANQSDSLFLFARPVSGPAMP
FT                   VAVARLNVADLPTQVVLDDSTAMSPDMVISAHSQVNLVATINHDGSPAPTPGDLLGELN
FT                   AVDLGTQVTLVIDTIVE"
FT   sig_peptide     complement(327731..327823)
FT                   /locus_tag="Fbal_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            328236..330200
FT                   /locus_tag="Fbal_0303"
FT   CDS_pept        328236..330200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0303"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="COGs: COG1138 Cytochrome c biogenesis factor;
FT                   InterPro IPR003567: IPR003568: IPR003570: IPR002541; KEGG:
FT                   swp:swp_2046 cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; SPTR: A2UXA4
FT                   Cytochrome c-type biogenesis protein CcmF; TIGRFAM:
FT                   cytochrome c-type biogenesis protein CcmF; PFAM: Cytochrome
FT                   C assembly protein; TIGRFAM: c-type cytochrome biogenesis
FT                   protein CcmF; cytochrome c nitrate reductase biogenesis
FT                   protein NrfE"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74517"
FT                   /db_xref="GOA:E1SMG2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG2"
FT                   /protein_id="ADN74517.1"
FT                   /translation="MVPELGHYSLIIGLAFAALLAVVPLIGVARKDAYLVSFARPMAYG
FT                   MCLFMALSVVCLGYAFATDDFSVAYVAHNSNSHLPVYFKIAAIWGGHEGSLLFWTFSIS
FT                   IWAATVSAFSKGLEEAFTARVLSVLGMIIVGFALFMLFTSSPFERLLPNVPMEGRDLNP
FT                   MLQDVGLIFHPPLLYLGYVGFSVTFAFAIAALMSGRLDSAWARWSRPWALAAWAFLTAG
FT                   IALGSWWAYYELGWGGWWFWDPVENASFMPWLVGTALIHSLIVTEKRGTFRNWTILLAI
FT                   FTFSLSLLGTFLVRSGVLTSVHSFAADPSRGLFILILLGLTIGGSLMLFALRATELASP
FT                   SRFELLSKETMLLLCNVLLVVATGSVLLGTLYPLLGDALGLGQISVGPPYFNTVFNPIV
FT                   LVMFVFMGIGPFIRWKKAKEGELKRLLPSLIVAIVVAIAAPLLIGGKLNGWIFAGLFTA
FT                   TWITATLVQGLIRECRDTDGSFTMRRITRSYVGMQIAHLGIAMAIVGGTVVSHFESERS
FT                   VRMGPGISESLAGYTFTYEQTRMVQGPNYTAEQGVVTVTQDGDYVTTLYPDRRQYNVRT
FT                   MDMTEAGIDWGFFRDLYVTMGDPLDATHYAVRLNYKPMVRWLWIGSILMMVGGIVAATD
FT                   KRIRAKKPAPAANAKLANA"
FT   gene            330214..330768
FT                   /locus_tag="Fbal_0304"
FT   CDS_pept        330214..330768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0304"
FT                   /product="periplasmic protein thiol/disulfide
FT                   oxidoreductase DsbE"
FT                   /note="InterPro IPR006662: IPR000866: IPR013740: IPR017937:
FT                   IPR 004799; KEGG: swp:swp_2047 thiol:disulfide interchange
FT                   protein DsbE; PFAM: Redoxin domain protein; alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; SPTR: A2UXA5 Periplasmic protein
FT                   thiol--disulphide oxidoreductase DsbE; TIGRFAM: periplasmic
FT                   protein thiol/disulphide oxidoreductase DsbE; PFAM:
FT                   Redoxin; TIGRFAM: periplasmic protein thiol:disulfide
FT                   oxidoreductases, DsbE subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74518"
FT                   /db_xref="GOA:E1SMG3"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG3"
FT                   /protein_id="ADN74518.1"
FT                   /translation="MKRAALFVPLFIFLGLSVFLFKGLFLDPSKLDSVLVGNPVPTFEL
FT                   ETLEDAGVKITNEDLLGDVYLINVWATWCPSCKYEHPFLNQLQRQGAIKIYGVNYRDER
FT                   DLAIRYLAQSGDPYTRNIFDPEGTLSFDMGVYGAPETFVVDHNGIVRHRFAGVLEPQVW
FT                   AKDFMPLIQQIRAEAAAEGNS"
FT   sig_peptide     330214..330279
FT                   /locus_tag="Fbal_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            330768..331238
FT                   /locus_tag="Fbal_0305"
FT   CDS_pept        330768..331238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0305"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="COGs: COG3088 Uncharacterized protein involved in
FT                   biosynthesis of c-type cytochromes; InterPro IPR005616;
FT                   KEGG: swp:swp_2048 cytochrome c biogenesis protein; PFAM:
FT                   cytochrome C biogenesis protein; SPTR: A2UXA6 Cytochrome C
FT                   biogenesis protein; PFAM: Cytochrome C biogenesis protein;
FT                   TIGRFAM: cytochrome c nitrite reductase, accessory protein
FT                   NrfF"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74519"
FT                   /db_xref="GOA:E1SMG4"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG4"
FT                   /protein_id="ADN74519.1"
FT                   /translation="MKRLFQLVAIMLFAGAVHATPIDTYEFKNDANRERGVKLAAELRC
FT                   PQCQNQNLHDSNSPIAKDMRLQVYEMVDQGKSNDEIVGYFTQRYGDFVRYKPAFDARTY
FT                   VLWLGPVAFFVVGGLALFAFVRSQRQQSGGTVEVSADDEAKLAKLLDQDKNA"
FT   sig_peptide     330768..330824
FT                   /locus_tag="Fbal_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            331238..331789
FT                   /locus_tag="Fbal_0306"
FT   CDS_pept        331238..331789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0306"
FT                   /product="Redoxin domain protein"
FT                   /note="InterPro IPR006662: IPR000866: IPR013740: IPR017937;
FT                   KEGG: sbn:Sbal195_0237 redoxin domain-containing protein;
FT                   PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; SPTR:
FT                   A2UXA7 Redoxin; PFAM: Redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74520"
FT                   /db_xref="GOA:E1SMG5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG5"
FT                   /protein_id="ADN74520.1"
FT                   /translation="MKVVVYLVLALLSSSAFAYPGATKVAEDPALSRFIHLSKPQDLDS
FT                   VQLVAPDGQPIQLSDLKGQPVMINLWATWCPPCVRELPSLARFRADFEARGLKVVPIAI
FT                   DYDPAVVQPFLNQLELPEFRTWYDSVNAMGQIVPTDLVPATYILDEQGRLVAFVRSFVD
FT                   WDNAAVREVMERYLPAAKSQ"
FT   sig_peptide     331238..331291
FT                   /locus_tag="Fbal_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            332305..333845
FT                   /locus_tag="Fbal_R0014"
FT   rRNA            332305..333845
FT                   /locus_tag="Fbal_R0014"
FT                   /product="16S ribosomal RNA"
FT   gene            333938..334014
FT                   /locus_tag="Fbal_R0015"
FT   tRNA            333938..334014
FT                   /locus_tag="Fbal_R0015"
FT                   /product="tRNA-Ile"
FT   gene            334044..334119
FT                   /locus_tag="Fbal_R0016"
FT   tRNA            334044..334119
FT                   /locus_tag="Fbal_R0016"
FT                   /product="tRNA-Ala"
FT   gene            334399..337285
FT                   /locus_tag="Fbal_R0017"
FT   rRNA            334399..337285
FT                   /locus_tag="Fbal_R0017"
FT                   /product="23S ribosomal RNA"
FT   gene            337379..337492
FT                   /locus_tag="Fbal_R0018"
FT   rRNA            337379..337492
FT                   /locus_tag="Fbal_R0018"
FT                   /product="5S ribosomal RNA"
FT   gene            337501..337576
FT                   /locus_tag="Fbal_R0019"
FT   tRNA            337501..337576
FT                   /locus_tag="Fbal_R0019"
FT                   /product="tRNA-Thr"
FT   gene            337716..339005
FT                   /locus_tag="Fbal_0307"
FT   CDS_pept        337716..339005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0307"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="COGs: COG1058 nucleotide-utilizing enzyme related to
FT                   molybdopterin-biosynthesis enzyme MoeA; InterPro IPR001453:
FT                   IPR008136: IPR008135; KEGG: swd:Swoo_0325
FT                   competence/damage-inducible protein CinA; PFAM: CinA domain
FT                   protein; molybdopterin binding domain; SPTR: B1KNC9
FT                   CinA-like protein; TIGRFAM: competence/damage-inducible
FT                   protein CinA; PFAM: Probable molybdopterin binding domain;
FT                   Competence-damaged protein; TIGRFAM:
FT                   competence/damage-inducible protein CinA N-terminal domain;
FT                   competence/damage-inducible protein CinA C-terminal domain;
FT                   molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74521"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG6"
FT                   /protein_id="ADN74521.1"
FT                   /translation="MRFEMICTGEEVLSGQIIDTNAAWVAQTLMSQGIEMQRRMTVGDR
FT                   LEDLVEAFRSCAGRADVVLVNGGLGPTADDLSAEAMATLLEVPLELNAEWLETMTRLFE
FT                   RRGRTMSDKNRKQALLPKGATMVDNPVGTACGFRACYQGTWYFFTPGVPSELKRMVHEQ
FT                   LLPWLKASFPIEVPVGLHRMLTIGQGESNLAQLLEPIPLPPGVTLGFRASLPYIEIKLL
FT                   QRRPVDPADWQPLLSAYREALGDALIGENIKTLPEAVHRALLAEGKTLATAESCTGGMV
FT                   ASQLVDLAGSSAYLVAGLVTYSNDAKKALLGVSEATLQQHGAVSLETVLEMAQGARTRM
FT                   GTDMAVSISGIAGPDGGTEAKPVGTVSFALATEQGCVAQTLHLGARDRNAIRLLAATVA
FT                   LDMVRRALLGLPVVAEYGYLNRVEQCQITA"
FT   gene            complement(338995..339534)
FT                   /locus_tag="Fbal_0308"
FT   CDS_pept        complement(338995..339534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0308"
FT                   /product="protein of unknown function DUF1439"
FT                   /note="InterPro IPR010835; KEGG: saz:Sama_0253 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1439; SPTR:
FT                   A2V3G7 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1439)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74522"
FT                   /db_xref="InterPro:IPR010835"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG7"
FT                   /protein_id="ADN74522.1"
FT                   /translation="MRVLTLLLVTLGLGGCAASYSVTETELEGYLNNALRKEQRAELNP
FT                   GLSATMTLSDIDVTIGDEAERVAIRTRSSVKVKTPLIPLRAELAFTFSAKPWYDSDDHS
FT                   VYLKDVALSEVSASPEELEQLLIPLSREAMQVVKLYLENQPVYQLDQQGWKEDLLRQFG
FT                   RELKVSPGQLEFVLKP"
FT   sig_peptide     complement(339472..339534)
FT                   /locus_tag="Fbal_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(339539..342178)
FT                   /locus_tag="Fbal_0309"
FT   CDS_pept        complement(339539..342178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0309"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="COGs: COG2352 Phosphoenolpyruvate carboxylase;
FT                   InterPro IPR001449: IPR018129; KEGG: slo:Shew_0200
FT                   phosphoenolpyruvate carboxylase; PFAM: phosphoenolpyruvate
FT                   carboxylase; PRIAM: Phosphoenolpyruvate carboxylase; SPTR:
FT                   A3Q9C4 Phosphoenolpyruvate carboxylase; PFAM:
FT                   Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74523"
FT                   /db_xref="GOA:E1SMG8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG8"
FT                   /protein_id="ADN74523.1"
FT                   /translation="MTDMYAPLKANVHLLGDILGETIEAEHGAAFLNLIEEVRQLSKAS
FT                   RQGDTEAQSKMLALLSELPDEQLVPFASAFNQFLNLANIAEQFHTISRNCDELVCVPDP
FT                   VDLLLGRLFNGKAQLKPDQLIDELEKLEIDLVLTAHPTEVTRRTLISKYSALIECLSER
FT                   ENPQLSERETKRNQLRMRQLVAQIWHTNEIRKQRPTPVDEARWGMATVETSLWHAVPEF
FT                   LRQLNEQVEEHAGRQLPPHVAPVRFSSWMGGDRDGNPFVTAKVSEEVLLRNRCTATRLY
FT                   LEDINQLIGELSMTDCDQAIRAMVGDHREPYRILLRQLREKLSDTQDYLMARLDGQQPK
FT                   TNPSTLIWHKKDLLEPLELIYQSLLDQGMRLIANGLLLDTLRRIHCFGLTLVRVDIRQS
FT                   SDRHASAIAEITRYLGLGDYLHWSEAEKQSFLLRELASRRPLLPHQWQASADTQEVLDT
FT                   CRLIGQQSPEALGSYVISMASEASDVLAVALLLKECDCNFALPIVPLFETLSDLDNAPA
FT                   VMRNLLQIDWYLGYCRGKQQVMIGYSDSAKDAGVMAASWAQYRAQEALVSVCKDAGVAL
FT                   TLFHGRGGSIGRGGGPAHEAILSQPPGSVDSRLRVTEQGEMIRFKFGLPEVAVQSLALY
FT                   TSAVLEATLLPPLAPKPEWRSLMDSIADDSVRAYRQIVQDEPDFVPYFRAATPELELSA
FT                   LPLGSRPAKRRADGGVESLRAIPWIFAWTQNRLMLPAWLGAGESLQNAIDQGHQETLQE
FT                   MFLNWPLFRTRLSMLEMVYAKSEPNLSRYYEQILVKPELHGLGEKLRQSLEIGVRSVLN
FT                   LTQEQGLMDLTPWNKESVALRHPYIDPLNFLQAELLRRCRQEPEDPALQQALMITIAGI
FT                   AAGLRNTG"
FT   gene            342530..343531
FT                   /locus_tag="Fbal_0310"
FT   CDS_pept        342530..343531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0310"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="COGs: COG0002 Acetylglutamate semialdehyde
FT                   dehydrogenase; InterPro IPR000534: IPR012280: IPR000706;
FT                   KEGG: swd:Swoo_0329 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region; PRIAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; SPTR: B1KND3
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, dimerisation domain;
FT                   Semialdehyde dehydrogenase, NAD binding domain; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase, common form"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74524"
FT                   /db_xref="GOA:E1SMG9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG9"
FT                   /protein_id="ADN74524.1"
FT                   /translation="MLKVAIVGASGYTGATLAKLIANHPSLALAGCYVSAGSADAHTPL
FT                   SQLYPELLGLVDQPLQPLTHEAQAELGQQAQAVCLATDHQVSAELAPALLAQGLTVFDL
FT                   SGGHRFADPAIYPQHYGFSHPSPELLSDAVYGLAEWAGTALADAALIAVPGCYPTAALT
FT                   ALKPLAQHGLIAGVPVINAVSGVSGAGRKASLNSSFCQVSLTPYGVLGHRHQPEIESQL
FT                   GHAVVFTPHLGAFKRGILATITVPVSADCTEAALSEAYGCYDDSAVVHCLPAGQWPKVD
FT                   DVAGSDRCLLAWKLDSERQVLVVASAIDNLMKGAASQALQCILIRFGLGGEA"
FT   sig_peptide     342530..342619
FT                   /locus_tag="Fbal_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            343528..344301
FT                   /locus_tag="Fbal_0311"
FT   CDS_pept        343528..344301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0311"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COGs: COG0548 Acetylglutamate kinase; InterPro
FT                   IPR001057: IPR001048: IPR004662; KEGG: sse:Ssed_4275
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; SPTR: A8G1A6 Acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: Amino acid kinase family;
FT                   TIGRFAM: acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74525"
FT                   /db_xref="GOA:E1SMH0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH0"
FT                   /protein_id="ADN74525.1"
FT                   /translation="MKTMVIKVGGALLGCEAGVERLFSTLKALGQSGWQAVLVHGGGVL
FT                   VEQQLSANGFLSEKKNGLRVTPEEQMSVVAGALAGSANTQLVAAAVAAGLVPVGLSLAD
FT                   GGMTQAEVLDPDLGAVGKVSVGQPALLEQLLGLGMLPIISSIAVSDQGQRLNVNADQAA
FT                   TVVCQLLGAELTLLSDVSGVLDGKGQLIPNLDPALVDELTRQGVIEGGMKVKVDAALEA
FT                   ARSINNRVLVASWRYPEQLAALVKGEPVGTQVHPC"
FT   gene            344322..345230
FT                   /locus_tag="Fbal_0312"
FT   CDS_pept        344322..345230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0312"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterPro IPR002082: IPR006130: IPR002292: IPR006132: IPR
FT                   006131; KEGG: shl:Shal_4091 ornithine carbamoyltransferase;
FT                   PFAM: aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; PRIAM: Ornithine
FT                   carbamoyltransferase; SPTR: A2V3G2 Ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain;
FT                   Aspartate/ornithine carbamoyltransferase, Asp/Orn binding
FT                   domain; TIGRFAM: ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74526"
FT                   /db_xref="GOA:E1SMH1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH1"
FT                   /protein_id="ADN74526.1"
FT                   /translation="MNHLLSIKDLSPEQIHGLIDLAKTLKADYIPYQDALKGKSVVTLF
FT                   EKPSLRTRVSFDIGINKLGGHCLYLDQQNGAIGQREAVKDFAMNLSRWCDAIVARVFSH
FT                   QTLEELAEYATVPVVNSLSDLYHPCQGLADFLTLSEHYDDLSQVKLGYIGDGNNVTHSL
FT                   MYAAAKLGATMVVVCPPGHFPDGQVVTEAQAIAAEHGGALVLSSDLAALEGVDALYADT
FT                   WISMGDNTPMAAIKAKFQPYQINSKLMSLTGAKYVLHCQPAHREVEITSEVMDSDASLI
FT                   LDQAENRMHIQNAILLELMKD"
FT   gene            345235..346443
FT                   /locus_tag="Fbal_0313"
FT   CDS_pept        345235..346443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0313"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COGs: COG0137 Argininosuccinate synthase; InterPro
FT                   IPR001518: IPR018223; KEGG: amc:MADE_00529
FT                   argininosuccinate synthase; PFAM: argininosuccinate
FT                   synthase; PRIAM: Argininosuccinate synthase; SPTR: A0XXT0
FT                   Argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; PFAM: Arginosuccinate synthase; TIGRFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74527"
FT                   /db_xref="GOA:E1SMH2"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH2"
FT                   /protein_id="ADN74527.1"
FT                   /translation="MTQIKKVVLAYSGGLDTSAIIPWLKEQHDCEVVAFVADVGQGAEE
FT                   LEGVEAKAIASGASSCHVVDLKDAFVSEYINPILKTGALYEGTYLLGTAMARPIIAKAQ
FT                   VELALKVGADALAHGCTGKGNDQVRFESTYAALAPELSVIAPWREWTMKSRTDLLNYLA
FT                   SKNIPTTASAEKIYSRDANAWHISHEGGELEDPYCEPSEQVWTWTQSLEQAPNEAQYVS
FT                   LQFEAGVLTAVDGESMTPYNALNYLNGVAAKHGVGRIDIVENRLVGMKSRGCYETPGGT
FT                   VINNALRGLETLVLDKAAFKFREQIGLEFSHVLYDGRWFTPVAQAQLAAAESLAQALTG
FT                   EIVVKLYKGHATVVKRQSPNSLYSEAFSTFEEDEVYNQKHAEGFIRLFSLSSRIAAMHK
FT                   EQN"
FT   gene            346445..348376
FT                   /locus_tag="Fbal_0314"
FT   CDS_pept        346445..348376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0314"
FT                   /product="N-acetylglutamate synthase ;argininosuccinate
FT                   lyase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="4.3.2.1"
FT                   /note="COGs: COG0165 Argininosuccinate lyase; InterPro
FT                   IPR000362: IPR000182: IPR020557: IPR009049; KEGG:
FT                   cps:CPS_0464 bifunctional argininosuccinate
FT                   lyase/N-acetylglutamate synthase; PFAM: fumarate lyase;
FT                   GCN5-related N-acetyltransferase; SPTR: P59620 Bifunctional
FT                   protein argH; TIGRFAM: argininosuccinate lyase; PFAM:
FT                   Lyase; Acetyltransferase (GNAT) family; TIGRFAM:
FT                   argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74528"
FT                   /db_xref="GOA:E1SMH3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR011244"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH3"
FT                   /protein_id="ADN74528.1"
FT                   /translation="MTAKGALWGGRFSGAADSRFKLFNDSLPVDYRLVQQDITGSIAWA
FT                   GALQQVGVLDELEHGSLVKALHELSESVTDEQILSSGAEDIHSFVEGALIEKVGDLGKK
FT                   LHTGRSRNDQVATDLKLWCKDQGEQLIEALVRLQQQLLSLAQQEAQTVLPGYTHLQRAQ
FT                   PITFGHWCLAYVEMLERDLTRVKDALARLDRCPLGSGALAGTAYPVDRQALAHALGFAS
FT                   ATANSLDAVSDRDHVVELCSAASTAMMHLSRFAEDLIFYNSGEAGFIELSDAVTSGSSL
FT                   MPQKKNPDALELIRGKAGRVYGALIGILTTMKALPMAYNKDMQEDKEGLFDALDTWLAC
FT                   TEMATLVLDGLKVNSQRTLAAAQQGYANATELADYLVSKGMPFREAHHVVGEVVVAAIA
FT                   AQKALEDFTLPELQAFSGVIQSDVFQHLTIDACLAKRDTLGGTALIQVEQALGNREAKE
FT                   AVAEHDALGGTAPEQVLHALDTSQQRLNAHKAEILKVRNAKLSDVDAIHRINAYWADKG
FT                   DTLPRSRDDVLKDILDFSVAEQEGQVVGCASLYIYETGLAEMRSVGIDPNHHGAGQGRA
FT                   LVDYMLQRGRELELQRVIVLTRVPGFFGKLGFLRTDMAGLPEKVIKDCELCPRKHACDE
FT                   VAMEYRFD"
FT   gene            complement(348437..350986)
FT                   /locus_tag="Fbal_0315"
FT   CDS_pept        complement(348437..350986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0315"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG5009 Membrane
FT                   carboxypeptidase/penicillin-binding protein; InterPro
FT                   IPR001460: IPR001264: IPR011816; KEGG: swd:Swoo_0334 1A
FT                   family penicillin-binding protein; PFAM: glycosyl
FT                   transferase family 51; penicillin-binding protein
FT                   transpeptidase; PRIAM: Peptidoglycan glycosyltransferase;
FT                   SPTR: A2V3F9 Penicillin-binding protein, 1A family;
FT                   TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   Penicillin binding protein transpeptidase domain;
FT                   Transglycosylase; TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type; penicillin-binding protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74529"
FT                   /db_xref="GOA:E1SMH4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH4"
FT                   /protein_id="ADN74529.1"
FT                   /translation="METRNVKWLKRLLITLTVLGLLGVGALAGLYLWIAPTLPGVESLK
FT                   TVQLQTPMRVYSADGLLMSQFGEKRRIPLRYDEIPQPLIDAVLATEDARFFEHHGVDPI
FT                   GVVRAAVVLITTGRKAQGASTITMQVARNFFLTREKTYIRKVKEIFLALEIERLLSKEE
FT                   ILELYLNRSFLGNRAYGVGAAAQVYYGRDVNQLTLAEMAMIAGLPQAPSAANPIRNPER
FT                   AMARRNVVLGRMLDVGSISRSEFDEARQQPVTARYHGAEIDLYAPYIAEMVRDQMVATY
FT                   GEEAAYTSGFDIYTTVRSDQQQAAQRALLDNLFAYDARHGYRGPETRLWGEPLPEQNTT
FT                   PDAETWSTEQILNHLKGINRYRDLYPAVVLNVEEKQAEVMTADGKTVTLPWEGINWARQ
FT                   FITDTRQGNSPNSATEVLTPGDQIWIRQHDGHWWLSQVPEVSSAFVALDPENGAIRALV
FT                   GGYDFGQSQYNRVTQAKRQLGSNIKPFLYSSALENGFTLSTLVNNAPINQWDRSQGTAW
FT                   RPRNSPDVYTGPTRVRQGLAQSINVMAVRVIRDIGVDTFIDHATKFGFDRADLPRNESI
FT                   SLGSASVTPLENARAFAVFANGGFLIDPYFIERIEDHNGNQIFTAQPKIACLECKAALA
FT                   QEQSGIESTLPEFAQQCPWPEDRLAPQIISEQNAFLIHETLKSVIWGGGNWSQGTGWNG
FT                   TAWRASRLLKRHDIGGKTGTTNEARDTWFTGFAPHLVATAWVGFDDHSRQLGRTRWNKY
FT                   GPQDQITAGESGAKTAGPAWNQFMFDVLKGVPEQSTVIPEGIVTARIDRATGKLSNRTD
FT                   ASSRFEYFIEGTAPTELADVAEPEAPIFEQEVSEELF"
FT   sig_peptide     complement(350903..350986)
FT                   /locus_tag="Fbal_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            351144..352223
FT                   /locus_tag="Fbal_0316"
FT   CDS_pept        351144..352223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0316"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="COGs: COG4972 Tfp pilus assembly protein ATPase
FT                   PilM; InterPro IPR005883; KEGG: sbn:Sbal195_4207 type IV
FT                   pilus assembly protein PilM; SPTR: A2V3F8 Type IV pilus
FT                   assembly protein PilM; TIGRFAM: type IV pilus assembly
FT                   protein PilM; PFAM: Competence protein A; Cell division
FT                   protein FtsA; TIGRFAM: type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74530"
FT                   /db_xref="GOA:E1SMH5"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH5"
FT                   /protein_id="ADN74530.1"
FT                   /translation="MLSKLFKPRLPRMVGVDIGSREVKAILLAETPDGYQVDGVGKVPL
FT                   PRGAVVDREIKDPVAVGTAMAQLRAQLPKDVKFGAASVSGSTVMTKVIQMDGSLSDEEL
FT                   EAQIEIEADNLIPYPLEEVNIDFQTLNINDNDAGKVDVLLAACRSDNVDSRVDALDSAE
FT                   LDAKVIDIEGYALGRSAKLVAKQVPGGLTGQVVALVDLGASMTTFSIVDNGETVFIREQ
FT                   AFGGEQFTQSILSYYGMSYDEAEAAKVNNELPRNYVFEVLAPFQTQLLQQIRRTLQIYC
FT                   NASGKEKVDCLILSGGSAAIEGLTTLLSNELSIPVEIANPFTGSVTVKESLRRQLESDF
FT                   PRYMVACGLALRSFEPWHT"
FT   gene            352211..352816
FT                   /locus_tag="Fbal_0317"
FT   CDS_pept        352211..352816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0317"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="COGs: COG3166 Tfp pilus assembly protein PilN;
FT                   InterPro IPR007813; KEGG: shn:Shewana3_3898 fimbrial
FT                   assembly family protein; PFAM: Fimbrial assembly family
FT                   protein; SPTR: A2V3F7 Fimbrial assembly; PFAM: Fimbrial
FT                   assembly protein (PilN)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74531"
FT                   /db_xref="GOA:E1SMH6"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH6"
FT                   /protein_id="ADN74531.1"
FT                   /translation="MAHINLLPWREAQRARKQKEYLTILGCVGGLTLGLVLAFNMLVGH
FT                   WQEQQRERNQFMQSEIAKLDQQIAEIRRFKEQKANLMRRIEVIETLQQRRHLPVQVMNE
FT                   LARVMVPGVYLTRLQVQDGRVQVEGYCESNNHLANMMREVEQARWLASPKVQQIVASDK
FT                   NENYLGRQHAFKLELTVLSEGEGPLKDEQHLAALGGTR"
FT   gene            352813..353415
FT                   /locus_tag="Fbal_0318"
FT   CDS_pept        352813..353415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0318"
FT                   /product="Pilus assembly protein PilO"
FT                   /note="COGs: COG3167 Tfp pilus assembly protein PilO;
FT                   InterPro IPR007445; KEGG: shn:Shewana3_3897 pilus assembly
FT                   protein, PilO; PFAM: Pilus assembly protein PilO; SPTR:
FT                   A2V3F6 Pilus assembly protein, PilO; PFAM: Pilus assembly
FT                   protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74532"
FT                   /db_xref="GOA:E1SMH7"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH7"
FT                   /protein_id="ADN74532.1"
FT                   /translation="MKVDLKQLNDLDFENLANWPKEVKIIFAVVLAVLVGVAGYFLFIK
FT                   DSMASLERLQAEEQKLRGEFEAKYRLAANLPRYREQLTQMTEQFEAMLGMLPTASEMPG
FT                   LLDDVTFLATDANLQINSLNWQPEQVKEFYVELPIEMKIQGGYHEFGAFSAGVANLPRI
FT                   VSLHDFTMERAANGVSMTVLAKTYRFAEMADPEGGKK"
FT   gene            353415..353930
FT                   /locus_tag="Fbal_0319"
FT   CDS_pept        353415..353930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0319"
FT                   /product="Pilus assembly protein PilP"
FT                   /note="COGs: COG3168 Tfp pilus assembly protein PilP;
FT                   InterPro IPR007446; KEGG: saz:Sama_3370 type IV pilus
FT                   biogenesis protein PilP; PFAM: Pilus assembly protein PilP;
FT                   SPTR: A2V3F5 Pilus assembly protein, PilQ; PFAM: Pilus
FT                   assembly protein, PilP"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74533"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH8"
FT                   /protein_id="ADN74533.1"
FT                   /translation="MRKVSLAALLLLTGCGGGMGDLREFVADVQSTPVPFNEPPVTPPE
FT                   FKSVPYQVAQLRSPFQQSARSITDPVDLGRPDCPQPDNQRKRATLEAFALDSLDLKGLM
FT                   QDPSHYWALLQAGDGNVYTVKEGDYLGLYHGQIADINDDGVLVTEWIPDGNGCWNQRDT
FT                   RMVLARDE"
FT   sig_peptide     353415..353474
FT                   /locus_tag="Fbal_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            353943..355988
FT                   /locus_tag="Fbal_0320"
FT   CDS_pept        353943..355988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0320"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="COGs: COG4796 Type II secretory pathway component
FT                   HofQ; InterPro IPR001775: IPR004846: IPR011662: IPR005644:
FT                   IPR 018252: IPR004845: IPR013355; KEGG: shw:Sputw3181_3848
FT                   type IV pilus secretin PilQ; PFAM: type II and III
FT                   secretion system protein; Secretin/TonB short domain; NolW
FT                   domain protein; SPTR: A2V3F4 Type IV pilus secretin PilQ;
FT                   TIGRFAM: type IV pilus secretin PilQ; PFAM: Bacterial type
FT                   II/III secretion system short domain; Secretin and TonB N
FT                   terminus short domain; Bacterial type II and III secretion
FT                   system protein; TIGRFAM: type IV pilus secretin (or
FT                   competence protein) PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74534"
FT                   /db_xref="GOA:E1SMH9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH9"
FT                   /protein_id="ADN74534.1"
FT                   /translation="MSFFSGIRQGLPRLQHRIIASRLLLGGVLLCLANSATAGTLQDLR
FT                   YQAQVDDMLEVELAFDQLAGEPRIAVSANPAELTLHFAGSQSGLQMSQIPIDLKGIKAV
FT                   ETRSGSNGLDVVFQLEKMTTYQGRLDGNRYRITFNDNSPVARAETPQFLNEIESINFHR
FT                   GDNGQAQLVLSLSSPTAAANFNRVGSDLELTLYNTRIQDKDLYIVDVQDFSTVVTGFET
FT                   FRDNANARLRFDVRGEFVFDSRQEGNRLVIDIAEQTQPLMEEKVYDGSTLSMNFQDVPV
FT                   RTVLQIIADHNQFNLVTTENVAGNLTLHLDKVPWDQALDMILKIRGLDKRIEGNILLVA
FT                   PRDELAAQESLELRAAQEVREVAPLFSEYLQINYAKAVDIATLLDNDGNTLLSERGSVS
FT                   VDERTNTLLVYDTAERLEDIHRLVDILDVPVKQVVIESRMVTVRDNINEELGIRWGISD
FT                   QQGDKGTAGTLPGAEDIANGIVPSLSDRLNVNLPVVEPAGSIAFHVAKLGDGTLLDLEL
FT                   SALERENKGEIIASPRLTTANQYTAFIEQGTEIPFVQSTSSGATSVEFKKAVLGLTVTP
FT                   QITPDNRIVLDLTVTQDTRGETVQTATGPAVAIDTQRISTQVLAQNGETIVLGGIFQQQ
FT                   QLNTVTKVPLLGDIPFVGVLFRNSQDFTEKKELLIFVTPKIVIDEF"
FT   sig_peptide     353943..354056
FT                   /locus_tag="Fbal_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            356149..356664
FT                   /locus_tag="Fbal_0321"
FT   CDS_pept        356149..356664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0321"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="COGs: COG0703 Shikimate kinase; InterPro IPR000623;
FT                   KEGG: shl:Shal_4082 shikimate kinase I; PFAM: shikimate
FT                   kinase; PRIAM: Shikimate kinase; SPTR: B0TL77 Shikimate
FT                   kinase; PFAM: Shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74535"
FT                   /db_xref="GOA:E1SMI0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI0"
FT                   /protein_id="ADN74535.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLEFFDSDQEIEARSGA
FT                   DISWIFDVEGEEGFRNREARVIHELTEKQGIVLATGGGSVQSKEVRNRLSARGIVVYLE
FT                   TTIDKQVARTQRDKRRPLLQVDEPRDVLEQLAEERNPLYQEIADLVVRTDEQSAKVVAN
FT                   QIIEKLGF"
FT   gene            356689..357768
FT                   /locus_tag="Fbal_0322"
FT   CDS_pept        356689..357768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0322"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="COGs: COG0337 3-dehydroquinate synthetase; InterPro
FT                   IPR002658: IPR016037; KEGG: aha:AHA_3188 3-dehydroquinate
FT                   synthase; PFAM: 3-dehydroquinate synthase; SPTR: A0KN28
FT                   3-dehydroquinate synthase; TIGRFAM: 3-dehydroquinate
FT                   synthase; PFAM: 3-dehydroquinate synthase; TIGRFAM:
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74536"
FT                   /db_xref="GOA:E1SMI1"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI1"
FT                   /protein_id="ADN74536.1"
FT                   /translation="MERIQVELGQRSYPIIIGAQLLSQAETWLQSLALNRVLIVTNDVV
FT                   APLYLDAVEGTFQRLNVRTDHLVLPDGESYKTLDTLESIFARALELNLGRDVMLVALGG
FT                   GVIGDMVGFAAACYQRGVPFIQIPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFHQPVLV
FT                   LADTETLNTLPDREFAAGMAEVIKYGIIWDSAFFSWLEQQREALMARDPQALTYAIRRC
FT                   CEIKAEVVAQDETEQGVRALLNLGHTFGHAIEAEMGYGSWLHGEAVAAGTVLACQLAQQ
FT                   LGRMSDEDVARVSALLAAFNLPLLAPSAMRCADFLPHMLRDKKSLAGKIRFILPQGIGH
FT                   ADVVGGISEAQLQQLIDGA"
FT   gene            357765..359228
FT                   /locus_tag="Fbal_0323"
FT   CDS_pept        357765..359228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0323"
FT                   /product="Sporulation domain protein"
FT                   /note="COGs: COG3266 conserved hypothetical protein;
FT                   InterPro IPR007730; KEGG: she:Shewmr4_3696 sporulation
FT                   domain-containing protein; PFAM: Sporulation domain
FT                   protein; SPTR: A2V3F1 Sporulation related"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74537"
FT                   /db_xref="GOA:E1SMI2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI2"
FT                   /protein_id="ADN74537.1"
FT                   /translation="MIADPALNHLLPSQRALLERFRYLTEYGDHLLVLHGAAGVGKTVL
FT                   AQSLLDGAESFNQAYVAIGDDLTPASVRERLIRQWLPRAVFDPEEPLLDTLERILPEGD
FT                   GRYMLIVDDAQSMGDALLAELIALVMDQETLGMRLTLVLVADDGLVQRLQQNLPEPYQT
FT                   RLIPVEVPPLSVRERRKLYDQLVKRHSGKLFINQAAVERQLAEQDGSAAAVVALVEAAK
FT                   SRPPLGQSLPAHKGLAAAIGAAVLLLAGGLLWPTTEPAPQPEPLAQADRAAAPEPEPEQ
FT                   QAPQPLDLGLAKPWPEVTTAEVAIPEVEPALLLPEDEIAVATAPVVSAETESVAQAQPA
FT                   ETATAAVAQPAAQPMAQPAPDSEAKPEPSVEPAVAAVPAVLPLSEQPLAQRPADSYVLQ
FT                   LAVFSYPQLIGPFLDSHGLGEAVRVYRIEREPQAWFVVVQGGFADRKAAQQAKEALVAS
FT                   VKRLSPYVKPLEAVQKELSEELELAEILR"
FT   gene            359272..360087
FT                   /locus_tag="Fbal_0324"
FT   CDS_pept        359272..360087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0324"
FT                   /product="DNA adenine methylase Dam"
FT                   /EC_number="2.1.1.72"
FT                   /note="COGs: COG0338 Site-specific DNA methylase; InterPro
FT                   IPR002294: IPR012327: IPR002052: IPR012326; KEGG:
FT                   vfi:VF_2289 DNA adenine methylase; PFAM: D12 class N6
FT                   adenine-specific DNA methyltransferase; PRIAM:
FT                   Site-specific DNA-methyltransferase (adenine-specific);
FT                   SPTR: A3RK89 DNA adenine methylase; TIGRFAM: DNA adenine
FT                   methylase; PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; TIGRFAM: DNA adenine methylase (dam)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74538"
FT                   /db_xref="GOA:E1SMI3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI3"
FT                   /protein_id="ADN74538.1"
FT                   /translation="MTKSRAFLKWAGGKYKLVDDIAARLPHADRLVEPFVGAGSVFLNT
FT                   NFSSYLLSDINPDLIGLYNTLKQTPERYVREASKLFVDANNDKDAYYGRRAEFNQCHDR
FT                   FDRAVLFLYLNRFGYNGLCRYNKSGGFNVPFGSYKRPYFPEKELYFFAEKAQRATFLCE
FT                   GYVQTFARCQAGDVVYCDPPYLPLSTTSNFTSYASGGFSLDDQAMLAFQAEDAARSKKL
FT                   TVLISNHDTTLARKLYDKAELDTIQVGRSISQNGRGRKKVNELMALYRP"
FT   gene            complement(360073..360252)
FT                   /locus_tag="Fbal_0325"
FT   CDS_pept        complement(360073..360252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swp:swp_2070 hypothetical protein; SPTR:
FT                   A3WLP7 Uncharacterized conserved membrane protein; PFAM:
FT                   Protein of unknown function (DUF2970)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74539"
FT                   /db_xref="GOA:E1SMI4"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI4"
FT                   /protein_id="ADN74539.1"
FT                   /translation="MRVVWSVLAAMFGVQSERNRERNFTDTSPLPYIITGVIMLVLFVL
FT                   SLIWLVNQVLSGPV"
FT   gene            complement(360252..360515)
FT                   /locus_tag="Fbal_0326"
FT   CDS_pept        complement(360252..360515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3843 hypothetical protein; SPTR:
FT                   A2V3E9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74540"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI5"
FT                   /protein_id="ADN74540.1"
FT                   /translation="MAKRKGLKRGVVILTGVLALAATGVTLHHHRCDDAQSVAQCAAQS
FT                   PLNWHNWLVGRSGSSQFHFVDLLELLYGHEKRPTSSPSGPLN"
FT   sig_peptide     complement(360444..360515)
FT                   /locus_tag="Fbal_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(360629..361294)
FT                   /locus_tag="Fbal_0327"
FT   CDS_pept        complement(360629..361294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR010239; KEGG: saz:Sama_3159 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: A2UUU4
FT                   Putative uncharacterized protein; PFAM: Bacterial protein
FT                   of unknown function (Gcw_chp); TIGRFAM: conserved
FT                   hypothetical protein, proteobacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74541"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI6"
FT                   /protein_id="ADN74541.1"
FT                   /translation="MMKKFALSSLAIALMASSAAVSAVEFSGNVGATSDYLWRGLSQTD
FT                   GKPAVSGGLDMYTDAGFYAGTWASNIDFGDDATYEIDFYAGYYGEVGDFFYDVGYNYYA
FT                   YPNGEDLDFGEVYGSVGWNWLGLNVFYATNESASEDYYKDSFYVEGTAAFDLSDSLSLG
FT                   FAIGHQSFDIDDEDDYITYNVSLTKSTDLGDVAFMVSDTDLDDDDPIVLVSWTYEFDL"
FT   sig_peptide     complement(361226..361294)
FT                   /locus_tag="Fbal_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            361483..362157
FT                   /locus_tag="Fbal_0328"
FT   CDS_pept        361483..362157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0328"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="COGs: COG0036 Pentose-5-phosphate-3-epimerase;
FT                   InterPro IPR000056; KEGG: shm:Shewmr7_0253
FT                   ribulose-5-phosphate 3-epimerase; PFAM: ribulose-phosphate
FT                   3-epimerase; PRIAM: Ribulose-phosphate 3-epimerase; SPTR:
FT                   A2V3E8 Ribulose-phosphate 3-epimerase; TIGRFAM:
FT                   ribulose-phosphate 3-epimerase; PFAM: Ribulose-phosphate 3
FT                   epimerase family; TIGRFAM: ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74542"
FT                   /db_xref="GOA:E1SMI7"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI7"
FT                   /protein_id="ADN74542.1"
FT                   /translation="MNDFLIAPSILSADFARLGEEVANVLAAGADVVHFDVMDNHYVPN
FT                   LTIGPMVCQALRNYGIEAPIDVHLMVKPVDRIIPDFAKAGASIITFHPEASEHVDRTLQ
FT                   LIKSEGCQAGLVLNPATPLHHLDYVMDKLDVILLMSVNPGFGGQSFIPHTLDKIRQVRE
FT                   RIDASGRNIRLEIDGGVKADNIAEIAAAGADMFVAGSAIFGKPDYKAEIDKMREQLASV
FT                   RR"
FT   gene            362157..362858
FT                   /locus_tag="Fbal_0329"
FT   CDS_pept        362157..362858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0329"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="COGs: COG0546 phosphatase; InterPro IPR005833:
FT                   IPR005834: IPR006402: IPR006439: IPR 006388: IPR006346;
FT                   KEGG: shl:Shal_4075 phosphoglycolate phosphatase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; SPTR:
FT                   A2V3E7 Phosphoglycolate phosphatase; TIGRFAM:
FT                   phosphoglycolate phosphatase; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 2 (HAD-like); PFAM: haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: haloacid dehalogenase
FT                   superfamily, subfamily IA, variant 3 with third motif
FT                   having DD or ED; haloacid dehalogenase superfamily,
FT                   subfamily IA, variant 1 with third motif having Dx(3-4)D or
FT                   Dx(3-4)E; 2-phosphoglycolate phosphatase, prokaryotic;
FT                   2-haloalkanoic acid dehalogenase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74543"
FT                   /db_xref="GOA:E1SMI8"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI8"
FT                   /protein_id="ADN74543.1"
FT                   /translation="MLSSEIRAIAFDLDGTLIDSVPALAEAAAAALVDLGMAPCSELAA
FT                   RGWIGNGAEMLMRRALSGNVNPDPNLAPSLVEQALARFHHHYGAHLDQGSPLYPGVADT
FT                   LAALHQRGYRMALITNKPARYLPDLMATCGLSHYFELMLGGDSLAQRKPDPMPLQHVLT
FT                   QFGLAPQQMVMVGDSRNDIEAARAAGCASVGLTYGYNYGQPIAELGPDHVLDHFEHLLA
FT                   LLPARQETESV"
FT   gene            362855..363862
FT                   /locus_tag="Fbal_0330"
FT   CDS_pept        362855..363862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0330"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COGs: COG0180 Tryptophanyl-tRNA synthetase; InterPro
FT                   IPR002306: IPR002305: IPR001412; KEGG: shw:Sputw3181_3840
FT                   tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; PRIAM: Tryptophan--tRNA ligase; SPTR:
FT                   A2V3E6 Tryptophanyl-tRNA synthetase; TIGRFAM:
FT                   tryptophanyl-tRNA synthetase; PFAM: tRNA synthetases class
FT                   I (W and Y); TIGRFAM: tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74544"
FT                   /db_xref="GOA:E1SMI9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI9"
FT                   /protein_id="ADN74544.1"
FT                   /translation="MTKPVVLSGAQPSGGLTLGNYMGALRQWVKLQETHDALYCIVDLH
FT                   AITVRQDPEKLRNACMDTLALYLACGVDPKKSTVFVQSHVQEHTQLGWILNCYTQMGEL
FT                   NRMTQFKDKSARHASNINAGLFSYPVLMAADILLYQANEVPVGNDQKQHLELARDIATR
FT                   FNNLYGDVFTVPEPHIPEAGARVMSLQDPSKKMSKSDDNANNRVGLLEDPKTITKKFKK
FT                   AVTDSDEPPVVRFDLDNKAGVSNLMSIYSATSGKSFAEIEAEFEGKMYGHLKVATAESV
FT                   VALLEPMQQRFAEIRADQAYLDEVMKAGAEGARERAAKTLAKVYDAVGLPAMPR"
FT   gene            complement(363921..364496)
FT                   /locus_tag="Fbal_0331"
FT   CDS_pept        complement(363921..364496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0331"
FT                   /product="transport-associated protein"
FT                   /note="COGs: COG2823 periplasmic or secreted lipoprotein;
FT                   InterPro IPR007055: IPR014004; KEGG: spl:Spea_0249
FT                   transport-associated; PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; SPTR: A2V3E3
FT                   Transport-associated; PFAM: Putative phospholipid-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74545"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ0"
FT                   /protein_id="ADN74545.1"
FT                   /translation="MNALPIRLLATLLIVTSLSGCAGVIMAGAVGGAVMVNDRRSFTTQ
FT                   FDDHGLDVAVTAALDEDDGLKNQSRIRVISMNRRVLLVGQVPNQMLKDRAVQIARANTD
FT                   VAQVHDQLRIGNPVGFTTRSNDTWTTTKVKSRMFGDNELDAIRIKVITENGEVFLLGLV
FT                   DPSEADLAVEVARTTSGVRKVIKVFEYL"
FT   sig_peptide     complement(364416..364496)
FT                   /locus_tag="Fbal_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(364499..365086)
FT                   /locus_tag="Fbal_0332"
FT   CDS_pept        complement(364499..365086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0332"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="COGs: COG0279 Phosphoheptose isomerase; KEGG:
FT                   sbp:Sbal223_3991 phosphoheptose isomerase; SPTR: A9L683
FT                   Phosphoheptose isomerase; PFAM: SIS domain; TIGRFAM:
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74546"
FT                   /db_xref="GOA:E1SMJ1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ1"
FT                   /protein_id="ADN74546.1"
FT                   /translation="MLERIKESFTESIQTKIDALEALPESIEKGAMAMVHCLLSGNKIL
FT                   CCGNGGSAGDAQHFSSELLNRFETERPSLPAIALTTDSSTLTSIANDYSFSEVFSKQVH
FT                   ALGQRGDILLAISTSGNSQNVIKAMEAAVNRDMTIVALTGNDGGAMAGLLSDNDVEIRV
FT                   PSHSTPRIQEVHLLVLHSLCDVIDRTLFPQED"
FT   gene            complement(365102..365434)
FT                   /locus_tag="Fbal_0333"
FT   CDS_pept        complement(365102..365434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0333"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="COGs: COG0792 endonuclease distantly related to
FT                   Holliday junction resolvase; InterPro IPR003509; KEGG:
FT                   aha:AHA_3896 hypothetical protein; PFAM: protein of unknown
FT                   function UPF0102; SPTR: A0KPY4 UPF0102 protein AHA_3896;
FT                   PFAM: Uncharacterised protein family UPF0102; TIGRFAM:
FT                   conserved hypothetical protein TIGR00252"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74547"
FT                   /db_xref="GOA:E1SMJ2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ2"
FT                   /protein_id="ADN74547.1"
FT                   /translation="MRQQGQQAEDAAQHYLQQQGLTPVARNVQCRFGELDLVMRQGNTL
FT                   VFIEVKYRRSSAFGGAAAAVTATKQHKLRLTADWYLQQQGLSQNPCRFDVVAIEGDTIN
FT                   WIQNAF"
FT   gene            complement(365434..367233)
FT                   /locus_tag="Fbal_0334"
FT   CDS_pept        complement(365434..367233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0334"
FT                   /product="LppC family lipoprotein"
FT                   /note="COGs: COG3107 Putative lipoprotein; InterPro
FT                   IPR007443; KEGG: son:SO_0300 putative lipoprotein; PFAM:
FT                   LppC family lipoprotein; SPTR: A2V3E0 LppC putative
FT                   lipoprotein; PFAM: LppC putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74548"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ3"
FT                   /protein_id="ADN74548.1"
FT                   /translation="MRRRHLALALVVAVLAGCASGPQTPQAPTESLSLGQVSQSPNAYL
FT                   QLANQNSGEVQQSYLLLAARAYLAQDQRSAAQNLLTSLAPQLPDSGPLQAEYRLLQAHI
FT                   LADQQQRSEALALLKWPANWSLSSAQWRDFFTLQAELQHAEGQHLAEAAARYGLTPYLS
FT                   AQEQDANADALWLALSRTDEATLKAQQQQATDPVWRGWLELGWLAQHFAVQPSSLLGEL
FT                   ARWQQANPSHPAAQRLPMDLERALSVQPYRPHQVAVLLPLSGRVASQARAIQDGLLANL
FT                   LANQDQREVRFYDTGEMDAVEAYQQARADGAEFIIGPLLKPNLDKVLAQYDGQVPLLAL
FT                   NARDENAPSGNDLYFFSLDPETEASQAAQRIWLEGHKHPLVLASGNAIGKRMAERFVAE
FT                   WAELSDDPVEIHYFGNQASMRETVQKSMHVDQSQERIKAIKALFGPKTQADFRSRRDVD
FT                   ALYLVANGNEVRLLKPFVDVSLSVFADPLALYGSSRAHQALDSQQSQELDGLELSDMPW
FT                   LLADNPERAEAEQLWPDRQQALMRLYAMGYDSWSLIDRLAQMRVFTGYRVKGLSGDLAV
FT                   QPDGELERELGWAKYRRGALKAE"
FT   sig_peptide     complement(367174..367233)
FT                   /locus_tag="Fbal_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            367353..368192
FT                   /locus_tag="Fbal_0335"
FT   CDS_pept        367353..368192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0335"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="COGs: COG0313 methyltransferase; InterPro IPR000878:
FT                   IPR018063: IPR008189; KEGG: ppr:PBPRA3226 putative
FT                   methyltransferase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR: P67087 UPF0011
FT                   protein yraL; PFAM: Tetrapyrrole (Corrin/Porphyrin)
FT                   Methylases; TIGRFAM: conserved hypothetical protein
FT                   TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74549"
FT                   /db_xref="GOA:E1SMJ4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ4"
FT                   /protein_id="ADN74549.1"
FT                   /translation="MSSSATLYIVPTPIGNLADITHRALQVLQDVDLIACEDTRHTGKL
FT                   LSHFGIGTSTMSVHDHNERQRAQSIIHRLQQGQNIALVSDAGTPLISDPGYHLVTQVRE
FT                   AGFTVVPLPGPCAATTALCAAGLPSDRFAFEGFLPAKSKARIDTLTALMEEPRTLIFYE
FT                   SPRRVLDTLAEVIEVMGPERQVVLARELTKSFETIHGGPVAELREWLLEDDNRTRGEMV
FT                   LMIGPYRAPEDALPAEALRTTELLCQELPLKKAAALAAQIHGVKKNALYKAGLDMGW"
FT   gene            complement(368787..369806)
FT                   /locus_tag="Fbal_0336"
FT   CDS_pept        complement(368787..369806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74550"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ5"
FT                   /protein_id="ADN74550.1"
FT                   /translation="MRYSKLARALTLLGSALPLAAMAADPVMIDFSEGGVEGNLGTSTV
FT                   MDAATGTSALGLYLDPNDNLWKPANLYRRDQTGDEGLGVCNPLEAADNGGDCPGPGGGG
FT                   DINELSNQLAPEFIYLKRPEHWRWVSVYLSSLDGNDGAEFPETGQIWSDTDGNPNNGGL
FT                   VLLAEFTGNDDNVEQVLDIAALGAADAPFLVLRPVDIAPDGTDTNNDFLVKAAVIEEKP
FT                   KEPPMGGQGCTPGYWKQPHHFDSWVMYGPHDTFYMAFGSDLFGMDKTLLQVLSQGGGKE
FT                   YAMGRHAVAALLNALSDGVSYKYSKEEVIAAVQGAHSGSYNHVKNAFEYQNEMGCPLN"
FT   sig_peptide     complement(369738..369806)
FT                   /locus_tag="Fbal_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            370196..370654
FT                   /locus_tag="Fbal_0337"
FT   CDS_pept        370196..370654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0337"
FT                   /product="MraZ protein"
FT                   /note="COGs: COG2001 conserved hypothetical protein;
FT                   InterPro IPR003444: IPR020603; KEGG: pat:Patl_3528 cell
FT                   division protein MraZ; PFAM: MraZ domain; SPTR: Q15Q08
FT                   Protein mraZ; TIGRFAM: MraZ protein; PFAM: MraZ protein;
FT                   TIGRFAM: mraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74551"
FT                   /db_xref="GOA:E1SMJ6"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ6"
FT                   /protein_id="ADN74551.1"
FT                   /translation="MFRGANAITMDSKGRLTVPTRYRDSLRSQCGGQLICTVDIQSPCL
FT                   LLYPLPEWERVEQKLMSLSDTQPAERAIKRLLLGYATEGELDKAGRLLLSAPLRQYAGL
FT                   DKSVMLVGQLNKFELWSEANWQDQIQAAHQQVSEAELLSNPRLQDFSL"
FT   gene            370654..371601
FT                   /locus_tag="Fbal_0338"
FT   CDS_pept        370654..371601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0338"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="COGs: COG0275 S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis;
FT                   InterPro IPR002903; KEGG: sdn:Sden_0347
FT                   S-adenosyl-methyltransferase MraW; PFAM: methyltransferase;
FT                   SPTR: Q8E9P0 S-adenosyl-L-methionine-dependent
FT                   methyltransferase mraW; TIGRFAM:
FT                   S-adenosyl-methyltransferase MraW; PFAM: MraW methylase
FT                   family; TIGRFAM: S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74552"
FT                   /db_xref="GOA:E1SMJ7"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ7"
FT                   /protein_id="ADN74552.1"
FT                   /translation="MSESFRHITVLLDEAVNGLQLKPDGIYVDGTFGRGGHSRHILSQL
FT                   GPNGRLIGIDRDPQAVAVAQQLAAEDPRFQIVHGPFSGIAEYVEALGLTGQIDGVLLDL
FT                   GVSSPQLDDAERGFSFLRDGPLDMRMDNSRGETAAEWLARAEANDIAWVLKTFGEEKFA
FT                   RPIARKIVEHIAAGEPMDRTSHLAGLIEKMTPKHKRDQGKHPATRSFQAIRIYINSELE
FT                   EIEKALMGALEALKPGGRLSVISFHSLEDRLVKRFMRRESQGEPVPHGLPLTEEQMKQT
FT                   RRLKTVGKALKPSDTEVEDNTRARSSVLRVGEKL"
FT   gene            371611..371916
FT                   /locus_tag="Fbal_0339"
FT   CDS_pept        371611..371916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0339"
FT                   /product="cell division protein FtsL"
FT                   /note="COGs: COG3116 Cell division protein; InterPro
FT                   IPR007082: IPR011922; KEGG: shm:Shewmr7_0379 cell division
FT                   protein FtsL; PFAM: cell division protein FtsL; SPTR:
FT                   A2UXQ3 Cell division protein FtsL; TIGRFAM: cell division
FT                   protein FtsL; PFAM: Cell division protein FtsL; TIGRFAM:
FT                   cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74553"
FT                   /db_xref="GOA:E1SMJ8"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ8"
FT                   /protein_id="ADN74553.1"
FT                   /translation="MTTNLARIIGKDLWHHKWLVALSLCVLGSALAVVWSAQESRNLTA
FT                   HWNDLLQQRDQLDVQWRHLLLEEQTLAEHSRVARMASKDLNMHRPKPSAERVVRLP"
FT   sig_peptide     371611..371706
FT                   /locus_tag="Fbal_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            371913..373703
FT                   /locus_tag="Fbal_0340"
FT   CDS_pept        371913..373703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0340"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro IPR001460:
FT                   IPR005311; KEGG: spl:Spea_3817 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase; Penicillin-binding protein dimerisation
FT                   domain; PRIAM: Peptidoglycan glycosyltransferase; SPTR:
FT                   A2UXQ4 Penicillin-binding protein, transpeptidase; PFAM:
FT                   Penicillin binding protein transpeptidase domain;
FT                   Penicillin-binding Protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74554"
FT                   /db_xref="GOA:E1SMJ9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ9"
FT                   /protein_id="ADN74554.1"
FT                   /translation="MTRRKINKPSNKSKQAKQKLKPTPFLWRLRLVTFAIALVFSGIVA
FT                   RAAYIQVIAPDRLRHESDLRTLRLETRDVQRGMITDRNGEMLAVSVPVQAVWADPKRVF
FT                   EGNGFDDPRRWRALADVLEVPEAELVERVKQDPKRRFLYLRRQVTPAVAEYIAKLRIPG
FT                   VGLKPESRRYYPAGEATGQLIGLTNIDDKGIEGLERNYDDWLTGSPEKVRVRKGLGGEV
FT                   VENLSVVAEGEHPNDLVLSLDMRLQSLAYRALKKATQYHMATSGSLVIIDIPTGEILAM
FT                   ANTPSFNPNQRSGIQAYQMRNRAITDAYEPGSVVKPLVVAAAMEKGLVTPDTVMDTSPG
FT                   WMRVSGGLVRDTRNFGKQDVTHLLVKSSNIGMAKMALQMEVDELLAFYADFGLGTYSGI
FT                   NLDGETTGNVPKRRRWSEHERATLAFGYGLTSTPLQLARMYAILGANGVARPASILKLR
FT                   DGQVPEGEQVLSPKVAKQMLAILTQVTEPGGTATRAAIDGYKVAGKTGTSRKAVAGGYG
FT                   EDYVSLFAGLAPSDNPRLAMAVVINEPQGDAYYGGVVAAPVFSEVMAGALQLLNVEPSQ
FT                   RSPELGTLASVWGSDNVVTR"
FT   sig_peptide     371913..372053
FT                   /locus_tag="Fbal_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            373687..375150
FT                   /locus_tag="Fbal_0341"
FT   CDS_pept        373687..375150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0341"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="COGs: COG0769 UDP-N-acetylmuramyl tripeptide
FT                   synthase; InterPro IPR000713: IPR004101: IPR013221:
FT                   IPR018109: IPR 005761; KEGG: sse:Ssed_0405
FT                   UDP-N-acetylmuramyl-tripeptide synthetase; PFAM: Mur ligase
FT                   middle domain protein; cytoplasmic peptidoglycan synthetase
FT                   domain protein; SPTR: Q8E9P3 UDP-N-acetylmuramyl-tripeptide
FT                   synthetase; TIGRFAM: UDP-N-acetylmuramyl-tripeptide
FT                   synthetase; PFAM: Mur ligase family, glutamate ligase
FT                   domain; Mur ligase family, catalytic domain; Mur ligase
FT                   middle domain; TIGRFAM: UDP-N-acetylmuramyl-tripeptide
FT                   synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74555"
FT                   /db_xref="GOA:E1SMK0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK0"
FT                   /protein_id="ADN74555.1"
FT                   /translation="MSSLDDLLAPWMALDTGVEFQQLVLDSRRVRPGDCFVAVAGHQVD
FT                   GRDFIDSAIALGAVAVLADADADGRQADRNGVIVVGVHNLSQRLSALALRAYPAATRPT
FT                   LIGVTGTNGKTTVTQLCAQLLTALGHQAGVMGTVGNGLWGDLIPSVNTTSDAITVAREL
FT                   DRQAKSGAEAVALEISSHGLSQSRVAALPVQVGVYTNLSRDHLDYHGDMAAYADAKRQL
FT                   FALPGLRHGVFNLDDETGSRWHRELSGSLLALGYSIQGARCDGAYLTVEGVEYHDQGVR
FT                   ARVVSSFGQGTLNSPLLGAFNLANLLAALGALLSLGYSLSDLLSVVPQLHSAAGRMECF
FT                   GTDSTPTLVVDYAHTPDALSQALAALRPHCRGALWCVFGCGGERDSGKRPLMAQAAEQG
FT                   ADHLIITADNPRSEAFADIAAQMEAGLTGQAEVIEDRAAAVRRAFAQAQPGDMVLLAGK
FT                   GHEDYQIIGGNRLDYNERALAQQLVEQGV"
FT   gene            375147..376514
FT                   /locus_tag="Fbal_0342"
FT   CDS_pept        375147..376514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0342"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamin
FT                   opimelate/D-alanyl-D-alanylligase"
FT                   /note="COGs: COG0770 UDP-N-acetylmuramyl pentapeptide
FT                   synthase; InterPro IPR000713: IPR004101: IPR013221:
FT                   IPR005863; KEGG: eic:NT01EI_0732
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase;
FT                   PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; SPTR: P11880
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase;
FT                   TIGRFAM:UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-d
FT                   iaminopimelate/D-alanyl-D-alanylligase; PFAM: Mur ligase
FT                   family, glutamate ligase domain; Mur ligase family,
FT                   catalytic domain; Mur ligase middle domain; TIGRFAM:
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74556"
FT                   /db_xref="GOA:E1SMK1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK1"
FT                   /protein_id="ADN74556.1"
FT                   /translation="MIPVTLSTLADAVGGTLNGADLMVSRIGTDTRALAEGDLFLALVG
FT                   DRFDGHEFVAQAEASGAAALVVSRPVDSALPQILVEDTLLALGQMGAWLRRELAPRCLA
FT                   ITGSVGKTSVKEMTAAIFAQVGPTLATRGNLNNTIGVPMTLLELTPEHRFAVIELGANH
FT                   AGEIRYTSSLALPHAAVINNIRGAHLEGFGGIEGVARAKSEIYEHLGEAGTAIVNLDDE
FT                   WAPWLLERLGDQNRFTYSSRGPADLWASALSRDADGCYHFLLHRGEAEVLVRLPLPGRH
FT                   QVDNALAAAALASTAELSLEQIASGLAQAPTVAGRTQMTALSGEVMLIDDSYNANAAST
FT                   MAAIDLMAERDGSSLLVFGDMGELGEEAEAEHRTVGRYAGEKGIDRLLTVGTLSRFAAQ
FT                   EHDAARHFGDQAELLPTLMTELAALPRPVTVLIKGSRSARMENVAKALREQLGEHE"
FT   gene            376515..377594
FT                   /locus_tag="Fbal_0343"
FT   CDS_pept        376515..377594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0343"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="COGs: COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N- acetylglucosamine-1-phosphate
FT                   transferase; InterPro IPR018481: IPR018480: IPR003524;
FT                   KEGG: saz:Sama_0351
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   Glycosyl transferase, family 4, conserved region;
FT                   Phospho-N-acetylmuramoyl-pentapeptide transferase,
FT                   conserved site;
FT                   PRIAM:Phospho-N-acetylmuramoyl-pentapeptide-transfe rase;
FT                   SPTR: A1S2F6
FT                   Phospho-N-acetylmuramoyl-pentapeptide-transferase;
FT                   TIGRFAM:phospho-N-acetylmuramoyl-pentapeptide-trans ferase;
FT                   PFAM: Glycosyl transferase family 4;
FT                   Phospho-N-acetylmuramoyl-pentapeptide-transferase signature
FT                   1; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74557"
FT                   /db_xref="GOA:E1SMK2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK2"
FT                   /protein_id="ADN74557.1"
FT                   /translation="MLVYLAEYLTQYYTAFNVFSYLTFRAIVGLLTALAFCLWAGPRMI
FT                   AYLQRLQIGQVVRDDGPESHFSKRGTPTMGGLMILAGIFVSTLLWGDLGNHYVLTMLFV
FT                   IGAFGLIGFIDDYRKVIRKDPKGLIARWKYFWQSAAALTVAITLYACTAPEQQVLVVPF
FT                   LKDVMPQLGLVYIALAYFTIVGSSNAVNLTDGLDGLAIVPTVMVAAAFALVAYLSGNVN
FT                   FAQYLHIPYLPGAGELVVVCTAMVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGALAV
FT                   LTRQEILLVIMGGLFVVETLSVILQVGSFKLRRKRIFRMAPIHHHYELKGWPEPRVIVR
FT                   FWIISLCLVLLGLATLKVR"
FT   gene            377594..378895
FT                   /locus_tag="Fbal_0344"
FT   CDS_pept        377594..378895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0344"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="COGs: COG0771
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase; InterPro
FT                   IPR004101: IPR013221: IPR006162: IPR005762; KEGG:
FT                   spl:Spea_3813 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; SPTR: A2UXQ8
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase; PFAM: Mur
FT                   ligase family, glutamate ligase domain; Mur ligase middle
FT                   domain; TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74558"
FT                   /db_xref="GOA:E1SMK3"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK3"
FT                   /protein_id="ADN74558.1"
FT                   /translation="MTTPAPHTWILGLGITGLSVVRHLAAESESLAVWDSRANPPGADT
FT                   LARDFAHVALQTGPFDGDVLAQAKRLVVSPGIDLRTPALAQAIAAGVEVVGDIELFARA
FT                   ADAPVVAITGSNGKSTVTTLVGHLAQACGVSVGVGGNIGTPALDLLGQGHQLYVLELSS
FT                   FQLETTRSLPAQVGTVLNVSPDHLDRYDSYEAYRDAKLALYPQCRIALFNRADHNTLPS
FT                   SHPRTLSFGPDAPDGDNFGVVGDWLMQGQTRLKRRDQLTLVGAHNEQNVLAALALGQAA
FT                   GLEMDAMLSALDSYRGLPHRCELVAERAGVRYVNDSKATNLGATQAALDGLELGRVWLI
FT                   AGGDAKGQDLSVLAPALNQLAGLITLGQDGPAIAALRSDATEVVSIESAVAVAADQARA
FT                   GDIVLLSPACSSLDMFASFEQRGECFAAAARGLR"
FT   sig_peptide     377594..377668
FT                   /locus_tag="Fbal_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            378907..380112
FT                   /locus_tag="Fbal_0345"
FT   CDS_pept        378907..380112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0345"
FT                   /product="cell division-specific peptidoglycan biosynthesis
FT                   regulator FtsW"
FT                   /note="COGs: COG0772 Bacterial cell division membrane
FT                   protein; InterPro IPR001182: IPR006162: IPR018365:
FT                   IPR013437; KEGG: swp:swp_2230 cell cycle protein; PFAM:
FT                   cell cycle protein; SPTR: A2UXQ9 Cell division protein
FT                   FtsW; TIGRFAM: cell division protein FtsW; PFAM: Cell cycle
FT                   protein; TIGRFAM: cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74559"
FT                   /db_xref="GOA:E1SMK4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK4"
FT                   /protein_id="ADN74559.1"
FT                   /translation="MQLSLFSDRWAALWSNLFPRKAPGMQLYDRTLLVLILTLAITGLL
FT                   MVTSASMAEGAKLTGDPYHFVKRQLLFLGTAMMIGVAVLQVPMQRWEQFSWALMLAALV
FT                   LLVVVLIGGRTVNGATRWLPLGPFNLQVAEVAKLALFVFLAGYLVRRHQELREEIKGFV
FT                   KPVAVLAVYAGLILLQPDLGTVVVMFVTVMGMLFLAGASLGKFITLALVGVGLVVLLIV
FT                   VEPYRMARVMNFMDPWEDPFGSGYQLTQSLMAYGRGDWLGQGLGNSIQKLEYLPEAHTD
FT                   FIFAVLGEELGFIGVVTVLALLLALAFRALWIGHLALKQEQAFAGYLAYGIGIWFSFQT
FT                   AVNVGASVGVLPTKGLTLPLVSYGGSSLWVMTAASAMLLRIDHERRVAQSQPAKVTEAS
FT                   DE"
FT   sig_peptide     378907..379065
FT                   /locus_tag="Fbal_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            380105..381190
FT                   /locus_tag="Fbal_0346"
FT   CDS_pept        380105..381190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0346"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="COGs: COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase; InterPro IPR004276:
FT                   IPR007235: IPR006009; KEGG: slo:Shew_3453
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; PFAM: glycosyl
FT                   transferase family 28; Glycosyltransferase 28 domain;
FT                   PRIAM: Undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; SPTR: A3QIM1
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase;
FT                   TIGRFAM:UDP-N-acetylglucosamine--N-acetylmuramyl-
FT                   (pentapeptide) pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase; PFAM: Glycosyltransferase
FT                   family 28 N-terminal domain; Glycosyltransferase family 28
FT                   C-terminal domain; TIGRFAM:
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74560"
FT                   /db_xref="GOA:E1SMK5"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK5"
FT                   /protein_id="ADN74560.1"
FT                   /translation="MSDNKAPRLMVMAGGTGGHVFPALAVARRLRQQGWEVLWLGTAER
FT                   MEARLVPQHGFAIRFIDIKGVRGNGLLRKLKAPFQIFKAIAQARRIQAEFQPDVVMGMG
FT                   GYAAGPGGIAAWLRRTPLVLHEQNAVAGATNAILAKFANKVLVAFDNVLPGEQRVGNPV
FT                   RDELVAIGETQPVVPGEQLKVLVVGGSLGAQVLNDQVPAAVGRLANEAAVTVWHQVGRG
FT                   NEAAVTQRWAEMAPGVGAQVTEFIDDMAAAYAWADLVICRAGALTVAELAATGRPSLLV
FT                   PFPHAVDDHQTKNAEALVAAGAARLLPQASLTPERLADEMLTLVQQPDTLVQMAEAARN
FT                   SAILDATDKVAGICASLARRD"
FT   sig_peptide     380105..380179
FT                   /locus_tag="Fbal_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            381192..382652
FT                   /locus_tag="Fbal_0347"
FT   CDS_pept        381192..382652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0347"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="COGs: COG0773 UDP-N-acetylmuramate-alanine ligase;
FT                   InterPro IPR000713: IPR004101: IPR013221: IPR005758; KEGG:
FT                   slo:Shew_3452 UDP-N-acetylmuramate--L-alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; SPTR: A3QIM0
FT                   UDP-N-acetylmuramate--L-alanine ligase; TIGRFAM:
FT                   UDP-N-acetylmuramate/alanine ligase; PFAM: Mur ligase
FT                   family, glutamate ligase domain; Mur ligase family,
FT                   catalytic domain; Mur ligase middle domain; TIGRFAM:
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74561"
FT                   /db_xref="GOA:E1SMK6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK6"
FT                   /protein_id="ADN74561.1"
FT                   /translation="MSKVQVSGANSPRPGMGRVKRIHFVGIGGAGMGGIAEVLANEGYQ
FT                   VSGSDIAQNPVTERLVQAGAAVHIGHSAEWVEDADVVVVSTAIREENPEIRAARERRIP
FT                   VVRRAEMLAELMRFRHGIAVAGTHGKTTTTSLTASLFGQGGLDPTFVIGGKLNSAGTNA
FT                   QLGLGRYLVAEADESDASFLHLQPMISVVTNIEPDHMDTYGGDINKLYDTFVDFLHNLP
FT                   FYGVAVLCLDDPGVQVILPRVGRRIVTYGFHPDADVRAEDFVQVGTRTQFTLHRPNRDP
FT                   LPLVLNLPGRHNVQNALAAIAVAMEEGVEDDAIEAALDQFQGIGRRFQQYGEFDTGAGK
FT                   VLLVDDYGHHPSEVAVTIKAARASWPDRRLVMVFQPHRFSRTRDLYDDFCAVLSEVDCL
FT                   LLMEVYSAGEDLIPGADSRALCRSIRQRGIDPVYVPGPEGLPALLADQLQDGDVVLTQG
FT                   AGNIGALAKDLAQMGLSVNKMKQERSGE"
FT   gene            382645..383565
FT                   /locus_tag="Fbal_0348"
FT   CDS_pept        382645..383565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0348"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="COGs: COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp protein; InterPro IPR011095: IPR013651:
FT                   IPR011127: IPR011761: IPR 000291: IPR019825: IPR005905;
FT                   KEGG: abo:ABO_0600 D-alanine--D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; RimK domain
FT                   protein ATP-grasp; PRIAM: D-alanine--D-alanine ligase;
FT                   SPTR: Q0VS00 D-alanine--D-alanine ligase; TIGRFAM:
FT                   D-alanine/D-alanine ligase; PFAM: D-ala D-ala ligase
FT                   N-terminus; D-ala D-ala ligase C-terminus; TIGRFAM:
FT                   D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74562"
FT                   /db_xref="GOA:E1SMK7"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK7"
FT                   /protein_id="ADN74562.1"
FT                   /translation="MSEVVKQDKVAVLFGGTSAEREVSLRSGAAVLAGLQRGGVDAHPF
FT                   DPAERSLDELKGFDRAFIVLHGRGGEDGTVQGALELMKIPYTGSRVLGCAVAMDKVRTK
FT                   WLWAGLGLPTADFEVVDKESFSPNSAEDIMARLGSPVMVKPACEGSSIGMAKAEDAASL
FT                   QKAIDTALQYDDTVLVEAWVHGPEFTVSILGEEALPAIRMETPNVFYDYEAKYQSQTTQ
FT                   YHCPAGLSDDDEQALRALALRAFKAVGASGWGRVDVMRDADGSWRLLEVNTVPGMTETS
FT                   LVPKAANAVGVDFDTLVARILAASY"
FT   gene            383576..384322
FT                   /locus_tag="Fbal_0349"
FT   CDS_pept        383576..384322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0349"
FT                   /product="cell division protein FtsQ"
FT                   /note="COGs: COG1589 Cell division septal protein; InterPro
FT                   IPR013685: IPR005548; KEGG: sse:Ssed_0412
FT                   polypeptide-transport-associated domain-containing protein;
FT                   PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein FtsQ-type;
FT                   SPTR: A2UXR2 Polypeptide-transport-associated, FtsQ-type;
FT                   PFAM: Cell division protein FtsQ; POTRA domain, FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74563"
FT                   /db_xref="GOA:E1SN64"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN64"
FT                   /protein_id="ADN74563.1"
FT                   /translation="MVLAQWREIRWSLWLGLTFLFLVLIGLVQGGLWLKAFATSADQLP
FT                   IEEVALMGERRFTADQEVRDALHNLETWSLFTADVGQIRDALDDLPWVDRVTVRREWPN
FT                   RLRVFLVEQQPVAHWDGEGWLNDRAEPFQAPVRPGLDALPELRGPQGSASKVWQMWQQV
FT                   SELLALNGHTGHSLSLSGRHAWQLVLDNGIALELGRKDTLARVQRFIDVWPELQRDGRV
FT                   PERVDLRYDTGLAVRWQQNEQEKQKG"
FT   gene            384319..385554
FT                   /locus_tag="Fbal_0350"
FT   CDS_pept        384319..385554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0350"
FT                   /product="cell division protein FtsA"
FT                   /note="COGs: COG0849 Actin-like ATPase involved in cell
FT                   division; InterPro IPR003494; KEGG: slo:Shew_3450 cell
FT                   division protein FtsA; PFAM: cell division protein FtsA;
FT                   SPTR: A3WNF8 Cell division ATPase, FtsA; TIGRFAM: cell
FT                   division protein FtsA; PFAM: Cell division protein FtsA;
FT                   TIGRFAM: cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74564"
FT                   /db_xref="GOA:E1SN65"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN65"
FT                   /protein_id="ADN74564.1"
FT                   /translation="MTTSTETGLVVGLDIGTAQVTAVIGEVLPDGEISVIGIGSQLSRG
FT                   MDKGGVNDLDSVVRCVRLALTQAENMAQCEVASVYLSISGHHISCQNEKGMVSIDGAEV
FT                   MQEDVDHVIHTAQSVKIPNERRILHVLPQEFTIDELEGIRSPVGMSGMRMEAKVHMVTC
FT                   ASDWARNITKCVERCGIHVDGLVFSGIASAESVLTEDEKDLGVCLVDIGAGTTDIAIYS
FT                   GGALRHCQVIPVAGNQVTSDIAKIFRTPLSHAEQIKVQFACARSGLVSSEDSIEVPSVG
FT                   GRPARTMSRQTLAEVVEPRYQELFELVADALRASGLEDQVAAGVVLTGGTAQIEGAEVV
FT                   AEECFGMPVRLAQPLPLKGLNDYIREPSYATAVGLLHHGAQQLMEKTQERAPQNGISQL
FT                   LTRMQSWFKGEF"
FT   gene            385588..386808
FT                   /locus_tag="Fbal_0351"
FT   CDS_pept        385588..386808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0351"
FT                   /product="cell division protein FtsZ"
FT                   /note="COGs: COG0206 Cell division GTPase; InterPro
FT                   IPR000158: IPR018316: IPR003008; KEGG: shl:Shal_0459 cell
FT                   division protein FtsZ; PFAM: Tubulin/FtsZ GTPase;
FT                   Tubulin/FtsZ, 2-layer sandwich domain; SPTR: P0A9A6 Cell
FT                   division protein ftsZ; TIGRFAM: cell division protein FtsZ;
FT                   PFAM: Tubulin/FtsZ family, GTPase domain; FtsZ family,
FT                   C-terminal domain; TIGRFAM: cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74565"
FT                   /db_xref="GOA:E1SN66"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN66"
FT                   /protein_id="ADN74565.1"
FT                   /translation="MFEIVDCHNDDAVIKVIGVGGGGGNAVEHMVEQTIEGVEFICANT
FT                   DSQALRKSSANTTIQLGKNVTKGLGAGANPEVGREAALEDRETIRAAIAGSDMVFIAAG
FT                   MGGGTGTGAAPVVAEVAKEEGILTVAVVTKPFSFEGKKRSAFADQGIDLLSKHVDSLIT
FT                   VPNDKLLKVLGGRTSLLDAFKAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMG
FT                   NAMMGTGVARGEDRAEEAAEAAVASPLLEDIDLSGARGVLVNITAGLDISIEEFETVGN
FT                   HVKAYASENATVVVGAVIDPEMSDELRVTVVATGIGAEKKPDIQLVSNAVAKPKQPEPA
FT                   RDAYTAEPAAPSMTRPAVEPSHNEPAEPMRTSVGGQGGAAAAKQPNENLNKDNYLDIPA
FT                   FLRRQAD"
FT   gene            386899..387810
FT                   /locus_tag="Fbal_0352"
FT   CDS_pept        386899..387810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0352"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="COGs: COG0774 UDP-3-O-acyl-N-acetylglucosamine
FT                   deacetylase; InterPro IPR004463; KEGG: slo:Shew_3448
FT                   UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase; PFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; SPTR: A3QIL6 UDP-3-O-[3-hydroxymyristoyl]
FT                   N-acetylglucosamine deacetylase; TIGRFAM: UDP-3-0-acyl
FT                   N-acetylglucosamine deacetylase; PFAM: UDP-3-O-acyl
FT                   N-acetylglycosamine deacetylase; TIGRFAM: UDP-3-0-acyl
FT                   N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74566"
FT                   /db_xref="GOA:E1SN67"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN67"
FT                   /protein_id="ADN74566.1"
FT                   /translation="MSKQRTLQRPIQATGVGLHSGKKVTLGIKPAPANTGIVFRRVDLN
FT                   PVAEIPARADLVRETTLCTGLVNEQGVKVATVEHLLSALAGLGVDNAFIEVDAPEIPIM
FT                   DGSASPFVFLLQSAGIVEQSASKQYLRIRKTVRVEDGDKWAEFRPYHGFKLDFSIDFQH
FT                   PEISRSAQRMTLDFSAGAFSRKISRARTFGFMKDIEFLRANNLALGGSMENAIVLDEFR
FT                   ILNPDGLRDKDEFVKHKILDAVGDLYLAGHAILGEYRAHKSGHALNNQMVRAVLADASA
FT                   WELVSFEQAQEVPMDYLVPATA"
FT   gene            complement(387807..388238)
FT                   /locus_tag="Fbal_0353"
FT   CDS_pept        complement(387807..388238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0353"
FT                   /product="protein of unknown function DUF721"
FT                   /note="COGs: COG4701 conserved hypothetical protein;
FT                   InterPro IPR007922; KEGG: sdn:Sden_0361 hypothetical
FT                   protein; PFAM: protein of unknown function DUF721; SPTR:
FT                   A2V4N0 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74567"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN68"
FT                   /protein_id="ADN74567.1"
FT                   /translation="MLMGQRFAQIQDKSGTLAQLHQHLLAALDPAVRPHCAVSNLRGGV
FT                   LVIGVSSAAWATRLQYQRLELLSELRGKGFPMLTSIEFKVNPQLSRLQAEKPTNTNRLS
FT                   DKASEHLQQLAENIGGELGEKLKRLAAQAGRPDKGSKSD"
FT   gene            388297..389202
FT                   /locus_tag="Fbal_0354"
FT   CDS_pept        388297..389202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0354"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   slo:Shew_3446 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   A2V4N1 Peptidase M23B; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74568"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN69"
FT                   /protein_id="ADN74568.1"
FT                   /translation="MSVTVFIRGKHGVRRIEPGKRWLLAPLMLVAAGATLWWQARENVS
FT                   TVEHQLAAASASTEHHQNEIAALRDRTEAQLSLLAARLGRMQARMNRIESLGIAVADRV
FT                   ELSDQFDFQSEVGLGSSGVEPSEQVELSLLLEEMDQMMLRLERADDQLALLETLERHHH
FT                   IDEDTYLSGRPLSKGWQSSSFGYRNDPFNGRRTLHRGLDFAGPEGGEVIATGAGVVSYS
FT                   GTMFGYGNLVEIDHGNGVKTRYGHNKENLVELGQVVAKGETVALIGNTGRSTGPHVHYE
FT                   VMLNDQQVDPARYVYRKPRT"
FT   gene            389278..391995
FT                   /locus_tag="Fbal_0355"
FT   CDS_pept        389278..391995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0355"
FT                   /product="protein translocase subunit secA"
FT                   /note="COGs: COG0653 Preprotein translocase subunit SecA
FT                   (ATPase RNA helicase); InterPro IPR000185: IPR004027:
FT                   IPR011130: IPR011116: IPR 011115: IPR014021: IPR014018;
FT                   KEGG: shm:Shewmr7_0394 preprotein translocase subunit SecA;
FT                   PFAM: SecA DEAD domain protein; SecA Wing and Scaffold;
FT                   SecA preprotein cross-linking region; SEC-C motif domain
FT                   protein; SPTR: Q0HZQ8 Protein translocase subunit secA;
FT                   TIGRFAM: preprotein translocase, SecA subunit; PFAM: SecA
FT                   DEAD-like domain; SecA preprotein cross-linking domain;
FT                   SEC-C motif; SecA Wing and Scaffold domain; TIGRFAM:
FT                   preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74569"
FT                   /db_xref="GOA:E1SN70"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN70"
FT                   /protein_id="ADN74569.1"
FT                   /translation="MFGKLLTKVFGSKNERTLKQLQKVVAQINALEADWEALSDEQLKQ
FT                   KTEEFKQRLADGTPLDAVLPEAFATVREASKRVFGMRHFDVQLVGGMVLQSGRIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVITVNDYLARRDAEWNRPLFEFLGMTVGINVPGLSH
FT                   MDKKAAYEADITYGTNNEFGFDYLRDNMAFSAPERVQRELHYAVVDEVDSILIDEARTP
FT                   LIISGAAEDSSALYIQVNTLIPKLVRQDKEDSEEFTGEGDYSVDEKAKQVNMTERGQEK
FT                   VEQLLLEAGLLNEGDSLYSATNISLLHHVNAALRAHTLFERDVDYIVSDNGEIVIVDEH
FT                   TGRTMPGRRWSDGLHQAVEAKEGQRIQNENQTLASITFQNYFRMYEKLAGMTGTADTEA
FT                   FEFQSIYGLDTVVIPTNKPMIRKDMADLVYLTAEEKFEAIINDIRDCIERGQPVLVGTI
FT                   SIESSELLSNVLRKAKIKHNVLNAKFHEKEAEIVAEAGRPGAVTIATNMAGRGTDIVLG
FT                   GSWQSEIDALGEGATEAQIEKIKADWRVRHEQVLEAGGLHIIGTERHESRRIDNQLRGR
FT                   SGRQGDAGSSRFYLSMEDALMRIFASDRVSGMMKKLGMERGEAIEHPWVNRAIENAQRK
FT                   VEARNFDIRKQLLEYDDVANDQRQVVYAQRNELMDAEDIHETIEAVRADVLEEVVGQYI
FT                   PPQSLEEMWDIPGLEERLASDFNLKLPIGQWLEEEDDLHEENLHERIVKAWDDAYAAKE
FT                   EQVGAPVLRQFEKAIMLQTLDNLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFAL
FT                   FQSMLDSLKTDVISILSKVQVQAQADVDEMEAKRREQEEQLARMRNFQHAQSEGMGEEG
FT                   ESSPEQRQGPKVGRNDPCPCGSGKKYKQCHGKLS"
FT   gene            392025..392453
FT                   /locus_tag="Fbal_0356"
FT   CDS_pept        392025..392453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0356"
FT                   /product="8-oxo-dGTPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG1051 ADP-ribose pyrophosphatase; InterPro
FT                   IPR020476: IPR000086: IPR003561; KEGG: mmw:Mmwyl1_2605
FT                   mutator MutT protein; PFAM: NUDIX hydrolase; SPTR: A0Y259
FT                   7,8-dihydro-8-oxoguanine-triphosphatase, prefers dGTP;
FT                   TIGRFAM: mutator MutT protein; PFAM: NUDIX domain; TIGRFAM:
FT                   mutator mutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74570"
FT                   /db_xref="GOA:E1SN71"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN71"
FT                   /protein_id="ADN74570.1"
FT                   /translation="MAALFYGTNESNDMAIVQVAIGLVVIDGAVLVAKRHKDQHQGGLW
FT                   EFPGGKVEPGETPEQAVIRECQEEVGLTLSQPELFDYIEHDYGDRQVQLSAFLATAAEG
FT                   EAHGREGNPLRWCPISELAQLPMPAANGRLIEKLLAAQ"
FT   gene            complement(392380..394071)
FT                   /locus_tag="Fbal_0357"
FT   CDS_pept        complement(392380..394071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0357"
FT                   /product="O-antigen polymerase"
FT                   /note="COGs: COG3307 Lipid A core - O-antigen ligase;
FT                   InterPro IPR007016; KEGG: vsp:VS_0319 hypothetical protein;
FT                   PFAM: O-antigen polymerase; SPTR: A2P9B3 Membrane protein,
FT                   putative; PFAM: Domain of unknown function (DUF3366);
FT                   O-Antigen ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74571"
FT                   /db_xref="GOA:E1SN72"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN72"
FT                   /protein_id="ADN74571.1"
FT                   /translation="MMTMTREGQLNRWYLGAWGLLWLLAMHYYQPNGGGSGLSLAFNTT
FT                   SWMALALVLAVGAYQAARRGCLRFNALLPVSTLCLLALCLPLLWSPAPWAGTALPRYLG
FT                   LFALLALLLCQQQMSLRPQQQRLFWRLVIAAGLIQTLFSLIQFLSPTWFPALMTSQRPV
FT                   GIFQQTNLVATFIGATMAISYYRLQQETSQGWRRLSWLLILLGATAQWLIQSRTGVVGT
FT                   TLALLGLSALLGWHLSKRLWALLVVGVVLGAALQALNQAPPRDNLEQPGYRTTLYGLSA
FT                   ELIAEHPWQGVGIGQFQPAFMEKQAQHQAGAGDYPYWSTASSHPHNELLFWGVEGGLLP
FT                   MVAILMFGLWVTYRVWRAGRLRHKALWLCLLPVLLHSQTEYPLYQSAPHLALFAVLVAA
FT                   MVPGRWRRLTLRGEGVLRLSAPIMVVLVWAFMLTNLHTTYVAGQYYATKQPHYLVEIVN
FT                   PFGQTRNINYLTTQALLRVGSPTALAQAEQLAHEEARLRPTIGSYALWQDSLWAQGRYD
FT                   EAEQVRQRGQYLFRDQPKFQRAVTAPPTTSQSAARSLPASAAAPAH"
FT   gene            complement(394071..394295)
FT                   /locus_tag="Fbal_0358"
FT   CDS_pept        complement(394071..394295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0358"
FT                   /product="protein of unknown function DUF329"
FT                   /note="COGs: COG3024 conserved hypothetical protein;
FT                   InterPro IPR005584; KEGG: swp:swp_4766 hypothetical
FT                   protein; PFAM: protein of unknown function DUF329; SPTR:
FT                   B8CUS1 UPF0243 zinc-binding protein swp_4766; PFAM: Domain
FT                   of unknown function (DUF329)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74572"
FT                   /db_xref="GOA:E1SN73"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN73"
FT                   /protein_id="ADN74572.1"
FT                   /translation="MTLKVECPTCQAEVSWDEQHPFRPFCSERCKLIDLGEWAEERHAI
FT                   AGKPELPDEFDISEPDFFLQDEDEQDREH"
FT   gene            complement(394292..395041)
FT                   /locus_tag="Fbal_0359"
FT   CDS_pept        complement(394292..395041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0359"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="COGs: COG4582 conserved hypothetical protein;
FT                   InterPro IPR009777; KEGG: sbn:Sbal195_4064 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1342; SPTR:
FT                   A6WTC8 UPF0289 protein Shew185_3946; PFAM: Protein of
FT                   unknown function (DUF1342)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74573"
FT                   /db_xref="GOA:E1SN74"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN74"
FT                   /protein_id="ADN74573.1"
FT                   /translation="MLLVYEQPLNEKIRNYLRIETVAAQMDAHSQFEHPGAELAFFRAL
FT                   FELIELLERADLRSDILKDLERHLGQIAFWRQADNVDLAQLDALESQFKTLLQSLHEIS
FT                   RPGQQLKTDRFLSAVRQRMNIPGGYGNFDLPQLHFWQALPTADKSAQAMAWRKALAPML
FT                   DSIRLLLTMLRETARWGDQMAMNGCYQETCEQGLELLRVQIKQEYGVYPTISAHRHRFT
FT                   IHLINYESGKADNRNLPLRLSLSMEPK"
FT   gene            complement(395025..395648)
FT                   /locus_tag="Fbal_0360"
FT   CDS_pept        complement(395025..395648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0360"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; InterPro
FT                   IPR001977; KEGG: son:SO_0413 dephospho-CoA kinase; PRIAM:
FT                   Dephospho-CoA kinase; SPTR: Q8EJP9 Dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74574"
FT                   /db_xref="GOA:E1SN75"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN75"
FT                   /protein_id="ADN74574.1"
FT                   /translation="MSDLIVGLTGGIGSGKSQVSDQFAQLGVTVVDADIIARDVVTPGS
FT                   YGLQAIVDHFGETLLNPDGTLNRAELRRRVFNDEAERQWLNNLTHPMIRTEMQRQCREA
FT                   PGEYALMVVPLMVENGLQALVDRLIVVDVPESQQRHRTALRDQTDGNEVDKIIARQASR
FT                   SERLALADEVIDNSGPIEALTPQVHRLHQKFLTLARSRSSATGV"
FT   gene            complement(395645..396526)
FT                   /locus_tag="Fbal_0361"
FT   CDS_pept        complement(395645..396526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0361"
FT                   /product="type 4 prepilin peptidase 1"
FT                   /EC_number="3.4.23.43"
FT                   /note="COGs: COG1989 Type II secretory pathway prepilin
FT                   signal peptidase PulO and related peptidase; InterPro
FT                   IPR014032: IPR010627: IPR000045; KEGG: slo:Shew_3440
FT                   prepilin peptidase; PFAM: peptidase A24A domain protein;
FT                   peptidase A24A prepilin type IV; PRIAM: Prepilin peptidase;
FT                   SPTR: A2UYK1 Peptidase A24A-like; PFAM: Bacterial Peptidase
FT                   A24 N-terminal domain; Type IV leader peptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74575"
FT                   /db_xref="GOA:E1SN76"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN76"
FT                   /protein_id="ADN74575.1"
FT                   /translation="MTHWIALFDQLPWLFLLLTTALGLILGSFLNVVIHRMPLMMEREW
FT                   QQECAEALSMPAPASELPDRFNLMVPGSACPRCGTAIPIWHNIPVLSYLLLRGRCHHCK
FT                   TPISLRYPTVELLTGLATLFLAWHFGPSAQFLAAWVLTLGLISLAAIDFDTMLLPDQLT
FT                   LPLLWLGLLVNLNGLFVPLEQAVIGAALGYLSLWSLFQLFKLLTGKEGMGYGDFKLLAL
FT                   FGAWFGYPALLPVILIASIGGAVVGITLQVSGKLGRGKPMPFGPWIVLGGWIYLVWGTD
FT                   IVNWYLHTVVGV"
FT   gene            complement(396563..397822)
FT                   /locus_tag="Fbal_0362"
FT   CDS_pept        complement(396563..397822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0362"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR003004: IPR018076: IPR001992; KEGG:
FT                   shm:Shewmr7_3606 type II secretion system protein; PFAM:
FT                   Type II secretion system F domain; SPTR: A2UYK0 Type II
FT                   secretion system protein; PFAM: Bacterial type II secretion
FT                   system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74576"
FT                   /db_xref="GOA:E1SN77"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN77"
FT                   /protein_id="ADN74576.1"
FT                   /translation="MAIAAKKRLKTSEPDKPALDVRTYLWKGKNSKGNSVKGELSGQTT
FT                   AEVKVLLRKQGITPLSVKKKPKALFERKAKIRGMDIAVVTRQIATMLLAGVPLVTAIEM
FT                   VGRSHENDAVRKLLAIILAEVQSGTPLSKALRPHRQYFDDLYCDLVAAGEHSGTLDQVF
FT                   DRIATYREKSEALKSKIKKAMFYPTAVVVVAISVTVLLLLFVVPQFEAIFNDFGAELPI
FT                   FTQIVINLSRFLSESWYYFLAAIVIVIWLFIRSHRNSQKFRDKVDHFLLKIPVVGPILD
FT                   KAAVARFSRTLATTFAAGVPLVDGLDSASGASGNALYRDAVMKIKEEVIAGLQMNVAMR
FT                   TTGLFPDMLIQMVMIGEESGALDDMLNKVASIYEAQVDDAVDGLSTLIEPIMMVVIGGL
FT                   VGGLVVAMYLPIFQLGNVVG"
FT   gene            complement(397839..399401)
FT                   /locus_tag="Fbal_0363"
FT   CDS_pept        complement(397839..399401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0363"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="COGs: COG2804 Type II secretory pathway ATPase
FT                   PulE/Tfp pilus assembly pathway ATPase PilB; InterPro
FT                   IPR001482: IPR007831: IPR013374; KEGG: saz:Sama_0369 type
FT                   IV pilus biogenesis protein PilB; PFAM: type II secretion
FT                   system protein E; General secretory system II protein E
FT                   domain protein; SPTR: A2UYJ9 Type IV-A pilus assembly
FT                   ATPase PilB; TIGRFAM: type IV-A pilus assembly ATPase PilB;
FT                   PFAM: Type II/IV secretion system protein; GSPII_E
FT                   N-terminal domain; TIGRFAM: type IV-A pilus assembly ATPase
FT                   PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74577"
FT                   /db_xref="GOA:E1SN78"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN78"
FT                   /protein_id="ADN74577.1"
FT                   /translation="MLEPANVNIQMKPNFGIPQMDVSYLVTDFIEDSFLNTKLIEKHNA
FT                   VPLTVRDNRLLIAIADPDNFEALEDFKFNLGYHAEPIQVDKNSLDKLISELLQEDLGQL
FT                   EITEEDEKNLAHIDTEDDKKQDDVSGADDAPIVVFLNKIMTEAIRKGASDLHFEPYENE
FT                   YRIRFRIDGMLHTVNTPPVGLGPRLSARIKVMSRLDLAERRLPQDGRIKLKVGKKTMID
FT                   FRVSTLPTLYGEKVVMRILDSSAAKLNIDILGFSDAQKDLYLKNLHRPQGMILVTGPTG
FT                   SGKTVSLYTGLNILNTEERNISTAEDPVEINLPGINQVQIHPKAGLSFASALRAFLRQD
FT                   PDIVMVGEIRDLETAEIAVKAAQTGHLVMSTLHTNSAAETLTRMLNMGVPAYNIASSVN
FT                   LIMAQRLCRKLCPKCRQPESIPHEELLREGFSPGQLHTQPTIYRAVGCDDCTDGYKGRV
FT                   GLYELMPMSKAISDLIMNNGSSLELEAQANREGMVSLRHSGLLKVLEGVTSLAEVNRVT
FT                   IAH"
FT   gene            complement(399475..399903)
FT                   /locus_tag="Fbal_0364"
FT   CDS_pept        complement(399475..399903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0364"
FT                   /product="methylation site containing protein"
FT                   /note="COGs: COG4969 Tfp pilus assembly protein major pilin
FT                   PilA; InterPro IPR002416: IPR012902: IPR001120; KEGG:
FT                   shm:Shewmr7_3604 methylation site containing protein; SPTR:
FT                   P45791 Pilus biogenesis protein tapA; PFAM: Prokaryotic
FT                   N-terminal methylation motif; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74578"
FT                   /db_xref="GOA:E1SN79"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN79"
FT                   /protein_id="ADN74578.1"
FT                   /translation="MNRQVRKQQGFTLIELMIVVAIVGILAAIALPAYQTYTKKAKMTE
FT                   VAAATGGMKTAAEVCFQLNATNYATVCTAANELADQTQPNISIKYTAGNAPKITALTTA
FT                   ALGPVPSGVSYVLTGTVASSGQVTWAKSCTGEAASYCP"
FT   gene            complement(400171..401028)
FT                   /locus_tag="Fbal_0365"
FT   CDS_pept        complement(400171..401028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0365"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="COGs: COG0157 Nicotinate-nucleotide
FT                   pyrophosphorylase; InterPro IPR002638: IPR004393; KEGG:
FT                   shn:Shewana3_0422 nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating]; PFAM: Quinolinate phosphoribosyl
FT                   transferase; PRIAM: Nicotinate-nucleotide diphosphorylase
FT                   (carboxylating); SPTR: A2UYJ7 Nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase, C-terminal domain; Quinolinate phosphoribosyl
FT                   transferase, N-terminal domain; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74579"
FT                   /db_xref="GOA:E1SN80"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN80"
FT                   /protein_id="ADN74579.1"
FT                   /translation="MLENDIRLTVAAALDEDLGGQGPAQGDITAQLIPADRYAEATIIT
FT                   REDGVFCGKAWAEQVFNQLGGDVALHWHVDDGDLVVAGQTLCELAGPARLLLTGERTVL
FT                   NFIQTLSGVATTVSHYVAKLEGTQTRLLDTRKTLPGLRTAQKYAVTCGGGHNHRIGLFD
FT                   AFLIKENHIAACGGISPAIAAARQLRPEAPVEVEVENLEELKEALTGGADIVMLDNFDI
FT                   TMMLDAVTLNREQFEGRCKLEVSGDVTLATIGDFARTGVDFISVGALTKHVKAMDLSMR
FT                   FKAN"
FT   gene            complement(401035..401550)
FT                   /locus_tag="Fbal_0366"
FT   CDS_pept        complement(401035..401550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0366"
FT                   /product="aspartyl protease"
FT                   /note="COGs: COG3577 aspartyl protease; InterPro IPR001969:
FT                   IPR011969; KEGG: ilo:IL2346 aspartyl protease; SPTR: A3WLN8
FT                   Predicted aspartyl protease; TIGRFAM: conserved
FT                   hypothetical protein TIGR02281"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74580"
FT                   /db_xref="GOA:E1SN81"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN81"
FT                   /protein_id="ADN74580.1"
FT                   /translation="MGTPSTPRRYGQTLFVLAWLVLAALLYLYFDSKLARQYNPNQRVA
FT                   SEISGQSIAVNLLRNRQGHYVASGQINGHDVVMMVDTGATRISIPESVATRLSLRRGQS
FT                   YPVETANGTVTVWHTRIDQLSIGALTLYDLDANINPGLGDSTILLGMNALKDLELIQRG
FT                   DTLTLRKY"
FT   sig_peptide     complement(401482..401550)
FT                   /locus_tag="Fbal_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            401620..402222
FT                   /locus_tag="Fbal_0367"
FT   CDS_pept        401620..402222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0367"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="COGs: COG3023 Negative regulator of beta-lactamase
FT                   expression; InterPro IPR002502; KEGG: sdn:Sden_3386
FT                   N-acetyl-anhydromuranmyl-L-alanine amidase; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SMART:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SPTR: A3WNI2
FT                   N-acetyl-anhydromuramyl-L-alanine amidase; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74581"
FT                   /db_xref="GOA:E1SN82"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN82"
FT                   /protein_id="ADN74581.1"
FT                   /translation="MAICPPDGEPSPVIPSYTLEPAGRWLEQGTHCFSPFQGPRPDAGD
FT                   ISLLVIHNITLPPGLFGAPYIQQLFLGCVQADFAPLCEVQGLQVSAHLLIRRDGSVVQF
FT                   VPFDRRAWHAGVSEFDGRPACNDYSIGIELEGTDYTPYNLVQYQALVSVTRALLRQYPL
FT                   LTKDRVTGHSDIAPGRKTDPGPAFDWSLFHALLDKDS"
FT   gene            402222..403073
FT                   /locus_tag="Fbal_0368"
FT   CDS_pept        402222..403073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0368"
FT                   /product="signaling modulator of AmpD, AmpE"
FT                   /note="COGs: COG3725 Membrane protein required for
FT                   beta-lactamase induction; KEGG: shl:Shal_0474 regulatory
FT                   protein AmpE; SPTR: A2UYJ5 Signaling modulator of AmpD,
FT                   AmpE"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74582"
FT                   /db_xref="GOA:E1SN83"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN83"
FT                   /protein_id="ADN74582.1"
FT                   /translation="MALFSLIVVLLAERLRLVADAFQFEAWFGRYRRLMFDDQALRSPL
FT                   RMAVALVLPALVVWLAQRLLTGVWFGVLHLALWIGVGLLLFAHGPLRQRFRQYLEAARR
FT                   GDTQSCFNYADSLDESTAMQAASVEELGQRMGQLSAWLNYRYYAAVALYFVLLGPAMAT
FT                   FYCTVRAYCDHFAAQDCRRPLLGPLMKLLDWVPVRIVSLGFALSGHFSKAAPVLVPKVL
FT                   DPFSDPRRMITEVALAAEEVPETAGEPLCVQPTLALLKLAKRNFILLLVVVSLLTIFGV
FT                   IH"
FT   gene            403279..404034
FT                   /locus_tag="Fbal_0369"
FT   CDS_pept        403279..404034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0369"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2186 Transcriptional regulators; InterPro
FT                   IPR000524: IPR011711; KEGG: sbp:Sbal223_3857 regulatory
FT                   protein GntR HTH; PFAM: regulatory protein GntR HTH; GntR
FT                   domain protein; SMART: regulatory protein GntR HTH; SPTR:
FT                   A2UYJ4 Regulatory protein GntR, HTH; PFAM: Bacterial
FT                   regulatory proteins, gntR family; FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74583"
FT                   /db_xref="GOA:E1SN84"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN84"
FT                   /protein_id="ADN74583.1"
FT                   /translation="MTYRRINQPKLSDVILKELEKMILEGSLKPGQKLPPERELAVQFE
FT                   VSRPSLREAIQKLEAKGVLTRRQGGGTYVKQQLWNSLADPLVELLASNPESQYDLLEFR
FT                   YATEGMMAYYAAARGTDADHAQMRQKMDTIKSVQGDTEAEAQAIVDFYRSIAEASHNVA
FT                   MLHLVLSLTPLLVRNVAENLELLYRRERSSEVANTHREALLEAILKRDPELARRASNDH
FT                   LAYIEEVTLEVRQEDSRQQRSLRRMRNDL"
FT   gene            404102..406768
FT                   /locus_tag="Fbal_0370"
FT   CDS_pept        404102..406768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0370"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG2609 Pyruvate dehydrogenase complex
FT                   dehydrogenase (E1) component; InterPro IPR004660; KEGG:
FT                   vpa:VP2519 pyruvate dehydrogenase subunit E1; SPTR: A3GNE4
FT                   Pyruvate dehydrogenase, E1 component; TIGRFAM: 2-oxo-acid
FT                   dehydrogenase E1 subunit, homodimeric type; PFAM:
FT                   Transketolase, thiamine diphosphate binding domain;
FT                   TIGRFAM: pyruvate dehydrogenase E1 component, homodimeric
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74584"
FT                   /db_xref="GOA:E1SN85"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN85"
FT                   /protein_id="ADN74584.1"
FT                   /translation="MSEPMNYDVDKQETQEWLESLAAVMQEDGLERAQFLLEQMISKAK
FT                   HEGVDLPTGITTNYINTIAPKDEPAYPGDSSLERRIRSIIRWNAIMIVLRASKKDLDLG
FT                   GHMASYQSAASFYEVGFNHFFRAPNAQDGGDLVYYQGHISPGIYARAFLEGRLSEEQLD
FT                   NFRQEVDGKGIPSYPHPKLMPEFWQFPTVSMGLGPISAIYQARFLKYLDGRGMKDTSAQ
FT                   RVYAFLGDGEMDEPESRGALSFAAREGLDNLCFLINCNLQRLDGPVMGNGKIIQELEGL
FT                   FKGAGWNVVKVIWGNGWDKLLAKDTSGKLLQLMNETVDGDYQTYKAKNGAYVREHFFGR
FT                   YPETAALVADMTDDEIFALQRGGHSSSKLYAAYMNAKNTKGKPTVILAKTVKGYGMGGA
FT                   AEGMNIAHQVKKMNAEHVRQLRDRLGLKDLVSDEQLMDLPYLKLDESSPEYRYLHARRE
FT                   ALHGYTPQRLPNFTQELALPKLESFQGLLDEQKRDISTTMGFVRALNILLKDKGIGKNI
FT                   VPIIADEARTFGMEGLFRQIGIYNPKGQTYTPQDRDVVSYYKEATNGQVLQEGINELGA
FT                   MSSWVAAATSYSTNDLPMIPFYIYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTL
FT                   NGEGLQHEDGHSHIMAGTIPNCISYDPTFAYEVAVIMQDGIQRMYGPAQENVFYYLTLM
FT                   NENYAQPAMPEGVEEGIRKGIYKLESHAGDNGKVQLLSSGTIMMQVREAARILADDYGI
FT                   GSDVFSVTSFNELTRDGQDAERWNMLHPTEQARVPYVTTVLGDAPAIAATDYMKNYAEQ
FT                   IRAFVPAQSYKVLGTDGFGRSDSRANLRRHFEVDAGYVVVAALSELAKQGKLDTAVVTE
FT                   AIAKFNIDADKQNPLYA"
FT   gene            406783..408681
FT                   /locus_tag="Fbal_0371"
FT   CDS_pept        406783..408681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0371"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="COGs: COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide acyltransferase (E2) protein;
FT                   InterPro IPR004167: IPR000089: IPR001078: IPR003016: IPR
FT                   006256; KEGG: vsp:VS_2541 dihydrolipoamide
FT                   acetyltransferase; PFAM: catalytic domain of components of
FT                   various dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein;
FT                   PRIAM: Dihydrolipoyllysine-residue acetyltransferase; SPTR:
FT                   A3GNE3 Pyruvate dehydrogenase, E2 component,
FT                   dihydrolipoamide acetyltransferase; TIGRFAM: pyruvate
FT                   dehydrogenase complex dihydrolipoamide acetyltransferase;
FT                   PFAM: 2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); e3 binding domain; Biotin-requiring enzyme;
FT                   TIGRFAM: pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase, long form"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74585"
FT                   /db_xref="GOA:E1SN86"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN86"
FT                   /protein_id="ADN74585.1"
FT                   /translation="MTIEINVPDIGADEVEVTEILVQVGDRVEEEQSLISVEGDKASME
FT                   VPASAAGVVKEIKVAVGDKVATGSLIMVFEAEGGAAPAEQAAPAAVAEAPAAPAAASVQ
FT                   AVAVPDIGGDEVDVTELLVKVGDVVTEEQPLITVEGDKASMEVPAPFSGTVKSISINVG
FT                   DKVSTGSVIMEFEVTGGGAAAPVANAPAAAPAASGSEVKVVAVPDIGGDAVDVTELLVA
FT                   VGDRVTDEQPLITVEGDKASMEVPAPFAGVVKAIRIQVGDKVSTGTEIMEFEVEGAAPA
FT                   AVSAPAPAPAAAPAERKPAPSAPADSAEVASVEAATGFIENSAYAYATPVIRRMARELG
FT                   VDLSKVKGTGRKTRILKEDVHSYVKAALAQVQSGAVAPAGKHGGGLDLLPWPKVDFSKF
FT                   GEVESQPLSRIKKLSGANLARNWAMIPHVTQFDEADITDVEAFRKEQNAVVAKQELGFK
FT                   ITPLVFILKAVAKTLADLPQFNSSLSEDGESVILKKYIHIGVAVDTPNGLVVPVVRDVN
FT                   KKGIYELSEELMAISKKARAGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILG
FT                   VSKSEMKPVWNGKEFAPRLMLPLSLSYDHRVIDGADGARFSSTLAGYLSDIRKLVL"
FT   gene            408796..410223
FT                   /locus_tag="Fbal_0372"
FT   CDS_pept        408796..410223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0372"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3); InterPro
FT                   IPR000759: IPR013027: IPR000103: IPR000815: IPR 001327:
FT                   IPR004099: IPR002218: IPR012999: IPR006258; KEGG:
FT                   shm:Shewmr7_3597 dihydrolipoamide dehydrogenase; PFAM:
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A; SPTR:
FT                   A2UYJ1 Dihydrolipoyl dehydrogenase; TIGRFAM:
FT                   dihydrolipoamide dehydrogenase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain;
FT                   TIGRFAM: dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74586"
FT                   /db_xref="GOA:E1SN87"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN87"
FT                   /protein_id="ADN74586.1"
FT                   /translation="MSNEIKTQVVVLGAGPAGYSAAFRAADLGLETVIIERYSTLGGVC
FT                   LNVGCIPSKALLHIAKVIDEAKVMADHGVTFGEPNIDLDKIRAHKEKVIGQLTGGLGGM
FT                   AKMRKVKVVNGNAQFTGANSIDVTAEDGSVTTVKFDNAIIAAGSRPIQLPFIPHEDPRI
FT                   WDSTDALELKEVPGRLLIMGGGIIGLEMGTVYKALGSEVDVVEMLDQVIPAADKDVVRV
FT                   FTKRMNKKFKFMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRTPNGKLL
FT                   AAENAGVAVDERGFINVDKQMRTNVPHIYAIGDIVGQPMLAHKGVHEGHVAAEVISGKK
FT                   HYFDPKVIPSIAYTDPEIAWVGLTEKEAKEQGLNYETATFPWAASGRAIASDAADGMTK
FT                   LIFDKDTHRIIGGAVAGTNAGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAE
FT                   VYEGSITDLPNPKAKKK"
FT   gene            410348..414745
FT                   /locus_tag="Fbal_0373"
FT   CDS_pept        410348..414745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0373"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="COGs: COG5001 signal transduction protein containing
FT                   a membrane domain an EAL and a GGDEF domain; InterPro
FT                   IPR013655: IPR011110: IPR001633: IPR000160: IPR 013767:
FT                   IPR013656: IPR001610: IPR000014: IPR000700: IPR002345;
FT                   KEGG: shw:Sputw3181_0529 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); PFAM: EAL
FT                   domain protein; PAS fold-3 domain protein; Two component
FT                   regulator propeller; GGDEF domain containing protein; PAS
FT                   fold domain protein; PAS fold-4 domain protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein; PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   SPTR: A2UYJ0 Diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(S); TIGRFAM: diguanylate cyclase; PAS sensor
FT                   protein; PFAM: EAL domain; GGDEF domain; Two component
FT                   regulator propeller; PAS fold; TIGRFAM: PAS domain S-box;
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74587"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN88"
FT                   /protein_id="ADN74587.1"
FT                   /translation="MRVFLLLWLCVLQSLTPAMASALRWVNAEQGLQNQSVLALAEDSN
FT                   GLMWIGTEDGLYRLTDRRLRRVDLQGSRHLFGESFIQALLPLPNHQMLVATDESIYHFD
FT                   LFENRAVPLAASLKLPAHTTTTRFYLDTQDNIWFISTEGVVFRLAPELDLFEVIGTLPP
FT                   AQHWRELYRDEHDRLWAMSRHQLVSLEGRSLASRDNLWPSQRGELRGIAADGQGRVWLA
FT                   SYSGLYQLDVVRGAVARKPLLDVPLRDIDEDGNGGLWLLGRGELYHWAAGAPRPVKVEL
FT                   DLPSNFRSESLFATQVDSQGRLWLISSYDGLVGYRHDAPFLLEQINTETHPNIGHDMTW
FT                   DIYAKGPMRYLATDGGVQWVNRDSGEHGTVTLPEMRDAGAAFALWPMDEQTLVVASTEG
FT                   LYQLDTERLEARPLTDMGLPNLRQNLVYNLIDDGHQVWIVTDRYLYRWWPAQQRSERFE
FT                   LDGEPLLGVRNLARGPDGRLWFGGENLLAYQGPEGEFTRVLTARTVDQRKHSIGFLAPQ
FT                   PDGSLWFGSYGRGVWMYDPRWREFRHLSEQWKLDCDSAYFGALVEGQMVIGCSRNLFVV
FT                   EPHLQTLYGLDPYDGLGLNDFNESALFYDSEAGGLMLGGVNGVVVVDPKALAPQPKHDR
FT                   AIIESLEVHYLDGHRQLWLQPEGRLINIEPDYQLLALQFASNRQLDRTPKHFRYRLNHN
FT                   GVVGELVDFPNQGQLTFSGLKPGRYELELYGVSQGIWSVVPSRVSFMVNQHWWQSEPVK
FT                   ALAGSALVAFLMLGLLQRQRQVRRIRQFNTELSQSQQRLHLALSAGRSDTWEWDKASNR
FT                   FRLENHQRCLGEDDEPRLLEMNQMTIHPDDRLRVWRAWREHYLGLSEHYDVEYRQADLQ
FT                   GRWRWIWAAGKAVERDERNGQARRVVGIYSDMTAHRRLEEEHGLYAQAIENTAEGVVIL
FT                   DHQLMVQGCNPAAEMILATPRARLMGDRFHHYWYREQGPQLDAVTRGNASWQGEVLLRG
FT                   SAGETVPVWLNISPMGDNARHLVALFSDITERKRAELELRRLADFDPLTGLPNRSQFNT
FT                   RLHAAVQARGPGGRPMALMFLDLDRFKHINDTYGHSTGDGLLVQAAQRLKGLMGDSELL
FT                   CRFGGDEFIVLISEFRTRAELERLAQRVLSAIAEPFELDGQLFYVSTSVGIACFPDDAQ
FT                   QPETLIRHADLAMYHAKEEGRGRYSFYTPQRDAQATYQLELENALRQALEANQLELHYQ
FT                   PQVDLQTGQVTGVEALLRWFDEENGAVPPDTFITLAESSGIIVKLDRWALRQACQSFVR
FT                   WGLGDGIKLSVNVSASHFHQPDYVDFVSRVLTETGLPASQLCLEITEGVLMKRVSLAQS
FT                   HLHALRRLGVSVAVDDFGTGYSSLAYLSQFAVDSLKIDRSFVHDLPGNLTNGAITRSIL
FT                   DMGRNLGLQVVAEGVETEEQEAFLRHQGCARMQGFRYARPMNAEACCLWLQERAEQQEC
FT                   ESVS"
FT   sig_peptide     410348..410407
FT                   /locus_tag="Fbal_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(414738..415403)
FT                   /locus_tag="Fbal_0374"
FT   CDS_pept        complement(414738..415403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0374"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="COGs: COG0637 phosphatase/phosphohexomutase;
FT                   InterPro IPR005833: IPR005834: IPR006402; KEGG:
FT                   sdn:Sden_3378 2-deoxyglucose-6-phosphatase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR: A2UV34
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 3
FT                   with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74588"
FT                   /db_xref="GOA:E1SN89"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN89"
FT                   /protein_id="ADN74588.1"
FT                   /translation="MTHKIQAVIFDMDGVLVDSEPFWQQAELEILCDHGVPLTLEDTLK
FT                   TQGLRIDQVVGYWYQRHPWSGTSPELVADAILSRVVDLIAQQGEALSGVDSAISLIQQQ
FT                   GWALGLATSSPSRLVEATLSRLGLHSAFAVTCSAEHLRYGKPHPQVYLNAADELRVAPE
FT                   HAMAIEDSFNGLLAAKAARMTTLAVPDPHHRDDPRFVIADHRLDSLSQFTQSWLDTLN"
FT   gene            415546..416592
FT                   /locus_tag="Fbal_0375"
FT   CDS_pept        415546..416592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0375"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: vpa:VP0375 putative lipoprotein; SPTR: A3UKY5
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74589"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN90"
FT                   /protein_id="ADN74589.1"
FT                   /translation="MKQMKTLVAASLIGLLSACGGGDDNNSVNTGTFNLGVSDAPVEEA
FT                   SEVVLFFSHVVMVPEDGGDAIVFDFAEDEGAPRSVDLLDFQGSNADFIISERELPVGDY
FT                   RMCMYALNGDGSEELSYVNSKEQGIVPLSIDSQGSCYGTKPDFEDGGRLKLTDERLVSI
FT                   NVGINSFVAEFDLRKGLVDPKNAPGMKIKPNAVRLVNVSEIGTISGTLAQTQFDACEAD
FT                   FSSLLGASEFSHAAYLYAGSRDRTTMGDIAGDQGFPADSALVEPVAVASINPVEVAQED
FT                   GTTATELQYEFGFIGEGTYSIGYTCVANADLPDTHETDAEGFAIYQHYTPVEVEANEET
FT                   VQDLDPIL"
FT   sig_peptide     415546..415611
FT                   /locus_tag="Fbal_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            416872..419466
FT                   /locus_tag="Fbal_0376"
FT   CDS_pept        416872..419466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0376"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="COGs: COG1049 Aconitase B; InterPro IPR015929:
FT                   IPR001030: IPR018136: IPR004406; KEGG: vpa:VP2495
FT                   bifunctional aconitate hydratase 2/2-methylisocitrate
FT                   dehydratase; PFAM: Aconitase B, N-terminal; aconitate
FT                   hydratase domain protein; SPTR: A3H377 Aconitate hydratase
FT                   2; TIGRFAM: aconitate hydratase 2; PFAM: Aconitate B
FT                   N-terminal domain; Aconitase family (aconitate hydratase);
FT                   Aconitate hydratase 2 N-terminus; TIGRFAM: aconitate
FT                   hydratase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74590"
FT                   /db_xref="GOA:E1SN91"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN91"
FT                   /protein_id="ADN74590.1"
FT                   /translation="MLEAYREHVAERAAQGVVPKPLDAQQTSELVELLKNPPAGEEDTL
FT                   IDLLENRIPPGVDEAAYVKASFLAAVTTGEVSSPLVSAERATELLGTMQGGYNIEPLIK
FT                   LLGHDGLAPLAAKALSHTLLMFDAFHDVVDLANGGNAYAKQVLQSWADAEWFTSRPKLA
FT                   EAITLTVFKVPGETNTDDLSPAPDAWSRPDIPLHALAMLKSAREGITPDEPGVVGPIST
FT                   IDQLKEKGHPLVYVGDVVGTGSSRKSATNSVLWFMGDDLPGVPNKRGGGFCFGGKIAPI
FT                   FFNTMEDAGALPIEMPVDKMAMGDVITVYPYEGVVKNEAGEVISEFALKTDVLLDEVRA
FT                   GGRIPLIIGRGLTDKAREALGLGHSDVFRRPQDVADSGKGYTLAQKMVGKACGVTGVRP
FT                   GQYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSADLTMQSFCHTAAYPKPVDVNTHAT
FT                   LPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPLGISFPAGSGLVAFA
FT                   AATGVMPLDMPESVLVRFKGEMQPGITLRDLVHAIPYYAIQQGLLTVEKQGKKNVFSGR
FT                   VLEIEGLENLTVEQAFELSDASAERSAAGCTIKLSEDSIAEYLQSNIVMLKWMIAEGYG
FT                   DRRTIERRINAMEAWLANPELMEADADAEYTEVIEIDLAEIKEPILCAPNDPDDARLLS
FT                   DVQGDKIDEVFIGSCMTNIGHFRAAGKLLDKFKGALPTRLWVAPPTKMDQQQLIDEGYY
FT                   GIYGRVGARTEMPGCSLCMGNQARVADGASVVSTSTRNFPNRLGTGANVYLASAELAAV
FT                   ASILGKLPTVAEYLEYAKTIDAQAADTYRYLNFHQMEQYTKPAGEVIVQQPA"
FT   gene            complement(419572..420048)
FT                   /locus_tag="Fbal_0377"
FT   CDS_pept        complement(419572..420048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0377"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="COGs: COG3160 Regulator of sigma D; InterPro
FT                   IPR007448; KEGG: sse:Ssed_0439 anti-RNA polymerase sigma 70
FT                   factor; PFAM: regulator of RNA polymerase sigma(70) subunit
FT                   Rsd/AlgQ; SPTR: A2UV32 Regulator of RpoD, Rsd/AlgQ; PFAM:
FT                   Regulator of RNA polymerase sigma(70) subunit, Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74591"
FT                   /db_xref="GOA:E1SN92"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN92"
FT                   /protein_id="ADN74591.1"
FT                   /translation="MLTKLERAVDAWGGSNTLIDNWLESRRQLLIHYCQLAGLPPYEGE
FT                   KGHLPDETRVQQFCNLLVDYMSEGHFEVYDQVSTACEQSGEHAKALAQSLVPKISASTD
FT                   AALDFNDKYTNGVNDDIMMELDQDLSELGQKMEERFELEDRLLEALFERHSEAS"
FT   gene            420434..421498
FT                   /locus_tag="Fbal_0378"
FT   CDS_pept        420434..421498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0378"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="COGs: COG0407 Uroporphyrinogen-III decarboxylase;
FT                   InterPro IPR000257: IPR006361; KEGG: saz:Sama_0387
FT                   uroporphyrinogen decarboxylase; PFAM: Uroporphyrinogen
FT                   decarboxylase (URO-D); PRIAM: Uroporphyrinogen
FT                   decarboxylase; SPTR: A1S2J2 Uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D); TIGRFAM:
FT                   uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74592"
FT                   /db_xref="GOA:E1SN93"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN93"
FT                   /protein_id="ADN74592.1"
FT                   /translation="MSELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYRATRAEAGD
FT                   FMSLCKNPELACEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLYFETGEGPRFQTLAD
FT                   NKATIENLPIPDPEQELGYVMDAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKD
FT                   FAKIKKMAFAEPATLHLLLDKLADSVILYLNAQIKAGAQAVQIFDTWGGALSGPAYREF
FT                   SLRYMHKIVDGLIRDYDGHKVPVVLFTKGGGQWLEDIAATGCDAVGLDWTVDVKAARAR
FT                   VGDKVALQGNMDPSMLYAPVPRIEEEVERILGEFGHGDGHVFNLGHGIHQHADPEHAGA
FT                   FINAVHELSRKYHK"
FT   gene            421619..422710
FT                   /locus_tag="Fbal_0379"
FT   CDS_pept        421619..422710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0379"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002139: IPR013196: IPR011611: IPR002173; KEGG:
FT                   slo:Shew_2725 ribokinase-like domain-containing protein;
FT                   PFAM: PfkB domain protein; Helix-turn-helix type 11 domain
FT                   protein; SPTR: P33020 Uncharacterized sugar kinase yeiI;
FT                   PFAM: HTH domain; pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74593"
FT                   /db_xref="GOA:E1SN94"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN94"
FT                   /protein_id="ADN74593.1"
FT                   /translation="MTEREQQILDLIRQDPLIPQQELADKLGISRSAIAGHIMHLTQKG
FT                   HIQGKGYILAPERYALVIGGANMDLCGVADRPLVDGDSTPGSLTASAGGVGRNIADNLA
FT                   RLGSRVEFVSALGDDRWAEQLIESCRLAGVGTEHCLKIAGATTSSYLSLHDSDGEMRLA
FT                   LNDMSLIERLDAEQMERRRGPIDRASVVVLDANLSEDALETLFARPLDAPVLVDPVSRA
FT                   KAHKLKPFLAQIDTLKPNALEAELLSGHRLDSDEDLPRVADALHQLGVKRVLLSLGSRG
FT                   AYASDAGQGVRYLPSATDVVNVTGAGDALMAGLAHGRLAGWSFTETVPFALAAARLALA
FT                   TKTTINSTMSEAAVRRLMEKTPC"
FT   gene            422704..423621
FT                   /locus_tag="Fbal_0380"
FT   CDS_pept        422704..423621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0380"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="COGs: COG2313 Uncharacterized protein involved in
FT                   pigment biosynthesis; InterPro IPR007342; KEGG:
FT                   sse:Ssed_1352 indigoidine synthase A family protein; PFAM:
FT                   Indigoidine synthase A family protein; SPTR: P33025 UPF0724
FT                   protein yeiN; PFAM: Indigoidine synthase A like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74594"
FT                   /db_xref="GOA:E1SN95"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN95"
FT                   /protein_id="ADN74594.1"
FT                   /translation="MLEKYLDIHPEVAEAIANNRPVVALESTIISHGMPYPQNVETALK
FT                   VEQTVRDAGAIPATIAIIKGRLTVGLTEEQVEFLGKEGLSVTKASRRDIPFIVAAGKTG
FT                   ATTVASTMILAAMAGIKVFATGGIGGVHRGAQQTFDISADLQELANTDVAVVCAGAKSI
FT                   LDLGLTREYLETFGVPVVGYQTDCLPAFYTRESDFSIDYRLDSSEAIATALNAKWGMGL
FT                   KGGVVIANPIPEQYAMPKADIDAAIAQALAEAEQQGVGGKESTPFLLARVCELTGGNSL
FT                   DSNIQLVLNNARLASGIARDLCAE"
FT   gene            complement(423675..424295)
FT                   /locus_tag="Fbal_0381"
FT   CDS_pept        complement(423675..424295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0381"
FT                   /product="uracil-DNA glycosylase superfamily protein"
FT                   /note="COGs: COG1573 Uracil-DNA glycosylase; KEGG:
FT                   bac:BamMC406_4405 uracil-DNA glycosylase superfamily
FT                   protein; SPTR: A2VYJ6 Uracil-DNA glycosylase; PFAM: Uracil
FT                   DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74595"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN96"
FT                   /protein_id="ADN74595.1"
FT                   /translation="MTVCPTSASAAQIPISDDSTRELIHTVHACRLCQDVLDPNPVVQL
FT                   ASSARLLIIGQAPGLKVHQSGIPWNDASGDRLRHWLGMDRDTFYDPSRVAIIPMGLCYP
FT                   GRGRSGDNPPDKRCAPRWHPTLLAQLPALELTLYIGQYAQKHYLEGFTSLTDTVARWAE
FT                   FGPDRFPLPHPSPRNTLWLKRHPWFDDDVVPALRQRVQGLMAG"
FT   sig_peptide     complement(424209..424295)
FT                   /locus_tag="Fbal_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            424389..426956
FT                   /locus_tag="Fbal_0382"
FT   CDS_pept        424389..426956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0382"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR001633:
FT                   IPR000160: IPR013767: IPR013656: IPR 000700: IPR000014;
FT                   KEGG: son:SO_0437 sensory box protein; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein; SPTR: A2UV29
FT                   Diguanylate cyclase/phosphodiesterase with PAS/PAC
FT                   sensor(S); TIGRFAM: diguanylate cyclase; PAS sensor
FT                   protein; PFAM: EAL domain; GGDEF domain; PAS fold; TIGRFAM:
FT                   PAS domain S-box; diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74596"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN97"
FT                   /protein_id="ADN74596.1"
FT                   /translation="MKLSRRLLLLLFCLAIPLILTATGAAYWMIRDGFVGYEQRTYAAE
FT                   RAHLQMDVEHWLTQNRKSMTAIRTALESERPEALDFLVAQARQRGLISLVMNHHGELHV
FT                   LQNPALPVDGNSEAMRALLDPILSTGTFQYERSGFARLGHQVFGLVAQPLNHRNWRGLI
FT                   GIQAFDQTLLDTLSYRHHRIHTATLVDAPEGSPLALPHFAGTALTLEPQFDLTERQIRT
FT                   EQIHRVMAILALVLVLLALASFFTFRRILLGPIGSLKQRIEQGLTQRKTSRPLPESGQD
FT                   ELSEISQLCNELFSQRLHQRQQISTLLRTVSDAVVLVDPQARIELVNPEAEKLLAVEHG
FT                   PVRQCALVNLVAGPAGQELHAALKELLSSGRISLEGRVSLQQGGQKRQLEYHAARTLDH
FT                   EGHTLGAVLVLRDITHSEQMKRELMHKSQRDQTTGIYNRHTFEQRLEALADLPGQHAIC
FT                   YMDLNRFKLINDSCGHEAGDRMLRDVAQEMVRSIRPGDLLARIGGDEFGLIMKDTSALE
FT                   TARVLKQLMERVEGITLYWDSGSYRVGISIGVAFQRADEQRPREVFKDAEIACHANKGK
FT                   GGESQIHFFDSLDQDLAHQRNAPQWAMKINEAIVNDDLVLFYQPIEPVQASSPRRKCEV
FT                   LLRIREEGGRILAPGQFIAAAERFNLMPAVDKAVIRKSFEWLARNSHLWNTQVLSINLS
FT                   GTTLSNGNLVSYIDEMCALYRVPPETICFEVTETAAIANENRALEILHALRRRGFAFAL
FT                   DDFGSGFASYGYLRQLPVDYVKIDGCFVRNLANNAKDYAIVKSIHDVCRVMGIETVAEF
FT                   VEDQETLSRLRAIGVNYAQGYGIGRPKDLETYQPVPQEDGVKA"
FT   sig_peptide     424389..424460
FT                   /locus_tag="Fbal_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            427019..427804
FT                   /locus_tag="Fbal_0383"
FT   CDS_pept        427019..427804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0383"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR002347: IPR002198:
FT                   IPR013968; KEGG: sbm:Shew185_3918 short chain
FT                   dehydrogenase; PFAM: short-chain dehydrogenase/reductase
FT                   SDR; KR domain protein; SPTR: A2UV28 Short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74597"
FT                   /db_xref="GOA:E1SN98"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN98"
FT                   /protein_id="ADN74597.1"
FT                   /translation="MDGEVVLLTGASEGIGRALAHQLSARGARLMLVARNRERLDSLVA
FT                   ELPSPAFAYPLDLTELDQLPKLVEAALAQFGRLDRLILNAGITMWSTVEALTDLSVLER
FT                   VMRVNYLATAHLAHAALPALKQSRGHIAVVSSLTGLTGVPTRSGYCASKHAVMGFFDAL
FT                   RIELRGSGVDVTVLCPDFVVTQTHKRAMGADGQPLGQTPMQESKIMTAEQCARAMVRAI
FT                   EKRQRLWLGSFRGRLGRWLKLLAPGLIDGIAARAIARRH"
FT   gene            complement(427740..428648)
FT                   /locus_tag="Fbal_0384"
FT   CDS_pept        complement(427740..428648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0384"
FT                   /product="Patatin"
FT                   /note="COGs: COG4667 esterase of the alpha-beta hydrolase
FT                   superfamily; InterPro IPR002641; KEGG: vpa:VPA1288
FT                   hypothetical protein; PFAM: Patatin; SPTR: A0XXZ8 Putative
FT                   ratatin-like phospholipase or esterase of the alpha-beta
FT                   hydrolase superfamily protein; PFAM: Patatin-like
FT                   phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74598"
FT                   /db_xref="GOA:E1SN99"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN99"
FT                   /protein_id="ADN74598.1"
FT                   /translation="MDQVGPSALIVEGGAMRGVFSCGVLDTFLARDFSPFDSFWGVSAG
FT                   ASNLAAYLAKMPGRNRKIYTDYSCRRAFLTPGRFLRGGDLMDLDWMWTITLAELGIDKA
FT                   VLAADPRPFFLAVTRQDSGQAEYHTPDVEQLAETMKASSALPVLYRKGVRLGQHTYVDG
FT                   GVADALPVAEAIRRGARQIMVLRSRPASYRKSASGLPALQRWLLRDTPHLVEPMLSRAE
FT                   RYNRTLDLIRQPPEGVNIVEICPPESFRLKRLTRDAEPLERGYELGRIAGEAAMARWQP
FT                   FSGDGQSPAPQCHRSNPAPAV"
FT   gene            428867..431227
FT                   /locus_tag="Fbal_0385"
FT   CDS_pept        428867..431227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0385"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR007197: IPR013704: IPR006638: IPR005839; KEGG:
FT                   aha:AHA_1290 radical SAM domain-containing protein; PFAM:
FT                   Radical SAM domain protein; Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: Q83SW5 UPF0313
FT                   protein ygiQ; PFAM: Domain of unknown function (DUF3362);
FT                   Radical SAM superfamily; Radical SAM N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74599"
FT                   /db_xref="GOA:E1SNA0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA0"
FT                   /protein_id="ADN74599.1"
FT                   /translation="MIPTPKTKLFDYPKFWAECLGPAPFLPTTRAEMDLLGWDSCDIIM
FT                   VTGDAYVDHPSFGMAVIGRMLESQGFRVGIIDQPDWQSKAPFMALGKPNLFFGVTAGNM
FT                   DSMINHYTADRRLRHDDAYTPDNVHGKRPDRATVVYTQRCKEAYKDVPVILGGIEASLR
FT                   RIAHYDYWSDKVRRSVLFDAKADMLIFGNAERPLVEVAHRLSQGDDIKSMRDIRGTAFL
FT                   VREALPGWNGVDSRTLDTPGKIDPIPNPYGADDMGCELGSKFEDAPVQQQAQPITLQPA
FT                   GAGRKLKPWEQQYILLPDYEQVRADKVLYAHTSRLFHLETNPGCARALMQRHGDRYVWI
FT                   NPPAIPLETDEMDGVFALPYARVPHPKYDGKKIPAYDMIKTSINIMRGCFGGCSFCSIT
FT                   EHEGRIIQSRSQESILDEIEQIKEKVPGFTGVISDLGGPTANMYKLRCKSPKAEATCRR
FT                   LSCIYPDICGHMDTDHTPTIELYRAAREIPGIKRIFVASGVRYDLAVEDPRYVKELVQH
FT                   HVGGYLKIAPEHTEEGPLSIMMKPGMGSYYRFKEMFDRFSKEAGKEQYLIPYFISAHPG
FT                   ASDEDMVNLAMWLKRNKFRLDQVQNFYPSPLANATTVWHTGKNSLRKVTHDSEDVPVAK
FT                   GGRQRRLHKALLRYHDTDNWPIIREGLLNIGMGHLIGSGPDCLVPAEGRRPAHRGGRTQ
FT                   PALTKHSGQGQFQSRSLPGKSKPAAKGKGSGNGKGNNASGQGKPAGKGQGSGRGGKPQQ
FT                   GQANGRGGKPQQGQQAGRGGKPQSGQRKGPKRK"
FT   gene            complement(431282..431674)
FT                   /locus_tag="Fbal_0386"
FT   CDS_pept        complement(431282..431674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0386"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="COGs: COG2030 Acyl dehydratase; InterPro IPR003965:
FT                   IPR002539; KEGG: spl:Spea_1753 dehydratase; PFAM: MaoC
FT                   domain protein dehydratase; SPTR: A9UWL2 Predicted protein;
FT                   PFAM: MaoC like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74600"
FT                   /db_xref="GOA:E1SNA1"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA1"
FT                   /protein_id="ADN74600.1"
FT                   /translation="MTLQPGQSAEIQKVFGPAEVAAFAELSEDRNPIHLDAEFAAQTPF
FT                   GHPIVHGILLSSLLSGLLGQHLPGQGTIYLGQTLKFVRPVLVGEAVTARVTVAQVRDDK
FT                   PIVTLTTEVVNAKGEPCVQGEAVVKV"
FT   gene            complement(431671..433437)
FT                   /locus_tag="Fbal_0387"
FT   CDS_pept        complement(431671..433437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0387"
FT                   /product="poly(R)-hydroxyalkanoic acid synthase, class I"
FT                   /note="COGs: COG3243 Poly(3-hydroxyalkanoate) synthetase;
FT                   InterPro IPR000073: IPR010941: IPR010963; KEGG:
FT                   asa:ASA_2280 poly(3-hydroxyalkanoate) polymerase; PFAM:
FT                   Poly-beta-hydroxybutyrate polymerase domain protein;
FT                   alpha/beta hydrolase fold; SPTR: A1EI07 Polyhydroxyalkanoic
FT                   acid synthase; TIGRFAM: poly(R)-hydroxyalkanoic acid
FT                   synthase, class I; PFAM: Poly-beta-hydroxybutyrate
FT                   polymerase (PhaC) N-terminus; alpha/beta hydrolase fold;
FT                   TIGRFAM: poly(R)-hydroxyalkanoic acid synthase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74601"
FT                   /db_xref="GOA:E1SNA2"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA2"
FT                   /protein_id="ADN74601.1"
FT                   /translation="MNQGSYQRLMESLIRCNEQLFELASKQSQPTTQALLQMQMQDLSN
FT                   ALNKGMEDPAALLTQQANWWQSQLQLFQNAMLKQAGQEVAPMVEPERGDRRFRDSQWQE
FT                   HPWYDYIKQSYLLTARQMLEQVDRIPDLTDAERDRLRFFTRQMVNALAPSNFLASNPEL
FT                   LKLTLESGGHNLLDGLKLLTEDIERSAGTLNVRMTDESAYQLGRDLATTAGEVIHQAPL
FT                   FELIQYRPSTDTVAKRPLLIVPPFVNKYYILDLRPENSLVKYLVDQGHTVLMISWANPD
FT                   QRHTQVDFEDYVVDGVLAALDAVEAATGEREVNAVGYCIGGTLLATAMAYMAGRRMKQR
FT                   VKSATFFTTILDFSQPGELGAFINDEIVTAMETQNAENGLMDGRQLAVTFSLLRENNLY
FT                   WNYYIDGYLKGQSPMAFDLLHWNCDSTNVAGPTHSTMLRQLYLENRLIQPGEFTVRGSK
FT                   IDLGKITVPTYFVSTMDDHIALWQGTYQGMQCLAGEPTFVLGESGHIAGIINPPGGKYG
FT                   HYTGPLADAAEDWLEQASHQEGSWWTHWQGWLSERQGAEPVPARNINKGIAPAPGDYVQ
FT                   VRLNPTAKGDAA"
FT   gene            433720..434067
FT                   /locus_tag="Fbal_0388"
FT   CDS_pept        433720..434067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0388"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="COGs: COG0640 transcriptional regulator protein;
FT                   InterPro IPR001845; KEGG: psa:PST_2096 arsenic resistance
FT                   transcriptional regulator; PFAM: regulatory protein ArsR;
FT                   SMART: regulatory protein ArsR; SPTR: A3L8V2 ArsR protein;
FT                   PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74602"
FT                   /db_xref="GOA:E1SNA3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA3"
FT                   /protein_id="ADN74602.1"
FT                   /translation="MSQSVAQLKSLSDETRLKILLLIRQETELCVCELTCALDESQPKV
FT                   SRHLARLRADGLLEDRRSGQWVYYRLAALPDWIVGALEGIAGSDVELIDACAERLANMG
FT                   DRPQRQQICCA"
FT   gene            434077..435144
FT                   /locus_tag="Fbal_0389"
FT   CDS_pept        434077..435144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0389"
FT                   /product="arsenical-resistance protein"
FT                   /note="COGs: COG0798 Arsenite efflux pump ACR3 and related
FT                   permease; InterPro IPR002657: IPR004706; KEGG: sde:Sde_3779
FT                   arsenical pump membrane protein, putative; PFAM: Bile
FT                   acid:sodium symporter; SPTR: A3WN53 Arsenical pump membrane
FT                   protein, putative; TIGRFAM: arsenical-resistance protein;
FT                   PFAM: Sodium Bile acid symporter family; TIGRFAM:
FT                   arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74603"
FT                   /db_xref="GOA:E1SNA4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA4"
FT                   /protein_id="ADN74603.1"
FT                   /translation="MGNFERYLSVWVGLAIVAGVALGHAFPVVFETLAQWQMFQINGVI
FT                   AVLIWVMIYPMMIQVDFHSVRKVGQQPQGLWLTLVVNWLIKPFSMAAIGWLFFRVFFVD
FT                   LVSPEDASQYIAGMILLGVAPCTAMVFVWSQLTRGNPAYTLVQVSVNDLIMVVAFAPIA
FT                   ALLLGVSEILVPWETLLLATLLYVALPLVAGILTRHLLMKRGEAALNGFVQRLKPASMV
FT                   GLLATVAILFGIQAPTLLAKPMVIGLIAIPLLLQTYGIFAIAYGSARVMKLPHNVAAPA
FT                   AMIGTSNFFELAVAVAIALFGLHSGAALATVVGVLVEVPVMLSLVAFANRTRHWFPASA
FT                   DAPDTLNANAQRDAA"
FT   sig_peptide     434077..434145
FT                   /locus_tag="Fbal_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            435141..436148
FT                   /locus_tag="Fbal_0390"
FT   CDS_pept        435141..436148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0390"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.13"
FT                   /EC_number="1.2.1.12"
FT                   /note="COGs: COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase; InterPro
FT                   IPR000173: IPR006424; KEGG: shw:Sputw3181_2923
FT                   glyceraldehyde-3-phosphate dehydrogenase; PFAM:
FT                   glyceraldehyde 3-phosphate dehydrogenase; PRIAM:
FT                   Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating);
FT                   SPTR: A2UV92 Glyceraldehyde-3-phosphate dehydrogenase, type
FT                   I; TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase, type
FT                   I; PFAM: Glyceraldehyde 3-phosphate dehydrogenase,
FT                   C-terminal domain; Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NAD binding domain; TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74604"
FT                   /db_xref="GOA:E1SNA5"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA5"
FT                   /protein_id="ADN74604.1"
FT                   /translation="MTIKIGINGFGRMGRLALRSAWDWAEFEFVQINDPAGGAAALGHL
FT                   LEFDSVHGRWGKDVVVDDDALIIDGKRIAVSSNTELETTDWSGCDMVIEASGKFKRKEV
FT                   LQKYLDQGVKKVIVTAPVKQEGVLDAVYGVNHHWYDKAKHDIVTAASCTTNCLAPAVKV
FT                   IHEKLGIKHGSMTTIHSITNTQTILDAPHKDLRRARACGESLIPTTTGSATAITHIFPE
FT                   LKGRLNGHAIRVPLCNASITDCVFEVERATSADEVNGLLQEAAEGELKGILGYETRPLV
FT                   SIDYRTDPRSSVVDALSTMVVNDTQVKLYLWYDNEWGYANRTVELARYVAEQGW"
FT   gene            436152..437396
FT                   /locus_tag="Fbal_0391"
FT   CDS_pept        436152..437396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0391"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: ppr:PBPRA2207 putative
FT                   transporter; PFAM: major facilitator superfamily MFS_1;
FT                   SPTR: A3GYA5 Permease; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74605"
FT                   /db_xref="GOA:E1SNA6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA6"
FT                   /protein_id="ADN74605.1"
FT                   /translation="MVSALSGLSRDVKQYLLITFNYWNFTLTDGALRMLVVLHFHQLGY
FT                   SPLAIASLFLFYEIFGVVTNLVGGYLGARLGLNRTMNLGLAMQVVALAMLAVPSGMLSV
FT                   PYVMAAQALSGIAKDLNKMSAKSAIKMLVPKGEPGALYKWVAILTGSKNALKGFGFFLG
FT                   GVLLGWLGFQGAMVAMASVLVGVLILSLLWLGKDLGKAKNKPKFSEMFSKSRSINILSA
FT                   ARLFLFGARDVWFVIALPITLGSVFGWSHSAVGAFLATWVIGYGLVQGLAPRLTGTARG
FT                   QIPDGAAALKWALLLCAVTVAVATGVQLDWHPQFTLVFGLMVFGAAFAINSSLHSFLIV
FT                   HYAGEDGVSLDVGFYYMANAMGRLVGTVLSGWVFQMAGLAACLWISAAFLALTALISIG
FT                   LPRGADHEQGARHGI"
FT   gene            437386..437862
FT                   /locus_tag="Fbal_0392"
FT   CDS_pept        437386..437862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0392"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="COGs: COG2453 protein-tyrosine phosphatase; InterPro
FT                   IPR016130: IPR000387; KEGG: vcj:VCD_003270 protein tyrosine
FT                   phosphatase; SPTR: A2P602 Phosphatase, putative; PFAM: Dual
FT                   specificity phosphatase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74606"
FT                   /db_xref="GOA:E1SNA7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA7"
FT                   /protein_id="ADN74606.1"
FT                   /translation="MAFEPAFIDVNGLPMALHPAPGLEGRLKEDVALLAAAGVAAVVTT
FT                   LTEEELTRFGIPTLGQEVEAAGMQWVHLPVQDKSLPDAEFDAAWAEQREMLTALMESGK
FT                   RVSVHCRGGTGRTGLVAAKLLLDSGADWQETLDRVREARPGALEQDSQLGYLQR"
FT   gene            437968..438462
FT                   /locus_tag="Fbal_0393"
FT   CDS_pept        437968..438462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0393"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   swd:Swoo_1851 GCN5-related N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: A2UVD1 GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74607"
FT                   /db_xref="GOA:E1SNA8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA8"
FT                   /protein_id="ADN74607.1"
FT                   /translation="MSITIRRAEPSDAEALQATMSAEICFSNTLQLPWPSLTMWQQRLA
FT                   QLGPDQHLLVAENDAGDVVGNLMLAQASNPRRRHVAEIGMAVVPEWQGRGVGSALLQAA
FT                   INLGEQWLALTRLELDVYTDNEAALALYRRHGFEPEGIARAAAFRDGARVDVMRMARIR
FT                   D"
FT   gene            complement(438459..439130)
FT                   /locus_tag="Fbal_0394"
FT   CDS_pept        complement(438459..439130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0394"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="COGs: COG0546 phosphatase; InterPro IPR005834; KEGG:
FT                   pct:PC1_3478 haloacid dehalogenase domain protein
FT                   hydrolase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: A0YA55 Probable phosphoglycolate
FT                   phosphatase; PFAM: haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74608"
FT                   /db_xref="GOA:E1SNA9"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA9"
FT                   /protein_id="ADN74608.1"
FT                   /translation="MTHCAPESLPTQLLARLAGYRQVIWDWNGTLVNDAPLATDIVNAM
FT                   LSEHQLPATALDHYRDTFCHPVEAYYQRIGLTEKLSFDVICQRFGQDYRAARDRLNLHP
FT                   GARPLLHALSQTHTQSLLSASSQSSLEHCLDHHRISTCFHHVYGLDNHHAACKIDRGHE
FT                   LLKAAGVRASDTVMIGDTDHDHEVAEALGIDLILIADGHQSHASLSQLGAELYPGWDAL
FT                   R"
FT   gene            complement(439210..439620)
FT                   /locus_tag="Fbal_0395"
FT   CDS_pept        complement(439210..439620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0395"
FT                   /product="protein of unknown function DUF307"
FT                   /note="COGs: COG3304 membrane protein; InterPro IPR005185;
FT                   KEGG: dma:DMR_26390 hypothetical protein; PFAM: protein of
FT                   unknown function DUF307; SPTR: A2V407 Putative
FT                   uncharacterized protein; PFAM: Domain of unknown function
FT                   (DUF307)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74609"
FT                   /db_xref="GOA:E1SNB0"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB0"
FT                   /protein_id="ADN74609.1"
FT                   /translation="MDLLRFIGNVIWLIWGGIAMALGWALVGVILALTIIGLPWARSCF
FT                   VIAQLSLWPFGKDVANRRVVNREDDIGTGALGTIGNVIWFLVAGLWLALGHLFFAVTLF
FT                   CTIIGIPFGLQHVKLAMLTVAPIGYTLVDDPD"
FT   gene            complement(439705..439902)
FT                   /locus_tag="Fbal_0396"
FT   CDS_pept        complement(439705..439902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74610"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB1"
FT                   /protein_id="ADN74610.1"
FT                   /translation="MIVSAAHSAYHWVMPKALCPADHSQDLPKQAEAIAEKADPVEAAT
FT                   ELAVEVGKAAYLGRKLLAVV"
FT   gene            440012..442363
FT                   /locus_tag="Fbal_0397"
FT   CDS_pept        440012..442363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0397"
FT                   /product="helicase domain protein"
FT                   /note="COGs: COG1643 HrpA-like helicase; InterPro
FT                   IPR007502: IPR011545: IPR001650: IPR014001: IPR 014021:
FT                   IPR019825; KEGG: swd:Swoo_4927 helicase domain-containing
FT                   protein; PFAM: helicase domain protein; helicase-associated
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein; SPTR:
FT                   A3UVI8 Putative ATP-dependent helicase; PFAM: Helicase
FT                   conserved C-terminal domain; Helicase associated domain
FT                   (HA2); DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74611"
FT                   /db_xref="GOA:E1SNB2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB2"
FT                   /protein_id="ADN74611.1"
FT                   /translation="MSAIASLPIDPLQPQFLEHLRHHHLVVEADTGSGKSTRLPIWAAQ
FT                   LGRVLVVEPRRVACTALAEFLAAESGQPLGEQVGYAIRFDSNVMDTTEVAFVTPGIALR
FT                   WLTEDGLAGFHTVIIDEFHERRWDTDLLLALLQRRQQHRLVLTSATVDGVRLADYLGGE
FT                   RLYAEGRRFEVQIQHQARDSHSLPDDRGLVQRVADAVADQLAAREGDVLVFLPGRKEIS
FT                   QCEASLKAALGDRALVLPLHASVPRPLQRQALTAGPQRRVILATNVAETSLTIPGVTVV
FT                   IDSGLERRTRQRNGRTVLALTRISQASAAQRAGRAGRVAPGVCVRLWGQHAPLEALTPP
FT                   ELQREELVEPMLAAACAGAVLSDLRFVDPLPEKSLLLAQQRLRAMAAIDGLGGVTEHGR
FT                   RLFPLPIDTQFAHLITAMPDKPCMEAMVDLAAALSLGQRLWRLPASEAGRQALKAWQPQ
FT                   PCDGLTLVMLLRQSPPEALAIDPALHSEARQLAEQIRAALALPQLSASSHLPYRRWCEA
FT                   ILAAMPELAFVRRAKRRDALGNGVMEVQPGRESRFAEEAEAALVLDQHSLPGRGHKQTL
FT                   NLATCMMPLTLAQLVEAGLGEVRQGELNQGETGLLVTQERVYAGRVIEQRLAQPEGEQG
FT                   RQAMVQSILDGQLLAPAGAQLQADARAWALWLGLGLGEGEPIDPQAWLLQQLADLGVES
FT                   EQDLALIEPQDLHFEGIPEWQRAEFDERFPHFLVLAELKLHVEYQPRAKRVTVVYAEGS
FT                   RKSDPKRWELPSWAGWRVQYRRASRVVDVR"
FT   gene            442428..442853
FT                   /locus_tag="Fbal_0398"
FT   CDS_pept        442428..442853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_4874 hypothetical protein; SPTR:
FT                   A3LHR6 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function VcgC/VcgE (DUF2780)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74612"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB3"
FT                   /protein_id="ADN74612.1"
FT                   /translation="MRIWRILVLAAAMAMGAPAWGASLVDTLVSELGITEDQAIGGAGA
FT                   LMAYAKQDLGSEDWSQLAELVPEASTLAESADMGGVMGSLGNVLGDGAGMAQVLEQMSA
FT                   LGLDADTISQFAPVVMDYLKQQGGEDLIGTLTKLWSP"
FT   sig_peptide     442428..442490
FT                   /locus_tag="Fbal_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            442939..443151
FT                   /locus_tag="Fbal_0399"
FT   CDS_pept        442939..443151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74613"
FT                   /db_xref="GOA:E1SNB4"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB4"
FT                   /protein_id="ADN74613.1"
FT                   /translation="MNSVWITRLVAMVGAGLWCLLHFLNTRFTALKRQIPLTAKRQAPA
FT                   SNARSGGKRAVPWNIQAPAFASVNS"
FT   gene            complement(443163..443717)
FT                   /locus_tag="Fbal_0400"
FT   CDS_pept        complement(443163..443717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_0875 hypothetical protein; SPTR:
FT                   A2V4Z7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74614"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB5"
FT                   /protein_id="ADN74614.1"
FT                   /translation="MKRILRSLLLPLAVVASLGGCASPAGNIDYNSATDFSAINRYGFL
FT                   PVGDQTDPLVAQRLQAALTEQLDGRGWQQLEQVDAQVSGDTVAVRYHSWPETRSRDSGL
FT                   TIGVGGGRSSGNTSIGGSVAIPVGDSERMVQVVRIDMVQQGKVIWRGSDDYPISERDSP
FT                   QKRTERTDKLVAELLAQFPPR"
FT   sig_peptide     complement(443652..443717)
FT                   /locus_tag="Fbal_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            443831..444343
FT                   /locus_tag="Fbal_0401"
FT   CDS_pept        443831..444343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0401"
FT                   /product="pilin, putative"
FT                   /note="InterPro IPR000983: IPR012902: IPR001120; KEGG:
FT                   swp:swp_4067 pilin, putative; SPTR: A2UWB0 Prepilin-type
FT                   cleavage/methylation; PFAM: Prokaryotic N-terminal
FT                   methylation motif; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74615"
FT                   /db_xref="GOA:E1SNB6"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB6"
FT                   /protein_id="ADN74615.1"
FT                   /translation="MKRQGFTLVELVIVVVLLAILAAVALPRYLNLGDDAERSRFYATM
FT                   AALESAVDLSHLCWQLRAGEGAVADLDCGGFDEVDFNESGYPVGVLEGGLVSINNDHDC
FT                   LLVFDGIVDTDMKLWSPNDGRAPGVSRDEAQIQSDYVGNGRCRFTLLSDSNEQFEYHSN
FT                   TGQVLAQ"
FT   sig_peptide     443831..443905
FT                   /locus_tag="Fbal_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            444340..444573
FT                   /locus_tag="Fbal_0402"
FT   CDS_pept        444340..444573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0402"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="COGs: COG3313 Fe-S protein; InterPro IPR010710;
FT                   KEGG: swd:Swoo_3162 hypothetical protein; PFAM: protein of
FT                   unknown function DUF1289; SPTR: A3SXP0 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1289)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74616"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB7"
FT                   /protein_id="ADN74616.1"
FT                   /translation="MTRIESPCVACCKLDEQDVCQGCYRTLAEIANWNRRTEAEKADIL
FT                   ARLPARAEAYRREAEGPTHAITRQAVLAVKEH"
FT   gene            444675..444959
FT                   /locus_tag="Fbal_0403"
FT   CDS_pept        444675..444959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VVA0263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74617"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB8"
FT                   /protein_id="ADN74617.1"
FT                   /translation="MYIHVHRCRLALPNAVHGAFFVDPTGTLEVELAGKTEPLHANLAE
FT                   LSFWPEETGDCRLCCGQHWQLRLKPDDAQSLQGLISDAREELASLHRDL"
FT   gene            complement(444963..445208)
FT                   /locus_tag="Fbal_0404"
FT   CDS_pept        complement(444963..445208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asa:ASA_0854 hypothetical protein; SPTR:
FT                   A2UV47 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2960)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74618"
FT                   /db_xref="InterPro:IPR021343"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB9"
FT                   /protein_id="ADN74618.1"
FT                   /translation="MALKLQYTYKGHTKVVGYANDKHHSMFEAAAAAEGLDLKRYQMLE
FT                   QQVQMSTRDKKAHRDFRDNYFRDLGFSDIQVIRDEA"
FT   gene            445374..445529
FT                   /locus_tag="Fbal_0405"
FT   CDS_pept        445374..445529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74619"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC0"
FT                   /protein_id="ADN74619.1"
FT                   /translation="MQMVTILLLLLVAVAAVLFFLVPRKRKHQTVTPIPNHARKRRPRK
FT                   RQRAHS"
FT   sig_peptide     445374..445418
FT                   /locus_tag="Fbal_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            445636..446034
FT                   /locus_tag="Fbal_0406"
FT   CDS_pept        445636..446034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74620"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC1"
FT                   /protein_id="ADN74620.1"
FT                   /translation="MTLMDPLGLEPALVEHGCAQPGLYRAFVPLFIQYYGRMHRCLDVN
FT                   ESPGNAIRDFNAMALAFMDVVEDQHLPLERELLAEFGIDLSFDRRDPQRRAALTGTACY
FT                   QNCYDRLTATVMPVVQMQSLSYGARLGR"
FT   gene            446200..446652
FT                   /locus_tag="Fbal_0407"
FT   CDS_pept        446200..446652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74621"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC2"
FT                   /protein_id="ADN74621.1"
FT                   /translation="MGQTLERYLQYRDDLEGAGYFRWMEQLYRAGGWQSRDEMHAAASQ
FT                   MGDPDQVRHLNFYAVTGLLDEMVQLYRQYGEALAQRPGTDLTPASPPSTFVAQTLSAPA
FT                   DARLPIVQQWAQIVAVLTDNMVAEAQQQEYGEISPSVTESPLGSES"
FT   gene            446649..447263
FT                   /locus_tag="Fbal_0408"
FT   CDS_pept        446649..447263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3247 conserved hypothetical protein;
FT                   InterPro IPR005325; KEGG: mxa:MXAN_3732 hypothetical
FT                   protein; SPTR: A0NLE4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74622"
FT                   /db_xref="GOA:E1SNC3"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC3"
FT                   /protein_id="ADN74622.1"
FT                   /translation="MIKTTLDAALTLGRRSGIFLLILGILSVAMPWATGLALEMLLGIL
FT                   LLCAGVAQLFFAFRTRELSGFPLRLVFGLLTSFAGLYLLFNPTAGVVAITLILGIYFLI
FT                   DGLATLLASFQYRAQRNWLMMFANGAVTLALAAVILWQWPASGRYVIGILVGIKLIMMG
FT                   LMMITTAGMVSAAKDRMDAVRAQQRADGAKVVDGEDRTVDP"
FT   sig_peptide     446649..446747
FT                   /locus_tag="Fbal_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(447311..447685)
FT                   /locus_tag="Fbal_0409"
FT   CDS_pept        complement(447311..447685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0409"
FT                   /product="glutaredoxin"
FT                   /note="InterPro IPR002109: IPR011767; KEGG:
FT                   shw:Sputw3181_2537 glutaredoxin; PFAM: glutaredoxin; SPTR:
FT                   A2V312 Glutaredoxin; PFAM: Glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74623"
FT                   /db_xref="GOA:E1SNC4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC4"
FT                   /protein_id="ADN74623.1"
FT                   /translation="MFVIRWILGRIVLLVNALTAPKPAQRPAEQQAKLDQAMARYSLYQ
FT                   YDACPFCVKVRRALRRNNFNIELRDAKQEPHRSELEAGGGRLMVPCLRIEEAGEVRWMY
FT                   ESSDIIAYLEQQYGDQPQAA"
FT   gene            448143..449561
FT                   /locus_tag="Fbal_0410"
FT   CDS_pept        448143..449561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0410"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="COGs: COG2704 Anaerobic C4-dicarboxylate
FT                   transporter; InterPro IPR004668; KEGG: spl:Spea_0685
FT                   anaerobic C4-dicarboxylate transporter; PFAM: anaerobic
FT                   c4-dicarboxylate membrane transporter; SPTR: A3XS28
FT                   Anaerobic C4-dicarboxylate transporter; TIGRFAM: anaerobic
FT                   c4-dicarboxylate antiporter, Dcu family; PFAM: Anaerobic
FT                   c4-dicarboxylate membrane transporter; TIGRFAM: anaerobic
FT                   c4-dicarboxylate membrane transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74624"
FT                   /db_xref="GOA:E1SNC5"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC5"
FT                   /protein_id="ADN74624.1"
FT                   /translation="MFYVHMLLLFAVIFVGIRYGGIAFGLLGGLGVSILSFVFGVAPGN
FT                   PPIGVMLIILAVVAASATLEATGGLKLLVKYAEKLLRKHPSKVVFLGPLCTYSLTVLVG
FT                   TGHSVYPLLPVIYDVSIKRGIRPERPMAMATIASQMGITASPIAAAAAVVMATAATNQL
FT                   DITLGQVLLVTIPATLTGVLIAATWSLKRGKELNQDPEFLARCQDPQFKAQLIDESDAK
FT                   SDKPEHDGQKAKRGLTVFLLGIVTVIFVAMFGKTLGLLPDGVKTSTALQFLMLSVGAII
FT                   LLSTNIDPKKIVKTNVFVAGMSAVIIIFGIAWMSDTIISHNKPYIISLVEDVVKTHPWT
FT                   FAIAMYVASVFLKSQAAVLTIMLPLGFTLGIPGEVLIGVLPACYAYYFFPFYPSDLAAI
FT                   TFDRSGTTRIGKYILNHSFFIPGFIGVFSATCIGYALSVGLLPIWLWGIAIVGLALAVN
FT                   LYMNRLSSETLTLA"
FT   gene            449769..450305
FT                   /locus_tag="Fbal_0411"
FT   CDS_pept        449769..450305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmw:Mmwyl1_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74625"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC6"
FT                   /protein_id="ADN74625.1"
FT                   /translation="MRKGWMGLGLLLLTGCMSVPVATMVKMAGFDRQDFLALEPEALRL
FT                   KLTLDQNVPVQLAATRLELGAELDNGQQQLFAGSVRQEEYRQFEVDGGWFSREPEPRYQ
FT                   YLLALDEAGEAAIRDFQRVLTEDEVASASLNVRLDLDDQFDQPVQVTVEVKLSEQEGFF
FT                   TLLDEATFEPERYRD"
FT   sig_peptide     449769..449837
FT                   /locus_tag="Fbal_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(450350..451636)
FT                   /locus_tag="Fbal_0412"
FT   CDS_pept        complement(450350..451636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0412"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="COGs: COG0151 Phosphoribosylamine-glycine ligase;
FT                   InterPro IPR003806: IPR020560: IPR020562: IPR020561: IPR
FT                   011761: IPR020559: IPR000115; KEGG: ppr:PBPRA3420
FT                   phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain; protein of
FT                   unknown function DUF201; PRIAM:
FT                   Phosphoribosylamine--glycine ligase; SPTR: Q87KS8
FT                   Phosphoribosylamine--glycine ligase; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, N domain;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, C domain; TIGRFAM:
FT                   phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74626"
FT                   /db_xref="GOA:E1SNC7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC7"
FT                   /protein_id="ADN74626.1"
FT                   /translation="MMKVLVIGSGGREHALAWKVAQNPAVEQVFVAPGNAGTATEPKVE
FT                   NVAVSGNEALVAFARENGVGLTIVGPEAPLVEGVVDAFDAAGLTIFGPTAAAAQLEGSK
FT                   AFTKDFLARHAIPTAEYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLAEA
FT                   EAAVEDMLAGNAFGDAGHRVVIEEFLEGEEASFIVMVDGDNILPMATSQDHKRVGDGDT
FT                   GPNTGGMGAYSPAPVVTQAIHDRIMAEVIRPTVDGMKAEGHPYKGFLYAGLMIDADGTP
FT                   KVIEYNCRFGDPETQPIMLRMQSDLVELCLAACEGKLDQHTAEFDPRAAVGVVLASGGY
FT                   PASYEKGFAISGLRTEYAEGEKVFHAGTAEQDGAIVNTGGRVLCATALGHTVTEAQQRA
FT                   YALADQISWQGMFTRRDIAYRAIAREQQG"
FT   gene            complement(451657..451881)
FT                   /locus_tag="Fbal_0413"
FT   CDS_pept        complement(451657..451881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74627"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC8"
FT                   /protein_id="ADN74627.1"
FT                   /translation="MKSCECGCGEYTAGGKFRPGHDQKLRSRLEAKTGDLLGMRNLVES
FT                   AFAYSQGQMSESDFLSHVRSVFAQQHTPR"
FT   gene            complement(452050..453642)
FT                   /locus_tag="Fbal_0414"
FT   CDS_pept        complement(452050..453642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0414"
FT                   /product="IMP cyclohydrolase
FT                   ;phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="COGs: COG0138 AICAR transformylase/IMP
FT                   cyclohydrolase PurH (only IMP cyclohydrolase domain in
FT                   Aful); InterPro IPR011607: IPR013982: IPR002695; KEGG:
FT                   vfm:VFMJ11_2512 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein; PRIAM: IMP cyclohydrolase; SMART: AICARFT/IMPCHase
FT                   bienzyme formylation region; SPTR: B5FC70 Bifunctional
FT                   purine biosynthesis protein purH; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme; MGS-like domain; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74628"
FT                   /db_xref="GOA:E1SNC9"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC9"
FT                   /protein_id="ADN74628.1"
FT                   /translation="MNAPRPIRRALLSVSDKTGIVEFARALSERGVELLSTGGTARLLA
FT                   DSGLNVTEVSDYTCFPEMMDGRVKTLHPKVHGGILGRREQDDAVMDSHGIKPIDMVVVN
FT                   LYPFAQTVAKAGCTLEDAVENIDIGGPTMVRSAAKNHKDVAIVVNAHDYDRVITEMDAG
FT                   EGSLTFQTRFDLAIAAFEHTAAYDGMIANYFGTMVPSYGDNKEGDEESVFPRTFNQQFI
FT                   KKQDMRYGENSHQRAAFYVEKNVQEASVATAVQLQGKALSYNNIADTDAALECVKEFDV
FT                   PACVIVKHANPCGVALGDNILDAYDRAFKTDPTSAFGGIIAFNRELDGDTAKAIVDRQF
FT                   VEVIIAPSISADAKAIVADKKNVRLLACGQWESKTTEFDTKRVNGGLLVQDRDQGMVGL
FT                   DDIKVVSKRQPTAEQLQDLMFCWKVAKYVKSNAIVYAKDGMTVGVGAGQMSRVYSAKIA
FT                   GIKAADEGLTVPGSVMASDAFFPFRDGIDAAAEAGISCVIQPGGSMRDQEVIDAADEHG
FT                   MVMIFTNMRHFKH"
FT   gene            453991..454395
FT                   /locus_tag="Fbal_0415"
FT   CDS_pept        453991..454395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0415"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR000551: IPR015358: IPR011788; KEGG:
FT                   shl:Shal_0489 zinc-responsive transcriptional regulator;
FT                   PFAM: Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; SMART: regulatory protein MerR; SPTR: A2UV20
FT                   Transcriptional regulator, MerR family; TIGRFAM:
FT                   Zn(II)-responsive transcriptional regulator; PFAM: MerR,
FT                   DNA binding; MerR family regulatory protein; TIGRFAM:
FT                   Zn(II)-responsive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74629"
FT                   /db_xref="GOA:E1SND0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011788"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E1SND0"
FT                   /protein_id="ADN74629.1"
FT                   /translation="MYRIGELAQRYEIKTDTLRYYEKHGLLSPSGRSDSGYRLYNDDDE
FT                   LKLRFILRAKAVGFSLAQIHELLVIEASRAKWACQDVKSIVEKKVVELEQKIAELNQFR
FT                   DSLQQLADACCGGPESAEHCSILDALEVRQ"
FT   gene            454392..455714
FT                   /locus_tag="Fbal_0416"
FT   CDS_pept        454392..455714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0416"
FT                   /product="permease"
FT                   /note="COGs: COG0701 permease; InterPro IPR005524; KEGG:
FT                   shl:Shal_0490 permease; PFAM: permease; SPTR: A2UV19
FT                   Permease; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74630"
FT                   /db_xref="GOA:E1SND1"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:E1SND1"
FT                   /protein_id="ADN74630.1"
FT                   /translation="MNTLTELALNFLDLFLDSAPWLLLGLFMAGMIKMFVPMSWMQKQL
FT                   GGHGFKPTVKAAIFGAPLPLCSCGVIPAAVGLRRSGASKSATTAFLVATPETGVDSVSV
FT                   SYVLLGPFMAVVRPITAVVSAIVAGLLVGRDQHDAEAKAKPTPKFTPVAAGGSMMTAPT
FT                   MKGESASCCASKAAAPAVKAQSSCCSSKSEVKAESAGCCGSKSEVKAESTSCCSSKAEV
FT                   KAEVASCCASKPAKSEQGGCCSSKKEAPAPEGVVAKLVNGVNYAATDLVRDTTLWLLVG
FT                   LFFAALVNTFVPASFLSQWGDGILAMTVMVLVSIPMYICATASTPIAAGLLLAGVSPGA
FT                   VLVFMMAGPATNIATLGVVRNELGKRALWAYLTGVIGTAMLFGFAVDYAVAEFGFKVMP
FT                   LVGEEHRMLPHWLVYGSGVLLAILMVKAMWSKWMPARTSLA"
FT   gene            455804..456094
FT                   /locus_tag="Fbal_0417"
FT   CDS_pept        455804..456094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74631"
FT                   /db_xref="UniProtKB/TrEMBL:E1SND2"
FT                   /protein_id="ADN74631.1"
FT                   /translation="MKGIALLATLLAATPALAAESIVYRCGMGNVERIIAVHYPHGETL
FT                   PCEVHYSKPEGSQILWTAQNTEGYCEQRAENFVEKQRGWGWQCNKEVAKPE"
FT   sig_peptide     455804..455857
FT                   /locus_tag="Fbal_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(456149..457045)
FT                   /locus_tag="Fbal_0418"
FT   CDS_pept        complement(456149..457045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0418"
FT                   /product="protein of unknown function DUF340 membrane"
FT                   /note="COGs: COG2431 membrane protein; InterPro IPR005642;
FT                   KEGG: aha:AHA_1683 hypothetical protein; PFAM: protein of
FT                   unknown function DUF340 membrane; SPTR: A3GYM4 Membrane
FT                   protein; PFAM: Membrane protein of unknown function
FT                   (DUF340)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74632"
FT                   /db_xref="GOA:E1SNY3"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY3"
FT                   /protein_id="ADN74632.1"
FT                   /translation="MDTLVILSPLVVGYLIPLRHRPTLQLIDRALTAIIYLILGLMGVG
FT                   LGSMDNLAGEIGGILTLTLTLIGLTLVANIAALPLVDKRWPLSLGQQEGEVRTFAMVVE
FT                   SLQLAGVVLAGFMLGLLFPQPSAHIESGVNLILMLLLLLIGIQLRASGMSLRQILLNPR
FT                   GLAIAAAVLGTSLLAGAATAWLWQLPIHHGMALAAGTGWYSLSGALVSAKLGPAMGSVA
FT                   FLADLCRELIAIILIPLMMRRQPATAIGYGGATAMDFTLPIIQKSGGPQTVPIAIVSGF
FT                   VLSLAGPILIPFFLSLG"
FT   gene            457153..457509
FT                   /locus_tag="Fbal_0419"
FT   CDS_pept        457153..457509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0419"
FT                   /product="glutaredoxin"
FT                   /note="InterPro IPR002109: IPR000560: IPR017937; KEGG:
FT                   cja:CJA_1891 glutaredoxin NrdH-related protein; PFAM:
FT                   glutaredoxin; PFAM: Glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74633"
FT                   /db_xref="GOA:E1SNY4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY4"
FT                   /protein_id="ADN74633.1"
FT                   /translation="MGKKGAAALALVMLVALMGFSVYQLGAGNRLALSFNEAHDSEVVM
FT                   YSAAWCPACAATRDYLTARGQSFVELDMEKNPAAAQEFAQFGGHGIPLVLAKGEVIRGH
FT                   RPSELNRILAPLQP"
FT   sig_peptide     457153..457230
FT                   /locus_tag="Fbal_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(457522..457719)
FT                   /locus_tag="Fbal_0420"
FT   CDS_pept        complement(457522..457719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR014271; KEGG: shn:Shewana3_1157
FT                   hypothetical protein; SPTR: A2V061 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF2375);
FT                   TIGRFAM: conserved hypothetical protein TIGR02922"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74634"
FT                   /db_xref="InterPro:IPR014271"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY5"
FT                   /protein_id="ADN74634.1"
FT                   /translation="MELRDVTVLFFDSDESLVMKKAVVRGMATENGSRVQLPEHFREGK
FT                   VIVAVLNGDVEVLSLVGDRI"
FT   gene            457972..459306
FT                   /locus_tag="Fbal_0421"
FT   CDS_pept        457972..459306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0421"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG0513 Superfamily II DNA and RNA helicase;
FT                   InterPro IPR001650: IPR011545: IPR014001: IPR014021: IPR
FT                   000629: IPR014014; KEGG: son:SO_2838 DEAD-box ATP dependent
FT                   DNA helicase; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; SPTR: A2V2Y7 DEAD/DEAH box
FT                   helicase-like; PFAM: Helicase conserved C-terminal domain;
FT                   DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74635"
FT                   /db_xref="GOA:E1SNY6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY6"
FT                   /protein_id="ADN74635.1"
FT                   /translation="MQFSQLALDKRLLATVDHLGFAEATEIQQKAIPTAIAGKDLLASS
FT                   RTGSGKTLAFLLPAMQRLIRSKPLSKRDPRVLILAPTRELAKQVYGQLRLVVANTSYKS
FT                   LLILGGEDFNQQSKALARDPHFVVATPGRLADHLEHGHLYLHGLEMLILDEADRMLDLG
FT                   FADQLQAIHKAADHRKRQTLMFSATLDHAAVNQFGAQLLNNPTRIRIDSEAEIHSDIHH
FT                   RMLFSDHLDHKEAQLKALLEKQDFKQLILFTATRGDTDRLAVLLSEWGYSTLALSGELN
FT                   QTARSQIMQDFAAGKAKILITTDVASRGLDIPQVSHVVNFDLPKHPEEYVHRVGRTGRA
FT                   GAKGDAFSLVGPKDWPSFKKLEAFLQQPLAFEAIEGLEAKFKGLVEKPKRGPAKAKPTA
FT                   RSGKKTGPAKRAPAKVKRPVAGLRDIGDAPMMVKKKPVQPVDDES"
FT   gene            459350..460108
FT                   /locus_tag="Fbal_0422"
FT   CDS_pept        459350..460108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_2105 hypothetical protein; SPTR:
FT                   Q50658 Uncharacterized protein Rv2307c/MT2364"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74636"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY7"
FT                   /protein_id="ADN74636.1"
FT                   /translation="MAQLGRILLWLVLIYLLLCLAMTLSQRHLLYLPTPKAPASVPALR
FT                   LAGPEGDLVVHPVQPGRANAVFYFGGNAEAVYRSADSLARALPGCTLYLVNYPGYGGSA
FT                   GQPSEATLTAAALSAYDQLSSGHQQLAAIGRSLGSAVALSLAARRPLQRQALLTPFASL
FT                   EALAYEHYPWLPASLLLWDRYDLLALAPAVTSPSLVLLAQQDRVVPLAASSPLLSALKA
FT                   PTIVEVAGTHNRFDATASLAAFFHPICGAL"
FT   gene            460145..460954
FT                   /locus_tag="Fbal_0423"
FT   CDS_pept        460145..460954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_00312 hypothetical protein; SPTR:
FT                   A3JIL9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74637"
FT                   /db_xref="GOA:E1SNY8"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY8"
FT                   /protein_id="ADN74637.1"
FT                   /translation="MLVLAKILAAVIAVVGLAWLAERVGPRWAGVLSGFPLGTAIVLLF
FT                   YALEQGPGFAAQAAPYGLLGLAATTGFALTFTLSAARFGRRSLWPVLLALAALFGLASL
FT                   FQQLPPLGWWGALVALAAALLAVAITRRLPDPPFVAVRSGWGLVWARAALAAALVVAIT
FT                   ALANTVPPAWAGVMASFPITLFPLMLLLQLSYGTAPVQTLTRHYPYGAGSLIIYTLAVG
FT                   LGYPVLGIGLGTLAAFALAGVYLTGYWWLSQRGQRRLQATAQPVPDQ"
FT   gene            complement(460948..461499)
FT                   /locus_tag="Fbal_0424"
FT   CDS_pept        complement(460948..461499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0424"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: ppr:PBPRB0449 TetR family
FT                   transcriptional regulator; PFAM: regulatory protein TetR;
FT                   SPTR: A3XSU0 Putative uncharacterized protein; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74638"
FT                   /db_xref="GOA:E1SNY9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY9"
FT                   /protein_id="ADN74638.1"
FT                   /translation="MTVKTAKRGRPSQLNAERIVECARALLAEQGKIPSIRALSAALSV
FT                   DPMAIYHYFPNKAALLEAVCLALIEAIHRPAGPDWRTEIRALCLSYLTLLQAHPGLLDT
FT                   LLSMDGSGPAQVFIARYEQALQPLALPQPVLNDSRDLLVDYLHGYALAMQTSQGKLDLS
FT                   YLDGPLAFWTRALQREADAH"
FT   gene            461599..462147
FT                   /locus_tag="Fbal_0425"
FT   CDS_pept        461599..462147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0425"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="COGs: COG0262 Dihydrofolate reductase; InterPro
FT                   IPR002734; KEGG: ppr:PBPRB0448 putative dihydrofolate
FT                   reductase; PFAM: bifunctional deaminase-reductase domain
FT                   protein; SPTR: A3UPR3 Pyrimidine reductase; PFAM: RibD
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74639"
FT                   /db_xref="GOA:E1SNZ0"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ0"
FT                   /protein_id="ADN74639.1"
FT                   /translation="MSNVVYIATSLDGFIADRDGGLDWLHSVPNPQGDDLGFAAFLAGI
FT                   DALLMGRNTYQSILDFNLDLPSQWPYPKPVYVVGSSPITIPDALEGKVFALAPAEPAEM
FT                   MATLAQMGHRHLYLDGGNTIQRFMAQGLVDELIISQIPVVLGGGVPLFGALPTMQSYEL
FT                   VSSEVMLGAMVKSHYRRIR"
FT   gene            complement(462213..462872)
FT                   /locus_tag="Fbal_0426"
FT   CDS_pept        complement(462213..462872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0426"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="COGs: COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)protein; InterPro IPR006664:
FT                   IPR006665: IPR008816; KEGG: asa:ASA_4258 putative outer
FT                   membrane lipoprotein; PFAM: OmpA/MotB domain protein; 17
FT                   kDa surface antigen; SPTR: P37665 Inner membrane
FT                   lipoprotein yiaD; PFAM: Rickettsia 17 kDa surface antigen;
FT                   OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74640"
FT                   /db_xref="GOA:E1SNZ1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ1"
FT                   /protein_id="ADN74640.1"
FT                   /translation="MRTPMISALAAAALVLGGCASTDPYTGEQKTSNATSGALIGAVSG
FT                   ALIGAASSSKSDRGKGILIGAASGAAVGGGIGHYMDRQEAALREKLAGTGVSVKRDGDH
FT                   IQLVMPNSLTFDVGSDRLKMPAINALSGVAMVVSEFDETNLQITGHTDSTGGRDLNMRL
FT                   SRERAEAVASELLRQSISATRMSTYGAGPDRPIASNQSEAGRAENRRVEIVLTPRT"
FT   sig_peptide     complement(462807..462872)
FT                   /locus_tag="Fbal_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(463018..463359)
FT                   /locus_tag="Fbal_0427"
FT   CDS_pept        complement(463018..463359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0427"
FT                   /product="protein of unknown function DUF1260"
FT                   /note="InterPro IPR009671; KEGG: slo:Shew_2467 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1260; SPTR:
FT                   A2V2X8 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1260)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74641"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ2"
FT                   /protein_id="ADN74641.1"
FT                   /translation="MAFPNDANGELLSLMQQEGIDLTQPYMLDFYVVFGSEKQGQLTAE
FT                   AVTEAFPGAGVFLNLSEDTGQWELRLQQEMVPEYEAIGAIEARLAELAKPFKGKTDGWG
FT                   MLEPEDEEE"
FT   gene            complement(463370..463666)
FT                   /locus_tag="Fbal_0428"
FT   CDS_pept        complement(463370..463666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0428"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG2501 conserved hypothetical protein;
FT                   InterPro IPR002942; KEGG: saz:Sama_1264 RNA-binding S4;
FT                   PFAM: RNA-binding S4 domain protein; SPTR: A2V2X7
FT                   RNA-binding S4; PFAM: S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74642"
FT                   /db_xref="GOA:E1SNZ3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ3"
FT                   /protein_id="ADN74642.1"
FT                   /translation="MSTSVLELHPGDDFIELYKVLKIEGWVGSGSEAKMLIAEGEVLVN
FT                   HEVETRKRRKLVPGDNVIFGEEAVLIQASAKPAPQVDEASKPAKPKRRPSLKF"
FT   gene            complement(463768..467769)
FT                   /locus_tag="Fbal_0429"
FT   CDS_pept        complement(463768..467769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0429"
FT                   /product="Ricin B lectin"
FT                   /note="COGs: COG3240 Phospholipase/lecithinase/hemolysin;
FT                   InterPro IPR000772: IPR003367: IPR001087; KEGG:
FT                   saz:Sama_1102 ATPase; PFAM: Ricin B lectin; Thrombospondin
FT                   type 3 repeat; lipolytic protein G-D-S-L family; SMART:
FT                   Ricin B lectin; SPTR: A0YMB1 Putative uncharacterized
FT                   protein; PFAM: Ricin-type beta-trefoil lectin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74643"
FT                   /db_xref="GOA:E1SNZ4"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ4"
FT                   /protein_id="ADN74643.1"
FT                   /translation="MPYHATGRALPLPVILTSLWLVPLSHGISAPFNAQLQNQRTALCV
FT                   AVAQASGQSGANVVPTDCIALQPEQTLAFTPVATLADTYTLSFSHSGQCLDVSGGSDAN
FT                   GASLIQTPCDGRISQQFRAINEGSQWVIYTGTGSGDKVVDSHAYEADIIQWQDFGNDNQ
FT                   RWTLLNVSEGQDRDGDGVADDNDAFPDDPNEWADSDGDNLGDNSDPFPLDPDNDSDGDG
FT                   FGVNDDAFPDDPNEWLDSDGDGQGDNGDPFPLDASNDSDGDGVSGHIDNCPDDANADQS
FT                   DRDNDGLGDLCDPEPDGPVQPDAQFSAQLINQRTGQCIAVELGSSNAGANVAPATCIDQ
FT                   QPEQTLNFVAIAGLDDGYTLAFAHSGQCLDVAGGSPDNGATLIQTPCDDRASQRFRALD
FT                   EGSQWVLYTGTGDGSKVVDSHARESDIIQWKDLGKDNQRWRLQLVSQDPDRDGDGVPDT
FT                   LDPFPDDPDEWADSDGDGLGDNSDPFPSDPDNDIDGDGFGANDDAFPDDPNEWLDSDSD
FT                   GQGDNGDPFPLDPNNDRDGDGISGHIDNCPNDANADQSDRDNDGLGDVCDPEPDGPAEP
FT                   EADFSAQLRNQRTGLCVAVTGASQQAGANVAPDDCNAQNPEQALNFVSLDSNTGRYTLQ
FT                   FAHSGQCLDVAGGSPDNGATLVQSPCDGRASQQFRAIDEGTRWVIYTGTGDGTKVVDSH
FT                   ARESDIIQWKDLGKDNQRWLLERLSQGDDRDGDGIPDDQDRFPDDPGEWADSDDDGLGD
FT                   NSDPFPFDPDNDSDGDGFGANDDAFPDDGSEWVDSDGDGQGDNGDPFPLDANNDSDGDG
FT                   VSGHIDNCPNDANADQSDRDGDGLGDVCDSEPDGPAPPDSSWTAQLQNQRTGLCIAVTA
FT                   ASTSSGANVAPAGCIEQRSEQVLSFVPVTGLDNGFTLMFGHSGQCLDVAGGSDANGATL
FT                   VQTPCDGRASQRFIAIDEGTQWALYTGTGSGDKVVDSHAYESDIIQWQDFGNDNQRWLL
FT                   VYRSDDLDADNDGIPLGEDNCPLVANSDQVDSDNDGLGDPCDPYPFDPDNAPPLPASFS
FT                   SLQVMGNSYGERFESNGDIYATRLAEALGIAIDNVSRSGATTSQIINGRGGDPGQLLQL
FT                   LGDPAVADADALYVLWGGFNDVYYGDDSSPRSLSAAINDLATILDTLEQAGARYVMVPN
FT                   LLDVGLWPAVTGSDVAAHRLRSLTFNAQLQLMLQARQGSLRVVEFEVFDWADAIAANPS
FT                   DYGISELSVPCEDREPVSGSSDAPVADCRGYLFWDDFHLAAEVHQRIAERMQSLLALEA
FT                   APQSWVDSDVDGVPDHRDDFPSDDSEQYDSDGDGVGNNSDADPADPQLW"
FT   sig_peptide     complement(467668..467769)
FT                   /locus_tag="Fbal_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(467851..469347)
FT                   /locus_tag="Fbal_0430"
FT   CDS_pept        complement(467851..469347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0430"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterPro IPR013105: IPR019734: IPR013026; KEGG:
FT                   xoo:XOO4397 hypothetical protein; PFAM: Tetratricopeptide
FT                   TPR_2 repeat protein; SPTR: A3S0L3 Tetratricopeptide repeat
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74644"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ5"
FT                   /protein_id="ADN74644.1"
FT                   /translation="MNWQQGYNAVSVAHLVRTALEKEDLTTAIELCHELNQRAPDYGPG
FT                   WHLAAEIALLRDNPASALAMAKRSLACQADSAAELLVVECHCRLGQYREGRAAARVLGH
FT                   GLPPSLALKRAELLLALHCPDDAAAQYRYLLETEGANPTLLSALADVLSEMGQLREAEQ
FT                   VLDQAIQLAPQQDALWTQRAYLRKQSEANHHIETLQFAIARRDRPCPQLHFALAKEWAD
FT                   LRCEDAAWHNLHLGARQQQAQQPYDASRDLSRLRAIRAHWSAPASKAAETTAEGPQPLF
FT                   LIGLPDGAIDALADHLAQHPQVFHLGAHQRFLPELERQLARQARLRDRPLWSTQAKLAA
FT                   SAQLDPAALGQAYLASLPPEAEEARWVIDTSPQHDQHLGLLLRALPHARAIAPLAPLSH
FT                   SGAALYQADPRQTGPYRYDPIELARYLKGHRALMQHWQRCHPEQLLCLDLNQPAGVATE
FT                   ALWHHLGFAPPPPSKAWPFVRPWGDIDSALPELLGALGKD"
FT   gene            469516..470970
FT                   /locus_tag="Fbal_0431"
FT   CDS_pept        469516..470970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0431"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /EC_number="1.2.1.24"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590: IPR016160: IPR010102; KEGG:
FT                   swd:Swoo_3863 succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; PRIAM: Succinate-semialdehyde
FT                   dehydrogenase; SPTR: P25526 Succinate-semialdehyde
FT                   dehydrogenase [NADP+]; TIGRFAM: succinic semialdehyde
FT                   dehydrogenase; PFAM: Aldehyde dehydrogenase family;
FT                   TIGRFAM: succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74645"
FT                   /db_xref="GOA:E1SNZ6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ6"
FT                   /protein_id="ADN74645.1"
FT                   /translation="MKAISDSGLLRQCSFIDGQWLAGDDRFSVDNPANGVPLALVEGAG
FT                   AELAERAVEAADRAQKLWAKVPAAERSATLMAWHDLMLAHIDDLARLLTLEQGKPLAEA
FT                   KGEIAYGASYVKWYAEEAVRIYGDTLPGPSSDKRVLVIKQPVGVVGAITPWNFPNAMLV
FT                   RKAAPALAAGCAFVGKPAAETPLSALAVAELAQRAGLPDGLLNVVVGTDAPGIGRVLTQ
FT                   HPLIRKFSFTGSTATGKILLAQCAEGVKRTSMELGGNAPFIVFDDADLDAAVQGLMVAK
FT                   FRNAGQTCVCSNRIFVHRAVYDAFAAKVVEAVAQLTVGDGLDAATQIGPLVGPAAVAKV
FT                   AELVEQSLAQGAQAQVVGNAPVQGYFYPPTVLSGVSNAMAVARNEIFGPVLPLIPFEDE
FT                   QEVIAQANDSEFGLAAYFYSRDIGRVFRVSEALEYGMVAINDGILSNAAAPFGGIKASG
FT                   HGREGSKYGLDDYLDIKYLCLGGLDR"
FT   gene            471231..473390
FT                   /locus_tag="Fbal_0432"
FT   CDS_pept        471231..473390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0432"
FT                   /product="decaheme c-type cytochrome, OmcA/MtrC family"
FT                   /note="InterPro IPR011031: IPR020014; KEGG: saz:Sama_2228
FT                   decaheme cytochrome c; SPTR: A2V1M0 Decaheme cytochrome c;
FT                   TIGRFAM: decaheme c-type cytochrome, OmcA/MtrC family;
FT                   TIGRFAM: decaheme c-type cytochrome, OmcA/MtrC family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74646"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020014"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ7"
FT                   /protein_id="ADN74646.1"
FT                   /translation="MRTHHLHLLALALVSALALSACGDDGEDGAPGEVGPPGPPGDPGL
FT                   PAGSFTTTAENAADLSFVLLPENIQIAEEFGIQFDLMGKDIRGQDIPFVGLDQVAIYLS
FT                   HLTINDSDIGAPTAWASHSYLSSGASSMYCALGGGEVTVRGRTYKACTLVETEPGTYTG
FT                   TWEHADTPAPVLLEGDDLSLTHRLWLRGYNIVDSNGNGVEDKVLSERLDYIPETGEVLA
FT                   DSGRNLVDDSACQACHGGEEGGIIANIHAHHNYQSVGNCVNCHNPFWEASDEQVANGWN
FT                   EGNWDLTVLVHRLHAGSHIADSLSGDALEFMGHIHYPGELNNCLACHEGNTAFSDNIYR
FT                   DACVACHINTDPRTGENHRGIVVADDASCDSCHGSGALGVMQAHEIGIRSLLKDAFYAE
FT                   VDPATITVAPDGTDPTLTTISFGFKAYLDGAEFTGDLATLDFISSAQKWLVNFQADSGY
FT                   ALAYQAYGTGTAPFREAAFNGTHYLTSTTAPTSIVTGTGVIISDVRLCADNGALTTCGA
FT                   EIDDTISLAMNNDAVYFDTANPANPDVVKSRYATDEGGVVSIAKCNDCHGDIAYGKRGH
FT                   HGVDRIEQCVHCHNENVIFFKGSSRDLGLNTHKFHAGHSEYFGEGESIGYPNMLGDCQA
FT                   CHVSDQWFDGGGALMSGKTGFRVSLDIDNVDRVSPVAATCLACHESEAVAAHAVAQGSI
FT                   VDPANAIPNPPIESCAVCHADVHSF"
FT   sig_peptide     471231..471299
FT                   /locus_tag="Fbal_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(473509..474225)
FT                   /locus_tag="Fbal_0433"
FT   CDS_pept        complement(473509..474225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0433"
FT                   /product="protein of unknown function DUF28"
FT                   /note="COGs: COG0217 conserved hypothetical protein;
FT                   InterPro IPR002876; KEGG: sbn:Sbal195_1323 hypothetical
FT                   protein; PFAM: protein of unknown function DUF28; SPTR:
FT                   Q15YF9 UPF0082 protein Patl_0550; PFAM: Domain of unknown
FT                   function DUF28; TIGRFAM: conserved hypothetical protein
FT                   TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74647"
FT                   /db_xref="GOA:E1SNZ8"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ8"
FT                   /protein_id="ADN74647.1"
FT                   /translation="MGRSFEVRKASMAKTAGQKTKVYSKYSKEIYVVAKNGSPDPDANL
FT                   ALRGLIERAKKDQVPGHVIDKAIDKAKGGAGEDYVPARYEGFGPGNCMVIVDCLTDNNN
FT                   RTFTDVRQCFVKTNAKIGSPGVVSHMFDHQAIFSFAGDDEDGVLEALMMADVDVTDVEV
FT                   EDGMTTVFAPNTEYFKAKTALQEAFPGIEFEMEEITFVPQTYTKIEGDDVAMFEKFLGM
FT                   LEDCDDVQNVYHNAEL"
FT   gene            474446..474988
FT                   /locus_tag="Fbal_0434"
FT   CDS_pept        474446..474988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0434"
FT                   /product="protein of unknown function DUF442"
FT                   /note="InterPro IPR005939; KEGG: spc:Sputcn32_0073
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF442; SPTR: A2UY06 Putative uncharacterized protein;
FT                   PFAM: Putative phosphatase (DUF442); TIGRFAM: conserved
FT                   hypothetical protein TIGR01244"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74648"
FT                   /db_xref="GOA:E1SNZ9"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ9"
FT                   /protein_id="ADN74648.1"
FT                   /translation="MRWFSFAAALTLMPMAHAALPDMTPVQDIRAFQTVSPSLLTAGLP
FT                   MPADFARLHQAGVEVVINLMPDSSNKAYSNEAELVTDAGMVYVAIPVDWQNPTTDDVDA
FT                   FFNVMSRYQDKTVLVHCLANFRASAFVYLYQWAQAEQGDKPEMAAVMAPWGDLEQSLKE
FT                   YPQWAALIEKVKAQRGQ"
FT   sig_peptide     474446..474499
FT                   /locus_tag="Fbal_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            475350..475886
FT                   /locus_tag="Fbal_0435"
FT   CDS_pept        475350..475886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0435"
FT                   /product="Lipid A 3-O-deacylase-related protein"
FT                   /note="InterPro IPR018550; KEGG: asa:ASA_2673 hypothetical
FT                   protein; PFAM: Lipid A 3-O-deacylase-related; PFAM: Lipid A
FT                   3-O-deacylase (PagL)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74649"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP00"
FT                   /protein_id="ADN74649.1"
FT                   /translation="MKSICLPVISLALLTLSSNAHSLSLLDSRQIQLSGGQPVTEQNVD
FT                   VSTFEIEYQQPLWMIPRYQVGVDWAFGGGTLDTEVENAPMVFSGLGLRWEPWQYLMLRA
FT                   DGKVRYLSEHRFQAEQGRAKDYGGRMQYSYSFSMLLNVQKDLQFGYRYQHMSNGGMYEV
FT                   NPALNTHNLVFGYRF"
FT   sig_peptide     475350..475409
FT                   /locus_tag="Fbal_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(475939..477156)
FT                   /locus_tag="Fbal_0436"
FT   CDS_pept        complement(475939..477156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0436"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="COGs: COG3562 Capsule polysaccharide export protein;
FT                   InterPro IPR007833; KEGG: ecp:ECP_3027 capsule
FT                   polysaccharide export protein KpsS; PFAM: Capsule
FT                   polysaccharide biosynthesis protein; SPTR: P42218 Capsule
FT                   polysaccharide export protein kpsS; PFAM: Capsule
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74650"
FT                   /db_xref="GOA:E1SP01"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP01"
FT                   /protein_id="ADN74650.1"
FT                   /translation="MNILLLQGPLGPFFRTLGNHLVAEGHNVFHISFNGGDECWRSQGS
FT                   LYRFTSTMKEWPAYFRHFCQQHQIDSVVCYGDCRPYHAKASNICRQLDIAFWALEEGYL
FT                   RPDFVTMELGGVNANSSLYPMRRHLPKFNPKHAFQIKHQAGKTFGSRAWFAIRYHVIKR
FT                   LGVSAYPHFVSHRPWGLLKEALSWVKGGLLKLRFKSIDRAMLQELQAEKGRVFLLPLQV
FT                   SEDFQILSHSNYRDVATVIKEVVGSFARHADSADTLLIKHHPMDRGYINYQPLINQLRE
FT                   QHHLGKRLRFGYELPLPEVYPLLKGVVTVNSTVGLSALLHHLPVKCLGKALYDIPGLTT
FT                   PGPLSSFWRQQQPVCEATFDAVRNALLHQTQINGSFFTLMEETAVEVAQVMVQHHSQQR
FT                   ELRAAS"
FT   gene            complement(477153..479192)
FT                   /locus_tag="Fbal_0437"
FT   CDS_pept        complement(477153..479192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0437"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="COGs: COG3563 Capsule polysaccharide export protein;
FT                   InterPro IPR007833: IPR000463; KEGG: ecp:ECP_3028 capsule
FT                   export protein KpsC; PFAM: Capsule polysaccharide
FT                   biosynthesis protein; SPTR: P42217 Capsule polysaccharide
FT                   export protein kpsC; PFAM: Capsule polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74651"
FT                   /db_xref="GOA:E1SP02"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP02"
FT                   /protein_id="ADN74651.1"
FT                   /translation="MTYYTNSAGILARQAVLHAALAQPLERLNAHAVTGKGDVYIGWGL
FT                   KPNSLAMKQQAAENGVPFWHLEDGFIGYTGHPAKGGHSLSVVVDKQGIYYDASQPSELE
FT                   QHIVDAGRDSALCERAHNLIARIRQYGITKYNVYPDFNSQTQLPSDLKQQLDGRPYVLL
FT                   VDQVAGDLSIAAAQASEADFLDMVAAARQRYPDAALVVRTHPDTRLGKKSGVLARLARH
FT                   PALQSVIWVKQACHPHALIHHCLALFTVSSQMGFEGLILDKPVHCFGQPFYAGWGLTDD
FT                   AKPHDRRAALHRAGITLPQLVAAALILYPRYVNPITGQRCEVEEIIELLALQQRPEPQY
FT                   QTLYLAGFSLWKRAFIGKFCGHLAHNIRFVSKPPKQLGHNDKLLVWGQRFTEQQDAIRV
FT                   EDGFVRSSGLGSNLCRPASLVVDQRGIYFNAQQNNDLRHLLNHLMVSEADQARGAALIH
FT                   KLVSADINKYNLISQNRYQPSAEHPLRLLVVGQVDGDASITTGSPVVTSNEALLWAVRK
FT                   AYPEAHILYKAHPDVVAGNREGQISQACYDACVDEQVAEYGLNQLYPHIHQLHTMTSLA
FT                   GFEALLRGIHVVTWGQPFYAGWGLTEDRNPAHDRNRQRTLEELVYIAIAAYPSYVDWAT
FT                   GLFTTPEWLIDLLANNKTDSSHRPNRFQRWQLKLGYLVDTLKPQ"
FT   sig_peptide     complement(479127..479192)
FT                   /locus_tag="Fbal_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(479296..480327)
FT                   /locus_tag="Fbal_0438"
FT   CDS_pept        complement(479296..480327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_00621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74652"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP03"
FT                   /protein_id="ADN74652.1"
FT                   /translation="MSLNFVERLRLWPTPRKTGLFQPQSRETSNKIERTWVVSELNTPT
FT                   MDYYFRSRQHRFRRYQELCSRQLPEKGHPLWTAANARVILSRNVPLRWLHALNALSVKP
FT                   ASIVWFIDDDIPGAHQDKSLPDDYRKRLSKWYTQAYPLLQSLCTEVWVSTRYLAEKYAL
FT                   PDQSVLPPLQLSSPCNSMVKCFYHGSSSHTLEWAFIHQFVTAVQARYPNTWFELIGDHS
FT                   LKRRFKGVPRVTIIHPLDWQNYQALIQSRRMDIGLVPLYDSPFNRARSHTKMLDIHRQG
FT                   AIGIYGSRFPLANRIKDEEAGVVCEDGLDNWLHAFSYAMEMPKDKTFEKATRLIESVES
FT                   AEQ"
FT   gene            complement(480332..480919)
FT                   /locus_tag="Fbal_0439"
FT   CDS_pept        complement(480332..480919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74653"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP04"
FT                   /protein_id="ADN74653.1"
FT                   /translation="MNQTILLLGPSGIGKTTVVKALTQRTPSVASVTLDNITHRYARAQ
FT                   GLIGPKEDLNALIAALEHDRERFLSFGQEALAIHTESLVDKSVIVDVGTGFLDAPSSKT
FT                   WIRGYCSICLSADSAAAFDRFRKARQLDITYEQYMTTQFSKCRSSTYQLADTVIKTDAL
FT                   SPDETAHRFACTVFGMLPKEQARIALAEWLRD"
FT   gene            complement(480916..483150)
FT                   /locus_tag="Fbal_0440"
FT   CDS_pept        complement(480916..483150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0440"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1216 glycosyltransferase; InterPro
FT                   IPR001173; KEGG: amc:MADE_00968 putative
FT                   glycosyltransferase family 2 protein; PFAM: glycosyl
FT                   transferase family 2; SPTR: P55465 Uncharacterized protein
FT                   y4gI; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74654"
FT                   /db_xref="GOA:E1SP05"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP05"
FT                   /protein_id="ADN74654.1"
FT                   /translation="MTFFSEAQGWLSPKIQFRLLPKKELQTGQSLDWASTGYDPTFHLK
FT                   HRGAAPKGWYMVSLRITASVPRVTAKLYADYGEGIDEKQALQFSVKSGTLFKRVCLFQD
FT                   RPVRLRLDPCQQPCEFTVEHLAFTKLTERRARALMQKKLQGRRNLGALSSLDSSPLLEQ
FT                   YNQCFDHNLSAITYAQWMSQVEAPTLDSSSLEAIYRKLANKPLISVLLTTYNTEPELLR
FT                   QCIESVQGQRYPHWQLCIADDASSHEPVRELLREFAETDKRIRLVLREKNGHISQASNS
FT                   ALELVNGEFVALLDHDDLLAPHALLMMVKAINDAPEAQFFYSDEDKIDEHNQRSEPHFK
FT                   SSWNRDLFYSHNYITHLAVIQTELVRRIGGFRAGVEGSQDYDLFLRAIGHLGNRQIVHV
FT                   PHVLYHWRAINGSTALSASQKGYTSKAGLKALRDYFNSTNLEIEVTPHRLNNCYQVRWP
FT                   LAEPSPLVSLIIPTRDGYELLKQCISSIRNKTRYSAFEILVINNQSQCPKTLAYFRELE
FT                   QTGQARVVDFDDEFNFSAINNLGVAHARGQIVGLINNDIEVINPDWLDEMVRHASRPDV
FT                   GCVGAKLFYPDGRIQHAGVVLGIGGVAGHAHKYFAGHHNGYHSRLSLVQNYSAVTAAAL
FT                   LVRKSVYLEVGGLEPLLKVAFNDVDFCLKVREAGYRNVWTPFAELYHHESVSRGFEDTP
FT                   EKQARFSNEIRWMEKRWGEVLKSDPCYNPNLSLTHEDFSYNTEPALTPSP"
FT   gene            complement(483227..484141)
FT                   /locus_tag="Fbal_0441"
FT   CDS_pept        complement(483227..484141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0441"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="COGs: COG1210 UDP-glucose pyrophosphorylase;
FT                   InterPro IPR005835: IPR005771; KEGG: cps:CPS_2107
FT                   UTP-glucose-1-phosphate uridylyltransferase; PFAM:
FT                   Nucleotidyl transferase; SPTR: A0Y112 Glucose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase;
FT                   TIGRFAM: UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74655"
FT                   /db_xref="GOA:E1SP06"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP06"
FT                   /protein_id="ADN74655.1"
FT                   /translation="MPSSMKAIIPVAGLGTRMLPATKAIPKEMLPIVDKPLIQYVVNEA
FT                   IAAGIKEIVLVTHSSKNSIENHFDTSFELEATLEKRVKRQLLDEVRGICPKGVTIMHVR
FT                   QGEAKGLGHAIACAKAIVGDEPFAVLLPDVIVDQFQCELTQDNLAEMVARFKASGHSQI
FT                   MVEPVPMETVSNYGVADCGGIRLAPGDSSAMTAVVEKPAMEDAPSNLAVTGRYVLDRSI
FT                   WPLLAKTAPGAGGEIQLTDAIAELMKTHQTEAYHIVGKSHDCGSKAGYLCANLEYGLQH
FT                   PDTADALKTAIQSVAGPETHNAA"
FT   gene            complement(484142..484732)
FT                   /locus_tag="Fbal_0442"
FT   CDS_pept        complement(484142..484732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpt:Bpet3016 hypothetical protein; SPTR:
FT                   A3VWW9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74656"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP07"
FT                   /protein_id="ADN74656.1"
FT                   /translation="MFRDFELTFSEPCSEFVRKTYPKHKVILEYGAGGSTLLAAGNGNT
FT                   VITTETDPRWLIELMGAYKEQGLPGDIIPIWADIGATKAWGYPTDDIAIKQWPAYPQRP
FT                   WHYCNEHGIKPDLILIDGRFRVASFLTACVNITKATTLLFDDFVEREHYHVVKQLFEPT
FT                   QIIGERMAVFRLRPKKVSSQFLLEHIDYYLDPR"
FT   gene            complement(484742..485908)
FT                   /locus_tag="Fbal_0443"
FT   CDS_pept        complement(484742..485908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0443"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COGs: COG1004 UDP-glucose 6-dehydrogenase; InterPro
FT                   IPR011128: IPR014027: IPR014026: IPR001732: IPR 017476;
FT                   KEGG: tau:Tola_2842 nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase ; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; PRIAM:
FT                   UDP-glucose 6-dehydrogenase; SPTR: A3EK13 UDP-glucose
FT                   6-dehydrogenase; TIGRFAM: nucleotide sugar dehydrogenase;
FT                   PFAM: UDP-glucose/GDP-mannose dehydrogenase family, NAD
FT                   binding domain; UDP-glucose/GDP-mannose dehydrogenase
FT                   family, central domain; UDP-glucose/GDP-mannose
FT                   dehydrogenase family, UDP binding domain; TIGRFAM:
FT                   nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74657"
FT                   /db_xref="GOA:E1SP08"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP08"
FT                   /protein_id="ADN74657.1"
FT                   /translation="MKIAIAGTGYVGLSNAVLLAQHHEVTAVDIVPEKVEQINQRISPI
FT                   QDTEIELFLKERLLNLTATLDWKAAYQQADFVVIATPTDYDPVTNYFNTRSVEAVIDNV
FT                   MAVNPNAIMVIKSTVPVGYTAAAKARFGTDNILFSPEFLREGKALYDNLYPSRIIVGER
FT                   SQRAEQFAKLLAEGAVKQDIPTLFTDSTEAEAIKLFSNTYLAMRVAYFNELDSYAEAHG
FT                   LSSRQIIEGVGLDPRIGDHYNNPSFGYGGYCLPKDTKQLLANYQDVPNNLIRAIVDANT
FT                   TRKDYIADSIIRRNPQRVGVYRLIMKSGSDNFRASAVQGIMKRIKAKGIEVVVYEPALD
FT                   DAEFFHSPVINNLEEFKASCDVIVANRLVDDLSDVVNKVYTRDLFGSD"
FT   gene            complement(485982..487919)
FT                   /locus_tag="Fbal_0444"
FT   CDS_pept        complement(485982..487919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0444"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296: IPR001173; KEGG: mpt:Mpe_A0613
FT                   glycosyltransferase involved in cell wall biogenesis-like
FT                   protein; PFAM: glycosyl transferase family 2; glycosyl
FT                   transferase group 1; SPTR: A3W6W3 Glycosyltransferase;
FT                   PFAM: Glycosyl transferases group 1; Glycosyl transferase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74658"
FT                   /db_xref="GOA:E1SP09"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP09"
FT                   /protein_id="ADN74658.1"
FT                   /translation="MSVVIPTLVCDEKFEFAFNSLRGQTSENNEILVVVDNSIACNRVS
FT                   HGVRPLINFVNLGAYGARNQGLKHATGDFITVHDADDWSHPQKLEMQVKALLDNPKAMA
FT                   SVSHWARCTTDMQFETRPDGSVVHRNISSLMIRREVFERLGYWDRVSVNADTEYYYRIL
FT                   AAYGPDSIVEVMPGRPLALGRRHEGSLTMQPETHWKTQFGGVRKDYMDAAHKWHKECAK
FT                   TGNWYMPFAPKERPFPVPELIDRAVIELGEKVWPHIRAKQAPKDGSPCILLCGHAAAEQ
FT                   QFGAERSLLDLAKAIDACGYRLVLTLPERQNHYIEQLKPYCSDIVLLPAPWREDDEVWD
FT                   IAVDAYQRLINHFNIDLIHVNTVVHRTPLLAAKRQGTKSVLHVRELLSSDSALQAAMGQ
FT                   SNQTSTEPTDMADLVLANSHYTAEQLAHRRDAKNGDRLDTQIRVLTNTVELSKAWQPKA
FT                   FSLGDPIRVGMISSNLPKKGIADFIRVAQGALDASLALQFYLIGPRNEHIDSLSHGLPS
FT                   NVALIDYSPGPDAALAHIDLLLNLSLFQETFGRTVAEAMLAAKPVITYRWGALPELVNN
FT                   GCNGFLVHLGDVEGVVSRLAYLCDHPDQIYQFGQEGQAMAQTRFTPKRFRDELAQVYQS
FT                   LLGVSTPVTH"
FT   gene            complement(487996..488877)
FT                   /locus_tag="Fbal_0445"
FT   CDS_pept        complement(487996..488877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0445"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: Protein of unknown function (DUF3118)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74659"
FT                   /db_xref="InterPro:IPR021466"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP10"
FT                   /protein_id="ADN74659.1"
FT                   /translation="MKPIIGLINFSTLCKKNSGSFISSRESDWETHKQSVLSRSRLEER
FT                   LFYFEQVSLKQFDSQVDVNYFEEFRLVILISTLLHDDLKKKVYELQVGRPWMIIEERGE
FT                   EDWLDATGAISRALISLIRGRATKYINEDKVCFASFRLDDDDFLSTNFLKSLSSYINDD
FT                   NAGKFVTFSHGFKCCWISKRIVNLVRIHKPLIAIGLSHIGQFCTKTMDFSTDPKTVFSG
FT                   VNHYKIGESSSVIEDITPGMFIWSQHSNQDTHNRFKSVEIEDYWREIPNENLYKDLGGY
FT                   DGIESHFKLNDA"
FT   gene            complement(488882..491050)
FT                   /locus_tag="Fbal_0446"
FT   CDS_pept        complement(488882..491050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0446"
FT                   /product="N-acetylgalactosaminyl-proteoglycan3-beta-glucur
FT                   onosyltransferase"
FT                   /EC_number="2.4.1.226"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: pmu:PM0775
FT                   hypothetical protein; PFAM: glycosyl transferase family 2;
FT                   PRIAM: N-acetylgalactosaminyl-proteoglycan
FT                   3-beta-glucuronosyltransferase; SPTR: Q8L0V4 Chondroitin
FT                   synthase; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74660"
FT                   /db_xref="GOA:E1SP11"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP11"
FT                   /protein_id="ADN74660.1"
FT                   /translation="MQTLISEIKNSGLFDIDWYLKQYPDVNLSGLPPVEHYLKFGWKIG
FT                   RDPSPHFSTQGYLSHYEDVRQSGLNPLAHFIRYGINEGRIKAGVKVQKPKIEALPIKPR
FT                   DTGCRFDAVTQLMLLNESGETNAPEYHELLKKVKEQQAKKSEDAETKEVDPIPGDWPKD
FT                   LQLRPLPESTNDYQWIKRYKKNALPDEIGLSVVIPTFNRSHILRVTLAAMLHQRTDYPF
FT                   EIIVADDGSQEDIPKVVREFENKLEVKYVRQKDTGYRLSAVRNLGLRTAKYEYVSILDC
FT                   DMAPNPDWIQSIINILMESDDVAVIGPRKYVDTSMLAIDYCESTPDFLAKLPEVRTNNS
FT                   VAGADAGAISVDWRLATFESTDNLRLCDSPFRFFSGGNVGFSKKWLEKAGWFDEEFEAW
FT                   GGEDGEYGYRLYRSGAFFQSHMGAMAYHQEPPGKENETDRAGGKAITEKIRLGKVPYFY
FT                   RKIASIEQAEVNPVPLVSIYIPAYNCEQYIVRCVESALNQTVSDLEVCICDDGSTDNTL
FT                   KVLQENYDNHPRVRFVSQQNGGIGAASNTAVKLCRGFYIGQLDSDDFLEPDAVELCLKE
FT                   FLKDHSLACVYTTNRNLDGEGKLLANGYNWPVYSREKLTTAMICHHFRMFTSRAWNLTD
FT                   GFDEKITNAVDYDMYLKLSEVGPFKHVNKICYNRVLHGENTSIMKLAAQKENHFKVVNE
FT                   SLYRQNLDAHVYSPYSTLDSCRKYKFTS"
FT   gene            complement(491068..493035)
FT                   /locus_tag="Fbal_0447"
FT   CDS_pept        complement(491068..493035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0447"
FT                   /product="Chromosome segregation ATPase"
FT                   /note="COGs: COG1196 Chromosome segregation ATPase; KEGG:
FT                   bcm:Bcenmc03_0851 glycosyl transferase family protein;
FT                   SPTR: A2DGN0 Viral A-type inclusion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74661"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP12"
FT                   /protein_id="ADN74661.1"
FT                   /translation="MKTQKRPRKKMTRITQTVEPSGSERIQYQKDFDMTQQNQAVTVQE
FT                   QHLPTISSKVMFWRPRYLADSQWLQHIPFYFWLTEALKPQVVVQPSLNSAVGYFALCQA
FT                   IDKLNLDSFAYGAFSPKCDVEKVKAYNHENYREFSQLSDLDENTMLREFDRGSIDLLIL
FT                   KHDCELLTSDKGRQELKERLTDSAVVLIHGTKLKHVRKLCQTLSKTYPSFELTQCQGLL
FT                   LLCMGSQIPERLEALINQSKDVSAQRLIQNIYARLGSANEDAWHRQVYERRVHDLTEKL
FT                   QQQTHTIQQIQGAKQTLSETLEQANNDIQAAKSQQAKLSERLEQFGEETELNQQQKQQL
FT                   EREKAQLDKELAQLKISRQDATSEIAKLQQDIDTRFDEVAKLTQMLVEAEARLESLQKE
FT                   NQELREALRNNKTLQEQTRSDVAQKQSHIDQLQTKVSAHQQENEQLRKALQRHQQQEEG
FT                   QQSELNKLKQQNALLERDQKVAADKISSLAQSELSLQKSLSERFDELATLTNLLQQKER
FT                   ELSGLIEQMKDSEKALTDSKPINNGNIKKTITALKQRRKKARQFAKDVEVIRQSDLFDE
FT                   AWYLQQYPDAAKHKHGAAGHYLERAVELEVNPSTAFDGNWYLKTHEDVKSAGMNPLFHY
FT                   LKFGHKESRLFKHLQVKHPN"
FT   gene            complement(493115..494779)
FT                   /locus_tag="Fbal_0448"
FT   CDS_pept        complement(493115..494779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0448"
FT                   /product="polysaccharide export protein"
FT                   /note="COGs: COG1596 Periplasmic protein involved in
FT                   polysaccharide export; InterPro IPR019554: IPR003715; KEGG:
FT                   pol:Bpro_4938 polysaccharide export protein; PFAM:
FT                   polysaccharide export protein; Soluble ligand binding
FT                   domain; SPTR: Q03961 Polysialic acid transport protein
FT                   kpsD; PFAM: Polysaccharide biosynthesis/export protein;
FT                   SLBB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74662"
FT                   /db_xref="GOA:E1SP13"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP13"
FT                   /protein_id="ADN74662.1"
FT                   /translation="MHNSILAKLALAGALSVLPLSTTFAAITFQQDVEAEQVETMSTAK
FT                   VPSQRYGSWLFNGAFSQHSFSATNPEYRLTQGDTLIVQVWGAINHQAEVVVDPQGNIFI
FT                   PKVGPIKVLGVSNAKLNEVIFKSVQRVYQANVEVYASLMSSQKVKVFLSGMVNQPGLYE
FT                   GQSADSVLRFIDQASGIRDDIGSYRNIQVKRNGRLVQQLDLYQFLQSGTLPPMQLQDGD
FT                   VIFVGPKQGEITLEGEVGFQGYYELLANGNKANPLKPILDAVVAGEQATHVTIVAPEAG
FT                   ASSAGNRRVNATQYQIEDAGTIQVSPGALVKVTAQLRPNSISIDLIGEHDSAQEMVLPW
FT                   GASLQDLLDQTQFTRLSNQSAVQLYRESVAERQYEMLQASLSALEQSVLNTRSNTREAA
FT                   ELRAAEAEVILRWIEKARQVQPKGQVLLSESSDFSQIILQQGDKVVIPAKRNLVIVHGE
FT                   VMFPTAIAYRDDLSVLDLINKAGGANQELDEMNILVMKPNGSFVTANKMLKKRDVIAPG
FT                   DEIFVLSKPDEKSMQFAKDITQIIFQVAMSAAVVLSI"
FT   sig_peptide     complement(494705..494779)
FT                   /locus_tag="Fbal_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(494781..496016)
FT                   /locus_tag="Fbal_0449"
FT   CDS_pept        complement(494781..496016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0449"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="COGs: COG3524 Capsule polysaccharide export protein;
FT                   InterPro IPR003856; KEGG: mpt:Mpe_A0622 capsular
FT                   polysaccharide ABC transporter; PFAM: lipopolysaccharide
FT                   biosynthesis protein; SPTR: P62587 Capsule polysaccharide
FT                   export inner-membrane protein kpsE; PFAM: Chain length
FT                   determinant protein; TIGRFAM: polysaccharide export
FT                   inner-membrane protein, BexC/CtrB/KpsE family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74663"
FT                   /db_xref="GOA:E1SP14"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP14"
FT                   /protein_id="ADN74663.1"
FT                   /translation="MSNPSAKPETMKTDKAKASLSPMQRKLRKLKRDPKLFLVDSKAYL
FT                   GTRKTLYLTWAKLGSFVLVLLASLLVVSYYTVIASPRYTSQVQFVVKQANDSELALPGL
FT                   AAIGAASPSTRDALIIQEYIRSAEMAEALDNAVGLKTHYEDPRWDALSRLTANSTQEEY
FT                   LEHFQKRLTVKYDELSEILLVELQSYDPEYSLKLANQLLAISEQFINDLGENMANQQLK
FT                   YAEQEVNRAHQLLSEQQIKLVAFQNTHQLLSPESQSGALLTAVHQLEAEIIAQETELKS
FT                   LQAYMQPGTAEIRALEFRLDALRKQLIEEQRKLTNPEQPSLNQLSADFKAIELNTKLAA
FT                   DLYASALTSLELARSEAFKKLKYLLIVEYPRLAQEDTYPKRLHSIVTWFVVLLLLYFVG
FT                   RLIVAVIKEHRD"
FT   gene            complement(495991..496671)
FT                   /locus_tag="Fbal_0450"
FT   CDS_pept        complement(495991..496671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0450"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1134 ABC-type polysaccharide/polyol
FT                   phosphate transport system ATPase component; InterPro
FT                   IPR003439: IPR003593: IPR017871; KEGG: fph:Fphi_1159
FT                   putative capsule polysaccharide export transport system
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: P24586 Polysialic acid transport
FT                   ATP-binding protein kpsT"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74664"
FT                   /db_xref="GOA:E1SP15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP15"
FT                   /protein_id="ADN74664.1"
FT                   /translation="MIRFDNVSKFYPTKSGRHYVLRDVNLELPTDRNIAILGPNGVGKS
FT                   TLIRLMGGADIPNRGQISSDQNISWPLGLQGGLQGSMTARENVRFVARIHGYKDTKPIE
FT                   RRVEEFAEIGKYFDEPVKSYSSGMRSRITFGLTMAFDFDFDVLLIDELGAVGDANFRNK
FT                   SEALLQSKFERTKLIMVSHSLKELKTYCQSGLVLINQQLHYFEHLNDAITLYQDTYVKP
FT                   ISKA"
FT   gene            complement(496668..497474)
FT                   /locus_tag="Fbal_0451"
FT   CDS_pept        complement(496668..497474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0451"
FT                   /product="ABC-2 type transporter"
FT                   /note="COGs: COG1682 ABC-type polysaccharide/polyol
FT                   phosphate export systems permease component; InterPro
FT                   IPR013526: IPR013525: IPR000412; KEGG: ebr:ECB_02828
FT                   polysialic acid transport protein KpsM; PFAM: ABC-2 type
FT                   transporter; SPTR: P24584 Polysialic acid transport protein
FT                   kpsM; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74665"
FT                   /db_xref="GOA:E1SP16"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP16"
FT                   /protein_id="ADN74665.1"
FT                   /translation="MNTTNTLIRPPKRSHWQITCDVVFALIIRELKTRFGANRLGYFWA
FT                   LAEPIAQAGIMVLIFTLLGRNSISGVPVALFMLVAILPFKFFSKLVPQLTAAVEANKGL
FT                   LSYRQVTAADPILSRVIIETVTFLVVYLLLMATLAWLNFSVVPENLLALLGVSALVLML
FT                   ALGLGLMLCSAVTYWKDTGKVVAMVMQPMFFISGIFFCATMIPQQYWYLFSWNPLFHVT
FT                   ELSRDAYFSAYTTPVGSWEYLGLWAFSCFTLGLMTFRVCQQRFITS"
FT   gene            complement(498391..498699)
FT                   /locus_tag="Fbal_0452"
FT   CDS_pept        complement(498391..498699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0452"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="COGs: COG2901 Factor for inversion stimulation Fis
FT                   transcriptional activator; InterPro IPR020441: IPR005412:
FT                   IPR002197; KEGG: saz:Sama_3226 DNA-binding protein fis;
FT                   PFAM: helix-turn-helix Fis-type; SPTR: Q088K0 DNA-binding
FT                   protein fis; PFAM: Bacterial regulatory protein, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74666"
FT                   /db_xref="GOA:E1SP17"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP17"
FT                   /protein_id="ADN74666.1"
FT                   /translation="MFDQQNSFSEAHQLTVGQIETPNGTVKPQLLRDSVKRAVSNYFAQ
FT                   LDGQEASEVYEMVLCEVEQPLLDIVMQYTRGNQTRAANILGINRGTLRKKLKKYGMN"
FT   gene            complement(498726..499691)
FT                   /locus_tag="Fbal_0453"
FT   CDS_pept        complement(498726..499691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0453"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /note="COGs: COG0042 tRNA-dihydrouridine synthase; InterPro
FT                   IPR001269: IPR018517: IPR004652; KEGG: pha:PSHAa0347
FT                   tRNA-dihydrouridine synthase B; PFAM: dihydrouridine
FT                   synthase DuS; SPTR: Q8EJR8 tRNA-dihydrouridine synthase B;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   Dihydrouridine synthase (Dus); TIGRFAM: putative TIM-barrel
FT                   protein, nifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74667"
FT                   /db_xref="GOA:E1SP18"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP18"
FT                   /protein_id="ADN74667.1"
FT                   /translation="MTLKIGPYHLDNQLIVAPMAGVTDLPFRQLCRRLGAGLAVSEMLS
FT                   SNPLVWATEKSMARMDHSSESGIRSVQIAGCEPELMAQAAQFNVERGAQIIDINMGCPA
FT                   KKVNKKLAGSALLRHPDLVRQILHAVVNAVEVPVTLKIRTGWDPDNRNGVEIAQIAEQS
FT                   GIAALAVHGRTRQCMYKGEAEYDTIAAIKRSVSIPVIANGDIDSPEKAKFVLDHTGVDG
FT                   LMIGRPAQGRPWIFREIQHYLATGEHLAPPSLEERKELMTGHLEHLHAFYGDERGMRIA
FT                   RKHVGWYLDNQQQPELRRQFNALDSACAQRDALAGFFEQH"
FT   gene            complement(499907..500794)
FT                   /locus_tag="Fbal_0454"
FT   CDS_pept        complement(499907..500794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0454"
FT                   /product="(LSU ribosomal protein L11P)-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG2264 Ribosomal protein L11 methylase;
FT                   InterPro IPR013216: IPR007848: IPR013217: IPR010456: IPR
FT                   004498; KEGG: vpa:VP2883 ribosomal protein L11
FT                   methyltransferase; PFAM: ribosomal L11 methyltransferase;
FT                   Methyltransferase type 12; methyltransferase small;
FT                   Methyltransferase type 11; SPTR: Q87KU2 Ribosomal protein
FT                   L11 methyltransferase; TIGRFAM: ribosomal protein L11
FT                   methyltransferase; PFAM: Ribosomal protein L11
FT                   methyltransferase (PrmA); TIGRFAM: ribosomal protein L11
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74668"
FT                   /db_xref="GOA:E1SP19"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP19"
FT                   /protein_id="ADN74668.1"
FT                   /translation="MAWIQIRLNATNETAETISDELMELGAASVTFVDAQDTPVFEPLP
FT                   GETRLWGDTDVIGLFDAVTDMAPVIDALKAMPELAQQMTYKVEALEDKDWEREWMDNFH
FT                   PMQFGRRLWICPSWREAPEPDAVNVMLDPGLAFGTGTHPTTALCLTWLDGLELGDKSVV
FT                   DFGCGSGILAIAAIKLGAQSVVGLDIDPQALTASADNAQRNGVEEKLTVYLPKNQPDDL
FT                   QADVVVANILAGPLRELAPVISALVKPGGQLALSGLLVEQAEELRAIYGQWFDLNPTAI
FT                   EGDWCRLDGQKRID"
FT   gene            500994..501659
FT                   /locus_tag="Fbal_0455"
FT   CDS_pept        500994..501659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shl:Shal_3899 fumarate reductase cytochrome
FT                   b-556 subunit; PFAM: Succinate dehydrogenase/Fumarate
FT                   reductase transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74669"
FT                   /db_xref="GOA:E1SP20"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP20"
FT                   /protein_id="ADN74669.1"
FT                   /translation="MDTPFASPRRFALYRRWLQATLGGILALECLLSFQWGFGQILGPR
FT                   PLSPIRDWIHGCPQEHTLSEWAATIILLSLFFLHGYLAMTQPYEKPPLKERHGFGRKPA
FT                   VCWEAVYHHVQVATGILLVPLTFIFCYTLMLSPPDPTVDDWYHRMTSLGSRLAYVMLIP
FT                   LLLLHATLGLARLVVRWRTSNPEAPYHGSRKWVLGSYAVLISSALTIAVIRGVPGFSF"
FT   gene            501816..502520
FT                   /locus_tag="Fbal_0456"
FT   CDS_pept        501816..502520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0456"
FT                   /product="Fumarate reductase respiratory complex"
FT                   /note="InterPro IPR018956; KEGG: shn:Shewana3_0401 fumarate
FT                   reductase cytochrome b-556 subunit; PFAM: Fumarate
FT                   reductase respiratory complex; SPTR: A2UYL7 Fumarate
FT                   reductase respiratory complex, transmembrane subunit; PFAM:
FT                   Succinate dehydrogenase/Fumarate reductase transmembrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74670"
FT                   /db_xref="GOA:E1SP21"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP21"
FT                   /protein_id="ADN74670.1"
FT                   /translation="MFKLSPFGRGPAIMDGLQGLSGALLALFLLLHLHLEASILIGPEA
FT                   FDAVAWFLHAGWADPAGHGYAAMVVAASLVILTLLALHVWTALRRVPIQFRQWRALSRH
FT                   LHWVHHSGTRWWLVQLVTGMALMIFLPVHLITMMTQPHQISVELSALRIVNEGGWLLYG
FT                   VLLPLAVLHGVIGLARLALKWLPSFTGRQGLRRITAVVVVYLLVLGGVSLAAHIDNGQR
FT                   LNDGQSLSVQSR"
FT   gene            502526..504487
FT                   /locus_tag="Fbal_0457"
FT   CDS_pept        502526..504487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0457"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /EC_number="1.3.99.1"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR004112:
FT                   IPR006076: IPR003953: IPR003952: IPR 014006; KEGG:
FT                   shn:Shewana3_0403 fumarate reductase flavoprotein subunit;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   PRIAM: Succinate dehydrogenase; SPTR: A2UYL5 Succinate
FT                   dehydrogenase or fumarate reductase, flavoprotein subunit;
FT                   TIGRFAM: succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit; PFAM: domain; FAD binding domain;
FT                   TIGRFAM: succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunitGram-negative/mitochondrial subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74671"
FT                   /db_xref="GOA:E1SP22"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP22"
FT                   /protein_id="ADN74671.1"
FT                   /translation="MKTRYTDALVIGGGLAGLRVAIACREQGLDTTVLSLIPAKRSHSA
FT                   AAQGGMQASLGNSLKGEGDNEDVHFHDTVKGSDWGCDQDVARMFTHVAPKAVREAANWG
FT                   VPWTRVTAGPRQVVVNAEKVTLDEPKEAHGLINARDFGGTKKWRTCYTSDGTGHSLLYA
FT                   LDNQAIGMGIEVHERMEAVRLIHDGERCHGAVVRCLVTGELIAYLARTTTIATGGYGRL
FT                   WSVSTNAIICEGTGAAIALETGKVALGNPEAVQFHPTAIVPVGILTTEGCRGDGGLLRD
FT                   VDGHRFMPDYEPEKKELASRDVVSRRMTEHMRKGKGVPSPYGDHLWLDITLLGKEHIEK
FT                   NLREVQEICQYFLGIDPVKEWIPVRPTQHYSMGGVRTNAQGESDGLKGLYAVGEAACWD
FT                   MHGFNRLGGNSLAETVVAGMIIGESVAVASKQTPMGDRDLAQRFVEAEQAEIDALLARE
FT                   IGEDVYVLRRDMEALMMDKVGIFRTGAELDKAVSELTSLLERSANIALLNKRRHSNPEL
FT                   VEALKVPRMLKLALCIATAAAARTESRGAHAREDYPQRNDRDWLKRTLVRWPEGQAAPQ
FT                   LSYETLDVMAMELPPGYRGYGVDNAIAHPDTERREAEIAQWDAANPDADRFQRQQALMP
FT                   YDLPKPYRARNQRRTGED"
FT   gene            504487..505221
FT                   /locus_tag="Fbal_0458"
FT   CDS_pept        504487..505221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0458"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /EC_number="1.3.99.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit; InterPro IPR001041:
FT                   IPR006058: IPR004489; KEGG: lhk:LHK_02342 succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: ferredoxin; PRIAM: Succinate dehydrogenase; SPTR:
FT                   A2UYL4 Succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein; TIGRFAM: succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74672"
FT                   /db_xref="GOA:E1SP23"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP23"
FT                   /protein_id="ADN74672.1"
FT                   /translation="MSARTLIFEIFRFDPQLPGDKPRTERFELEETPGMTVFIALNRLR
FT                   EEQDRSLQFDFVCRAGICGSCAMVINGKPTLACRTLTSTFSSPIITLMPLPGFELIGDL
FT                   SVNTGKFMRALSERVGAWLHPTDAKPCINALEAPMDPAEAEAIYEADRCVECGCCVAGC
FT                   ATAQMRETFIAAVGFNKVARFALDSRDARKPDDFYHIIGDEDGVFGCMTLLGCHDNCPK
FT                   DLNHQAQIAYLRRQLLRGSRIL"
FT   gene            complement(505218..506675)
FT                   /locus_tag="Fbal_0459"
FT   CDS_pept        complement(505218..506675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0459"
FT                   /product="von Willebrand factor type A"
FT                   /note="COGs: COG2425 Uncharacterized protein containing a
FT                   von Willebrand factor type A (vWA) domain; InterPro
FT                   IPR002035; KEGG: ppr:PBPRB0630 hypothetical protein; SMART:
FT                   von Willebrand factor type A; SPTR: A2SS27 von Willebrand
FT                   factor, type A; PFAM: VWA domain containing CoxE-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74673"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP24"
FT                   /protein_id="ADN74673.1"
FT                   /translation="MLDLTPQLQGLDSLLAQSPALQARLTDTLAQLDREARATLANECP
FT                   YQPELSQCLSREQQLAEQGVTPARLATWLEEHDALMARCGVPANRPFWQQQRSQLKQQP
FT                   ERLLPLARLLLQQQRRALEQAQAQWQLNRLSVLRRDYLARLQAWLDTLLALQQRFRGLG
FT                   LDPGVLVDLADSDALQQTAAELNRWADYLRGNPGILDLCERIGRHRQPQSQTEWHPITR
FT                   RVAHWPLQANAPAPESLFGLLPGRDLPQLLPSEWAQLGDPELASLFELKYLEARLLAYQ
FT                   RRGWQRELQWRQETRLEPSETERARGPLVIAVDTSLSMQGTPESAAKAIALCLSATARS
FT                   HHRPVHLINFATELAERDLTQHSEGLLGFLQLSFHGGTDVALALEAALNTLSRPDYELA
FT                   DVVLLSDMVLLDLPQPLLQRIDEARRQGHQIHAVAIGEIVRTTNLNSRLDCQWQFCPLQ
FT                   GDIEQSEGEAPAAAVQHGHWQGLAGSA"
FT   gene            complement(506663..508243)
FT                   /locus_tag="Fbal_0460"
FT   CDS_pept        complement(506663..508243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0460"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR001270:
FT                   IPR011704: IPR003593; KEGG: pin:Ping_2515 ATPase associated
FT                   with various cellular activities; PFAM: ATPase associated
FT                   with various cellular activities AAA_5; SMART: AAA ATPase;
FT                   SPTR: A2SS28 ATPase associated with various cellular
FT                   activities, AAA_5; PFAM: AAA domain (dynein-related
FT                   subfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74674"
FT                   /db_xref="GOA:E1SP25"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP25"
FT                   /protein_id="ADN74674.1"
FT                   /translation="MTSRRQRLQTLLNELKPGLYERDDALALTLLATLSGHHTFLFGPP
FT                   GTGKSLLARRVAAAFADSAYFECLMNRFSTPDEVFGPVALSALKADRYERQTEGYLPRA
FT                   DLAFLDEIFKASPAILNTLLTLINERQFRNGDQLLPVPLKGLITAANEIPEVEAGLDAL
FT                   YDRLLVRLIAAPTQDWDNFSALLQGSANPPVQVSQPIDTATWQQWHREMAAVRLDQQTL
FT                   LAIARLRSALARQLPDLYLSDRRWQWAAGLLKAAAYFEQRHHTQPSDLLLLTHVLWHRP
FT                   EQQATVAALVADELARLPLNSEPLLNELEWWESRLHEQLFYQEDAYDTVEFFPQQFFFA
FT                   NQGEQRQERGGYFYVKRQAVHIHRRAEPVHFDFFVHQSQMTSRAPFHPFDPLGHQRENV
FT                   QCQFRDNGILTIRYDELGRFDHSAYEVEPFSPPLKQRKGERRAHIDPDKLAEAQTALAQ
FT                   LRQGLDQLKAEAESLLGQLQQQPEPLFVRAEALAQMANGWANGIEDLALSQLRCDALIS
FT                   LANDVPCST"
FT   gene            508862..510448
FT                   /locus_tag="Fbal_0461"
FT   CDS_pept        508862..510448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0461"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="InterPro IPR000209: IPR003137: IPR010259; KEGG:
FT                   saz:Sama_3313 cold-active alkaline serine protease; PFAM:
FT                   peptidase S8 and S53 subtilisin kexin sedolisin;
FT                   protease-associated PA domain protein; proteinase inhibitor
FT                   I9 subtilisin propeptide; SPTR: A2V190 Peptidase S8 and
FT                   S53, subtilisin, kexin, sedolisin; PFAM: PA domain;
FT                   Peptidase inhibitor I9; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74675"
FT                   /db_xref="GOA:E1SP26"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP26"
FT                   /protein_id="ADN74675.1"
FT                   /translation="MSMKHPSLVLAGIAAAMCVGPTAVAAEEARYIVKYQQGKGQAVRA
FT                   QMQASKGKMKLDLPGRGAMAVMLSPAALKAMQNHPNVEYVEEDVKRYLLAEQVPYGIPM
FT                   VQADQLSDAAAGNTKVCIIDSGYDGGHEDLYQGAVVNGTNDPGTGSWNTDENGHGTHVA
FT                   GTIAGIGNNGTGVIGVLPSGNLNLHIIKVFGADGWAYSSGLVAALDACKAAKGSENMVI
FT                   NMSLGGDRKSRTEERAFAQADSEGILSIAAAGNDGNTRHSYPASYSSVVSVAAIDSAKV
FT                   VADFSQQTDQVEMAGPGVGVLSTVPMGSASIAALTVAGGDVDAAGMEGSPQGSATGQLV
FT                   DCGTGEAACTAAAGNICLIARGNISFSDKVLACEAGGGVGAIIYNNEPGQLYGTLGGVA
FT                   TTIPSVGISDTDGAALMGQQGASATIDVTADHYAYFNGTSMATPHVVGVAALVWSNNET
FT                   CSNAEVRAALNATAEDLGAAGRDNAYGHGLVQAKAASDYLATNGCGGGDTGGGGGGGGN
FT                   GGGKPNKGPKR"
FT   sig_peptide     508862..508936
FT                   /locus_tag="Fbal_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(510798..513374)
FT                   /locus_tag="Fbal_0462"
FT   CDS_pept        complement(510798..513374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_2521 hypothetical protein; SPTR:
FT                   A1HQI0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74676"
FT                   /db_xref="GOA:E1SP27"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP27"
FT                   /protein_id="ADN74676.1"
FT                   /translation="MSRLPLILLPRPESADPSGRPRGGGSIRTPSVTQQYQRLGPQFTR
FT                   LEQALSARRLEIANTAPGIEPEYTVVIETYGHVSEFFRAIQRIPGLEWLGENELEGLEP
FT                   NDDFQDERNAEKPMSGRTMLVLSDRRAIDELLSLWKGYGNDPTMQFARGWAKFRDVFDT
FT                   LKDIRYWSVEDRLHDTGVIEYWQEELEYAPDQPVRFEAELWFRADVYKRADSQARIESQ
FT                   VNQLGGQVVSNCCIEGIAYHSLLVELPAIHVERILDDADVTLVKSDEVMLFRPIGQMCT
FT                   IGGDEVEPEELNIEAPASDAMRDTPRVALLDGLPLANHVYLEGKLRIDDPESFEDSYQA
FT                   NQRLHGTAMASLIVNGDLREAGAPLSSPLYVRPILKPDQRTLGGVETLPADYLPVDLIH
FT                   RAVKRMFEGEGEEEPVAPTVKVINLSIGDPNLHFNGTMSPLARLVDWLSEEYNVLFCVS
FT                   AGNHSQALRLDMESRAFRDLSEEQQHIEAFRAAQLDTRNRKLLSPAESINALTIGATHA
FT                   DASEVNLLAGKLELYTNEMPALYSAHGNGYRRSIKPDLMLPGGRVIHDEPIGLGDATLR
FT                   GLWGSRSAPGLMVPFPHDGGSLCKTVYSRGTSNANAIATRSCAQVCDALELLFEEHNRQ
FT                   GSFEQFAPVLIKALVAHGAGWGDIYGHISEAFPEANRTKLKSLVSQHIGYGKPDVSKSI
FT                   YCLDNRATVLGFGGLVGGEAHEYQLPIPIELGGVELWRKLTVTLAWFAKPSPRNIKYRG
FT                   SALWATLEGENREFATERTYDWLQVRRGTLHHEVFEGEDISVLAGQSELTVKVNCKDDA
FT                   TSTAEPVKYGLAITLEVAEGEDVEIYEEIKERINVKIREQAPLLAR"
FT   gene            complement(513389..514363)
FT                   /locus_tag="Fbal_0463"
FT   CDS_pept        complement(513389..514363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0463"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class; InterPro
FT                   IPR003959: IPR011704: IPR003593: IPR003960; KEGG:
FT                   she:Shewmr4_2522 ATPase central domain-containing protein;
FT                   PFAM: AAA ATPase central domain protein; ATPase associated
FT                   with various cellular activities AAA_5; SMART: AAA ATPase;
FT                   SPTR: A3JBI6 Putative ATPase; PFAM: ATPase family
FT                   associated with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74677"
FT                   /db_xref="GOA:E1SP28"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP28"
FT                   /protein_id="ADN74677.1"
FT                   /translation="MAKSDKIISLVKAGALGDKQQFKRVTESLIADERAKKHHVIAERL
FT                   EDALRTISVSNATLRPRDYGFSKIASLVDERHPAIKLSELVLNPSITESINELIAEQSR
FT                   ADLLRSYSLEPRNRLLLIGPPGNGKTSIAEALAEALMVPLIVVRYEGVIGSYLGETASN
FT                   LKKVIEFASSRRCVLFFDEFDTLGKERGDTHDTGEVKRVVSSLLMQIDSLPSHVVVVGA
FT                   TNHSELLDRAVWRRFQIRLEVPMPTRSQISKWFSDFEQHHGISLGYAPETLAKKLSGAN
FT                   FSEVKEFGTTVLRKMVLSLPDANMKDICAETVKNWHKVTYKNN"
FT   gene            complement(514806..516113)
FT                   /locus_tag="Fbal_0464"
FT   CDS_pept        complement(514806..516113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0464"
FT                   /product="AAA ATPase"
FT                   /note="InterPro IPR003593; KEGG: ppd:Ppro_3564 hypothetical
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74678"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP29"
FT                   /protein_id="ADN74678.1"
FT                   /translation="MIGGIETHSECYYIKEHFRNAALDYTTDDPFQFTAGVKLYKDAQE
FT                   AEGASDSEITGHIINFVHRHNPEMMHVITPFLKTTKAAVEKQLQKLRQEAQAKASTFEN
FT                   FVLTDSQIEERLQQMSDDVMLAGGMVVKGQMTVFFAPPNTGKTLIVLTMLARDADSGLL
FT                   DGGGVIYINCDDGGKGAITKAKILHASGINAIVLGENGFKSQHLATLMAASCASGAAAN
FT                   QVIVLDTLKKFVDVMNKKDAPAFYEELRRFTMAGGTVISLAHCNKNRDESGKLVFGGVA
FT                   DSVDDTDAAYIIDPANESNSELKTVLAENIKRRGENVKEVAFQYDESDGLSYQERMNSV
FT                   DMIEGTKAKEFKTKADCERAIQAKRARLQDDANKILEVLMDEGGEVMVTSLVNAVYKQE
FT                   FVSRRTARNVIDLFNNELWLVQKEGKSKIVRHLYRS"
FT   gene            complement(516467..516799)
FT                   /locus_tag="Fbal_0465"
FT   CDS_pept        complement(516467..516799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0465"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="InterPro IPR010260; KEGG: sbc:SbBS512_E2186 prophage
FT                   CP4-57 regulatory protein (AlpA); PFAM: Prophage CP4-57
FT                   regulatory; SPTR: A1Z2Q5 Putative uncharacterized protein;
FT                   PFAM: Prophage CP4-57 regulatory protein (AlpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74679"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP30"
FT                   /protein_id="ADN74679.1"
FT                   /translation="MTTQTHHTSPVPKSNSNKGTHSHNSLSGVDARLRLYRQIALESGH
FT                   PDRFIRIKEATQLTSLSNTRHFQMEKEGIFPQRIRVGHRCSGYRLSDVLAWLADPASYR
FT                   AVRQEV"
FT   gene            complement(516908..517543)
FT                   /locus_tag="Fbal_0466"
FT   CDS_pept        complement(516908..517543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74680"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP31"
FT                   /protein_id="ADN74680.1"
FT                   /translation="MTKTKVDPNLLVRFKDAPPYPFKLSKDLREQFYPFDSRVALLERL
FT                   VAEANRLIPLRTDGEDLTKDETQRQVYELMGVRDDATMLKHDLIQHLPDALRYCPNSYE
FT                   YHEVDSYLNFIAMQMFRLGISTAHANLEYQLEPIIKEREGKSKGGQSKQYGPFEKAVAL
FT                   KLRTHGEPGPREGASWLRELAKTLSKETAIPTERHQNSILKAAVKAQK"
FT   gene            complement(517540..518787)
FT                   /locus_tag="Fbal_0467"
FT   CDS_pept        complement(517540..518787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0467"
FT                   /product="integrase family protein"
FT                   /note="InterPro IPR002104; KEGG: spc:Sputcn32_3540 phage
FT                   integrase family protein; PFAM: integrase family protein;
FT                   SPTR: A3ENU8 Site-specific recombinase, phage integrase
FT                   family protein (Fragment); PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74681"
FT                   /db_xref="GOA:E1SP32"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP32"
FT                   /protein_id="ADN74681.1"
FT                   /translation="MALNAKQIENLKPKDKSFAIADQNGLSLRIRPSGAKSWIYRFRYG
FT                   GKADTLTLGSYPLMSLKQARMRTVQLASELENGTSPREYIRQEKLEAQRKGYTVTALWE
FT                   EFDQIKISKRQRPEQPRYLAVKYILPIIGKIPCANLGKADVLEIFRPLEKTPGACESVF
FT                   SLVKLLLTFGVNRGEVRSDAIFGLRAKDVGGSSNKRDRNLAFAEIRQLLTIIEKSGTSP
FT                   TYKNAITMTLASGQRISTVLSARWSEFDMAARIWTIPASSEERYTKSKKSRKLPLSDFM
FT                   VSILEHQRQYVPARWKCVFPKQKSDEPPVNTSVNAVIRQMLKCHNDDGKEKLEHFHPHA
FT                   LRDTFVSRLAELGQPYDIVERTVGHAIAGTRAHYLHYDFFNEQLALLELWGNKLRELST
FT                   DNVVTIEERKDFQHTQ"
FT   gene            complement(518936..520285)
FT                   /locus_tag="Fbal_0468"
FT   CDS_pept        complement(518936..520285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0468"
FT                   /product="biotin carboxylase ;acetyl-CoA carboxylase
FT                   carboxyltransferase subunit alpha"
FT                   /EC_number="6.3.4.14"
FT                   /EC_number="6.4.1.2"
FT                   /note="COGs: COG0439 Biotin carboxylase; InterPro
FT                   IPR005482: IPR005479: IPR020561: IPR005481: IPR 011761:
FT                   IPR011764: IPR004549; KEGG: ilo:IL2286 acetyl-CoA
FT                   carboxylase biotin carboxylase subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain ATP-binding; biotin
FT                   carboxylase domain protein; Phosphoribosylglycinamide
FT                   synthetase, ATP-grasp (A) domain; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; SPTR: A3WLT1
FT                   Acetyl-CoA carboxylase; TIGRFAM: acetyl-CoA carboxylase,
FT                   biotin carboxylase; PFAM: Carbamoyl-phosphate synthase L
FT                   chain, ATP binding domain; Biotin carboxylase C-terminal
FT                   domain; Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; TIGRFAM: acetyl-CoA carboxylase, biotin
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74682"
FT                   /db_xref="GOA:E1SP33"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP33"
FT                   /protein_id="ADN74682.1"
FT                   /translation="MLDKVVIANRGEIALRILRACRELGIKTVAVHSTADRELKHVLLA
FT                   DETICIGNAPATESYLNIPAIIAAAEVTDAIAIHPGYGFLAENADFAEQVENSGFIFIG
FT                   PTADVIRLMGDKVSAINSMKKAGVPCVPGSDGPLTEDNTRNIQIAKRIGYPVIIKAAGG
FT                   GGGRGMRVVRSEAELLKSIELTKAEAGAAFGNDTVYMEKFLENPRHIEVQVLADGQGSA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITEEMRKFIGERCAKACVEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTEMVTGVDLIKEQLRIAAGQPLSISQEQVVIRGHAIECRIN
FT                   AEDPKNFIPSPGTITHFHPPGGMGIRWDSHIYAGYRVPPYYDSMIGKLITYGENRGIAI
FT                   ARMRNALHELVVDGIKTNVPLQQRIMADENFQNGGTNIHYLEKKLDQESS"
FT   gene            complement(520297..520749)
FT                   /locus_tag="Fbal_0469"
FT   CDS_pept        complement(520297..520749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0469"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="COGs: COG0511 Biotin carboxyl carrier protein;
FT                   InterPro IPR001249: IPR000089: IPR001882; KEGG: vpa:VP2880
FT                   acetyl-CoA carboxylase biotin carboxyl carrier protein
FT                   subunit; PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; SPTR: A3UWB2 Acetyl-CoA carboxylase; TIGRFAM:
FT                   acetyl-CoA carboxylase, biotin carboxyl carrier protein;
FT                   PFAM: Biotin-requiring enzyme; TIGRFAM: acetyl-CoA
FT                   carboxylase, biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74683"
FT                   /db_xref="GOA:E1SP34"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP34"
FT                   /protein_id="ADN74683.1"
FT                   /translation="MDIRKIKKLIELVQESGIAELEITEGEESVRIASTSTAPAPVTYA
FT                   APAPVAAAPAAAPAAAPAAPAAEAAEPAGHKVLSPMVGSFYRAPTPGAKPFVEVGDTVN
FT                   VGDTLCIIEAMKMMNQIEADKAGVIKAILAENGDPIEFDEPLFIIE"
FT   gene            complement(520770..521222)
FT                   /locus_tag="Fbal_0470"
FT   CDS_pept        complement(520770..521222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0470"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="COGs: COG0757 3-dehydroquinate dehydratase II;
FT                   InterPro IPR001874: IPR018509; KEGG: slo:Shew_3363
FT                   3-dehydroquinate dehydratase, type II; PFAM: dehydroquinase
FT                   class II; PRIAM: 3-dehydroquinate dehydratase; SPTR: A3QID1
FT                   3-dehydroquinate dehydratase; TIGRFAM: 3-dehydroquinate
FT                   dehydratase, type II; PFAM: Dehydroquinase class II;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74684"
FT                   /db_xref="GOA:E1SP35"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP35"
FT                   /protein_id="ADN74684.1"
FT                   /translation="MSNNFQILLVNGPNLNLLGQREPGHYGHQTLETIVDALRQQAEQA
FT                   GATLSHVQSNHEGVLIDTIQQSEADFVIINPAAYTHTSVALRDALLGVAKPFIEVHLSN
FT                   VHARESFRHTSYFSDVAIGVICGLGADGYRYALDAALAFLKRQASE"
FT   gene            complement(521390..521815)
FT                   /locus_tag="Fbal_0471"
FT   CDS_pept        complement(521390..521815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0471"
FT                   /product="Class I peptide chain release factor"
FT                   /note="COGs: COG1186 Protein chain release factor B;
FT                   InterPro IPR000352; KEGG: spl:Spea_0535 peptidyl-tRNA
FT                   hydrolase domain protein; PFAM: Class I peptide chain
FT                   release factor; SPTR: A3XUG9 Putative uncharacterized
FT                   protein; PFAM: RF-1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74685"
FT                   /db_xref="GOA:E1SP36"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP36"
FT                   /protein_id="ADN74685.1"
FT                   /translation="MLTLSSRVSIPANELEFQMIRASGPGGQHVNKTSTAIMLIFDVKH
FT                   STALPDHYKSRILARAHPNLTPGGKIIIKAQQYRSQEMNRQDALERLKAMIDAAMVVQK
FT                   KRIATKPTRASQKRRVDSKKRQGQTKKLRQSKPGMHD"
FT   gene            complement(521855..522262)
FT                   /locus_tag="Fbal_0472"
FT   CDS_pept        complement(521855..522262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0591 hypothetical protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2057)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74686"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP37"
FT                   /protein_id="ADN74686.1"
FT                   /translation="MKARYWPLMALFCPLAMAGELHLPEGFYATAVNGQAVSPHQNRLN
FT                   LGSGRQVVTLRYANPYLFHKEFHEVLVSAPLYLVFDASNQHYRISATLPTELEAARRFA
FT                   RDPEFSLTSQQQPIPYQTYRYNQAVNALLSR"
FT   sig_peptide     complement(522209..522262)
FT                   /locus_tag="Fbal_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(522369..522755)
FT                   /locus_tag="Fbal_0473"
FT   CDS_pept        complement(522369..522755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0473"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: Uncharacterized protein conserved in bacteria
FT                   (DUF2057)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74687"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP38"
FT                   /protein_id="ADN74687.1"
FT                   /translation="MRNTITTLTTLATSLVLSAAATAGQLELPEGFYATAVNGQSVSAH
FT                   ADSVQLGAGKQVVTVRYEENTIISKELNEYKVSAPMHLVFNADTGATYQIEKSGDTIAL
FT                   VSRSQSVPVEVHSESQAINKALSL"
FT   sig_peptide     complement(522687..522755)
FT                   /locus_tag="Fbal_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            523237..524271
FT                   /locus_tag="Fbal_0474"
FT   CDS_pept        523237..524271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4075 hypothetical protein; SPTR:
FT                   A0Y741 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74688"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP39"
FT                   /protein_id="ADN74688.1"
FT                   /translation="MLQLVVGPEARRQISQSGLQPELFDKVIAASGGPKWIPLAALDRH
FT                   LLYQFFPAEQPLSLLGTSSGAWRCTTLSNPGSDAAHRRLQHAYIHQRYDRPPMPAEVDA
FT                   MCEGILSDALGECAPAICDNLYRQLNIIVCRGRHLNDSARRGSQLAGLAFTALTNLARR
FT                   RSLSMSWQRLVASTGLDTPFVPMDDLPTEAAPLDANNLLPVMLASGSIPLVLSGVTGIP
FT                   GLPPGRYFDGGVTDYHLDLPALQRGGLTLYPHFYPHAAPGWFDKKLPWRRASTNFDKVA
FT                   ILTPDPTFIARLPRGRLPDRSDFKTLDSDRRIRDWERAAELGEALVDTFQKLVQDPMPY
FT                   LRSL"
FT   gene            524355..524570
FT                   /locus_tag="Fbal_0475"
FT   CDS_pept        524355..524570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0475"
FT                   /product="Protein of unknown function DUF2061, membrane"
FT                   /note="COGs: COG3205 membrane protein; InterPro IPR018638;
FT                   KEGG: tgr:Tgr7_0490 hypothetical protein; PFAM: Protein of
FT                   unknown function DUF2061, membrane; SPTR: A2V5R7 Putative
FT                   uncharacterized protein; PFAM: Predicted membrane protein
FT                   (DUF2061)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74689"
FT                   /db_xref="GOA:E1SP40"
FT                   /db_xref="InterPro:IPR018638"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP40"
FT                   /protein_id="ADN74689.1"
FT                   /translation="MLKTFTFAVMHFSIAFALAYLITGSIVIGGLLAVLEPMVNTVGYA
FT                   IHERVWKRIEARREAEAPSADVALPA"
FT   sig_peptide     524355..524453
FT                   /locus_tag="Fbal_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            525009..525809
FT                   /locus_tag="Fbal_0476"
FT   CDS_pept        525009..525809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74690"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP41"
FT                   /protein_id="ADN74690.1"
FT                   /translation="MSPLPRALSPCESRISGGEVQTKTPAWETPAFCFRRMMKDQKPHL
FT                   QGGKGWVGGKPLAHRLGLVITFSQWFGRGPTGLAYGGYRVFRGTFSVGGCPVCRPAIQT
FT                   KTPAWETPAFCFRRMMKDQKPHLQGGKGWVGGKPLAHRLGLVTTFSQWFGRGPTGLAYG
FT                   GHRVFRGTFSVGDCRRSRPATQTKTPAWETPAFCFRRMMKDQKPHLQGGKGWVGGKPLA
FT                   HRLGLVTTFSQWFGRGPTGLAYGGHRVFRRTFGAGSCPGVLIVA"
FT   gene            526118..526690
FT                   /locus_tag="Fbal_0477"
FT   CDS_pept        526118..526690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0477"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="COGs: COG2802 Uncharacterized protein similar to the
FT                   N-terminal domain of Lon protease; InterPro IPR003111;
FT                   KEGG: son:SO_4182 ATP-dependent protease La; PFAM:
FT                   peptidase S16 lon domain protein; SMART: peptidase S16 lon
FT                   domain protein; SPTR: A2UW99 ATP-dependent protease La
FT                   (LON) domain protein, putative; PFAM: ATP-dependent
FT                   protease La (LON) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74691"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP42"
FT                   /protein_id="ADN74691.1"
FT                   /translation="MKRIEAALLPIDDPVLPEGRKELRIVTPGQLRMVAASLKDGSSLA
FT                   VCMSREEGDMPCYPIATLVDVVDFFQLDDDTLSVVVEGRQRVRVLNTWAAPDGVWMGET
FT                   LTMTNWPSFPLDNNFSVLGEALRRLYEAQPELGHLYHDPHLEDASWVSQRWLEVLPLVE
FT                   QEKQRLMGQPDCGKTMQYVLSLILSHQ"
FT   gene            complement(526701..528281)
FT                   /locus_tag="Fbal_0478"
FT   CDS_pept        complement(526701..528281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0478"
FT                   /product="transporter, CPA2 family"
FT                   /note="COGs: COG4651 Kef-type K+ transport system predicted
FT                   NAD-binding component; InterPro IPR003148: IPR006153; KEGG:
FT                   shn:Shewana3_3577 sodium/hydrogen exchanger; PFAM:
FT                   sodium/hydrogen exchanger; TrkA-N domain protein; SPTR:
FT                   A2UUM3 Sodium/hydrogen exchanger; PFAM: TrkA-N domain;
FT                   Sodium/hydrogen exchanger family; (TC 2.A.37)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74692"
FT                   /db_xref="GOA:E1SP43"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP43"
FT                   /protein_id="ADN74692.1"
FT                   /translation="MLDPSLLLFPLLLALLATGLGFPPLIGYLAAGFALYAAGVDALPF
FT                   LQPIADLGVLLLLFAIGLKLDLRGLARAEIWGGASIHLALTMVITTSAIKLFSVMGIAL
FT                   FDELSLNQAVLLAFALGFSSTVFAIKMLEERGETQSLYGRTAIGILIMQDLFAVLYLTI
FT                   SKGALPSPWALLLLGLPLLRPLFYRLMDRVGHGEMLVLFGLAMALVPGAALFEAVGLKP
FT                   DLGALVLGILLAGHVKASELSKSLFLFKELFLVAFFLTIGQQGLPTGAEVLTALALMLL
FT                   LPIKLGLFLLLLARFRLRLRSALMASLSLGNFSEFGLIVLTAAIAAGSMDPSWLRVMAL
FT                   LVAFSFLLAAPLSTHGQSIYLRLRDQLLQLERHPLHPDDQPIRLGQPRVLIFGMGRIGS
FT                   GAYDELKQHFGDTLLGIDHKQEIIERHEQAGRRVVMGDATDTDFWDKLEHSDSVELVIL
FT                   AMPAHHGNLFTAEQLARIEFQGRVAAISRWPEEAEALKEMGVHSVYNIYEAAGSGVAEQ
FT                   VVELVKKPA"
FT   sig_peptide     complement(528171..528281)
FT                   /locus_tag="Fbal_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(528387..528794)
FT                   /locus_tag="Fbal_0479"
FT   CDS_pept        complement(528387..528794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0479"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG1607 Acyl-CoA hydrolase; InterPro
FT                   IPR006683; KEGG: slo:Shew_1159 thioesterase superfamily
FT                   protein; PFAM: thioesterase superfamily protein; SPTR:
FT                   A2UVA8 Thioesterase superfamily; PFAM: Thioesterase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74693"
FT                   /db_xref="GOA:E1SP44"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP44"
FT                   /protein_id="ADN74693.1"
FT                   /translation="MKYYSRRVIKPEDLNPGQSLFGGRLLSWLDEEAGIFAACQMGSHQ
FT                   LVTRQIRDITFHRPGRQGEVIEFGLALTHTGRTAVTVRCEVRNKQSLAVLATVEAMVFV
FT                   NLDANGRPSPHKLAPGRRANRVSTPDRKPGL"
FT   gene            complement(528969..530738)
FT                   /locus_tag="Fbal_0480"
FT   CDS_pept        complement(528969..530738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0480"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="COGs: COG4232 Thiol:disulfide interchange protein;
FT                   InterPro IPR006662: IPR013766: IPR003834: IPR017937; KEGG:
FT                   slo:Shew_3266 thiol:disulfide interchange protein
FT                   precursor; PFAM: cytochrome c biogenesis protein
FT                   transmembrane region; Thioredoxin domain; SPTR: A2UUM2
FT                   Cytochrome c biogenesis protein, transmembrane region;
FT                   PFAM: Thioredoxin; Disulphide bond corrector protein DsbC;
FT                   Cytochrome C biogenesis protein transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74694"
FT                   /db_xref="GOA:E1SP45"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP45"
FT                   /protein_id="ADN74694.1"
FT                   /translation="MTKTLTRLLLLPLLGLLSLGASANFSFLKQEPQVLPVDQAYLFDF
FT                   RQQDNALQLTWTMAGDQYYLYQDKFVLKVEVDGSAELGPIQYPSPVIHTDEFFGDQPVY
FT                   FNDVTLTIPVLEAQGEAAVTVTYQGCLDKVLCYPPTKQTVYLSAVAANDGLLTTAAPAP
FT                   AAPQTQQDGLAALLAGDGLLLPLVTFFGLGILLAFTPCVFPMYPILTGIIAGQGKKLST
FT                   GKAFALSMTYVQGMALTYSLLGLVVASAGVKYQAALQSPAVLIGLAILFVVLSLSMFGL
FT                   YNLQLPSSLQGKLANAQNQQKGGSFIGVFVMGLISGLVASPCTTAPLSGALIYVAQSGD
FT                   LVLGGLALYALSMGMGLPLLLLGTSGGKLLPKAGAWMEAIKHVFGFLLIAVSIMMLDRL
FT                   WPGTIMDVIWALWGVALAGYLLHQNKKTAFSWMQTVRNVVVVLGLFASVSYGFHAVMNR
FT                   GETLASAQHAVQFIKVKTVQDLEREVAKAGAEGKTVMLDLYADWCVACKEFEHKTFPQP
FT                   QVTARTDKMVLLQADVTANDAQDIELLESYQVLGLPTLLFFTPEGEELNQLRVTGFMGP
FT                   NPFADHLDAVLAQ"
FT   sig_peptide     complement(530670..530738)
FT                   /locus_tag="Fbal_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(530735..531082)
FT                   /locus_tag="Fbal_0481"
FT   CDS_pept        complement(530735..531082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0481"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="COGs: COG1324 conserved hypothetical protein
FT                   involved in tolerance to divalent cations; InterPro
FT                   IPR004323; KEGG: aha:AHA_0786 divalent-cation tolerance
FT                   protein CutA; PFAM: CutA1 divalent ion tolerance protein;
FT                   SPTR: B1JMR6 Divalent-cation tolerance protein cutA; PFAM:
FT                   CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74695"
FT                   /db_xref="GOA:E1SP46"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP46"
FT                   /protein_id="ADN74695.1"
FT                   /translation="MLSSAQTDPTNDHRVVLCTCPDNASAERVADALLSQKLVACVNLL
FT                   PGITSLYHWKGELCRDNEVQLVLKTRASCLPALETCIRAHHPYEVPEILALPVEWGHRP
FT                   YLEWINQHCQP"
FT   gene            531234..531731
FT                   /locus_tag="Fbal_0482"
FT   CDS_pept        531234..531731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0482"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="COGs: COG3030 Protein affecting phage T7 exclusion
FT                   by the F plasmid; InterPro IPR007313; KEGG: swp:swp_4518
FT                   FxsA cytoplasmic membrane protein; PFAM: FxsA cytoplasmic
FT                   membrane protein; SPTR: A2UUM0 FxsA cytoplasmic membrane
FT                   protein; PFAM: FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74696"
FT                   /db_xref="GOA:E1SP47"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP47"
FT                   /protein_id="ADN74696.1"
FT                   /translation="MLFYLFLLFAVMPIVEIYILIQVGNAFGALATIGLVLLTAALGAS
FT                   LVRSQGLSTLMSVQTRLNQGEIPGQQIVEGMLLAVAGVLLVTPGFVTDFLGLLILTPAT
FT                   RAPIAAALLKRMQLKVVQGQGFSAGFGGGFQGHDPFAGGQQPGPRQPDDGRTIDGDFER
FT                   KE"
FT   gene            complement(531781..533127)
FT                   /locus_tag="Fbal_0483"
FT   CDS_pept        complement(531781..533127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0483"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: sse:Ssed_0640 MATE efflux family
FT                   protein; PFAM: multi antimicrobial extrusion protein MatE;
FT                   SPTR: A2V243 MATE efflux family protein; TIGRFAM: MATE
FT                   efflux family protein; PFAM: MatE; TIGRFAM: putative efflux
FT                   protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74697"
FT                   /db_xref="GOA:E1SP48"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP48"
FT                   /protein_id="ADN74697.1"
FT                   /translation="MHREHDLLSGSIAGTLARLALPNLFAVLSLLLYHLTDTFFISRLG
FT                   TQPLAALSLTFPVTLVVSSVALGLGAGMSAQLGRLLGEGDRAQGRQFVTHGLLLTIVIV
FT                   TLFAIGGALTIDPLFRLLGADDALLGLVHDYMLVWYLGIGFLVLPMVGNQALRATGNTF
FT                   TPALVTAVAALVNAILDPLLIFGIGPFPRLEMQGAAIATVLSWILTFVVALYMLTARHN
FT                   LLARLKLDRLRAHWRLMLHIARPATLSNLLNPLANAVLIALLARMDTHAVAAFGAGTRI
FT                   ESLLLILVTALCGALTPFIAQNLGAGQTDRAARALMGSLHSVLLAQLAIYLVLWPLAPH
FT                   LASLFSTDGTVTHYLTQYLRWVPAAYGALGVVILLAMSLNAYHRPMSALGLNLSRLGLL
FT                   LLPGAWLGSQWVGVEGIFIAITLANLLMGAACYFLARQLTEPSLAPLLR"
FT   gene            533336..533626
FT                   /locus_tag="Fbal_0484"
FT   CDS_pept        533336..533626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0484"
FT                   /product="chaperonin Cpn10"
FT                   /note="COGs: COG0234 Co-chaperonin GroES (HSP10); InterPro
FT                   IPR001476: IPR018369; KEGG: eum:ECUMN_4677 co-chaperonin
FT                   GroES; PFAM: chaperonin Cpn10; SPTR: Q3YUJ8 10 kDa
FT                   chaperonin; PFAM: Chaperonin 10 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74698"
FT                   /db_xref="GOA:E1SP49"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP49"
FT                   /protein_id="ADN74698.1"
FT                   /translation="MNIRPLHDRVIVKRTEVETKSAGGIVLTGSAAEKSTRGEVLAVGN
FT                   GRILENGEVKALDVKVGDTVIFNEGYGVKTEKVDGQEVLIMSESDILAIVE"
FT   gene            533662..535302
FT                   /locus_tag="Fbal_0485"
FT   CDS_pept        533662..535302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0485"
FT                   /product="chaperonin GroEL"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterPro IPR017998: IPR001844: IPR002423: IPR000215: IPR
FT                   018370; KEGG: vch:VC2664 chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; SPTR: A3WLT6 60 kDa chaperonin; TIGRFAM:
FT                   chaperonin GroEL; PFAM: TCP-1/cpn60 chaperonin family;
FT                   TIGRFAM: chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74699"
FT                   /db_xref="GOA:E1SP50"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP50"
FT                   /protein_id="ADN74699.1"
FT                   /translation="MAAKDVKFGNDARVKMLKGVNILADAVKVTLGPKGRNVVLDKSFG
FT                   APTITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVVAAVEELKALAVPCTDSKAIAQVGTISANSDTSIGEIIA
FT                   TAMEKVGQEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINNAENGTVELDSPFILL
FT                   VDKKISNIRELLPILEGLTKAGKPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIAILTGGTVISEEIGLELEKATLEDLGNAKRVVITKDNTTIIDGVGEED
FT                   QIKGRVAQIKQQIEESTSDYDKEKLQERMAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGTALVRVAAKISDLTGDNEEQNVGIKLALRAMEAPLRQIAFNA
FT                   GVESSVIANQVREGSGNYGYNAGTGVFGDMLEMGILDPTKVTRSALQFAASVAGLMITT
FT                   EAMVTELPKEEAAPDMGAMGGMGGMGGMM"
FT   gene            complement(535424..537253)
FT                   /locus_tag="Fbal_0486"
FT   CDS_pept        complement(535424..537253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0486"
FT                   /product="membrane protein"
FT                   /note="COGs: COG1289 membrane protein; KEGG:
FT                   eic:NT01EI_1395 hypothetical membrane protein; SPTR: A3XHL0
FT                   Putative uncharacterized protein; PFAM: Fusaric acid
FT                   resistance protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74700"
FT                   /db_xref="GOA:E1SP51"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP51"
FT                   /protein_id="ADN74700.1"
FT                   /translation="MMAGLLIFTLLGQQAAGVNALIVAWLVGVQGRNLAYPKRASLLSL
FT                   SAAICCLSSALALLSLWHPLLGSGILALIGLLYGLTSNQRKYIQLITYNAGFCFICALH
FT                   LLDSGVEARMIFASSLFGAVTAVFSAVIAGPWRSRHQGEQLLGRCHQKLADWCAILAQT
FT                   GPDQVKQRLALREQLDESIAVLSHWLLEMPDKPQVTHVAARLFTLLTMIETLEVISRIR
FT                   LQIRNQASLADYLHSAADALATDRPVPPLPEDIHHPLLLQAEDRLRQAQQCPAPAPGWR
FT                   ARLSQVWPSDAESIGVQWRKAIRRQSREWHHGLRILFTLMCCEGIVILLKLPQGYWVTL
FT                   TAFIVLMAAPLGQLQVRIWNRFYGTLLGSLLALSMIWFLGQGDWLYGATGLTVFLAFAT
FT                   YYKTRYEIHVFWLTMMMVFAITLLLPSDPYIAFYRALDTMTGALLAFLAMHLFIPSWTR
FT                   RWLDSYVDKWWELECQWLQAIEQGEQNSPLRWQAHAALRQLSQEIGYMQLEPNTSARDL
FT                   RDWQSLLWLGLRLHACLGMLARSHHAPDPVITHQFQQWRTLYRDRLNAHWCLLANRGAA
FT                   PHTEGDIQRWLAGDMQQLFAWVDRQRPFDQIDP"
FT   gene            537700..538227
FT                   /locus_tag="Fbal_0487"
FT   CDS_pept        537700..538227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3528 hypothetical protein; SPTR:
FT                   A2UUT8 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3016)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74701"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP52"
FT                   /protein_id="ADN74701.1"
FT                   /translation="MRKMIWLALALFTGSAMAEDAPKWPTQDGDVTVIWQEPDNYRDVK
FT                   TGSGVQSRYQNHVFATLGKHMQKKIEPLLAEGETATFTVTDLDLAGDVRPSFGATPNDI
FT                   RIVKSVYPPRIEFSYEVKGADGSVKVSGEEKLADLGFDTRSVTRYRNDALRYEMQMLDD
FT                   WISRTLEPQLKP"
FT   sig_peptide     537700..537753
FT                   /locus_tag="Fbal_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(538325..538633)
FT                   /locus_tag="Fbal_0488"
FT   CDS_pept        complement(538325..538633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_0438 hypothetical protein; SPTR:
FT                   A2UUT6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74702"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP53"
FT                   /protein_id="ADN74702.1"
FT                   /translation="MSFDTVIEQYRQSLQVAYRQSVDADALLDSLQQDGKGQFNAIFRD
FT                   DAGFTTQASRFVPYVQELAEGLSQFEAEPNAEALPQMVQQLELVLSTLAQLRQQLKG"
FT   gene            538722..539549
FT                   /locus_tag="Fbal_0489"
FT   CDS_pept        538722..539549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0489"
FT                   /product="GumN family protein"
FT                   /note="COGs: COG3735 conserved hypothetical protein;
FT                   InterPro IPR010891; KEGG: sdn:Sden_0672 GumN; PFAM: GumN
FT                   family protein; SPTR: A2UUT5 GumN; PFAM: GumN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74703"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPN9"
FT                   /protein_id="ADN74703.1"
FT                   /translation="MRALLLLLLLPFIVWAAPDDRPPFYQVEANGRTAWLLGTIHVGSR
FT                   DFYPLPAPVESAFEQAQVLALEADPNDPEVPALLARYGRSDTPLPEPLAKQVAQRCQQL
FT                   GFACDLGVSPWLLSAQLAMLQMAQAGYQPDLGVDSMLLSRKGQKPLWQLESMGRQMAIF
FT                   TELSQSAQWAMLESTLEDADPTELVQAWRGGNAAELDALMRDGLSDSDELWQRLMVDRN
FT                   HDMASTIGDWLERQDRVFIAVGAGHLVGPDGIPTLLKQAGVTVRDCWQEACQP"
FT   sig_peptide     538722..538769
FT                   /locus_tag="Fbal_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(539550..540101)
FT                   /locus_tag="Fbal_0490"
FT   CDS_pept        complement(539550..540101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP1297 hypothetical protein; SPTR: A0XZN4
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74704"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP0"
FT                   /protein_id="ADN74704.1"
FT                   /translation="MSTHWLITDIWGQHATLDPFLRRLEAIAPDWQVLDPYSGQRFAFE
FT                   DETQAYQYFLHRCSKATYQQKLEAVLEQAQQPLTLLACSAGANALWPLLDGPLASKIRK
FT                   AVLVYGSTIPEQPITPRCDTALLLCRGDNGVTGHQERLAQHSTLLLSDAPHGFLNPRAP
FT                   GYHPDAAAEAEAWLQQQLTR"
FT   gene            complement(540157..541179)
FT                   /locus_tag="Fbal_0491"
FT   CDS_pept        complement(540157..541179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0491"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="COGs: COG1509 Lysine 2 3-aminomutase; InterPro
FT                   IPR007197: IPR003739; KEGG: dze:Dd1591_0375 lysine
FT                   2,3-aminomutase YodO family protein; PFAM: Radical SAM
FT                   domain protein; PRIAM: Lysine 2,3-aminomutase; SPTR: A2P703
FT                   Putative uncharacterized protein; TIGRFAM: lysine
FT                   2,3-aminomutase YodO family protein; PFAM: Radical SAM
FT                   superfamily; TIGRFAM: KamA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74705"
FT                   /db_xref="GOA:E1SPP1"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP1"
FT                   /protein_id="ADN74705.1"
FT                   /translation="MITRNSHSVQGVDRAWQRELAEAYRSPVELLTDLQLDPAEFGQGL
FT                   EARRLFPMLVPKAFAAAMRPGDAQDPLLRQVLPVGDEFLVADGFGPDPIGEQDGPMPGL
FT                   LHKYQSRVLLMLRTGCAVNCRYCFRRHFPYADHKVGAAELAQAHEYIASDTRINELLLS
FT                   GGDPLMARDDHLAELVARFSDLPHLKRLRIHTRLPVVLPSRITDQLVSLLADAPWRVVM
FT                   VLHINHPNELQPELVAGLARLKAAGVTLLNQAVLLKGVNDHADTLVALAEGLFDAGVLP
FT                   YYLHLLDRVAGAAHFEVDEDRARALMAEQLQRLPGFLVPRLVREIAGEASKTPIDLKLV
FT                   "
FT   gene            541222..541794
FT                   /locus_tag="Fbal_0492"
FT   CDS_pept        541222..541794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0492"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="COGs: COG0231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A); InterPro
FT                   IPR015365: IPR001059: IPR013185: IPR013852: IPR 011768;
FT                   KEGG: dda:Dd703_0466 translation elongation factor P; PFAM:
FT                   Elongation factor KOW domain protein; Elongation factor P ;
FT                   Elongation factor P/YeiP protein; SPTR: A3WLU2 Elongation
FT                   factor P; TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P, C-terminal; Elongation factor P (EF-P)
FT                   KOW-like domain; Elongation factor P (EF-P) OB domain;
FT                   TIGRFAM: translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74706"
FT                   /db_xref="GOA:E1SPP2"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP2"
FT                   /protein_id="ADN74706.1"
FT                   /translation="MASYATNEFRSGLKIMLDGEPCNIIENEFVKPGKGQAFNRVKIRK
FT                   LLTGKVLEKTFKSGDTVEAADVMDHELAYLYNDGEFWHFMNNDTFEQIAADAKAVGDAE
FT                   KWLVEQDVCTITVWDGNPITVTPPNFVELEVTETDPGLKGDTQGTGGKPATLVTGAVVR
FT                   VPLFIAIGEVVKVDTRTGEYVERVRSK"
FT   gene            541908..542879
FT                   /locus_tag="Fbal_0493"
FT   CDS_pept        541908..542879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0493"
FT                   /product="lysyl-tRNA synthetase-related protein GenX"
FT                   /note="COGs: COG2269 Truncated possibly inactive lysyl-tRNA
FT                   synthetase (class II); InterPro IPR018149: IPR004364:
FT                   IPR006195: IPR004525; KEGG: vpa:VP2838 lysyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (D K and N);
FT                   SPTR: Q87KY6 Putative lysyl-tRNA synthetase; TIGRFAM:
FT                   lysyl-tRNA synthetase-related protein GenX; PFAM: tRNA
FT                   synthetases class II (D, K and N); TIGRFAM: lysyl-tRNA
FT                   synthetase-related protein GenX"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74707"
FT                   /db_xref="GOA:E1SPP3"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP3"
FT                   /protein_id="ADN74707.1"
FT                   /translation="MSQSWQPTATMAVLKQRAQLMGRIRDFFAERGVWEVETPCLSQAA
FT                   VTDVHLHNFDTRFVGPGAAEGIPLYLMTSPEYHMKRLLCAGSGSIFQLCRSFRNEEAGR
FT                   FHNPEFTMLEWYRVGFDHHALMDEMADLLQAVLGCGAPQRMTYAQAFEQALGVNPLEAS
FT                   LAQLKALCEQHGMGDLAEAEQDADTLLQLLFATQVESRIGQTVPAMVYHFPASQAALAR
FT                   IDEQDPRVARRFEVYFKGVELANGFHELADADEQRARFVADNAQRAAHGLPQRPIDEHL
FT                   IAALAAGLPDCAGVALGIDRLVMLALDAKAIKDVIPFPVFNA"
FT   gene            542934..543227
FT                   /locus_tag="Fbal_0494"
FT   CDS_pept        542934..543227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0494"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: Protein of unknown function (DUF2607)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74708"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP4"
FT                   /protein_id="ADN74708.1"
FT                   /translation="MVRIPRASAMIMAFWLLAIALVAPAHELSHVHDDITFSEHCDFFA
FT                   HQAQLQQLFSHQLAPLDPVTPFRWQADTLPLSPWLSLQVAYTARAPPLNSRV"
FT   sig_peptide     542934..542999
FT                   /locus_tag="Fbal_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            543287..544474
FT                   /locus_tag="Fbal_0495"
FT   CDS_pept        543287..544474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_3716 hypothetical protein; SPTR:
FT                   A2UUT0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74709"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP5"
FT                   /protein_id="ADN74709.1"
FT                   /translation="MKNRISLAVGVALAGAPFLSLAAPEGTLTNPNLSLVLDGYYQDGE
FT                   RALGEREEGFNLGHTELAISAAIDDKFYGKLTTVLETHDGETEIGLEEAFIQTLAMPGG
FT                   LSVRAGRFLSDIGYLNNQHLHTDAFVERPAAYRAFLGGHYFDDGVRINWVAPTDFYWEF
FT                   GGEAFSGDPLQAEELESVETVGVYHLYTKLGGDIGQSHSWQASLSWLRNENGQSHAGEH
FT                   DHDLEVAELADDHDHEHGHGAAFTGRDLFNVSAVYKWAPGGNYKYNHFTLSGEYFYLDA
FT                   PFEHEEGHDEEEAGPDYYDGWYLSGVYQFSPSWSAGVRYGEMSAAMLEIHDDHGHFHDA
FT                   RIKETEAMVAWHPSHFSAVRLQYTHQDLTEFGDFDDQVITLQYVMTLGAHGAHQF"
FT   sig_peptide     543287..543352
FT                   /locus_tag="Fbal_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            544458..545396
FT                   /locus_tag="Fbal_0496"
FT   CDS_pept        544458..545396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0496"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro IPR006127:
FT                   IPR018115; KEGG: sse:Ssed_0617 periplasmic solute binding
FT                   protein; PFAM: periplasmic solute binding protein; SPTR:
FT                   A2UUS9 Periplasmic solute binding protein; PFAM:
FT                   Periplasmic solute binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74710"
FT                   /db_xref="GOA:E1SPP6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL: