(data stored in ACNUC7421 zone)

EMBL: CP002213

ID   CP002213; SV 2; circular; genomic DNA; STD; PRO; 5728392 BP.
XX
AC   CP002213;
XX
PR   Project:PRJNA52019;
XX
DT   21-OCT-2010 (Rel. 106, Created)
DT   02-APR-2015 (Rel. 124, Last updated, Version 7)
XX
DE   Paenibacillus polymyxa SC2, complete genome.
XX
KW   .
XX
OS   Paenibacillus polymyxa SC2
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Paenibacillaceae; Paenibacillus.
XX
RN   [1]
RP   1-5728392
RX   DOI; 10.1128/JB.01234-10.
RX   PUBMED; 21037012.
RA   Ma M., Wang C., Ding Y., Li L., Shen D., Jiang X., Guan D., Cao F.,
RA   Chen H., Feng R., Wang X., Ge Y., Yao L., Bing X., Yang X., Li J., Du B.;
RT   "Complete genome sequence of Paenibacillus polymyxa SC2, a strain of plant
RT   growth-promoting Rhizobacterium with broad-spectrum antimicrobial
RT   activity";
RL   J. Bacteriol. 193(1):311-312(2011).
XX
RN   [2]
RP   1-5728392
RA   Du B., Ma M., Wang C., Ding Y., Li L., Shen D., Jiang X., Guan D., Cao F.,
RA   Chen H., Feng R., Wang X., Ge Y., Yao L., Bing X., Yang X., Li J.;
RT   ;
RL   Submitted (10-SEP-2010) to the INSDC.
RL   College of Life Sciences, Shandong Agricultural University, 61 Daizong
RL   Street, Taian, Shandong 271018, People's Republic of China.
XX
RN   [3]
RC   Sequence update by submitter
RP   1-5728392
RA   Du B., Hou X., Ma M., Wang C., Ding Y., Li L., Shen D., Jiang X., Guan D.,
RA   Cao F., Chen H., Feng R., Wang X., Ge Y., Yao L., Bing X., Yang X., Li J.;
RT   ;
RL   Submitted (27-MAR-2015) to the INSDC.
RL   College of Life Sciences, Shandong Agricultural University, 61 Daizong
RL   Street, Taian, Shandong 271018, People's Republic of China.
XX
DR   MD5; ee88db151405f294fe4c48f278097384.
DR   BioSample; SAMN02603854.
DR   EnsemblGenomes-Gn; PPSC2_00050.
DR   EnsemblGenomes-Gn; PPSC2_00055.
DR   EnsemblGenomes-Gn; PPSC2_00060.
DR   EnsemblGenomes-Gn; PPSC2_00425.
DR   EnsemblGenomes-Gn; PPSC2_00430.
DR   EnsemblGenomes-Gn; PPSC2_00435.
DR   EnsemblGenomes-Gn; PPSC2_00465.
DR   EnsemblGenomes-Gn; PPSC2_00745.
DR   EnsemblGenomes-Gn; PPSC2_00750.
DR   EnsemblGenomes-Gn; PPSC2_00755.
DR   EnsemblGenomes-Gn; PPSC2_00760.
DR   EnsemblGenomes-Gn; PPSC2_00765.
DR   EnsemblGenomes-Gn; PPSC2_00770.
DR   EnsemblGenomes-Gn; PPSC2_00775.
DR   EnsemblGenomes-Gn; PPSC2_00780.
DR   EnsemblGenomes-Gn; PPSC2_00785.
DR   EnsemblGenomes-Gn; PPSC2_00790.
DR   EnsemblGenomes-Gn; PPSC2_00795.
DR   EnsemblGenomes-Gn; PPSC2_00800.
DR   EnsemblGenomes-Gn; PPSC2_00805.
DR   EnsemblGenomes-Gn; PPSC2_00940.
DR   EnsemblGenomes-Gn; PPSC2_01945.
DR   EnsemblGenomes-Gn; PPSC2_01950.
DR   EnsemblGenomes-Gn; PPSC2_01955.
DR   EnsemblGenomes-Gn; PPSC2_01960.
DR   EnsemblGenomes-Gn; PPSC2_01965.
DR   EnsemblGenomes-Gn; PPSC2_01970.
DR   EnsemblGenomes-Gn; PPSC2_01975.
DR   EnsemblGenomes-Gn; PPSC2_01980.
DR   EnsemblGenomes-Gn; PPSC2_01985.
DR   EnsemblGenomes-Gn; PPSC2_01990.
DR   EnsemblGenomes-Gn; PPSC2_01995.
DR   EnsemblGenomes-Gn; PPSC2_02000.
DR   EnsemblGenomes-Gn; PPSC2_02005.
DR   EnsemblGenomes-Gn; PPSC2_02010.
DR   EnsemblGenomes-Gn; PPSC2_02015.
DR   EnsemblGenomes-Gn; PPSC2_02020.
DR   EnsemblGenomes-Gn; PPSC2_02025.
DR   EnsemblGenomes-Gn; PPSC2_02030.
DR   EnsemblGenomes-Gn; PPSC2_02035.
DR   EnsemblGenomes-Gn; PPSC2_02040.
DR   EnsemblGenomes-Gn; PPSC2_02045.
DR   EnsemblGenomes-Gn; PPSC2_02050.
DR   EnsemblGenomes-Gn; PPSC2_02055.
DR   EnsemblGenomes-Gn; PPSC2_02060.
DR   EnsemblGenomes-Gn; PPSC2_02085.
DR   EnsemblGenomes-Gn; PPSC2_02090.
DR   EnsemblGenomes-Gn; PPSC2_02095.
DR   EnsemblGenomes-Gn; PPSC2_02515.
DR   EnsemblGenomes-Gn; PPSC2_02520.
DR   EnsemblGenomes-Gn; PPSC2_02525.
DR   EnsemblGenomes-Gn; PPSC2_02530.
DR   EnsemblGenomes-Gn; PPSC2_02535.
DR   EnsemblGenomes-Gn; PPSC2_02540.
DR   EnsemblGenomes-Gn; PPSC2_02545.
DR   EnsemblGenomes-Gn; PPSC2_02550.
DR   EnsemblGenomes-Gn; PPSC2_02555.
DR   EnsemblGenomes-Gn; PPSC2_02560.
DR   EnsemblGenomes-Gn; PPSC2_02565.
DR   EnsemblGenomes-Gn; PPSC2_02570.
DR   EnsemblGenomes-Gn; PPSC2_02575.
DR   EnsemblGenomes-Gn; PPSC2_02580.
DR   EnsemblGenomes-Gn; PPSC2_02585.
DR   EnsemblGenomes-Gn; PPSC2_02590.
DR   EnsemblGenomes-Gn; PPSC2_02595.
DR   EnsemblGenomes-Gn; PPSC2_02600.
DR   EnsemblGenomes-Gn; PPSC2_02605.
DR   EnsemblGenomes-Gn; PPSC2_02610.
DR   EnsemblGenomes-Gn; PPSC2_02715.
DR   EnsemblGenomes-Gn; PPSC2_03375.
DR   EnsemblGenomes-Gn; PPSC2_03380.
DR   EnsemblGenomes-Gn; PPSC2_03385.
DR   EnsemblGenomes-Gn; PPSC2_04165.
DR   EnsemblGenomes-Gn; PPSC2_04170.
DR   EnsemblGenomes-Gn; PPSC2_04175.
DR   EnsemblGenomes-Gn; PPSC2_06330.
DR   EnsemblGenomes-Gn; PPSC2_06335.
DR   EnsemblGenomes-Gn; PPSC2_06350.
DR   EnsemblGenomes-Gn; PPSC2_06355.
DR   EnsemblGenomes-Gn; PPSC2_06360.
DR   EnsemblGenomes-Gn; PPSC2_06390.
DR   EnsemblGenomes-Gn; PPSC2_06955.
DR   EnsemblGenomes-Gn; PPSC2_07115.
DR   EnsemblGenomes-Gn; PPSC2_08385.
DR   EnsemblGenomes-Gn; PPSC2_08390.
DR   EnsemblGenomes-Gn; PPSC2_08720.
DR   EnsemblGenomes-Gn; PPSC2_09135.
DR   EnsemblGenomes-Gn; PPSC2_11120.
DR   EnsemblGenomes-Gn; PPSC2_11125.
DR   EnsemblGenomes-Gn; PPSC2_11130.
DR   EnsemblGenomes-Gn; PPSC2_11980.
DR   EnsemblGenomes-Gn; PPSC2_11985.
DR   EnsemblGenomes-Gn; PPSC2_11990.
DR   EnsemblGenomes-Gn; PPSC2_15720.
DR   EnsemblGenomes-Gn; PPSC2_15955.
DR   EnsemblGenomes-Gn; PPSC2_16110.
DR   EnsemblGenomes-Gn; PPSC2_16465.
DR   EnsemblGenomes-Gn; PPSC2_19240.
DR   EnsemblGenomes-Gn; PPSC2_19245.
DR   EnsemblGenomes-Gn; PPSC2_19250.
DR   EnsemblGenomes-Gn; PPSC2_19255.
DR   EnsemblGenomes-Gn; PPSC2_19260.
DR   EnsemblGenomes-Gn; PPSC2_19265.
DR   EnsemblGenomes-Gn; PPSC2_19270.
DR   EnsemblGenomes-Gn; PPSC2_19275.
DR   EnsemblGenomes-Gn; PPSC2_19280.
DR   EnsemblGenomes-Gn; PPSC2_19285.
DR   EnsemblGenomes-Gn; PPSC2_19290.
DR   EnsemblGenomes-Gn; PPSC2_19295.
DR   EnsemblGenomes-Gn; PPSC2_19300.
DR   EnsemblGenomes-Gn; PPSC2_19305.
DR   EnsemblGenomes-Gn; PPSC2_19535.
DR   EnsemblGenomes-Gn; PPSC2_19740.
DR   EnsemblGenomes-Gn; PPSC2_20995.
DR   EnsemblGenomes-Gn; PPSC2_21000.
DR   EnsemblGenomes-Gn; PPSC2_21005.
DR   EnsemblGenomes-Gn; PPSC2_21010.
DR   EnsemblGenomes-Gn; PPSC2_21015.
DR   EnsemblGenomes-Gn; PPSC2_21020.
DR   EnsemblGenomes-Gn; PPSC2_21025.
DR   EnsemblGenomes-Gn; PPSC2_21030.
DR   EnsemblGenomes-Gn; PPSC2_21035.
DR   EnsemblGenomes-Gn; PPSC2_21040.
DR   EnsemblGenomes-Gn; PPSC2_21045.
DR   EnsemblGenomes-Gn; PPSC2_21050.
DR   EnsemblGenomes-Gn; PPSC2_21055.
DR   EnsemblGenomes-Gn; PPSC2_21060.
DR   EnsemblGenomes-Gn; PPSC2_21065.
DR   EnsemblGenomes-Gn; PPSC2_22150.
DR   EnsemblGenomes-Gn; PPSC2_22155.
DR   EnsemblGenomes-Gn; PPSC2_22160.
DR   EnsemblGenomes-Gn; PPSC2_22165.
DR   EnsemblGenomes-Gn; PPSC2_22170.
DR   EnsemblGenomes-Gn; PPSC2_22175.
DR   EnsemblGenomes-Gn; PPSC2_22180.
DR   EnsemblGenomes-Gn; PPSC2_22185.
DR   EnsemblGenomes-Gn; PPSC2_22190.
DR   EnsemblGenomes-Gn; PPSC2_22195.
DR   EnsemblGenomes-Gn; PPSC2_22200.
DR   EnsemblGenomes-Gn; PPSC2_22205.
DR   EnsemblGenomes-Gn; PPSC2_22210.
DR   EnsemblGenomes-Gn; PPSC2_22215.
DR   EnsemblGenomes-Gn; PPSC2_22220.
DR   EnsemblGenomes-Gn; PPSC2_22225.
DR   EnsemblGenomes-Gn; PPSC2_22230.
DR   EnsemblGenomes-Gn; PPSC2_22605.
DR   EnsemblGenomes-Gn; PPSC2_22610.
DR   EnsemblGenomes-Gn; PPSC2_22615.
DR   EnsemblGenomes-Gn; PPSC2_22620.
DR   EnsemblGenomes-Gn; PPSC2_25450.
DR   EnsemblGenomes-Gn; PPSC2_25525.
DR   EnsemblGenomes-Tr; PPSC2_00050-1.
DR   EnsemblGenomes-Tr; PPSC2_00055-1.
DR   EnsemblGenomes-Tr; PPSC2_00060-1.
DR   EnsemblGenomes-Tr; PPSC2_00425-1.
DR   EnsemblGenomes-Tr; PPSC2_00430-1.
DR   EnsemblGenomes-Tr; PPSC2_00435-1.
DR   EnsemblGenomes-Tr; PPSC2_00465-1.
DR   EnsemblGenomes-Tr; PPSC2_00745-1.
DR   EnsemblGenomes-Tr; PPSC2_00750-1.
DR   EnsemblGenomes-Tr; PPSC2_00755-1.
DR   EnsemblGenomes-Tr; PPSC2_00760-1.
DR   EnsemblGenomes-Tr; PPSC2_00765-1.
DR   EnsemblGenomes-Tr; PPSC2_00770-1.
DR   EnsemblGenomes-Tr; PPSC2_00775-1.
DR   EnsemblGenomes-Tr; PPSC2_00780-1.
DR   EnsemblGenomes-Tr; PPSC2_00785-1.
DR   EnsemblGenomes-Tr; PPSC2_00790-1.
DR   EnsemblGenomes-Tr; PPSC2_00795-1.
DR   EnsemblGenomes-Tr; PPSC2_00800-1.
DR   EnsemblGenomes-Tr; PPSC2_00805-1.
DR   EnsemblGenomes-Tr; PPSC2_00940-1.
DR   EnsemblGenomes-Tr; PPSC2_01945-1.
DR   EnsemblGenomes-Tr; PPSC2_01950-1.
DR   EnsemblGenomes-Tr; PPSC2_01955-1.
DR   EnsemblGenomes-Tr; PPSC2_01960-1.
DR   EnsemblGenomes-Tr; PPSC2_01965-1.
DR   EnsemblGenomes-Tr; PPSC2_01970-1.
DR   EnsemblGenomes-Tr; PPSC2_01975-1.
DR   EnsemblGenomes-Tr; PPSC2_01980-1.
DR   EnsemblGenomes-Tr; PPSC2_01985-1.
DR   EnsemblGenomes-Tr; PPSC2_01990-1.
DR   EnsemblGenomes-Tr; PPSC2_01995-1.
DR   EnsemblGenomes-Tr; PPSC2_02000-1.
DR   EnsemblGenomes-Tr; PPSC2_02005-1.
DR   EnsemblGenomes-Tr; PPSC2_02010-1.
DR   EnsemblGenomes-Tr; PPSC2_02015-1.
DR   EnsemblGenomes-Tr; PPSC2_02020-1.
DR   EnsemblGenomes-Tr; PPSC2_02025-1.
DR   EnsemblGenomes-Tr; PPSC2_02030-1.
DR   EnsemblGenomes-Tr; PPSC2_02035-1.
DR   EnsemblGenomes-Tr; PPSC2_02040-1.
DR   EnsemblGenomes-Tr; PPSC2_02045-1.
DR   EnsemblGenomes-Tr; PPSC2_02050-1.
DR   EnsemblGenomes-Tr; PPSC2_02055-1.
DR   EnsemblGenomes-Tr; PPSC2_02060-1.
DR   EnsemblGenomes-Tr; PPSC2_02085-1.
DR   EnsemblGenomes-Tr; PPSC2_02090-1.
DR   EnsemblGenomes-Tr; PPSC2_02095-1.
DR   EnsemblGenomes-Tr; PPSC2_02515-1.
DR   EnsemblGenomes-Tr; PPSC2_02520-1.
DR   EnsemblGenomes-Tr; PPSC2_02525-1.
DR   EnsemblGenomes-Tr; PPSC2_02530-1.
DR   EnsemblGenomes-Tr; PPSC2_02535-1.
DR   EnsemblGenomes-Tr; PPSC2_02540-1.
DR   EnsemblGenomes-Tr; PPSC2_02545-1.
DR   EnsemblGenomes-Tr; PPSC2_02550-1.
DR   EnsemblGenomes-Tr; PPSC2_02555-1.
DR   EnsemblGenomes-Tr; PPSC2_02560-1.
DR   EnsemblGenomes-Tr; PPSC2_02565-1.
DR   EnsemblGenomes-Tr; PPSC2_02570-1.
DR   EnsemblGenomes-Tr; PPSC2_02575-1.
DR   EnsemblGenomes-Tr; PPSC2_02580-1.
DR   EnsemblGenomes-Tr; PPSC2_02585-1.
DR   EnsemblGenomes-Tr; PPSC2_02590-1.
DR   EnsemblGenomes-Tr; PPSC2_02595-1.
DR   EnsemblGenomes-Tr; PPSC2_02600-1.
DR   EnsemblGenomes-Tr; PPSC2_02605-1.
DR   EnsemblGenomes-Tr; PPSC2_02610-1.
DR   EnsemblGenomes-Tr; PPSC2_02715-1.
DR   EnsemblGenomes-Tr; PPSC2_03375-1.
DR   EnsemblGenomes-Tr; PPSC2_03380-1.
DR   EnsemblGenomes-Tr; PPSC2_03385-1.
DR   EnsemblGenomes-Tr; PPSC2_04165-1.
DR   EnsemblGenomes-Tr; PPSC2_04170-1.
DR   EnsemblGenomes-Tr; PPSC2_04175-1.
DR   EnsemblGenomes-Tr; PPSC2_06330-1.
DR   EnsemblGenomes-Tr; PPSC2_06335-1.
DR   EnsemblGenomes-Tr; PPSC2_06350-1.
DR   EnsemblGenomes-Tr; PPSC2_06355-1.
DR   EnsemblGenomes-Tr; PPSC2_06360-1.
DR   EnsemblGenomes-Tr; PPSC2_06390-1.
DR   EnsemblGenomes-Tr; PPSC2_06955-1.
DR   EnsemblGenomes-Tr; PPSC2_07115-1.
DR   EnsemblGenomes-Tr; PPSC2_08385-1.
DR   EnsemblGenomes-Tr; PPSC2_08390-1.
DR   EnsemblGenomes-Tr; PPSC2_08720-1.
DR   EnsemblGenomes-Tr; PPSC2_09135-1.
DR   EnsemblGenomes-Tr; PPSC2_11120-1.
DR   EnsemblGenomes-Tr; PPSC2_11125-1.
DR   EnsemblGenomes-Tr; PPSC2_11130-1.
DR   EnsemblGenomes-Tr; PPSC2_11980-1.
DR   EnsemblGenomes-Tr; PPSC2_11985-1.
DR   EnsemblGenomes-Tr; PPSC2_11990-1.
DR   EnsemblGenomes-Tr; PPSC2_15720-1.
DR   EnsemblGenomes-Tr; PPSC2_15955-1.
DR   EnsemblGenomes-Tr; PPSC2_16110-1.
DR   EnsemblGenomes-Tr; PPSC2_16465-1.
DR   EnsemblGenomes-Tr; PPSC2_19240-1.
DR   EnsemblGenomes-Tr; PPSC2_19245-1.
DR   EnsemblGenomes-Tr; PPSC2_19250-1.
DR   EnsemblGenomes-Tr; PPSC2_19255-1.
DR   EnsemblGenomes-Tr; PPSC2_19260-1.
DR   EnsemblGenomes-Tr; PPSC2_19265-1.
DR   EnsemblGenomes-Tr; PPSC2_19270-1.
DR   EnsemblGenomes-Tr; PPSC2_19275-1.
DR   EnsemblGenomes-Tr; PPSC2_19280-1.
DR   EnsemblGenomes-Tr; PPSC2_19285-1.
DR   EnsemblGenomes-Tr; PPSC2_19290-1.
DR   EnsemblGenomes-Tr; PPSC2_19295-1.
DR   EnsemblGenomes-Tr; PPSC2_19300-1.
DR   EnsemblGenomes-Tr; PPSC2_19305-1.
DR   EnsemblGenomes-Tr; PPSC2_19535-1.
DR   EnsemblGenomes-Tr; PPSC2_19740-1.
DR   EnsemblGenomes-Tr; PPSC2_20995-1.
DR   EnsemblGenomes-Tr; PPSC2_21000-1.
DR   EnsemblGenomes-Tr; PPSC2_21005-1.
DR   EnsemblGenomes-Tr; PPSC2_21010-1.
DR   EnsemblGenomes-Tr; PPSC2_21015-1.
DR   EnsemblGenomes-Tr; PPSC2_21020-1.
DR   EnsemblGenomes-Tr; PPSC2_21025-1.
DR   EnsemblGenomes-Tr; PPSC2_21030-1.
DR   EnsemblGenomes-Tr; PPSC2_21035-1.
DR   EnsemblGenomes-Tr; PPSC2_21040-1.
DR   EnsemblGenomes-Tr; PPSC2_21045-1.
DR   EnsemblGenomes-Tr; PPSC2_21050-1.
DR   EnsemblGenomes-Tr; PPSC2_21055-1.
DR   EnsemblGenomes-Tr; PPSC2_21060-1.
DR   EnsemblGenomes-Tr; PPSC2_21065-1.
DR   EnsemblGenomes-Tr; PPSC2_22150-1.
DR   EnsemblGenomes-Tr; PPSC2_22155-1.
DR   EnsemblGenomes-Tr; PPSC2_22160-1.
DR   EnsemblGenomes-Tr; PPSC2_22165-1.
DR   EnsemblGenomes-Tr; PPSC2_22170-1.
DR   EnsemblGenomes-Tr; PPSC2_22175-1.
DR   EnsemblGenomes-Tr; PPSC2_22180-1.
DR   EnsemblGenomes-Tr; PPSC2_22185-1.
DR   EnsemblGenomes-Tr; PPSC2_22190-1.
DR   EnsemblGenomes-Tr; PPSC2_22195-1.
DR   EnsemblGenomes-Tr; PPSC2_22200-1.
DR   EnsemblGenomes-Tr; PPSC2_22205-1.
DR   EnsemblGenomes-Tr; PPSC2_22210-1.
DR   EnsemblGenomes-Tr; PPSC2_22215-1.
DR   EnsemblGenomes-Tr; PPSC2_22220-1.
DR   EnsemblGenomes-Tr; PPSC2_22225-1.
DR   EnsemblGenomes-Tr; PPSC2_22230-1.
DR   EnsemblGenomes-Tr; PPSC2_22605-1.
DR   EnsemblGenomes-Tr; PPSC2_22610-1.
DR   EnsemblGenomes-Tr; PPSC2_22615-1.
DR   EnsemblGenomes-Tr; PPSC2_22620-1.
DR   EnsemblGenomes-Tr; PPSC2_25450-1.
DR   EnsemblGenomes-Tr; PPSC2_25525-1.
DR   EuropePMC; PMC3019932; 21037012.
DR   EuropePMC; PMC3156400.
DR   EuropePMC; PMC3209235; 22038959.
DR   EuropePMC; PMC4541268; 26251493.
DR   EuropePMC; PMC4615870; 26481143.
DR   EuropePMC; PMC5069919; 27756215.
DR   EuropePMC; PMC5340943; 28321410.
DR   EuropePMC; PMC5583396; 28912952.
DR   EuropePMC; PMC6204185; 30406130.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP002213.
DR   SILVA-SSU; CP002213.
XX
CC   On Mar 27, 2015 this sequence version replaced gi:309244421.
CC   Source DNA and bacteria are available from Binghai Du:
CC   bhdu@sdau.edu.cn.
CC   Annotation was added by the NCBI Prokaryotic Genome Annotation
CC   Pipeline (released 2013). Information about the Pipeline can be
CC   found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
CC   ##Genome-Annotation-Data-START##
CC   Annotation Provider          :: NCBI
CC   Annotation Date              :: 01/23/2015 14:36:26
CC   Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
CC                                   Pipeline
CC   Annotation Method            :: Best-placed reference protein set;
CC                                   GeneMarkS+
CC   Annotation Software revision :: 2.9 (rev. 456657)
CC   Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
CC                                   repeat_region
CC   Genes                        :: 5,744
CC   CDS                          :: 5,384
CC   Pseudo Genes                 :: 158
CC   rRNAs                        :: 40 ( 5S, 16S, 23S )
CC   tRNAs                        :: 161
CC   ncRNA                        :: 1
CC   Frameshifted Genes           :: 61
CC   ##Genome-Annotation-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Assembly Method       :: SMRT Analysis v. 2.3.0; HGAP Assembly v. 3
CC   Genome Coverage       :: 135x
CC   Sequencing Technology :: PacBio RS II
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5728392
FT                   /organism="Paenibacillus polymyxa SC2"
FT                   /strain="SC2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:886882"
FT   gene            25..1371
FT                   /gene="dnaA"
FT                   /locus_tag="PPSC2_00005"
FT                   /old_locus_tag="PPSC2_c0001"
FT   CDS_pept        25..1371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PPSC2_00005"
FT                   /old_locus_tag="PPSC2_c0001"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADO53989"
FT                   /db_xref="GOA:E3EDS3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDS3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279007.1"
FT                   /protein_id="ADO53989.1"
FT                   /translation="MDSHTSELWQQILSIIQTKLSKPSYDTWFKATKAAKLNDHSIVIS
FT                   APTTFAVEWLESRYTKLVGATVYEILGKHLEVKFVIEENKPAEVDLQQQPQQQPVVQEE
FT                   AVSHMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFLYGGVGLGKTHLMHAI
FT                   GHYILEHNPTSKVVYLSSEKFTNEFINAIRDNRGESFRNKYRNIDILLIDDIQFIAGKE
FT                   STQEEFFHTFNALHEERKQIIISSDRPPKEIPTLEERLRSRFEWGLITDIQPPDLETRI
FT                   AILRKKARAENLDIPNEAMMYIANQIDTNIRELEGALIRVVAYSSLTNQDVSSHLAAEA
FT                   LKDIIPSSRPKMITIQDIQHQVGEFYNLRLEDFKARKRTKAVAFPRQIAMYLSRELTDY
FT                   SLPKIGEAFGGRDHTTVIHAHEKISKSIQVDQDLFKVINNLIEKIKNPT"
FT   gene            1558..2700
FT                   /gene="dnaN1"
FT                   /locus_tag="PPSC2_00010"
FT                   /old_locus_tag="PPSC2_c0002"
FT   CDS_pept        1558..2700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN1"
FT                   /locus_tag="PPSC2_00010"
FT                   /old_locus_tag="PPSC2_c0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADO53990"
FT                   /db_xref="GOA:E3EDS4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDS4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007433252.1"
FT                   /protein_id="ADO53990.1"
FT                   /translation="MKISILKNVLNEAIQHVSKAISSRTTIPILSGIKLDVNHQGVTLT
FT                   ASDTDISIQSFIPMEDGDQTVVQIEQPGSVVLPAKFFVEIIKKLPSQEIRMEVKDQFQT
FT                   FISSGATEIQIVGLDPEEFPVLPNIEENQVISVPGDLLKNMIKQTVFSISTHETTPILT
FT                   GVLWNLAEGELKFVATDRHRLATRSAHLETSEGLRFSNVVIAGKTLNELSRIIPDQNML
FT                   VDIVVADNQVLFKVDRVLFYSRILDGTYPDTSRIIPTSYKTELIVDTKSLSESIDRAYL
FT                   LSREEKTNIVKMQSLENGDLEISSSSSELGKVREEVNVSKFEGEPLKISFNSKYMLDVL
FT                   KVIDSEQLTIAFTGIMSPIILKPADSSNALYIILPYRTTN"
FT   gene            2738..2956
FT                   /gene="yaaA"
FT                   /locus_tag="PPSC2_00015"
FT                   /old_locus_tag="PPSC2_c0003"
FT   CDS_pept        2738..2956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="PPSC2_00015"
FT                   /old_locus_tag="PPSC2_c0003"
FT                   /product="RNA-binding protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADO53991"
FT                   /db_xref="GOA:E3EDS5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDS5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368646.1"
FT                   /protein_id="ADO53991.1"
FT                   /translation="MKAISIQTEYIKLDQFLKLADCVSTGGMAKALLQEGQVRVNGEPE
FT                   ERRGRKLYPGDTVEVEDIGRFEVTAGA"
FT   gene            3011..4126
FT                   /gene="recF"
FT                   /locus_tag="PPSC2_00020"
FT                   /old_locus_tag="PPSC2_c0004"
FT   CDS_pept        3011..4126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PPSC2_00020"
FT                   /old_locus_tag="PPSC2_c0004"
FT                   /product="recombinase RecF"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADO53992"
FT                   /db_xref="GOA:E3EDS6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDS6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308098.1"
FT                   /protein_id="ADO53992.1"
FT                   /translation="MFVNNIVLQQYRNYEQLELNEFGPVNLLIGQNAQGKTNLVEAIFV
FT                   LALTKSHRTSRDKELISFGATSTHLAADVDKKYGKIRLDLSLSTQGKKAKINGLEQRKL
FT                   SDFIGSLNVVMFAPEDLEIVKGTPGVRRRFLDMEIGQVAPGYLYHLQQYQKVLVQRNNL
FT                   LKQAWGKDMASVQLMLEVWNEQLVEHGVKIVKKRKQFITKLQKWAQAIHEGIAGGTEEL
FT                   KLTYVPSFGEPEEEDEAVLLERFMIKLSQMREQEIRRGMTLAGPHRDDLAFAINGREVH
FT                   TYGSQGQQRTTALSLKLAEIELIHEEIGEYPILLLDDVLSELDPYRQTQLIETFQSKVQ
FT                   TFITATGIETLNAERLKGAHIYHVHDGHVEH"
FT   gene            4143..4394
FT                   /gene="yqbO1"
FT                   /locus_tag="PPSC2_00025"
FT                   /old_locus_tag="PPSC2_c0005"
FT   CDS_pept        4143..4394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqbO1"
FT                   /locus_tag="PPSC2_00025"
FT                   /old_locus_tag="PPSC2_c0005"
FT                   /product="yqbO1"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ADO53993"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDS7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279011.1"
FT                   /protein_id="ADO53993.1"
FT                   /translation="MYIHLGGEKIIRSSELVAIFDISIEKSSKISKQYVNHAQQQKHVE
FT                   MIGEEEAKSIVVTQNTVYYSPISSTTLKKRANQFVANA"
FT   gene            4426..6336
FT                   /gene="gyrB1"
FT                   /locus_tag="PPSC2_00030"
FT                   /old_locus_tag="PPSC2_c0006"
FT   CDS_pept        4426..6336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB1"
FT                   /locus_tag="PPSC2_00030"
FT                   /old_locus_tag="PPSC2_c0006"
FT                   /product="DNA gyrase subunit B"
FT                   /note="negatively supercoils closed circular
FT                   double-stranded DNA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADO53994"
FT                   /db_xref="GOA:E3EDS8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDS8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016822438.1"
FT                   /protein_id="ADO53994.1"
FT                   /translation="MSMNQPSYDAGEIQVLEGLEAVRKRPGMYIGSTSVKGLHHLVWEV
FT                   VDNSIDEALAGYCNSIQVVVHKDNSITVTDNGRGIPVSEHAKMKKSALEVVMTVLHAGG
FT                   KFGGGGYKVSGGLHGVGVSVVNALSSKMIVHVKRDGHVYEQEYHRGAPQYDVRVIGDTE
FT                   ETGTQTTFYPDEQIFTETTVYDYDTLQTRIRELAFLNKGIAISLTDERTGASDTFHYEG
FT                   GISEYVQFLNQKREALHEQPIYVEGSRDMIQVEVALQYNDSYTENIYSFANNINTHEGG
FT                   THESGFKSALTRIINDYARKNGLIKDNNANLTGDDVREGLTAIISVKIPEPQFEGQTKT
FT                   KLGNSEVRGIVESLFAEKLQEFLEENPSVSRRVVDKSLQAARAREAARKARELTRRKSA
FT                   LEISSLPGKLADCSSKDASISELYIVEGDSAGGSAKQGRDRHFQAILPIRGKILNVEKA
FT                   RLDRILSSDEIRSMVTAMGTGIGDDFDITKARYHKVIIMTDADVDGAHIRTLLLTFFYR
FT                   YMRKIIDAGYIYIAQPPLFKVERNKVVRYANSEAERDEIIKEFGENAKYNVQRYKGLGE
FT                   MNATQLWETTMDPESRTMLQVTVSDAMLADTLFNTLMGDNVEPRRDFIQEHAKYVKNLD
FT                   F"
FT   gene            complement(6479..7306)
FT                   /gene="yheD3"
FT                   /locus_tag="PPSC2_00035"
FT                   /old_locus_tag="PPSC2_c0007"
FT   CDS_pept        complement(6479..7306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yheD3"
FT                   /locus_tag="PPSC2_00035"
FT                   /old_locus_tag="PPSC2_c0007"
FT                   /product="endospore coat-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADO53995"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDS9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279013.1"
FT                   /protein_id="ADO53995.1"
FT                   /translation="MSIQRVSSKWAKTNAILPHPTLAAYIPETRLYTFEHLNEMLAVYG
FT                   TVYIKPDNGTYGKGVMRAERQTEQLPPTEEGIIEERTWYVLRYEVDILTFESLDELHRV
FT                   VSSRIKKRPYLIQRGIPLLQHEARPFDLRVLTQMNLRHQWETTLIVGRVAAPDKVVTNH
FT                   HSGGTTRFFNELVAPYMDVKEAVRLEQKLSKMGERVAWQLQKRYPRLREIGLDVGLDQQ
FT                   NYPWILEVNTRPAIKVFASLPNKSLYHKIFRYAVGYGRYTASTGKPVRSKKKA"
FT   gene            7773..10337
FT                   /gene="gyrA1"
FT                   /locus_tag="PPSC2_00040"
FT                   /old_locus_tag="PPSC2_c0008"
FT   CDS_pept        7773..10337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA1"
FT                   /locus_tag="PPSC2_00040"
FT                   /old_locus_tag="PPSC2_c0008"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADO53996"
FT                   /db_xref="GOA:E3EDT0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDT0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368650.1"
FT                   /protein_id="ADO53996.1"
FT                   /translation="MADQNNSQIINRDIGVEMRESFMDYAMSIIVSRALPDVRDGLKPV
FT                   HRRILYAMSELGMSPDKPYKKSARIVGEVIGKYHPHGDTAVYDTMVRMAQDFSLRYMLV
FT                   DGHGNFGSVDGDMAAAMRYTEARLSKIAMEMLRDLNKETVDFMPNYDGEENEPVVLPAR
FT                   YPNLLVNGVGGIAVGMATNIPPHNLGEVIDGVQALIENPDITPMELMDYIQGPDFPTAG
FT                   YILGRSGIRQAYQTGRGSVTMRAKTTIEEIGNKARIIVHELPYQVNKARLVEKIAELVR
FT                   DKRIEGITDLRDESDRTGMRIVIELRRDVNPNVVLNNLFKHTAMQSNFGINMLAIVNNE
FT                   PKILNLKDVLYYYLKHQIEVIRRRTEFDLKKAEARAHILEGLRIALDHLDEVISLIRSS
FT                   QTAEAAREGLIERFSLTLEQAQAILDMRLQRLTGLEREKIENEYNELIQKIMEYREILA
FT                   NEHLVLNIISEELNELKGRFADDRRTEITVGEESILDEDLIPREDVIITVTHTGYIKRL
FT                   PVTTYRSQKRGGRGVVGMDTKDEDFVEHLFITNSHHHLLFFTDKGKVYRIKAYEIPDLS
FT                   RTARGTPIINLIQIEQGESINAVIPIEEFVEDSYLFFATQHGIIKKTPLDDYANIRKGG
FT                   LIAINLREDDALIEVKLTDGQQEMIIGTAQGMSIRFPESDVRSMGRSATGVKGISLDES
FT                   DAVIGMDIVNTDLDILIVTAKGYGKRTPAVDYRIQSRGGKGIKTINVTDKNGPVVGLKV
FT                   VKAEEDLMIITASGTLIRTSMGEISTMGRNTQGVRLINIRDDDSVATVCRANKNEEQDE
FT                   LLEDLLEDGGTGEEPTLSSAEPTLEVNTEDTEGNDSESSEDE"
FT   gene            10545..11633
FT                   /gene="M1-161"
FT                   /locus_tag="PPSC2_00045"
FT                   /old_locus_tag="PPSC2_c0009"
FT   CDS_pept        10545..11633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-161"
FT                   /locus_tag="PPSC2_00045"
FT                   /old_locus_tag="PPSC2_c0009"
FT                   /product="HD family phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADO53997"
FT                   /db_xref="GOA:E3EDT2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDT2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368652.1"
FT                   /protein_id="ADO53997.1"
FT                   /translation="MTTVPVSELKAGLKLQSDVFTEMGSLLLPKGRILLPRDLEILEAF
FT                   LIQQVEVGTDDIAKSGSEPTTVRSGTAESQGASLDGRDESEQFQDEYDKMVMLVKNAFQ
FT                   SVLVSNLSIYELRGQLESLLAHIQRYNVMTYTPPAMIEVDYIFHNAVLTSLTSYSIAQW
FT                   IGLPQKDWMQVAFAGLLHDIGNAKMDPSILYKPSQLTQEEQEEVRRHTSLGYQLLKNVK
FT                   AINEGVRLAALQHHEKVDGTGYPLRLKGEQIHIYAKIVGVADVFHAMTLEKTYRPAQSP
FT                   YLVLEQIKSESFGKLDPSVVQVFIQKLTQFNNGTKVRLNDNRTGEIIFADRDHPTRPLI
FT                   QVDGEIINLMLQREIYIECIVT"
FT   gene            11961..13519
FT                   /locus_tag="PPSC2_00050"
FT                   /old_locus_tag="PPSC2_r001"
FT   rRNA            11961..13519
FT                   /locus_tag="PPSC2_00050"
FT                   /old_locus_tag="PPSC2_r001"
FT                   /product="16S ribosomal RNA"
FT   gene            13800..16728
FT                   /locus_tag="PPSC2_00055"
FT                   /old_locus_tag="PPSC2_r002"
FT   rRNA            13800..16728
FT                   /locus_tag="PPSC2_00055"
FT                   /old_locus_tag="PPSC2_r002"
FT                   /product="23S ribosomal RNA"
FT   gene            16872..16988
FT                   /locus_tag="PPSC2_00060"
FT                   /old_locus_tag="PPSC2_r003"
FT   rRNA            16872..16988
FT                   /locus_tag="PPSC2_00060"
FT                   /old_locus_tag="PPSC2_r003"
FT                   /product="5S ribosomal RNA"
FT   gene            17221..17640
FT                   /gene="M1-162"
FT                   /locus_tag="PPSC2_00065"
FT                   /old_locus_tag="PPSC2_c0011"
FT   CDS_pept        17221..17640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-162"
FT                   /locus_tag="PPSC2_00065"
FT                   /old_locus_tag="PPSC2_c0011"
FT                   /product="M1-162"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADO53999"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDT3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368653.1"
FT                   /protein_id="ADO53999.1"
FT                   /translation="MRRNKWLALLVLFSVAVAILTGCVEEEPSWTSFEGAANEKTFPVP
FT                   KEASKTDRASSNSDMDYVRYALPALKESDSLPAPYLEEIAAWGWTEEPNLSTSNQKVFQ
FT                   KNKHMVHLSVHDGSFTVLVPKDRKATVKSKSVDLN"
FT   gene            complement(18004..18531)
FT                   /locus_tag="PPSC2_00070"
FT                   /old_locus_tag="PPSC2_c0012"
FT   CDS_pept        complement(18004..18531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_00070"
FT                   /old_locus_tag="PPSC2_c0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54000"
FT                   /db_xref="GOA:E3EDT4"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDT4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007427994.1"
FT                   /protein_id="ADO54000.1"
FT                   /translation="MTEETGTKATYYHYKLIKKINIPRQLIWSHLTLPVIMLLFLLLAF
FT                   SWTSVFLFALAFFLTLWVHFVISRSVLYIGGGTAFRKRWAFQRRLPWLGYMTDQYIGYR
FT                   IFRRVHIHTLWIGICLSAVFILWSPPAFTVSLLFWHLWLIAPRLYVLSRLTGERKDGML
FT                   KFTDEEASYYQQ"
FT   gene            18931..19116
FT                   /gene="csfB"
FT                   /locus_tag="PPSC2_00075"
FT                   /old_locus_tag="PPSC2_c0014"
FT   CDS_pept        18931..19116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csfB"
FT                   /locus_tag="PPSC2_00075"
FT                   /old_locus_tag="PPSC2_c0014"
FT                   /product="inhibitor of sigma-G Gin"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54002"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDT6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368656.1"
FT                   /protein_id="ADO54002.1"
FT                   /translation="MHDQGDHRCIICGQHKHEGIFIVSEFICDTCEAEMVHTDATDAKY
FT                   HFFIDQLKQIWVQKNA"
FT   gene            19261..20844
FT                   /gene="yaaO"
FT                   /locus_tag="PPSC2_00080"
FT                   /old_locus_tag="PPSC2_c0015"
FT   CDS_pept        19261..20844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaO"
FT                   /locus_tag="PPSC2_00080"
FT                   /old_locus_tag="PPSC2_c0015"
FT                   /product="amino acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54003"
FT                   /db_xref="GOA:E3EDT7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDT7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685729.1"
FT                   /protein_id="ADO54003.1"
FT                   /translation="MMGKKTVHAPLVEALIRYSSQGNASFHVPGHKNGQVYRHEEMASL
FT                   LQEVMSIDATEITGLDDLHHPEDVIREGQELAAKCFGAEESFWLIGGSTVGNLAMILTV
FT                   CTKPGDVLLVQRNVHKSVLNGLMLSGAEAVFLDPEIDTLSGLAVAPSTDTIKAALKDYP
FT                   SAKGVLLTLPNYYGMGRDLTATAKACHAADVPLMVDEAHGAHYGLHPRLPFSALSCGAD
FT                   VVVQSTHKMLPAMTMGAMLHVQGRRIHRELLRQRLAMVQSSSPSYPLMASLDLARWYID
FT                   AYGTDAFTEGLAAADAFRKGLAQLPRFRLVEPTQQASEKCDAQKGISEALERAEERTNG
FT                   YSTQDPFKMVLYDTWGVLDGFGLKRELETYGCIPEMSDEKHVVLLFTLGSIARDVSHLL
FT                   QALVHINNDIRFKGTAEEPELAGKEQQRLELDFSTWNNDGMKAYSSPVQFGLQPIDPDQ
FT                   MEIVPVEESAGRTAAEMIIPYPPGIPLLYAGEMITEAIALRMVRLRELGAKWQGVADES
FT                   MLTIRVFRLQ"
FT   gene            20947..21594
FT                   /gene="tmk"
FT                   /locus_tag="PPSC2_00085"
FT                   /old_locus_tag="PPSC2_c0016"
FT   CDS_pept        20947..21594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="PPSC2_00085"
FT                   /old_locus_tag="PPSC2_c0016"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54004"
FT                   /db_xref="GOA:E3EDT8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDT8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427070.1"
FT                   /protein_id="ADO54004.1"
FT                   /translation="MNRKGIFITLEGGDGSGKTTMIQRLAKYMEEEGHPVVTTREPGGI
FT                   EISEKIRSIILDPAHTSMDARTEALLYAAARRQHLVEKVKPAIEQGAIVLCDRFVDSSL
FT                   VYQGFARGIGIEEVASINRFAVDDWEPDATFYLDIEPELGLARINASRGEEMDRLDMES
FT                   ISFHHKVREAYLELARKFPERITIVDASPAPEQVEQVLKDLLKKRFIQNFSV"
FT   gene            21668..21997
FT                   /gene="yaaQ"
FT                   /locus_tag="PPSC2_00090"
FT                   /old_locus_tag="PPSC2_c0017"
FT   CDS_pept        21668..21997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaQ"
FT                   /locus_tag="PPSC2_00090"
FT                   /old_locus_tag="PPSC2_c0017"
FT                   /product="yaaQ"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54005"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDT9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019640047.1"
FT                   /protein_id="ADO54005.1"
FT                   /translation="MKLIIAIVQDKDSNRLSSGLVKANFRATKLASTGGFLRAGNTTFM
FT                   IGVDDNQVDSLMNVIRSSCKVREQLVTPVTPMSGTTDSYLPLPVEVQVGGATVFVMPVD
FT                   RFEHF"
FT   gene            22194..22637
FT                   /gene="yaaR"
FT                   /locus_tag="PPSC2_00095"
FT                   /old_locus_tag="PPSC2_c0018"
FT   CDS_pept        22194..22637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaR"
FT                   /locus_tag="PPSC2_00095"
FT                   /old_locus_tag="PPSC2_c0018"
FT                   /product="yaaR"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54006"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDU0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279021.1"
FT                   /protein_id="ADO54006.1"
FT                   /translation="MKINPGYRPLHSTLSTNETSAKPIQPKSFSDVMQQNGEQASKEEL
FT                   NRRFKEIQMQGDRLARSMTIRELKAYKMLVKRFLEDTVRRGVSMKDTKGWDRRGRSKRY
FT                   KLIDEVDELLLKMADELLDTEQGKIELLQGVGEIRGLLINLSF"
FT   gene            22889..23884
FT                   /gene="holB"
FT                   /locus_tag="PPSC2_00100"
FT                   /old_locus_tag="PPSC2_c0019"
FT   CDS_pept        22889..23884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="PPSC2_00100"
FT                   /old_locus_tag="PPSC2_c0019"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54007"
FT                   /db_xref="GOA:E3EDU2"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDU2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818930.1"
FT                   /protein_id="ADO54007.1"
FT                   /translation="MSFQHILGQDVAKKMLQSALRNHTVSHAYVFSGPQGSGQMNMAQT
FT                   FAKALFCEKQTDDACGECLSCRKVEHGNHPDLHIVEPDGATIKIDQIRGLQRIFSYKSE
FT                   SSNPKVYIIRQADTMTVQAANSLLKFLEEPQIPVVGILISENGQALLPTIQSRTQQVPF
FT                   HALQPEMMMQALIGEGYTAGLVRSVVHMASGLESCREILQQNWFAEIRNVVLQLVKESM
FT                   SRGSSSIILAQQKIFKTGLSDHLDILFHLFHLWFKDMLHFRYGRHESIVFIDHLESVSK
FT                   LAITRSTEQWVSYMDLAANCRKKLRFHVNGQLCVEQLLIGLSDTSGSITG"
FT   gene            24023..24823
FT                   /gene="yaaT"
FT                   /locus_tag="PPSC2_00105"
FT                   /old_locus_tag="PPSC2_c0021"
FT   CDS_pept        24023..24823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaT"
FT                   /locus_tag="PPSC2_00105"
FT                   /old_locus_tag="PPSC2_c0021"
FT                   /product="stage 0 sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54009"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDU3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279023.1"
FT                   /protein_id="ADO54009.1"
FT                   /translation="MYSVVGVRFKKAGKTYYFDPLDLPVEKENCVIVETARGIEYGKVV
FT                   VGKKEVNDSDVVLPLKKVIRIAGDDDALVVEENKLAAKDAFGTCLNKIKDHNLKMKLVD
FT                   VEFTFDRNKIIFYFTAEGRVDFRELVKDLASIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   ILCCSSWLGDFDPVSIKMAKDQSLSLNPTKISGLCGRLMCCLKFEHDNYESMREELPQV
FT                   GKMVITSLGEGKVVGVNAGHRTVHVQLFEISKVKELPMDDVVVK"
FT   gene            24851..25225
FT                   /gene="yabA"
FT                   /locus_tag="PPSC2_00110"
FT                   /old_locus_tag="PPSC2_c0022"
FT   CDS_pept        24851..25225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="PPSC2_00110"
FT                   /old_locus_tag="PPSC2_c0022"
FT                   /product="DNA replication initiation control protein YabA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54010"
FT                   /db_xref="GOA:E3EDU4"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDU4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818929.1"
FT                   /protein_id="ADO54010.1"
FT                   /translation="MDKLNVFARIHEMETQMGQLHSDLGELKLAVKELLEENQRLTIEN
FT                   EQVRKMLKRETSGEEKTASKPKLPPPIVVKDEEETGEVVGEGYDNLARLYHEGFHICNV
FT                   YYGHLRTEGDCLFCLSFLNK"
FT   gene            25314..26072
FT                   /gene="M1-171"
FT                   /locus_tag="PPSC2_00115"
FT                   /old_locus_tag="PPSC2_c0023"
FT   CDS_pept        25314..26072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-171"
FT                   /locus_tag="PPSC2_00115"
FT                   /old_locus_tag="PPSC2_c0023"
FT                   /product="M1-171"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54011"
FT                   /db_xref="GOA:E3EDU5"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDU5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368664.1"
FT                   /protein_id="ADO54011.1"
FT                   /translation="MYENEKKSERIDDLLSHNLRIIQSDEVFSFSMDAVLLARFAGIPL
FT                   QRGKILDLCTGNGVVPILLTTRTKASIEGIEIQPRLADMARRSVSLNGLEDAIEIREGD
FT                   LRELVQITGHGAYDAITVNPPYMPLNGSDIKLNPHQAIARHEVNCTLEEVIQACTRLVR
FT                   NGGKVSMVHRPQRLAEIISLMRSYSLEPKRIRFVHPRIHMEANMVLVEAMRDGKPEVRL
FT                   LPPLIVYQEDGNYTQEIREIYGEVSKEDSV"
FT   gene            26069..26950
FT                   /gene="M1-172"
FT                   /locus_tag="PPSC2_00120"
FT                   /old_locus_tag="PPSC2_c0024"
FT   CDS_pept        26069..26950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-172"
FT                   /locus_tag="PPSC2_00120"
FT                   /old_locus_tag="PPSC2_c0024"
FT                   /product="16S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54012"
FT                   /db_xref="GOA:E3EDU6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDU6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368665.1"
FT                   /protein_id="ADO54012.1"
FT                   /translation="MTAAVQKSFSNREEERGKLYLVATPIGNLDDMTFRAINTLKSCNI
FT                   IAAEDTRQTRKLLTHFDITPDMLFSYHEHNKAASGPELIRYIIEGKNLALVSDAGLPAI
FT                   SDPGSDLVKLALEAEISVIPIPGANAALSALIASGLDTERFTFAGFPPREKKDLEKLLL
FT                   SFQVSHGTILFYESPHRIVRTLTVLKETLGSRKVVLARELTKLHEEWVRGTVEQCLAKL
FT                   EENPPLGEYCLIVEGKNEEEEEQERQAWWQDLSLESHVAHYESEGLTRKDAMKRTATDR
FT                   SISKRDVYNALL"
FT   gene            complement(27075..27329)
FT                   /gene="abrB3"
FT                   /locus_tag="PPSC2_00125"
FT                   /old_locus_tag="PPSC2_c0025"
FT   CDS_pept        complement(27075..27329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB3"
FT                   /locus_tag="PPSC2_00125"
FT                   /old_locus_tag="PPSC2_c0025"
FT                   /product="AbrB family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54013"
FT                   /db_xref="GOA:E3EDU7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDU7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019006085.1"
FT                   /protein_id="ADO54013.1"
FT                   /translation="MMKSTGIVRKVDELGRVVIPIELRRTLGIGEKDALEIYVDGERIM
FT                   LKKYEPACIFCGNAENVIYFKGKIVCQDCISEIPTPVTN"
FT   gene            27660..28943
FT                   /gene="ywfO"
FT                   /locus_tag="PPSC2_00130"
FT                   /old_locus_tag="PPSC2_c0026"
FT   CDS_pept        27660..28943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywfO"
FT                   /locus_tag="PPSC2_00130"
FT                   /old_locus_tag="PPSC2_c0026"
FT                   /product="ywfO"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54014"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDU8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368666.1"
FT                   /protein_id="ADO54014.1"
FT                   /translation="MHQPLSEEKVFKDPVHNYIHVQDTVIWRLINTPEFQRLRRIRQLG
FT                   TSYLTFHGAEHSRFSHSLGVYEITRRIISQFERGDFPDWPKEERLIALCAALLHDVGHG
FT                   PFSHSIEEAFHMNHEDWTCRIVLGDTKINAVLRQVDEMLPHKVAAVIAKTYDKPIVVNL
FT                   VTSPLDADRMDYLLRDAHSTGVNYGTIDLDRILRLLRPHNGRIVVKESGMHAVEDYLMS
FT                   RYQMYWQIYFHPVTRSSEILLRKIFKRAKELFKYGYEFGFLLDPLPDLLKGELTVEQYL
FT                   MLDESLIQTVFSQWKREKDEILSDLSSRFMDRRLYKYVEIENMDTDTVDHIREALEKAG
FT                   LHPEYDLEIDFPTDLPYDVFRQGGSTDNQILLLGRQGEVREISEVSEIVRSISGIHRGK
FT                   YHMYFPQNKLNGVKERLPAEIGNYFVKQ"
FT   gene            28977..29756
FT                   /gene="yabD"
FT                   /locus_tag="PPSC2_00135"
FT                   /old_locus_tag="PPSC2_c0027"
FT   CDS_pept        28977..29756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabD"
FT                   /locus_tag="PPSC2_00135"
FT                   /old_locus_tag="PPSC2_c0027"
FT                   /product="hydrolase TatD"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54015"
FT                   /db_xref="GOA:E3EDU9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDU9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685732.1"
FT                   /protein_id="ADO54015.2"
FT                   /translation="MKTLDLFDTHTHLDAPQFDEDREEVIARAVESGVTRMINIGFNRE
FT                   TIPSTMKLAETYDFIYAAVGWHPQDAITMQEGDLEWIASLCSHKKVVAIGEIGLDYYWD
FT                   TSPKDVQQRVLRNQIGLARELKMPIVIHNRDAHEDIVRILREEKAGEIGGVMHSFSGSW
FT                   ETAKMVLDMGFHLSFGGPITFKNAKQPKEVLAQVPLNRLLIETDAPYLTPHPFRGKRNE
FT                   SAHVRLVAEAAAQIKGITVEELVSITTQNALERFDIQ"
FT   gene            30508..31656
FT                   /gene="yabE"
FT                   /locus_tag="PPSC2_00140"
FT                   /old_locus_tag="PPSC2_c0028"
FT   CDS_pept        30508..31656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabE"
FT                   /locus_tag="PPSC2_00140"
FT                   /old_locus_tag="PPSC2_c0028"
FT                   /product="yabE"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54016"
FT                   /db_xref="GOA:E3EDV0"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDV0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308116.1"
FT                   /protein_id="ADO54016.1"
FT                   /translation="MGIFRKEETHESRSSSMSYVLRWKQENVRQAALVAIFLIALTIMI
FT                   SILMYTQSKKQVFFVIDGKASAVETRESKLQDLLNEHSISLQPHDTISMPLNGAVQDGD
FT                   RVVIKRANQVKVSSGNETKKLYTTENTVEGAIRTSGYKLSSTDKVYPALDASVSANMDI
FT                   KIVRVKKQQVEQKKQVPYQVIKTADPSLYKGDNRVIQSGKSGVVVQHVQKVYHDGKLVS
FT                   KQLVNKEVAQNRVDKVIAVGTKKKPVVLAASIGPKDAVKATKVSSGSAVRKAGINFNYK
FT                   KVLQNVSMTAYSAQEPGIGTRTASGTRVTEGRTIAVDPNVIPIGWWVYIEGVGFRRAED
FT                   TGGAIKGHKIDVYYESLSRANQFGRKHGKTVYVIGPVKPEIN"
FT   gene            31802..32347
FT                   /gene="rnmV"
FT                   /locus_tag="PPSC2_00145"
FT                   /old_locus_tag="PPSC2_c0029"
FT   CDS_pept        31802..32347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="PPSC2_00145"
FT                   /old_locus_tag="PPSC2_c0029"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54017"
FT                   /db_xref="GOA:E3EDV1"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDV1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308117.1"
FT                   /protein_id="ADO54017.1"
FT                   /translation="MIKEVIVVEGRDDTVAIRRAVEADTIETGGSAINKMTLRKIALAQ
FT                   ERRGVIILTDPDHAGERIRKIIASKVPGCKQAFIPEAEATRKGDIGVENASPEAIRHAL
FT                   ARVHTTVEGAEPLIEMADLIDAGLITHPNAAARRMALGNVLGIGYCNGKQLHKRLSVFQ
FT                   ISREEFASALAQIESEGL"
FT   gene            32355..33239
FT                   /gene="ksgA"
FT                   /locus_tag="PPSC2_00150"
FT                   /old_locus_tag="PPSC2_c0030"
FT   CDS_pept        32355..33239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="PPSC2_00150"
FT                   /old_locus_tag="PPSC2_c0030"
FT                   /product="16S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54018"
FT                   /db_xref="GOA:E3EDV2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDV2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427066.1"
FT                   /protein_id="ADO54018.1"
FT                   /translation="MTGIQDIATPRRTKEIIQRHGFSFKKSLGQNFLIDQNILSKIVNA
FT                   AGLDDTKGALEIGPGIGALTEKLAQSAKAVTAVEIDQRLLPILEEVLAPYEHVKVRHGD
FT                   VLKLDLREVFAADFADVSKVSVVANLPYYVTTPILMRLLEDKLPLENIVVMIQKEVAER
FT                   MAASPGTKDYGSLSIAVQYYSEPELVCTVPNTVFIPQPNVDSAVIRLRVREVPPVEVVD
FT                   EKHFFEVVHAAFAQRRKTISNNLKSRFFTKENRDTLEPLLQQADIEPSRRGETLSIEEF
FT                   ARLSAVLLEAGIS"
FT   gene            33295..34191
FT                   /gene="yabG"
FT                   /locus_tag="PPSC2_00155"
FT                   /old_locus_tag="PPSC2_c0031"
FT   CDS_pept        33295..34191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabG"
FT                   /locus_tag="PPSC2_00155"
FT                   /old_locus_tag="PPSC2_c0031"
FT                   /product="sporulation peptidase YabG"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54019"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDV3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368671.1"
FT                   /protein_id="ADO54019.2"
FT                   /translation="MSLGDLVVRKSYGGDVTFRVEDIQRDKAIIKGTEFRLLADSPVND
FT                   LVRVPADQISGKTQQAHIKAGESLNLLQRARQQQAARSQAALIGEWSDPVESTYFEMPG
FT                   KVLHLDGDPGYLRKCLSLYEQLRVPAEGHHVHESAMADTLYRLLPRIRPDIVVITGHDG
FT                   VLKQPQPYDLYSLKSYKNSQNFVAAIQVARQYERHLDSLTIVAGACQSHFEALLRAGAN
FT                   FASSPGRILIHALDPVYVAAKAAFTSIRDTVNMGDLFHQTISGSRGVGGIETRGSYRIG
FT                   LPKLENLSTLKVTPSAI"
FT   gene            34387..34668
FT                   /gene="veg"
FT                   /locus_tag="PPSC2_00160"
FT                   /old_locus_tag="PPSC2_c0032"
FT   CDS_pept        34387..34668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="PPSC2_00160"
FT                   /old_locus_tag="PPSC2_c0032"
FT                   /product="Veg protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54020"
FT                   /db_xref="GOA:E3EDV4"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDV4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308120.1"
FT                   /protein_id="ADO54020.1"
FT                   /translation="MAKNTLLEIKRSLDAHVGQKILLRANGGRRKTVERTGVLEETYPS
FT                   VFIVKLDQEQQTFKRVSYSYADILTESVEVSVYDPDSHTSVVEYFETP"
FT   gene            34834..35013
FT                   /gene="sspF"
FT                   /locus_tag="PPSC2_00165"
FT                   /old_locus_tag="PPSC2_c0033"
FT   CDS_pept        34834..35013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="PPSC2_00165"
FT                   /old_locus_tag="PPSC2_c0033"
FT                   /product="protein sspF"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54021"
FT                   /db_xref="GOA:E3EDV5"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDV5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010349533.1"
FT                   /protein_id="ADO54021.1"
FT                   /translation="MSRRRRSVMSEELKYELAKDLGFYDTVKEEGWGGIKAKDAGNMVK
FT                   RAIQLAEQAASRKS"
FT   gene            35158..36012
FT                   /gene="ispE"
FT                   /locus_tag="PPSC2_00170"
FT                   /old_locus_tag="PPSC2_c0034"
FT   CDS_pept        35158..36012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="PPSC2_00170"
FT                   /old_locus_tag="PPSC2_c0034"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="An essential enzyme in the nonmevalonate pathway of
FT                   isopentenyl diphosphate and dimethylallyl diphosphate
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54022"
FT                   /db_xref="GOA:E3EDV6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDV6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308121.1"
FT                   /protein_id="ADO54022.1"
FT                   /translation="MKIYEKAPAKINLMLDVLRKRDDGYHEVEMIMTMVDLSDRLTMSE
FT                   LPRDTIIISSQAGYIPLDEKNLAFQAARLIKERYNVSTGVHIHLDKHIPVAAGLAGGSS
FT                   DAAAALRGLNKLWKLGISDAELRVLGAELGSDVPFCITGGTALASGRGELLKPLPNPPQ
FT                   CWVILAKPPINVSTAEVYGRVKADQITHHPSARQMEQAIRNASFTDVCNTLGNVLEDVT
FT                   LKLYPEVEHLKNSMIRLGADGVLMSGSGPTVFGLVSKEAKVPRIYNGLRGFCKDVYAVR
FT                   LLT"
FT   gene            36194..37033
FT                   /gene="purR9"
FT                   /locus_tag="PPSC2_00175"
FT                   /old_locus_tag="PPSC2_c0035"
FT   CDS_pept        36194..37033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR9"
FT                   /locus_tag="PPSC2_00175"
FT                   /old_locus_tag="PPSC2_c0035"
FT                   /product="purine operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54023"
FT                   /db_xref="GOA:E3EDV7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDV7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368673.1"
FT                   /protein_id="ADO54023.1"
FT                   /translation="MKKLKRSSRLVEMTQFLLSRPHTLVPLTHFADRYGAAKSSISEDL
FT                   AIIKEVFEDEGTGELLTLAGAAGGVKLIPRLSKQHALAFANDLCAQLEQPDRILPGGYL
FT                   YLSDLLGQPAMMNEAGKIFATAFADRQIDVVMTVETKGIPLAYATGAQLNLPVVLVRRD
FT                   HQVTEGSAVSINYVSGSQKSLHTMSLSRRAMREKSRVLIVDDFMKAGGTIQGMVDLLAE
FT                   FDAEVAGVGVLVESGEVENEERLLHDYISLANLTAVDSRSKQITVKLGNYFDELTGQ"
FT   gene            37197..37484
FT                   /gene="spoVG"
FT                   /locus_tag="PPSC2_00180"
FT                   /old_locus_tag="PPSC2_c0036"
FT   CDS_pept        37197..37484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="PPSC2_00180"
FT                   /old_locus_tag="PPSC2_c0036"
FT                   /product="septation protein spoVG"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54024"
FT                   /db_xref="GOA:E3EDV8"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDV8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010279400.1"
FT                   /protein_id="ADO54024.1"
FT                   /translation="MQITDVRLRRVNSEGRMKAIASITIDNEFVVHDIRVIDGNNGMFV
FT                   AMPSKRTPDGEFRDIAHPISSGTREKIQAAVLTEYERAAVDEEVAIEEGA"
FT   gene            37833..39227
FT                   /gene="gcaD"
FT                   /locus_tag="PPSC2_00185"
FT                   /old_locus_tag="PPSC2_c0038"
FT   CDS_pept        37833..39227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="PPSC2_00185"
FT                   /old_locus_tag="PPSC2_c0038"
FT                   /product="bifunctional N-acetylglucosamine-1-phosphate
FT                   uridyltransferase/glucosamine-1-phosphate
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.157"
FT                   /note="forms a homotrimer; catalyzes the acetylation of
FT                   glucosamine-1-phosphate and uridylation of
FT                   N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
FT                   function in cell wall synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54026"
FT                   /db_xref="GOA:E3EDW0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDW0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685734.1"
FT                   /protein_id="ADO54026.2"
FT                   /translation="MERLAVILAAGQGKRMKSKLYKVLHPVCGKPMVGHVLDTVREIGV
FT                   SRSVVVVGHGAEAVQSYLGPSAEYALQAEQLGTGHAVKQAKDLLGQEQGTTIVICGDTP
FT                   LITAETLEGLVQLHESRGAAATILTAELDNPKGYGRVIRDTSGAVLKIVEQKDCSPEED
FT                   AVREINTGTYCFDNAKLFAALDKVTNTNAQQEYYLTDVIGILHGEGEQVEAYLTNDVSE
FT                   SIGVNDRVALSVAEGYMRERIVRKHMLNGVTVIDPSSTYIGSDVVIGSDTVLHPNTWLH
FT                   GQTQIGEDCVIGPQAEIQNTVIHSGATVKHSVLNEAEVGSSTSVGPFAYLRPGAKLGEH
FT                   VKIGDFVEVKNATIGDHSKVSHLSYVGDAKVGTNVNIGCGAITVNYDGYNKSITEIEDD
FT                   AFVGSNVNLIAPIKIGKGAYVVAGSTVTHAVPDNDLAIARPRQENKAGYADKIRARAKA
FT                   KKKRSE"
FT   gene            39287..40240
FT                   /gene="prs"
FT                   /locus_tag="PPSC2_00190"
FT                   /old_locus_tag="PPSC2_c0039"
FT   CDS_pept        39287..40240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="PPSC2_00190"
FT                   /old_locus_tag="PPSC2_c0039"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54027"
FT                   /db_xref="GOA:E3EDW1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDW1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018888047.1"
FT                   /protein_id="ADO54027.1"
FT                   /translation="MTYCDSKLKIFTCNSNPKLAHQIADYIGIPMGESHTTSFSDGEIQ
FT                   VKLSESVRGCHVYIVQSTCLPVNDNLMELLVMIDALKRASAKSINVVMPYYGYARQDRK
FT                   ARSRDPITAKLVANLIEKAGAHRVISMDLHAMQIQGFFDIPVDHMLGAPILAQYFRSKQ
FT                   IENPIVVSPDHGGVVRARKLADFLSAPLAIIDKRRPEPNVSEVMNIIGNIEGKTAILID
FT                   DIIDTAGTIVLGANALKEGGVKDVYACCTHAVLSGPAMERLENSPLKEVVVTDTIPIVH
FT                   PNPTSKLKVLSVAPLMGEAIIRVHEELSISKLFEIE"
FT   gene            complement(40309..40509)
FT                   /gene="M1-188"
FT                   /locus_tag="PPSC2_00195"
FT                   /old_locus_tag="PPSC2_c0040"
FT   CDS_pept        complement(40309..40509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-188"
FT                   /locus_tag="PPSC2_00195"
FT                   /old_locus_tag="PPSC2_c0040"
FT                   /product="M1-188"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54028"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDW2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279038.1"
FT                   /protein_id="ADO54028.1"
FT                   /translation="MLNQGDILLYDSHFLYHLKHSVPVQIYDGNVHVQIGIVARFNEHF
FT                   VEIEDTLYNRQRFTFISRPGF"
FT   gene            40585..41145
FT                   /gene="pth"
FT                   /locus_tag="PPSC2_00200"
FT                   /old_locus_tag="PPSC2_c0041"
FT   CDS_pept        40585..41145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="PPSC2_00200"
FT                   /old_locus_tag="PPSC2_c0041"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54029"
FT                   /db_xref="GOA:E3EDW3"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDW3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818918.1"
FT                   /protein_id="ADO54029.1"
FT                   /translation="MKWIVGLGNPGPQYEKTRHNVGFMALDALALRHNIQITQSKCKAL
FT                   IGEGHIGGVKTVLIKPMTYMNLSGESLRAYMDYYKADMEDLIVVYDDLDTEVGKIRLRY
FT                   QGSAGGHNGIKSIIQHTGTQSFNRIRMGISRPEPGHAIVDYVLGTFPKKEKELLTGMIE
FT                   DTCNALEYSLNHPFERTMAEFNK"
FT   gene            41233..41463
FT                   /gene="yabK"
FT                   /locus_tag="PPSC2_00205"
FT   CDS_pept        41233..41463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="PPSC2_00205"
FT                   /product="yabK"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00205"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44169"
FT                   /db_xref="GOA:A0A0D5ZC68"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZC68"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308128.1"
FT                   /protein_id="AKA44169.1"
FT                   /translation="MVVNYVCRHCRTFLGRIDSAVITEERLGFHSLTPAERRDIIAYNS
FT                   GGEVTVKVICEHCSQALENNPELSLLVNPLQ"
FT   gene            41598..45125
FT                   /gene="mfd"
FT                   /locus_tag="PPSC2_00210"
FT                   /old_locus_tag="PPSC2_c0043"
FT   CDS_pept        41598..45125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="PPSC2_00210"
FT                   /old_locus_tag="PPSC2_c0043"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54031"
FT                   /db_xref="GOA:E3EDW5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDW5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308129.1"
FT                   /protein_id="ADO54031.1"
FT                   /translation="MLQALIQAFTKDADYASIAAGISSGMKEQLISGLSGSSRQVLMAA
FT                   LAEDTGRPLMVMTHNMFAAQKIADDLQEALSPDQVLLYPANELVAAEAAISSPETLSQR
FT                   IDVLIRCAQGFRGVVVVPFSGVRRLLPIPETWREARVELKEGETIQLEAFLLHMVEMGY
FT                   QRVERVESRGEMSVRGGIIDFYPMTTRWGYRVELFDDEIDSIRMFDPQDQRSVEKVQEV
FT                   TVTPCKEVIASHQRMDQAADAAAMLLEEQLDKMTDRQAKQHLKEEIHREIELLREHVYF
FT                   DEIYKYISLLYPERKTLADYMPADTILIIDEPARMLETARQLERDESEWNLHLLQNGKT
FT                   LPQLELSDNSDNLLYNRRFQTLFLSIFLRQVPHTQPQNILNFICRGMQDFHGQMNVLKA
FT                   EMDRWRKAGTQVMMLASGDERLDRMRRVLQDYGIDEPTMAIGNLQSGFEMPSIHLAVIT
FT                   EGEMFSQKQRKARKQGRHVDNAERIKSYSELKVGDYVVHQNHGIGKYMGIGTLEVGGIH
FT                   KDYMHILYAGGDKLSVPIEQIDLIQKYVGSEDKEPKIYKLGGNEWTRVKSKVRSSVQDI
FT                   ADDLIKLYAERQSAPGFAFEKDSPEQQEFEDMFPYDETRDQVRAIEEIKKDMEQSRPMD
FT                   RLLCGDVGYGKTEVAIRAAFKSAIEGKQVAVLVPTTILAQQHYETFRERFSGYPFNIQV
FT                   LSRFRSRKEQNETTKGVRQGTVDIVIGTHRLLSQDLVFKDLGLLIVDEEQRFGVTHKEK
FT                   LKKLKTNVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYVVEHSQTLVRE
FT                   AIEREMARGGQVYYLYNRVQGIQEMAAEINALVPDAKVGVGHGQMSETELEKTILDFLD
FT                   GEYDVLVSTSIIETGVDIPNVNTLIVHDADKMGLSQLYQLRGRVGRSNRIAYAYFTYQR
FT                   DKVLTEVAEKRLQSIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGFIASVGFDLYSQ
FT                   MLAEEINKRKVSVLGEEDQSNRNWSTSIDLSVDAYLPGDYIYDSIQKIEIYKKVAAVST
FT                   FDEASELEDELVDRFGDLPEAVRHLLAVARLKVYGRMYGIESIVQRDDNMVLKFHEGRQ
FT                   QALQTAKLAEIGNRFERRVQFEQGTSMSVRIKGKGLNDAQLLELLEQFLSALKEAFTLK
FT                   EELQNVTTK"
FT   gene            45109..46227
FT                   /gene="prsA1"
FT                   /locus_tag="PPSC2_00215"
FT                   /old_locus_tag="PPSC2_c0044"
FT   CDS_pept        45109..46227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA1"
FT                   /locus_tag="PPSC2_00215"
FT                   /old_locus_tag="PPSC2_c0044"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54032"
FT                   /db_xref="GOA:E3EDW6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDW6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427061.1"
FT                   /protein_id="ADO54032.1"
FT                   /translation="MSQLNKRKPWRMLSLGMAALLAISVLAACTKQADENKVKDEPKDN
FT                   SKVVVTYKGGTITENEFNQEISMMKFLYPEYEAALASDQVREQIVKQEVVYKLLAAKAD
FT                   DKAKEEGAKQGNEQLEQYKKSVGEDKFKTFLSDQKLTEQGVKDYFTRVMTVINSETNKV
FT                   TDDQLKQEFEKNKDQFTTATVRHVLINFEDPKTKKQRTKEATLKLAKEVKAKLDGGADF
FT                   ATIAKKYSEDPGSASNGGLYENASVAQWVPAFKEAAETQPINKIGEPVETEYGYHVIKV
FT                   ESRNEPTFDKLKDNEKAALKNKLAGESIQNFTENDLTKLDLKINLPKAPATQEKSGATS
FT                   GAGSTTTPSGTTSGTGDSKAGTTKDGAANEGK"
FT   gene            46395..46937
FT                   /gene="spoVT"
FT                   /locus_tag="PPSC2_00220"
FT                   /old_locus_tag="PPSC2_c0045"
FT   CDS_pept        46395..46937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="PPSC2_00220"
FT                   /old_locus_tag="PPSC2_c0045"
FT                   /product="stage V sporulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54033"
FT                   /db_xref="GOA:E3EDW7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDW7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279043.1"
FT                   /protein_id="ADO54033.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPIGELGDFAKEYAESLFESTGHITMITDRDTIITVAGGSKKEFLDKQIGSIIEG
FT                   SMDNRKTVLETASGSYELTRDHEETLSSFVTAPIVSGGDPIGSVILLNKDENVKMSEME
FT                   VKMAETAAGFLGKQMEQ"
FT   gene            47078..48736
FT                   /gene="yabM"
FT                   /locus_tag="PPSC2_00225"
FT                   /old_locus_tag="PPSC2_c0046"
FT   CDS_pept        47078..48736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabM"
FT                   /locus_tag="PPSC2_00225"
FT                   /old_locus_tag="PPSC2_c0046"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54034"
FT                   /db_xref="GOA:E3EDW8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDW8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308132.1"
FT                   /protein_id="ADO54034.1"
FT                   /translation="MQENRAASRLLRGAVILTLAAVASKLIGTLQKIPLQNIGGDGVFG
FT                   IYNTVYPFYTLFITIAAAGFPAAVSKFVAEYEAVGNQAAGQRVARLSSLVLGIFGLILG
FT                   LLMYTCAPLIGQWIDNAHVIPSVRAAAIAFLFVPVMAGLRGYFQGLQNMIPTAVSQVTE
FT                   QAIRVSVMIILLLFMLSQGAGADMIAAGAVFGSAAGGAAGLVIMLLYWRGHRKRLRRQE
FT                   TVMTTVQAQTGELHPAESSGALLKALLRYALPVCLGALAVPLINLVDTFTVPRLLKQEG
FT                   LDDTAVMVAFGVYNRGLPLVQLVMMFATTLSALFIPSLAEARVTGGTELARRQCEQSLR
FT                   WFWLLGLAAATGLIVLAVPVNVMLYADDTGSTVMRWMALTAVGGTLSIISAALLQGLGA
FT                   VRAPALAMLAAAAAKGLLNWLLVPQLGTAGAAIAGAVAYLLAAVINIALLARLVGLRGS
FT                   WSASVLKPAALLVALAGAAGAAMWGTSAVLGALGWAAGGRATAAAESLLGVAAGAVVFV
FT                   IGLARLRLITEAELVAVPKLGRPLAAVLRRLRVLA"
FT   gene            48900..50399
FT                   /gene="yabN"
FT                   /locus_tag="PPSC2_00230"
FT                   /old_locus_tag="PPSC2_c0047"
FT   CDS_pept        48900..50399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="PPSC2_00230"
FT                   /old_locus_tag="PPSC2_c0047"
FT                   /product="yabN"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54035"
FT                   /db_xref="GOA:E3EDW9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDW9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368683.1"
FT                   /protein_id="ADO54035.1"
FT                   /translation="MSVTLTIVGLGSGDPDQLTIGILNKMRGASALYLRTKEHPAVRVL
FT                   DEFEVAFESFDAVYETKDSFPEVYEEITSQLMEKVAKAADGSEIVYAVPGHPMVAEAAV
FT                   QLLKERCPAQGIELNILGGESFLDEAFVRLGFDPIEGFQLLDAGTLDASWLQPQLHTLI
FT                   GQVYDTFTASDVKLCLMERYPDDYEVYVGHALGVEGEEAVHKVPLYELDRVEGYGNLSL
FT                   VYIPRSEDEALKRRSFDRLHEIVDILRSPEGCPWDREQTHQSIRKNLIEETYEVIETID
FT                   EDDPEHMKEELGDLLLQILLHAQMEEEVGTFNVYDVIQGLNDKLIFRHPHVFGDNQAND
FT                   AEEALQNWEQMKAEEKRLKGTAAANPSVLDGVPRDLPALMKSYKLQKKAAKVGFNWDSI
FT                   EGVFDKLDEEVAELKEAVREGHSMEAQLLELGDVLFVAVNAARFMDVDPEEALSATNRK
FT                   FVSRFQYIEQKLREQGRRPEDSSVDEMETYWQEAKKLLDRD"
FT   gene            50734..51006
FT                   /gene="hupA"
FT                   /locus_tag="PPSC2_00235"
FT                   /old_locus_tag="PPSC2_c0048"
FT   CDS_pept        50734..51006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="PPSC2_00235"
FT                   /old_locus_tag="PPSC2_c0048"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54036"
FT                   /db_xref="GOA:E3EDX0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDX0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019914475.1"
FT                   /protein_id="ADO54036.1"
FT                   /translation="MNKTDLINNISSKSGLSKRDVEAVLNGVLGEITDALASGDKVQLI
FT                   GFGTFETRKRSSRTGRNPQTGNTIEIPESTVPAFKAGNKLKEAVN"
FT   gene            51006..51284
FT                   /gene="yabO"
FT                   /locus_tag="PPSC2_00240"
FT   CDS_pept        51006..51284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabO"
FT                   /locus_tag="PPSC2_00240"
FT                   /product="yabO"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00240"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44170"
FT                   /db_xref="GOA:A0A0D5ZBK5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZBK5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428029.1"
FT                   /protein_id="AKA44170.1"
FT                   /translation="MRLDKFLKVSRLIKRRTVAKDVSEQGRVVVNGREAKPSSAVKVGD
FT                   EITVQFGQKLVTVRVERLADTTRKDEAASMYTLVKEEPIARDNGLNW"
FT   gene            51470..51754
FT                   /gene="yabP"
FT                   /locus_tag="PPSC2_00245"
FT                   /old_locus_tag="PPSC2_c0050"
FT   CDS_pept        51470..51754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="PPSC2_00245"
FT                   /old_locus_tag="PPSC2_c0050"
FT                   /product="spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54038"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDX2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428030.1"
FT                   /protein_id="ADO54038.1"
FT                   /translation="MIEQGKSKHHDLRMQSRKQLDISGVSNVESFDSEEFLLQTELGHL
FT                   TIRGQHLHIKNLSLEEGLLSIEGLITSLVYLEPGAPAKNGKSLFGKLFK"
FT   gene            51751..52329
FT                   /gene="yabQ"
FT                   /locus_tag="PPSC2_00250"
FT                   /old_locus_tag="PPSC2_c0051"
FT   CDS_pept        51751..52329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabQ"
FT                   /locus_tag="PPSC2_00250"
FT                   /old_locus_tag="PPSC2_c0051"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54039"
FT                   /db_xref="GOA:E3EDX3"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDX3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368686.1"
FT                   /protein_id="ADO54039.1"
FT                   /translation="MNPYTQWLTLTWMLLSGITMGVVFDSYRVLSIRFHFARWSVHLLD
FT                   VLYWVASALFIFRVLYASNRGELRFYVFLGLLLGVWLYFWAFSVTTQRFVVMLIEIVRR
FT                   LTLIVNSILRILIVLPVLALYRLLRKLVGWTWALIVLLGRMLIYILMPVWKPILWSIRP
FT                   LIARWKTPDPLVKLGIRLKNTAKRWFGRG"
FT   gene            52334..52663
FT                   /gene="divIC"
FT                   /locus_tag="PPSC2_00255"
FT                   /old_locus_tag="PPSC2_c0052"
FT   CDS_pept        52334..52663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="PPSC2_00255"
FT                   /old_locus_tag="PPSC2_c0052"
FT                   /product="septation ring formation regulator EzrA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54040"
FT                   /db_xref="GOA:E3EDX4"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDX4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308137.1"
FT                   /protein_id="ADO54040.1"
FT                   /translation="MRNSSVDRHSSPTSKSNAGGRRRIMIWLLSLAAFGSWAIFTFFSQ
FT                   GMIMADRSEQLTQKEKQKQAATQTEQQLQTEVNRLKDPEYIGEIARSKYGLYKPEETPI
FT                   IGDQK"
FT   gene            52787..53302
FT                   /gene="rps1"
FT                   /locus_tag="PPSC2_00260"
FT                   /old_locus_tag="PPSC2_c0053"
FT   CDS_pept        52787..53302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps1"
FT                   /locus_tag="PPSC2_00260"
FT                   /old_locus_tag="PPSC2_c0053"
FT                   /product="RNA-binding protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54041"
FT                   /db_xref="GOA:E3EDX5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDX5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368688.1"
FT                   /protein_id="ADO54041.1"
FT                   /translation="MAIEVGTKLEGKVTGITHFGAFVDLSGGVTGLVHISEIADNYVKD
FT                   VNDHLKINDVVTVKVINVDKDGKIGLSIKQTIDKPASEARPPRAPRPERTGGPGGGDRF
FT                   GGGGSGPSQGRGGGFNRDRGGRSFKPAPGKPSFEDKMSRFLKDSEERISSLKKNTEGKR
FT                   GGRGAKRV"
FT   gene            53811..56315
FT                   /gene="spoIIE"
FT                   /locus_tag="PPSC2_00265"
FT                   /old_locus_tag="PPSC2_c0055"
FT   CDS_pept        53811..56315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="PPSC2_00265"
FT                   /old_locus_tag="PPSC2_c0055"
FT                   /product="stage II sporulation protein E"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54042"
FT                   /db_xref="GOA:E3EDX6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDX6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685739.1"
FT                   /protein_id="ADO54042.2"
FT                   /translation="MEKWNVVHFPGLKSRKSKSKERTEGWPSRLKKRLNSHKVVQWVTA
FT                   QRWMLLLSAMGVLLGRATILDELSPFALAYFAVITFLRRDLMLPVAVSVVLGSLLAPYP
FT                   SLFMIGGELIVFYLLYRGLRTFDRLELSYAPLMVFLSVFMVNLFNAVMAPAFTWYELVI
FT                   VGTDAVLSFMLTLVFTQAIPLFTYRKKASQLKNEEILCLIILLASVMTGAVGWTVHSLS
FT                   VDHVLSRYLVLVFALVGGASLGASVGVITGLILSLANMSAIVQMSLLAFAGLLAGMLRE
FT                   GRKGAVALGMLLGSSILTIYLDGTGDVLTSTWESCAAILLFLMTPKSFFKAVSTYVPGT
FT                   QDHAKSQHEYAKRVRDLTAERVTKFSRVFSQLSRSFHQISASEGAKSDGEIEHFMNAVA
FT                   EGTCASCFKCEQCWDGKFMQTHQYMTEMMSAIEDNPDLEPEQMPPQWSKACAKTGAVLQ
FT                   VMKQQYSLYQHNMQWKRQVYDSRQLVADQLSGVSQIMEDLAREIQREGQTMHRQEEQIR
FT                   EALDRLGLSIQSIEIISLDAGQVEIEIVHAYTRGFDECRKIIAPLLSDILDEHIAVMRE
FT                   TAADRRQGLATVMFGSAKTYEIATGVASAAKGGDFFSGDSYSMMELGNGTFAVSLSDGM
FT                   GNGERAQQESSAALNILEELLQSGMDEKLAIKSVNSVLMLRSPEEMYATVDMALIDQYT
FT                   ARTTFMKIGSTPSFIKRGEEVIPVSASNLPIGIIQDIEVDLVSLQLQPGDILIMITDGI
FT                   YDSPGYAVNKEIWMKRMIQEIESEDPQQLADCLLERVIRYQQNQIYDDMTVVVSKIDHF
FT                   HPEWATLHVPGMRWLERPRTVS"
FT   gene            56442..57191
FT                   /gene="yabS"
FT                   /locus_tag="PPSC2_00270"
FT                   /old_locus_tag="PPSC2_c0056"
FT   CDS_pept        56442..57191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabS"
FT                   /locus_tag="PPSC2_00270"
FT                   /old_locus_tag="PPSC2_c0056"
FT                   /product="yabS"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54043"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDX7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427054.1"
FT                   /protein_id="ADO54043.1"
FT                   /translation="MKQILIITDGCSNVGVSPVMAAAQALREGITVNVAGVIDYGTIGE
FT                   LGSAEIQEIAKAGGGFSQIVGTKQLAQTMQMMTRKTVVQTIQQAVNRELTHILGEGGAR
FT                   HIGELPPAKRAQVVEVMDELTETSPLEIALLIDASASMKPKLPAVEDSIRDLLLSLQSR
FT                   SGLSRISVFHFPGGRMGEDAVMDIGWTSELDQIKSIFGRLRMKGATPTGPAILQVIDYY
FT                   RYVTLGEQKDLEESYSKGEGMLGDYVV"
FT   gene            57175..58113
FT                   /gene="yabT"
FT                   /locus_tag="PPSC2_00275"
FT                   /old_locus_tag="PPSC2_c0057"
FT   CDS_pept        57175..58113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabT"
FT                   /locus_tag="PPSC2_00275"
FT                   /old_locus_tag="PPSC2_c0057"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54044"
FT                   /db_xref="GOA:E3EDX8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDX8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010349552.1"
FT                   /protein_id="ADO54044.1"
FT                   /translation="MTTSSDPVLAPGTVIKGKWKRSSYVIQRLLGRGANGTVYLVKEAQ
FT                   ADRQFALKMGKNTLDLQSEINVLTTLQSQGTQAALQRNGNPSFLFEVDDVVLRSGEIPF
FT                   YVMRYVKGDPLHKFVAAKGSEWYGVAGTGILNRLADLHQAGWVFGDLKPQNILVNAYGE
FT                   AELIDYGGVSLAGRSVKQFTEWYDRGFWNAGSRNADPQYDLFAFALLTIHILESESLKA
FT                   AASRLPQLRNTAELTVIIRRSRILRPYAEWLLGAVRGEYSDTRAAARAWSRLASAHVRQ
FT                   SSVKRGNPRWLGYAFTVSLLLLAGALWIALR"
FT   gene            58180..59628
FT                   /gene="mesJ"
FT                   /locus_tag="PPSC2_00280"
FT                   /old_locus_tag="PPSC2_c0058"
FT   CDS_pept        58180..59628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="PPSC2_00280"
FT                   /old_locus_tag="PPSC2_c0058"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54045"
FT                   /db_xref="GOA:E3EDX9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDX9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368692.1"
FT                   /protein_id="ADO54045.1"
FT                   /translation="MGTTKPTGVVQEVLALAREHSLWSPGDRIVVAVSGGPDSVALLHI
FT                   LHEISVIHMPLQLVCAHVHHGFRPEESDAEAEEVHNIARKLKLPFEMIRVDAPAYMKES
FT                   GKGPQEAARELRYSFLHDTATKWKAQHIAMAHHGDDQAETVLLHLLRGSGPAGLAGMRL
FT                   ARNEKNVQLIRPLLRMYKADLIEYCNFHGFSYVTDSTNLSSKYRRNAIRMDVLPFLGQY
FT                   NEQLTPSLNRLAETMADENDFMEAATLSAYEKMVHFNNGRYMFSIASYRKLSVALQRRL
FT                   IKLILNYLPSGSENFDFRKIETVRLRLLQETSSTWSLDLGGGAVGVREYDQAVLFDRTQ
FT                   VVMGEWSYGLSVLPISGELELPEAGGILRWRRASYWDGHHPANEEEAWFDADELTLPLT
FT                   VRSRLPGDTMYVMGLNGRKKVKDIFIDEKIPPLMRSVIPIVCDHSGVVLWIPGVRRSVH
FT                   AAVQKHTSSVIYMSWQRRESPGHQ"
FT   gene            59676..60215
FT                   /gene="hprT"
FT                   /locus_tag="PPSC2_00285"
FT                   /old_locus_tag="PPSC2_c0059"
FT   CDS_pept        59676..60215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="PPSC2_00285"
FT                   /old_locus_tag="PPSC2_c0059"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54046"
FT                   /db_xref="GOA:E3EDY0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDY0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308144.1"
FT                   /protein_id="ADO54046.1"
FT                   /translation="MQNDIQEVLISEEEIQSKIKELGAQLSVKYEGKNPLVICVLKGAF
FT                   IFMADLVKSITVPLELDFMAVSSYGVSTKSSGVVKIIKDLDASVEGRDVLIVEDIIDSG
FT                   LTLTHLIELLKNRNANSVCVVTLFDKPARRTVNLEADYTGFTLPDAFVVGYGLDYAEHY
FT                   RNLPYIGILKPEIYTS"
FT   gene            60313..62352
FT                   /gene="ftsH3"
FT                   /locus_tag="PPSC2_00290"
FT                   /old_locus_tag="PPSC2_c0060"
FT   CDS_pept        60313..62352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH3"
FT                   /locus_tag="PPSC2_00290"
FT                   /old_locus_tag="PPSC2_c0060"
FT                   /product="cell division protein FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54047"
FT                   /db_xref="GOA:E3EDY1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDY1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818907.1"
FT                   /protein_id="ADO54047.1"
FT                   /translation="MNRFIRNSGFYLILFLVVVGIVQFVSNSNEASDLPRYDQLRQEVK
FT                   ANNISKVTVQFDGYAYLVTGAYKKQPANAKSTNFSVYVPPTDQALSELVNASETNGFEY
FT                   VQKKMEGESIWLTFLTSIIPLVIMFLLFFFLFNQAQGGGGKVMNFGKSKARLYNEEKKK
FT                   VTFEDVAGADEEKQELVEVVEFLKDPRKFAAVGARIPKGVLLVGPPGTGKTLLARAVAG
FT                   EAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGG
FT                   GHDEREQTLNQLLVEMDGFGANEGIIIVAATNRPDILDPALLRPGRFDRQITVDRPDVK
FT                   GREAVLHVHARNKPLTKDVKLDVIAKRTTGFTGADLENLLNEAALLAARRNRRDISMRE
FT                   VDEAIDRVIVGTEKRSRVISDREKRIVAYHEAGHTIIGYFLENADMVHKVTIIPRGRAG
FT                   GYVIMLPKEDRMLTTKQELLDKITGLLGGRVSEELFIGEIGTGAYSDFQQATSIARSMI
FT                   VEYGMSEKLGPMQFGTSQGQVFLGRDIGHEQNYSDQIAYQIDQEMNRFITDSYERAREL
FT                   LTKYSKEVHLIAQTLLEEETLELEQIKRLIETGSLDGNTNEGEGTPENGEPVIDNIGDV
FT                   RVRIQGKDDEPKNTTDQPNDIPNLKKPEDDNNSGNSGGTPPTTT"
FT   gene            62633..64246
FT                   /gene="nadB1"
FT                   /locus_tag="PPSC2_00295"
FT                   /old_locus_tag="PPSC2_c0061"
FT   CDS_pept        62633..64246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB1"
FT                   /locus_tag="PPSC2_00295"
FT                   /old_locus_tag="PPSC2_c0061"
FT                   /product="aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54048"
FT                   /db_xref="GOA:E3EDY2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDY2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308146.1"
FT                   /protein_id="ADO54048.1"
FT                   /translation="MIPRYLVDFDVAELTQYEADVLIIGSGIAGLYTAIKAAENRKVLL
FT                   ITKKTLMESNTRYAQGGIAAVTSDEDTPAYHMQDTLIAGAGLCEPEAVRTLVHEGPDGI
FT                   KELIRLGTAFDRVDGELALTREGAHSHRRILHANGDATGYEIVRALSQQVAAHPGIEVW
FT                   EECMVIDLLTEHGECIGALVQMPDGERSYITANATIVCSGGSGQLYRYTTNPDIATGDG
FT                   IAMAYRAGAVVRDMEFVQFHPTALCHPGAPRFLISEAVRGEGAVLRNIHGERFMDKYDS
FT                   RQELAPRDIVARAIIHEMERTQATFVYLDITHEPPERVKQRFPTIYRTCLSYGLDMTTG
FT                   RIPIAPAAHYMMGGIQTNLYGESSIRRLFACGETSSTGVHGANRLASNSLSEAIVFASR
FT                   IIERLHSLPPLVGHTLISYNDNRAEFQASSVAEQRYKLQETMVHYAGVRRHSEGLQAAL
FT                   EELRGLVTAFQAVITSREEIEFANLLTCALLVADGALLREESRGAHYREDFPETDDCKW
FT                   RKHVQQRREQGITEESVHDI"
FT   gene            64236..65126
FT                   /gene="nadC"
FT                   /locus_tag="PPSC2_00300"
FT                   /old_locus_tag="PPSC2_c0062"
FT   CDS_pept        64236..65126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="PPSC2_00300"
FT                   /old_locus_tag="PPSC2_c0062"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="'catalyzes the formation of
FT                   pyridine-2,3-dicarboxylate and 5-phospho-alpha-D-ribose
FT                   1-diphosphate from nictinate D-ribonucleotide'"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54049"
FT                   /db_xref="GOA:E3EDY3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDY3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279060.1"
FT                   /protein_id="ADO54049.1"
FT                   /translation="MTSNSELYGEFSGYQEELTAQIRSWLREDTGSGDVTTRWTIEPGH
FT                   QSKAVIHAKESGVIAGLPVAEIVFRVVDPSLSFTPLVTDGQWIEKGSVLAEVSGSTHAI
FT                   LTGERLALNLLQRMSGIATRTRTFIDQLHGLSTRLVDTRKTTPGHRLLEKYAVRVGGGS
FT                   NHRFGLYDAVMIKDNHIKGAGGIAQAVSRARAHIPHTMTIEVETENMTQVREALEAGAD
FT                   IIMLDNMSVPDMKEAVRFIREQAPHVKTEASGNVSLDTVREMAESGVDVISVGRLTYSF
FT                   HNLDISLDLNAKKDR"
FT   gene            65133..65900
FT                   /gene="panK"
FT                   /locus_tag="PPSC2_00305"
FT                   /old_locus_tag="PPSC2_c0063"
FT   CDS_pept        65133..65900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panK"
FT                   /locus_tag="PPSC2_00305"
FT                   /old_locus_tag="PPSC2_c0063"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54050"
FT                   /db_xref="GOA:E3EDY4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDY4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818904.1"
FT                   /protein_id="ADO54050.1"
FT                   /translation="MILVVDVGNTNIVLGIYEGRELLHHYRISTSRQATADEYGVLIHN
FT                   LFSMGGVLKDDIQGVIISSVVPPLVRVLEEMCDKYIGKTPLIVGPGIKTGLNLRYENPR
FT                   EVGADRIVNAVAAVERFGGPLVVVDFGTATTFDCIDDKGNYLGGVIVPGIGISTEALYQ
FT                   RASKLPRIELEKPKKVIGRNTVHAMQAGIIFGYAGQVDGIVRRIKEEMQVEPTVIATGG
FT                   LAELIASETESIQKVLPMLTLEGLRIIYQRNAE"
FT   gene            66119..67003
FT                   /gene="hslO"
FT                   /locus_tag="PPSC2_00310"
FT                   /old_locus_tag="PPSC2_c0064"
FT   CDS_pept        66119..67003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="PPSC2_00310"
FT                   /old_locus_tag="PPSC2_c0064"
FT                   /product="heat shock protein Hsp33"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54051"
FT                   /db_xref="GOA:E3EDY5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDY5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368698.1"
FT                   /protein_id="ADO54051.1"
FT                   /translation="MENKQDRLIRGTAMDGRVRAFAVRTTQLVEELRRRHDTYPTATAA
FT                   LGRTLTAGAIMGSMLKGKERLTIQVKGEGPIGQIVVDANAVGEVRGYVTEPHVHLPSNS
FT                   MGKLDVAGAVGTEGFIHIIKDLGLKEPYRGSIPIISGELGEDFTYYFAKSEQTPSAVGL
FT                   GVLVDTDNSVIVAGGFIIQLLPGLNDDEITAIENAVGSIPPVTALLDQGLELDEMLRWM
FT                   LPDVRVLDEMDIHFQCECSRERVEKTLISLGESELKQLIEEEGQAEVVCHFCNEAYQFN
FT                   KDELQNLLDQAKA"
FT   gene            67024..67974
FT                   /gene="prsA3"
FT                   /locus_tag="PPSC2_00315"
FT                   /old_locus_tag="PPSC2_c0065"
FT   CDS_pept        67024..67974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA3"
FT                   /locus_tag="PPSC2_00315"
FT                   /old_locus_tag="PPSC2_c0065"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54052"
FT                   /db_xref="GOA:E3EDY6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDY6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368699.1"
FT                   /protein_id="ADO54052.1"
FT                   /translation="MTTREKGLWTAVIILTVSVAALGGLIMLRGLLKPGDVSKDDGDHT
FT                   VAEMGQEGISEEQWVAELKKRYGTNTLLQMLNRKAVQAEAKRLGIKITQEDLQQVLEQD
FT                   SKGYDSEHAYFEEMQRQFGLNPVDLRNEAEYRIGLEKIATQGIQVEETEIDEYWEQHPE
FT                   EFAVGKQIKLAAIYVAKAEEAETLLDRVKQGESFDMLLREHSVSGNPLGEDHSGQLGWL
FT                   DEYDPFQPEAVMKAARELSSGDVAGPISVNDGYAVIYVQDVRLKNSPDKQQIRQQIRRS
FT                   LALAQAAPLDEVEKSLRDKYGARILSGKEAPSASL"
FT   gene            68215..69153
FT                   /gene="cysK1"
FT                   /locus_tag="PPSC2_00320"
FT                   /old_locus_tag="PPSC2_c0066"
FT   CDS_pept        68215..69153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK1"
FT                   /locus_tag="PPSC2_00320"
FT                   /old_locus_tag="PPSC2_c0066"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54053"
FT                   /db_xref="GOA:E3EDY7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDY7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818901.1"
FT                   /protein_id="ADO54053.1"
FT                   /translation="MAKVVNNITDLIGETPLVRLNRIVPEDSAEIYLKLEYQNPGSSVK
FT                   DRIAISMVEEAEREGLLKPGGTIIEATSGNTGIGLAMVAAAKGYKAVIVMPETMSIERR
FT                   NLLRAYGAELVLTPGSEGMNGSVKKMEELLSENPDYFAAEQFKNKANIKIHRETTGPEI
FT                   VEAIRSIGGTLDAFIAGIGTGGTISGAGEVLKKEFPDIKIVAVEPASSPLLAGGKPGPH
FT                   KIQGLGANFIPEILNRDIYDEIIHVENDEAFEVARRVAKEEGILSGISSGAAVHAALKL
FT                   AKQLGKGKRIVVIIPSNGERYLSTPLYNFEL"
FT   gene            69283..70905
FT                   /gene="pabB"
FT                   /locus_tag="PPSC2_00325"
FT                   /old_locus_tag="PPSC2_c0067"
FT   CDS_pept        69283..70905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="PPSC2_00325"
FT                   /old_locus_tag="PPSC2_c0067"
FT                   /product="anthranilate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54054"
FT                   /db_xref="GOA:E3EDY8"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDY8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685744.1"
FT                   /protein_id="ADO54054.1"
FT                   /translation="MKWTARVTEAQWQTWQKEGWNVLPYIAEYPLPVGGLPSSWRRAWE
FT                   DSSPYAFLLESAKGGRYTYLALNPVAILEGKGEQAVWTDLQSGEHGDIHGQPLTIMNDW
FT                   IASYRAPRVPGMPFFSGGFAGYLGYDVARSLERLPTQAADDTDIPDYVWMRVNELWIYD
FT                   HETSCLYCAVHIPNPARSGEFSGQTDLANELMVDETTSILGKLYAEAVQRAERMLTQWK
FT                   DIIHAGETDPAHPRRCARLSEKGLEAAHQESEGWKMAFSQQDFEHAVKRVQEYIAQGDV
FT                   FQVNLSIRQQRTLAALPENIYEWLRLLNPSPYMGMLRMPDLRIVSGSPELLVKLEDGRV
FT                   SARPIAGTRRRGLTPDEDAAMAAELLSSEKERAEHIMLVDLERNDIGRIAEYGSVHVPE
FT                   LLTVEYYSHVMHLVSQVEGKLASGRTAIDVIAATFPGGTITGAPKVRTMEIIEELEPVR
FT                   RGPYTGSLGWIDYNGNMELNIIIRTLAVQGNTAYLQTGAGIVIDSDPYREYRECRNKAR
FT                   AVMKAVQCGEEEAALNRSGITGG"
FT   gene            70911..71486
FT                   /gene="pabA"
FT                   /locus_tag="PPSC2_00330"
FT                   /old_locus_tag="PPSC2_c0068"
FT   CDS_pept        70911..71486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="PPSC2_00330"
FT                   /old_locus_tag="PPSC2_c0068"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TrpG; with TrpE catalyzes the formation of
FT                   anthranilate and glutamate from chorismate and glutamine;
FT                   TrpG provides the glutamine amidotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54055"
FT                   /db_xref="GOA:E3EDY9"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDY9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279066.1"
FT                   /protein_id="ADO54055.1"
FT                   /translation="MILVIDNYDSFTYNLVQYLGELGEEVTVKRNDEIDVKGIEELAPE
FT                   HILISPGPCTPNEAGISLDVISHFKGRIPIFGVCLGHQAIGQAFGGKVIRADRLMHGKT
FT                   SPILHHNTSVFEGLPSPFTATRYHSLLVERESLPECLEITAETAEGEIMGLRHKEFAVE
FT                   GVQFHPESIITDYGHQLLRNFLKRKVGV"
FT   gene            71490..72377
FT                   /gene="pabC"
FT                   /locus_tag="PPSC2_00335"
FT                   /old_locus_tag="PPSC2_c0069"
FT   CDS_pept        71490..72377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="PPSC2_00335"
FT                   /old_locus_tag="PPSC2_c0069"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54056"
FT                   /db_xref="GOA:E3EDZ0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDZ0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427048.1"
FT                   /protein_id="ADO54056.1"
FT                   /translation="MRYIGVNGVLTEAAKAVIHVSDHGFLYGMGLFETFRTYKGVPFLL
FT                   DRHLHRLEEGCRMLGIPFQPDEEQLTKHIQHLMAANGLNEAYIRYTVSAGEEALGLPSG
FT                   DYTRPNHILFAKPLPSINTQPGQSSALQLLRTPRNTPEGEVRLKSLHYMNNVLAKRELQ
FT                   QYAEAVRYKAEGIMLTANGFLAEGIVSNLFFVRNNTLYTPDLSTGILPGITREFILELA
FT                   DLRGIPWEQGLYHWYELKQADEIFMTNSIQEIRPVDLLLEPGEVASHLSVPLAQTESIT
FT                   ALLLHDYRQKAGMK"
FT   gene            72374..73240
FT                   /gene="sul"
FT                   /locus_tag="PPSC2_00340"
FT                   /old_locus_tag="PPSC2_c0070"
FT   CDS_pept        72374..73240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul"
FT                   /locus_tag="PPSC2_00340"
FT                   /old_locus_tag="PPSC2_c0070"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54057"
FT                   /db_xref="GOA:E3EET4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E3EET4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685746.1"
FT                   /protein_id="ADO54057.1"
FT                   /translation="MNIPTLYQRSYQMGDAKLTLGHSTQIMGILNVTPDSFSDGGLHYN
FT                   PEIAVLHALKLVEDGANIIDIGGESTRPGHEPVGVEEELARVIPVVQAIHRIAPDIPLS
FT                   VDTYKAEVARQALEAGAHIINDVWGFKADPDMARVAAEFDCPVILMHNRHDRNYSDLVS
FT                   DMLSDLKESIQLALDAGVRKEQIILDPGIGFAKDYDENIHAMTSLDTLSQLGFPLLLAT
FT                   SRKRFIRTALDLPVDDVVEGTAATVAFGIAQGCQIVRVHDVAQIKRTVRMCDAMVYGAK
FT                   NPLSYGG"
FT   gene            73522..73884
FT                   /gene="folB"
FT                   /locus_tag="PPSC2_00345"
FT                   /old_locus_tag="PPSC2_c0071"
FT   CDS_pept        73522..73884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="PPSC2_00345"
FT                   /old_locus_tag="PPSC2_c0071"
FT                   /product="dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54058"
FT                   /db_xref="GOA:E3EET5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E3EET5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368705.1"
FT                   /protein_id="ADO54058.1"
FT                   /translation="MDKMKLHRMEYYGYHGVFPEERKLGQRYYIDLELELDLREAGEQD
FT                   ALDKTVNYAEVHYTVKDIVEKESYQLIEALGERIASSLLDTYTSVNALTVKVTKPHPPF
FT                   DIHFQGVTVELYRARK"
FT   gene            73894..74442
FT                   /gene="folK"
FT                   /locus_tag="PPSC2_00350"
FT                   /old_locus_tag="PPSC2_c0072"
FT   CDS_pept        73894..74442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="PPSC2_00350"
FT                   /old_locus_tag="PPSC2_c0072"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54059"
FT                   /db_xref="GOA:E3EET6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E3EET6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308157.1"
FT                   /protein_id="ADO54059.1"
FT                   /translation="MNAHSTSEASEAYIALGANLGEREHTLYEAITALDEHPAIRVVRC
FT                   SSLYETEPVGYLDQPSFLNMTVAVSTTLAPEELLFYMLEVESRLGRVRHIPNGPRTIDL
FT                   DLLWMEATQLATPDLELPHPRMLERAFVLVPLADIVPSQDSSGLYSIVHTALNSVDGKD
FT                   GIQLWKTCSWRNDSAPFGS"
FT   gene            74463..74594
FT                   /locus_tag="PPSC2_00355"
FT   CDS_pept        74463..74594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_00355"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00355"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44171"
FT                   /db_xref="GOA:A0A0D5ZC76"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZC76"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428053.1"
FT                   /protein_id="AKA44171.1"
FT                   /translation="MANRTGISLTVLGAVERGNRTVEADMLNIIAQTLEIEVRELTD"
FT   gene            74640..75668
FT                   /gene="yacF"
FT                   /locus_tag="PPSC2_00360"
FT                   /old_locus_tag="PPSC2_c0074"
FT   CDS_pept        74640..75668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="PPSC2_00360"
FT                   /old_locus_tag="PPSC2_c0074"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54061"
FT                   /db_xref="GOA:E3EET8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E3EET8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427045.1"
FT                   /protein_id="ADO54061.1"
FT                   /translation="MLKIGDIEMKNQVVLAPMAGVCNPAFRLIAKEFGTGLVCAEMVSD
FT                   KAIIHGNKRTREMLFVDEREKPLSLQIFGGDRESLVKAAKVVDQETNADIIDINMGCPV
FT                   PKVTKCDAGARWLLDPNKIYEMVSAVVESVSKPVTVKMRIGWDSEHIYAVENARAVERA
FT                   GGQAVSVHGRTREQLYTGHANWDIIKEVKEAVSIPVIGNGDVVTPEDARRMLDLTHCDG
FT                   VMIGRGALGNPWMLYRTIEYLQTGKLLPDPSPEEKIRIAILHMDRLVALKGEAVAVREM
FT                   RKHLAWYLKGLKDSARIKDLIMEETKRDDMVRILDQFVSQLHMVENEGPSTNAASLATV
FT                   AQ"
FT   gene            75883..76359
FT                   /gene="greA1"
FT                   /locus_tag="PPSC2_00365"
FT                   /old_locus_tag="PPSC2_c0075"
FT   CDS_pept        75883..76359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA1"
FT                   /locus_tag="PPSC2_00365"
FT                   /old_locus_tag="PPSC2_c0075"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54062"
FT                   /db_xref="GOA:E3EET9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E3EET9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012772085.1"
FT                   /protein_id="ADO54062.1"
FT                   /translation="MSDKEVILTQEGLRKLEDELENLKSVKRREVAERIKVAIGYGDIS
FT                   ENSEYEDAKNEQAFIEGRVITLEKMLRNARIINSDEIDTDVVGVGATVTVEDLEFGDIT
FT                   EYAIVGSAESDPLQNKISNESPVGKAILGKKKGTVVDVTVPAGVIQYKIVDIKK"
FT   gene            76472..77998
FT                   /gene="lysS"
FT                   /locus_tag="PPSC2_00370"
FT                   /old_locus_tag="PPSC2_c0076"
FT   CDS_pept        76472..77998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="PPSC2_00370"
FT                   /old_locus_tag="PPSC2_c0076"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54063"
FT                   /db_xref="GOA:E3EEU0"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEU0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308161.1"
FT                   /protein_id="ADO54063.1"
FT                   /translation="MSDETTNQELQENREELSELLQIRRAKLDELRSLGIDPFGRKYIR
FT                   TAEAGVLLSKYDSLTKEELEEKNIEVSIAGRIMAKRVMGKASFAHIQDLSGRIQIYVRQ
FT                   DTVPEANYKAFGILDLGDIVGVKGVLFKTKTGETTIKVLDIEVLSKSLYPLPEKYHGLK
FT                   DVELRYRQRYVDLVMNPEVQKTFITRSRIIQSMRRYLDSLGYLEVETPTLHAIAGGAAA
FT                   KPFVTHHNALDTQLYMRIAIELHLKRLIVGGMEKVYEIGRVYRNEGVSTRHNPEFTLIE
FT                   LYEAYADYKDIMQLTENLIAHIAQEVLGTQHIQYQGQEVDLTPQWRRVSMVDAVKEVTG
FT                   VDFSAQMSNEEAHRLAKEHKVPVEPHMTFGHILNAFFEHFVEETLIQPTFITGHPVEIS
FT                   PLAKKNEQDPRFTDRFELFVVAREHANAFTELNDPIDQRQRFEAQLLEREHGNDEAHQM
FT                   DDDFIRALEYGMPPTGGLGIGIDRLVMLLTDAPSIRDVLLFPHMRNRTVE"
FT   gene            78086..79423
FT                   /gene="ktrB1"
FT                   /locus_tag="PPSC2_00375"
FT                   /old_locus_tag="PPSC2_c0077"
FT   CDS_pept        78086..79423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ktrB1"
FT                   /locus_tag="PPSC2_00375"
FT                   /old_locus_tag="PPSC2_c0077"
FT                   /product="ATP synthase subunit J"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54064"
FT                   /db_xref="GOA:E3EEU1"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEU1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428057.1"
FT                   /protein_id="ADO54064.1"
FT                   /translation="MKRSVKLSRFASPPFILVIGYVLIIALGTLLLMLPIANHGGHAPH
FT                   WIDSLFTSVSAACVTGLVVVDVDSTYTVFGETVILVLMQLGGLGFMTLATLFALLLGRR
FT                   LSLKDRLLLKEAINADSMEGIVRIIRKVLIFSFTIEAIAAVVLALRWMREMPVGQAIYY
FT                   GIFHSVSLFNNGGFDLFGTSFQQYAGDFVFNMIASVLVISGGLGFLVLSDLFDFRRARR
FT                   LTLHSKMVLSVSGALIVIGALVIFIFEFTNARTLGELNWEGKVYAAVFQSVSTRSSGTS
FT                   TVDISGLRQASQFFIMLLMIIGASPGSTGGGIKTTTFLLMVGALIAVMRGQKEIVFFRH
FT                   RVPQDIMMRALTIIVMALFIFSIVVILLLMTEDAPFLSLAFEAASAIGTVGLSVGVTPG
FT                   LSDAGKLIICVTMFIGRIGPLTIAYAIRPRSTKTLYRRPEGHIVIG"
FT   gene            79713..80246
FT                   /gene="ymcC"
FT                   /locus_tag="PPSC2_00380"
FT                   /old_locus_tag="PPSC2_c0078"
FT   CDS_pept        79713..80246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ymcC"
FT                   /locus_tag="PPSC2_00380"
FT                   /old_locus_tag="PPSC2_c0078"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54065"
FT                   /db_xref="GOA:E3EEU2"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEU2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818892.1"
FT                   /protein_id="ADO54065.1"
FT                   /translation="MYLFIISAEVLFWVFVVAGLVARYMFGLKKLGGLLLLFTPIIDIL
FT                   LLIAVFITVRSGMEITTATGLAACYFGITVAFGHRLIKWADVRFSHWFGKGPKPERKYG
FT                   AAHAKEERIGWLLHLLGWAIGNALLLAIIVYVGDPQRTAALEGIMQTWAIVLAIDFVVS
FT                   FSYTVAPKKHKHKA"
FT   gene            80670..81440
FT                   /gene="fusG"
FT                   /locus_tag="PPSC2_00385"
FT                   /old_locus_tag="PPSC2_c0080"
FT   CDS_pept        80670..81440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusG"
FT                   /locus_tag="PPSC2_00385"
FT                   /old_locus_tag="PPSC2_c0080"
FT                   /product="enoyl-ACP reductase"
FT                   /EC_number="1.3.1.10"
FT                   /note="Catalyzes a key regulatory step in fatty acid
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54067"
FT                   /db_xref="GOA:E3EEU4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEU4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818891.1"
FT                   /protein_id="ADO54067.1"
FT                   /translation="MAVLLSGKNILIMGVANNRSIAWGTAQSLAAEGANLIFTYENERV
FT                   AERVLKLAETIPGSIVCPCNVQSDEELDALTDFLKEKVGVLHGYFHSVAFAKAEDLEGL
FT                   FVDTSREGFAIAQEISAYSLAAVSRRVYPLMTEGGSIVTMTYIGAERAIKNYNIMGVAK
FT                   ASLEASMRYLSNDLGTYGIRVNAISAGPIRTLAAYGIKDFNTMLKHIEETTPLRKTVDT
FT                   SEVGDTALFLFSHLSRGITGEVIHVDAGYHITGM"
FT   gene            81453..82913
FT                   /gene="fusF"
FT                   /locus_tag="PPSC2_00390"
FT                   /old_locus_tag="PPSC2_c0081"
FT   CDS_pept        81453..82913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusF"
FT                   /locus_tag="PPSC2_00390"
FT                   /old_locus_tag="PPSC2_c0081"
FT                   /product="peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54068"
FT                   /db_xref="GOA:E3EEU5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEU5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368714.1"
FT                   /protein_id="ADO54068.1"
FT                   /translation="MLITHTDCRIISPEGIMSRERLERDVAIFSRMLTLRGIPEDGRVI
FT                   LKAANSYWFVVSLFSLCHLAVSVTVVDEQTVIDEVAQIYDEAGACCILTDSDLELPHAL
FT                   VILIQDLIQEEAVHPYWVGEPKSEALDFNKWCERSDALILYSSGTTGKPKGIVKAGSAF
FT                   MENIRHSIHAMNYIPSDHMLPVVPFSHFYGVSLIFSWWLTSCSLIICNPKNLWSVIASI
FT                   TKDRATVVDANPSAFYTLLRMLSRKPEQLELIKQSPVRMWCVGGSPLTQDLEEKFNNIF
FT                   GQPLLNGYGLSELGNVTLGTLDCPKGCGKPLPGVDLKILDSTGNQQADGIVGEVWIRSA
FT                   GCMEGYLNRPDLTQSVLQDGWFKTGDLGYLDDGMLYVIGRSGKTVNRMGYMVSPVYIED
FT                   RIGSLGYRSCVITLEDEAKGTLLVAFIESESPQVLPVLRKEMNRVLPSYMFPDLLLPLD
FT                   HFPLNRNGKVDRLEMERTALEKAASRKA"
FT   gene            82958..84181
FT                   /gene="fusE"
FT                   /locus_tag="PPSC2_00395"
FT                   /old_locus_tag="PPSC2_c0082"
FT   CDS_pept        82958..84181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusE"
FT                   /locus_tag="PPSC2_00395"
FT                   /old_locus_tag="PPSC2_c0082"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54069"
FT                   /db_xref="GOA:E3EEU6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEU6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308166.1"
FT                   /protein_id="ADO54069.1"
FT                   /translation="MSINPELAENTLFLKRHESILKCLNYLIENRQEVMDILTQFSSYR
FT                   AANAEIDSTILTLQGALQEVQTHQPSWQRSMAVFMPSNVILYSYALYLLIPSLYVENID
FT                   FRPSSHVNEYVNMLHEKLQAVHELPIYIRKVSQKVFMENSVMPADIVVFTGSYTNAEKI
FT                   KKQIRKDQLYIFYGQGINPFIIGPDADLELAVTDVIRMRLFNSGQDCLGPDIILVHQEV
FT                   SEPFKNLLIQRLDELVFGANNDPNANYSPIFYKDTLYSVSEYFNTNDKFIIYGGGIDFR
FT                   TKKMEPTVVYSELDQNLEIIEYFSPVFNVVSYQDDEQLIKRISSSYFSERAMGCSLYGS
FT                   EHLTDVLRKKHTLTINQTLEDVDQGNKPFGGYGTMSNYIFYDYKLVSKPILISEIVAEY
FT                   LSEKRSLV"
FT   gene            84178..85878
FT                   /gene="fusD"
FT                   /locus_tag="PPSC2_00400"
FT                   /old_locus_tag="PPSC2_c0083"
FT   CDS_pept        84178..85878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusD"
FT                   /locus_tag="PPSC2_00400"
FT                   /old_locus_tag="PPSC2_c0083"
FT                   /product="thiamine pyrophosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54070"
FT                   /db_xref="GOA:E3EEU7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEU7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428062.1"
FT                   /protein_id="ADO54070.1"
FT                   /translation="MTASISPWDAIIGYLQSAGVQHLFGLPSDDLNIVASLPSSGMDFI
FT                   LCKDQRNAVFMSAGYALTTNQMSVCVVGKGPALSNTLTGLLEAKNLGAPLLLLALGTGG
FT                   DKLGTRSFQEADQISLVKPLVKWAYRVEHVDRLVWAMERAAFLTINGAPGPVYIELPEN
FT                   LMDQPVPTELQFAPPEKLSCSPSLRELDAAWSIIETARKPLILVGGGMKSGTGDAIERF
FT                   ASQHGAALFATASGRSVINEDHALFCGVAGLYTDLSLRQIWNESDVVITLGSRLEETAT
FT                   FEWDILLQDTPLIQVNVELEDFAHEFRGIKLLGDGYAAVEQWLERRGQEPDEAWLETIG
FT                   RCKQKAFSQRANYLEELKRAPGIHVPELLDMIQAEFPEDLVLLQENGLQDMWSYFYPYF
FT                   RFASGSLSIVPSDQTSLGFGAAAALGASVATERPVVALVGDGAFNLFCSDFMTAVQYQI
FT                   PVIYLVLNNGGYGWLQNQMNYKHISGQDFPFVSEAVKTGIQIPQYEFVESLAIRSKGEA
FT                   REQLQLAWQKYKENKLVVVEVFADLADVHEKISHVYGDFPLYEQQASKN"
FT   gene            85899..87143
FT                   /gene="fusC"
FT                   /locus_tag="PPSC2_00405"
FT                   /old_locus_tag="PPSC2_c0084"
FT   CDS_pept        85899..87143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusC"
FT                   /locus_tag="PPSC2_00405"
FT                   /old_locus_tag="PPSC2_c0084"
FT                   /product="3-oxoacyl-ACP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54071"
FT                   /db_xref="GOA:E3EEU8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEU8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685750.1"
FT                   /protein_id="ADO54071.1"
FT                   /translation="MVRRRVVVTGQGVVTPVGLHLTDFWNSLLEGKSGIGPVTVFDTAN
FT                   IPTKIGAQVTGFDPLEYMSKKEAQKVAQFTQFALAAARQAVEQSKLVIDERNAGRVGVI
FT                   VGSGAGGLDVIEENYRKLTELGPKRVSPYFVSSMMINSAPGEISIAIGAKGPSFAVVTA
FT                   CATGSNAIGEALRTIQYGTADVVVAGGAEANFSQLDLASFANIHALSRRNEEPQKASRP
FT                   FDTDRDGFVIGGGAGVLVLEELEHALNRGATILAEVAGYGCTTDAYHITAPDPSGSGPA
FT                   EAINIALQDGGLTPQEIDYVNAHGTSTPFNDRMEINAIQKVFGEHAPRLAISSIKSMTG
FT                   HLMGGAGAVELIATVQSMIHSKVPPTLNCDNPEAPELNFVPHVYQEREVRAAISNSFGF
FT                   GGHNVCLAVRKWEGV"
FT   gene            87148..87555
FT                   /gene="fusB"
FT                   /locus_tag="PPSC2_00410"
FT                   /old_locus_tag="PPSC2_c0085"
FT   CDS_pept        87148..87555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusB"
FT                   /locus_tag="PPSC2_00410"
FT                   /old_locus_tag="PPSC2_c0085"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54072"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEU9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685751.1"
FT                   /protein_id="ADO54072.1"
FT                   /translation="MSEELIRIEDVLPHRYPFLLLDGVTGYETSQWAKGYKLVTRSEWF
FT                   ITEANPYMPPMLIVESLAQLAAFAAIDKRGISYLTNLNGVRFHSFAKPGDRIDLYFEVV
FT                   KRRRGYILGSGRATVGDRLVAEAEEIVSLDQ"
FT   gene            87651..111380
FT                   /gene="fusA"
FT                   /locus_tag="PPSC2_00415"
FT                   /old_locus_tag="PPSC2_c0086"
FT   CDS_pept        87651..111380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="PPSC2_00415"
FT                   /old_locus_tag="PPSC2_c0086"
FT                   /product="fusaricidin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54073"
FT                   /db_xref="GOA:E3EEV0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEV0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427039.1"
FT                   /protein_id="ADO54073.1"
FT                   /translation="MNNMQLFDLTNAQKRIWYTELLYPDTSVSQLSGTAKMKGHIHIAA
FT                   FMQSINLIIKQYDAFRIRITSVDGVPKQYVVPYEERQLECLDLTHIESISEVEALLEQH
FT                   KSKPLPLLDSELFQFLIVKISEEEYWINIKMHHIISDGISMVVYGNQLIAFYMDLIQGN
FT                   EPKLSDDCSYIEYIADENAYELSDRYQKDKAYWLDKFSDLPELTGWKSYNPLSLSTQAV
FT                   REHFTVPEALYRELQAFCQQNRISLFQFFMGAMYIYIHKVTNQPDVVIGTSFANRGNKK
FT                   EKQKIGMFVSTAAARTYVDKDVEVLSFLQDVARDQMSVLRHQKYPYNQLIQDLREMHGN
FT                   KDIQRLFGVSMEYRLINWVDLDDVRILTDYDFCGDEVNDFVLHIVEILDEGELVLDVDY
FT                   RTKLFERSEVTDMVSQLLTIAEQIIHTPQLSIAEVNLLGEAEEQSILALSEGDVVDYPR
FT                   EKTIHGLFEEQAARTPDHVAVQMGEQSITYLALNEQANQLARYLRTEGVGADVLVGIMA
FT                   DRSLEMVIGMLAVLKAGGAYVPIDPDYPEERIRYMLEDSGVRLLLTQSHLWESTTFDGK
FT                   LVSLDEAATYTGDASNLESISGPNHLAYVIYTSGTTGKPKGTLIEHKNVVRLLFNDSNL
FT                   FDFSSQDTWTLFHSFCFDFSVWEMYGALLYGGKLVIVPALTAKSPAAFLELLKDNQVTI
FT                   LNQTPTYFYQVIQEELAHSSTELSLRKIIFGGEALSPSLLKNWRAKYPGVQLINMYGIT
FT                   ETTVHVTYKEITEHEIEAGKSNIGRTIPTLSAYIFDEHRRLQPVGVPGELYIAGDGLAR
FT                   GYLNRPDLTAEKFVEHPYRAGERLYRTGDLARWLPDGNIEYLGRIDHQVKIRGYRIELG
FT                   EVEAQILKAPNVRETIVLARDDEQGQKLLCAYYVASSDLSPGELRSQLATELPAYMIPT
FT                   YFVRLEQMPLTPNGKLDRRALPAPEGSVQSGEDYLAPRTAVEAQLVLIWQDILGAARVG
FT                   VRDNFFEIGGHSLRATLLVTRIRKELGCSISLREVFQSPTVESLARLVKERIPTVYESI
FT                   PQAEKSEAYPVSSAQKRLYVLRQMDGGELSYNMPGAFTVDGPLDRVRLESAFKALIQRH
FT                   ESLRTGFYMQDGELVQRVHKNVPFALDYTEASVEETDTLIHSFTRAFDLSQAPLLRVGL
FT                   VKLQEERHLLLFDMHHIISDGVSIQILVEELTQLYQGEHLPELHIQYKDYAVWQREQSE
FT                   REWQDLEAYWLQAFEGELPVLELPTDFQRPSVRSFEGSRIDFTLDESGNKAIQELASRT
FT                   GTTLYMVLLAAYSVLLHKYTGQKDIVVGSPVAGRPRAELEGIIGMFVNTLALRSYPAGE
FT                   KTFQDYLLEVKETALKAFEHQDYPFEKLVEKLGVGRDVSRNPLFDTLLVLQNTEQEEQD
FT                   MDGVHFTPYPMDTVTAKFDLSLNVEEKGAELAFGLEYSTALYRRETVERLATHLLRVLH
FT                   AVATNPQLQLAEIEMITPEEKVQIIEVFNATATPYPRDKAIHELFAEQVKRTPEQTALV
FT                   FGDVRLTYLELEDKARRLAQTLRRLGTLREQPVAIMGGRSIEMVVGMLAVLQAGGAYVP
FT                   IDPDYPEDRVRYMLEDSNAKLLLVQKGELINVDYGLPIVDLSSAEAYASEPVQAEEVVQ
FT                   GPEGLAYVIYTSGTTGRPKGVMVEHRNVVRLVKETNYVELNESTRILQTGAVAFDASTF
FT                   EIWGALLNGGQLYFVENDDILIADRLKAAIAKYGITTMWLTSPLFNQLSLQDEYLFRGL
FT                   KALLVGGDVLSISHINRVIEANPDLVPINGYGPTENTTFSTTYKIPGRVEGGVPIGRPI
FT                   SNSTAYVVNESLQLQPIGAWGELIVGGEGVARGYLNRPDLTAEKFVPSPVKEGERCYRT
FT                   GDLVRWLPDGNLEFKGRIDEQVKIRGYRIELPEIEAQLAKVESVVEAVVVVRADELGEK
FT                   QLCAYYVADRALTAGEVRLALSQVLPGYMMPSYFIQMDRMPLTSNGKVDRRSLPAPQVG
FT                   AHTGRKYTAPRTPAEEALASVWQGVLGAEQVGIHDNFFELGGDSIKAIQVSSRLLQAGY
FT                   RLEMKQLFKSPTIAELGAEIQTAVHMAEQGVVRGATRLTPVQQWFFGRNQAEPHHFNQA
FT                   VMLYREQGFEEKALHHVLRKLAEHHDALRMVFRQTEHGYEAWNRDLEEGELYSLFTADL
FT                   RNESNPVAAITTLSDDIQRSINLAEGPLMKLGLFHCQDGDHLLIVIHHLVVDGVSWRIL
FT                   FEDIAAGYEQVIQGQALTFPQKTDSFRDWGDALARYSESPEIEIHRAYWRELGDQPLEQ
FT                   LPKDEAVESLLLKDSEMVTAEWTVEETDQLLRKAHRAYQTETNDLLLAALGMAVSKWSG
FT                   IGKIAVNLEGHGREPIVPNIDITRTVGWFTSQYPVILDMGNNTELSALIKSVKEGLRRI
FT                   PNKGIGYGLLKTMASQEDADSFNLQPEISFNYLGQFDQDLQGSSLQVSPYPTGSAQSLL
FT                   GESAYTLDINGMVTDGALTLTMSYNGKQYKSSTMKQLAGYIEESLRLLLQHCVTQERTV
FT                   LTPSDVLAKGLSIADLEELSKQTNHIGDIENVYSLTPMQKGMLFHDMFEPHTGAYFEQA
FT                   AFDFKGSFDPTAFGHSLDAVVERHAILRTNFYSGWGGEPLQVVFRHRGAKLVYEDLREM
FT                   NASQREAYLKTFAAKDKAQGFNLAEDELLRVSILHTDEESFRLLWSFHHIVMDGWCVPL
FT                   ITQEVFEHYFALLEGREPQLAEVQPYSRYIEWLEQQDEAAAADYWSRYLAGYEQQTLLP
FT                   QVDGAAKREGYVAEKLNYPVSRELTERLEKVARDAHVTMNILLQSIWGVALQRYNGSRD
FT                   VVYGSVVSGRPAEIPGIDRMIGLFINTIPVRVKTEENLPFTVLMKRQQEQYMASHMYDT
FT                   YPLFEIQAQTDQKQDLISHIMVFENYPVEEEVERLGGGEAAFEIEEAELLEQTNYDFNL
FT                   IVLPGKEMRLLFQYNALVYDPATIEQIKGHLFHLMEQIVENPAISVDALELVTPQEREQ
FT                   ILNVWGDTGASSKHRTTFHGLLEEQAGRTPDATAIVFENEVLTYAELNAKANGLARRLR
FT                   AEGIKTGDLVGLIVERSTDMIVGMYGIMKAGGAYVPIDPEYPKERINYMLEDSGTKMIL
FT                   AQAHLLEHRGWTGNVLLLDEPSTYDADTSNLKDTADPDDLAYVIYTSGTTGRPKGVLVE
FT                   HRGLQNLSDVYRGLFEVTPQDRIVQFASLSFDASVSEILTTLSHGATLCIPSTQEILDH
FT                   ALFEQFMNDKGITVATLPPAYAIHLEPERLPTLRCLLTAGSATSVELIEKWRKHVQYFN
FT                   AYGPTEDSVCTTIWNAQNSEETVGIVSIGQPIANHRVYILDEHFRLLPVGVAGELCISG
FT                   IGLARGYHNRPELMDEKFVDNPYAPGERMYRTGDLVRWLSNGTIEYLGRIDHQVKIRGY
FT                   RIELGEVEAHMLRVPSVQEVVVLAVESDDGYKDLVAYFVAAQKLEVSELRADLSEMLPG
FT                   YMIPSRFIQLEDMPLTSNGKIDRKALQGERGWAVTSSEAPKTPIEIQLAEIWQEVLGVE
FT                   SAGVKDNFFHFGGHSLRAALLVSRIRKEMNREISLREVFESPTIEGLARAIEGYTPLNF
FT                   EEIPTAEAREHYPLSSAQKRLFILSQLEGGELSYNMPGILTVEGDLNRERLEQAFRRLI
FT                   RRHGSLRTRFVTVNGEPVQQILPDVPFTVEYAELSESEAEATLQQFVRPFDLGEAPLLR
FT                   VGLIRIAHERHLLLFDMHHIVSDGVSMNILIEEFLRFYQEEDVLPALQIQYADYAVWQQ
FT                   EQLGRERLKAQEAYWLDAFRGSLPVLDLPVDEVRPAVRSFAGDRIDFQIDASLSASLQE
FT                   LATRTGSTLFMVLLAAYTTLLHKYTGQEDVIVGSPVAGRSHATLEGLIGMFVGTVAMRT
FT                   YPEGEKSFEAYLQEVKETALRAYENQDYPFEELVEKLQLQRDLSRNPLFDTMFVLQNIE
FT                   QGEQEIEGLRFTPYDHVHPAAKFDLTLTVSEADGTLNCTLEYATAIYKRETAERMAGHF
FT                   VQLIQEAIANPGMSLSSLDIVTPQEKSMLMKDADEAKADYPRDKTIHALFEEQAVRNPD
FT                   AVAVVCEEATLSYSELNERANGLARTLRERGLQPDGLVGIMADRSLEMVVGILAILKAG
FT                   GAYVPVDPEYPEDRIRFMLEDSGAKLLLTQAHLETRVSFTGDVINLDEPASYKEDISNL
FT                   EPAAGPNHLAYVIYTSGTTGKPKGTLIEHKNVVRLLFNDKNMFDFGSQDTWTLFHSFCF
FT                   DFSVWEMYGALLNGGRLVIVPSLTAKGPERFLQLLKDQKVTVLNQTPTYFYQLLQEELS
FT                   HRAAELSLRMIIFGGEALSPALLKDWRAKYPQVQLINMYGITETTVHVTYKEITELEIE
FT                   QGRSNIGIPIPTLRAYILDEQRRPQPIGIPGELYVAGEGLARGYLNRPELTEEKFVAHP
FT                   FEAGERMYRSGDLARWLPDGSMEYLGRIDHQVKIRGYRIELGEVEAKLLHAPSVREAVV
FT                   LAREDGSGQKVLVGYFTADQMLTVGELRKALAAELPAYMIPSYFMQLEQMPLTPNGKLD
FT                   RKALPAPEANVQTGAVYEAPRNAAEEALASVWQGVLGAQQIGIHDHFFDLGGDSIKAIQ
FT                   VSSRLFQSGYKLEMKDLFKYPTIAELSPYLQVAGRTAEQGEIKGAAELMPIQRWFFERH
FT                   TAEPHHYNHAVMLHRKDGFDEAALRLTMDQIAIHHDVLRMVFRPTEAGYTAWNRGVDEG
FT                   ELYTLDIADMRQADDEVAAVQAQADAIQASFHLEDGPLFKLGLFHCKDGDHLLIVIHHL
FT                   LVDGVSWRILFEDIATGYEQALNGQAIVLPQKTDSYLVWSEQAAKYAAGPALDKERSYW
FT                   QQIEETVLTPLPKDQDQEPGTIRDTESVTVTWSTEETDLLLRQANRAYHTETNDLLLTA
FT                   LGAAIQRWTGMEQVLVNLEGHGREMIIPDLDITRTVGWFTTQYPVLLNLQDGQEVSIRI
FT                   KRIKENLREVPHKGIGYGLLKYMAPEKDTRFSVEPEVSFNYLGQFDQDLEGNALSLSTH
FT                   SVGKALSDYTPQQYALDVNGMVAEGQLSLTITYSNRQYRKETVSHFAELLQSSLSEVIR
FT                   HCVAQERVQLTPSDVLFQGLTLEQLDRLTAQTAHIGEIEDVYKLTAMQKGMLFHSLLEP
FT                   DSSSYFEQASFELRGSFDVDTFFESFQALAQRHAILRTGFYNNITDVPLQVVFKQRPIP
FT                   LNYVDLRAATLEEQEAQIQAYTTEDMAKGFSLSEDPLMRVTVLQKEQSHLVLWSFHHIV
FT                   MDGWCIPIITQELFDYYSALRQQVQPVLPPAQPYSRYIEWLDAQDDQEASTYWSQYLED
FT                   YDGNTVLPEAKTKSQAKEEGYVLNEHVLHLGTALTRKMDVVAKRNHVTVNTLMQTAWGL
FT                   ILQRYNASSDVVFGGVVSGRPAEIAGIENMVGLFINTVPIRVQSSKDEAFVEVMKRTQA
FT                   HSLAGRAYDTYPLYEIQGKTTQKQDLISHIMIFENYPLDEQVEQSGNHTEDNLEVANFA
FT                   MFEQTNYDFNLVVIPGEDIKVCIRYNASVYEQESIARIGGHLLQMLDQVATRPQATIQE
FT                   LEIVTTEERTNLLDWGGKAHVYPSDQGLHTLFEEQVARTPDKIAAISGDIQITYRELNE
FT                   WANRLASTLIAQGLRSEQVVGLLADRSVELLVAIMGVLKAGGAYVPIDPEYPQERIQYI
FT                   LKDSGAEILLTQSHLTKLASFEGMVMELDSPHIYGTGVNNPNIPVRGNDLVYLIYTSGT
FT                   TGNPKGTMINHKGIVNYIWWANKVYCAGQPTDFPLYSSISFDLTMTSMFTPLINGGIVR
FT                   IYDGIDKAEVVQHILRENAVDILKLTPTHLSLIKDMTIPAESRIQQLIVGGENLTTHLS
FT                   KTITDLFGGNIKIYNEYGPTETVVGCMIHLYDPAKDTRESVPIGLPSDNIYIHILDEQL
FT                   RLVPLGVEGEMYIAGDGVARGYLNRPDLTAEKFIRNPFAAEGNMYRTGDLARRLPNGDI
FT                   EYIGRIDHQVKIRGYRIELGEIEAKLLDMPLVEEALVVAWADANGQKSLCAYFVADREM
FT                   SVSELRNELSAELPAYMIPSYFVQMDVMPLTPNGKLDRKALPEPNVGVKAGAAFAAPRT
FT                   DVENILASIWQGVLGVPLVGIHDNFFELGGDSIKSIQVSSRLLHAGYKLEMKDLFSYPT
FT                   IAELAQRVSAVSRIADQSEVHGTVKLGPAQRRFLEEQSTDLHHFNQSVMLYRREGFNTD
FT                   ALAKVIQKIAEHHDALRLVFRQGEHGVEAWNRSLGEGELYSLQIHDLRDEKDPALAIEA
FT                   GAEAIQRSISLEDGPLFRLGLFRCTEGEHLLIIIHHLAVDGVSWRILFEDLQEGYEQAA
FT                   RGEAVKLPQKTDSYRAWVDGITQYANSPAAEQERSFWAEVEGEGFALLPKDKVDGALLI
FT                   KDSEAVTVTWSAEETEQFLKEANRTYNTEVNDLLLTALGMAVQEWTGIERVGILLEGHG
FT                   REPVVPELDITRTIGWFTSQYPVALEMGGEMEIGARIKRIKEDLRRIPNKGVGYGILKY
FT                   LSDVSDGSSFSAEPEITFNYLGQFDQDLAEGTMEVSPYSAGSEVSEQMVQHQALNINGL
FT                   ITEGQLQLSVSYNHQQFHADSVENFVGILKERLSEVIGHCVRKERTELTPSDVLLKDIS
FT                   LEEIEELEEQTRHIGSIENMYKLTPMQKGMLFHSLLEPHSEVYFEQATFEIQGVFYPED
FT                   FKRSLQHLMKRHAILRTNFHAGWGDFPIQIVFKERACDFVYEDLHELESSEIEARLVAY
FT                   IAQDKARGFDLANEALLRVAILRTAKEHYHLLWSSHHIILDGWCMPLVLQEVFETYGAL
FT                   REQKEPELPAAASYSQYIQWLEKQGEEEASSYWRGYLEGYEQQTKLPQAFTQPSAKAEA
FT                   YLSEKLVFTLDAELTERLEQVAKQHQVTMNTLMQAAWGIVLQRYNRSQDVVFGSVVSGR
FT                   PAEIPGIESMIGLFINTVPVRVQAEGSESFSHVMKRQQELYLAGHAYDSYPLYEIQAQS
FT                   EQKQDLISHIMVFENYPVEEHLEEKIANDEAEYKITDVQMFEQTNYDFNLIVLPGRSLE
FT                   FLYRYNARVYDRESVERIQGHLTKILTSVSVQPAIRIDELELITPEEKSQIIEVWGDTA
FT                   APYPREKTLHGIFEEKAALTPDHTALIFGETELTYGELHQQANRLARTLRAQGVRPDQP
FT                   VGIMVERSLEMIIGIHAILKAGGAYVPIDPEFPEDRIRHMLEDSGAKLLLTKSHLIDRF
FT                   PFTGTILALDDPQAYHADDSNLEPIAGPEHLAYIIYTSGSTGKPKGVMIEHRSAVHTLS
FT                   QLEAEYPMLAGDRFLLKTTFTFDFSVPELFCWFFGQGTLVILPQGVDKDPVALLEAVDT
FT                   NRITHLNLVPSMLSVLVQYLKESSTQGFPTLKYLFACGETLPAKLVEEYYKVSPYAVLE
FT                   NIYGPTEAAVYATRYTTSPETAALTHVPIGKPYANVQVWMMDSAAQLSPVGVPGELCIA
FT                   GEGVARGYFNQPDLTAEKFIPHPYKPGERIYRTGDLARWLPDGNIEYLGRIDHQVKIRG
FT                   YRIELGEVEAQILKVPSVQEAVVLALADSSGSTQLCAYFVAEEGLAAGVLREALASELP
FT                   SYMIPSAFIQLGQMPLNPNGKLDRKALPAPETLLRSTAEYIAPRTQTEVELAQIWSEVL
FT                   GVQEIGIRDHFFELGGHSLKVLGLIQRISSSMGVHLPLQAVFNLPTVEEMAHEIFKLQA
FT                   TAAADEQEMEIIRFPGKGTLKVFCFPPRVGHSLGYYEMAKELEGLCEVYGMEFIGDRYQ
FT                   GQDMLDRYIDAIVDIQAEGPYVFLGYSLGGNLAFEVAKAMEMRGYHVGDIIMVDAMRKM
FT                   SKDESTPEELEEIVETVLDSIREQYKAFLADPADRERVMEKMLVYSTYRDELINAGEVH
FT                   ANIHALIAEDDSIGPDTSLDKLLWQQATLGQYKEYEVIGTHDVLLDSGFVGENAKVLRQ
FT                   ILGKIAEASSKNKPILS"
FT   gene            complement(111496..112530)
FT                   /gene="fusTE"
FT                   /locus_tag="PPSC2_00420"
FT                   /old_locus_tag="PPSC2_c0087"
FT   CDS_pept        complement(111496..112530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusTE"
FT                   /locus_tag="PPSC2_00420"
FT                   /old_locus_tag="PPSC2_c0087"
FT                   /product="alpha/beta hydrolase-thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54074"
FT                   /db_xref="GOA:E3EEV1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEV1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818884.1"
FT                   /protein_id="ADO54074.1"
FT                   /translation="MKQRRRTWTRVVFGVISCLLLVVISGFVYESIASKHDKSQYPPLG
FT                   RMVDAGGYRLHIHKIGAGSPTIVLESGSGESSLSWRDIPEKLSSFATVVSYDRAGYAWS
FT                   EEANTPRTGENIVRELHTALKNADIQPPYIFVGHSLGGMYSRLYAQTYRNEVAGLVLVD
FT                   ARPENDARRTNKIYAKERPKGNPSPLISILLEKAGAFRLFPNFMLNGRVEYRDRKSFVN
FT                   IVASPKYFRSVAEEGDLASTTEDAIRGQHLGNLPVRVIARGIQQDLTQFGISKRGNDQI
FT                   EQSWQIGQREMLNISTNSKFIVAKKSEHMIIHDQPELVIQVIRELISNIHYSRSTVAKT
FT                   NTDH"
FT   gene            113147..114705
FT                   /locus_tag="PPSC2_00425"
FT                   /old_locus_tag="PPSC2_r004"
FT   rRNA            113147..114705
FT                   /locus_tag="PPSC2_00425"
FT                   /old_locus_tag="PPSC2_r004"
FT                   /product="16S ribosomal RNA"
FT   gene            114913..117843
FT                   /locus_tag="PPSC2_00430"
FT                   /old_locus_tag="PPSC2_r005"
FT   rRNA            114913..117843
FT                   /locus_tag="PPSC2_00430"
FT                   /old_locus_tag="PPSC2_r005"
FT                   /product="23S ribosomal RNA"
FT   gene            117920..118036
FT                   /locus_tag="PPSC2_00435"
FT                   /old_locus_tag="PPSC2_r006"
FT   rRNA            117920..118036
FT                   /locus_tag="PPSC2_00435"
FT                   /old_locus_tag="PPSC2_r006"
FT                   /product="5S ribosomal RNA"
FT   gene            118380..119837
FT                   /gene="guaB"
FT                   /locus_tag="PPSC2_00440"
FT                   /old_locus_tag="PPSC2_c0088"
FT   CDS_pept        118380..119837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="PPSC2_00440"
FT                   /old_locus_tag="PPSC2_c0088"
FT                   /product="inosine-5-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="catalyzes the synthesis of xanthosine monophosphate
FT                   by the NAD+ dependent oxidation of inosine monophosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54075"
FT                   /db_xref="GOA:E3EEV2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEV2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427215.1"
FT                   /protein_id="ADO54075.1"
FT                   /translation="MWEDKFGKEGLTFDDVLLVPRKSVVLPKEVSVATRLSDNVKLNIP
FT                   LMSAGMDTVTEAVLAIAMAREGGIGVIHKNMSIEQQAVEVDRVKRSESGVITNPFSLTP
FT                   DHLVSDAEAVMGKYRISGVPVVNEENKLVGIITNRDLRFIHNFDLKISEVMTKEELVTA
FT                   PVGTTLQEAEVILQKHKIEKLPLVDEGNYLKGLITIKDIEKAIQFPNAAKDAQGRLLVG
FT                   AAVGISKDTFERTEALVKAGVDLIVVDSAHGHHINIIEAVRELRKTYPDLTIVAGNVAT
FT                   GDGTRELIEAGASVVKVGIGPGSICTTRVIAGIGVPQITAIYDCATVAREYNIPIIADG
FT                   GIKYSGEITKAIAAGASAVMLGSLFAGTEESPGESEIYQGRRFKVYRGMGSMAAMKQGS
FT                   KDRYFQDDDKKLVPEGIEGRVAYKGPLSDTVHQLLGGLRSGMGYCGTANIEELRNDTSF
FT                   IRITGAGLRESHPHDVQITKEAPNYSL"
FT   gene            120165..121553
FT                   /gene="dacA1"
FT                   /locus_tag="PPSC2_00445"
FT                   /old_locus_tag="PPSC2_c0089"
FT   CDS_pept        120165..121553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA1"
FT                   /locus_tag="PPSC2_00445"
FT                   /old_locus_tag="PPSC2_c0089"
FT                   /product="peptidase M15"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54076"
FT                   /db_xref="GOA:E3EEV3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEV3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428068.1"
FT                   /protein_id="ADO54076.1"
FT                   /translation="MKANNFKKNNKRSMIKKSVTAVMVLNMMYMSALPVVGNFDSSVAT
FT                   FAAGAATEATNITGTGSINPPSLALRSAILIEPSTGQVLLSMNPDEPLPPASMTKMMTE
FT                   YIVAEQVKQGKLKWTDKVTVNENASKSIGSRIFLAQGDQHTVEELYIAMAVGSANDATV
FT                   ALAERVSGTEQDFVKLMNETAQRMGMKNTYFINSTGLDRKDMPTGFQPDTDRETVMTAR
FT                   DAATLAGYIIKDHPDYTRFTTIQSYKFRPTDKAPIINYNWMLEANKNITNFRKFAYPGL
FT                   DGMKTGHTANAGNCFTGTAERNGMRLISVVMGADSDAHRFTETAKVLNYGFDNFEVKQV
FT                   VAPKTVVKGVENVPVTKGTETEVPIVTKDAVSFIVPKGASNPKVTFTTNITPASSLVAP
FT                   LKQGAKVGTITYTYKTDGVDKGQTKTVDLVTTTAVEEGGWFRMLFRAIGDFFGDLFQGI
FT                   KNLF"
FT   gene            121685..122566
FT                   /gene="yaaD"
FT                   /locus_tag="PPSC2_00450"
FT                   /old_locus_tag="PPSC2_c0090"
FT   CDS_pept        121685..122566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaD"
FT                   /locus_tag="PPSC2_00450"
FT                   /old_locus_tag="PPSC2_c0090"
FT                   /product="pyridoxal biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54077"
FT                   /db_xref="GOA:E3EEV4"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEV4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428069.1"
FT                   /protein_id="ADO54077.1"
FT                   /translation="METGTSRVKRGMAEMQKGGVIMDVMNAEQAKIAEAAGATAVMALE
FT                   RVPSDIRAAGGVARMADPTIVEEVMKVVSIPVMAKARIGHFVEAKVLESLGVDYLDESE
FT                   VLTPADEVFHIDKREFTVPFVCGAKDLGEALRRIGEGASMIRTKGEPGTGNIVEAVRHM
FT                   RFINGQIRKVQNLSKDELYAEAKNLGVAYELLLEVHELGKLPVVNFAAGGVATPADAAL
FT                   MMHLGADGVFVGSGIFKSDSPEKFARAIVEATTHYTDYKLIAEVSKNLGTPMKGIEISK
FT                   LASHERMQDRGW"
FT   gene            122583..123149
FT                   /gene="guaA1"
FT                   /locus_tag="PPSC2_00455"
FT                   /old_locus_tag="PPSC2_c0091"
FT   CDS_pept        122583..123149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA1"
FT                   /locus_tag="PPSC2_00455"
FT                   /old_locus_tag="PPSC2_c0091"
FT                   /product="glutamine amidotransferase"
FT                   /note="with PdxST is involved in the biosynthesis of
FT                   pyridoxal 5'-phosphate; PdxT catalyzes the hydrolysis of
FT                   glutamine to glutamate and ammonia; PdxS utilizes the
FT                   ammonia to synthesize pyridoxal 5'-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54078"
FT                   /db_xref="GOA:E3EEV5"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEV5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368724.1"
FT                   /protein_id="ADO54078.1"
FT                   /translation="MKIGVLSLQGAVAEHIRSVERAGAEGIAVKKIEQLDELSGLIIPG
FT                   GESTTIGKLMRKYDFIEAIRQFSNQGKPVFGTCAGLIVLAKTIQGQEEAHLGLMDITVS
FT                   RNAFGRQRESFETDLNIKGIEEPVRAVFIRAPLIQSVGMGVDVLSEYNGEIVAARQGHL
FT                   LASSFHPELTDDFRLHQYFVDMVRG"
FT   gene            123186..124469
FT                   /gene="serS1"
FT                   /locus_tag="PPSC2_00460"
FT                   /old_locus_tag="PPSC2_c0092"
FT   CDS_pept        123186..124469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS1"
FT                   /locus_tag="PPSC2_00460"
FT                   /old_locus_tag="PPSC2_c0092"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54079"
FT                   /db_xref="GOA:E3EEV6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEV6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308176.1"
FT                   /protein_id="ADO54079.1"
FT                   /translation="MLDIKILRNELGRVEKALQNRGKSLDLINGFTDLDVSRRELLQES
FT                   EGLKNRRNVVSGEVAKLKKNKENADDLIAEMRQVSDRIKELDEQVRELEVQIDELVMSI
FT                   PNIPNETVPVGASEEDNVEIRRWSEPREFSFTPKAHWELAQDLDILDFEAAAKVTGSRF
FT                   TFYKGLGARLERALINFMMDLHSSEHGYEEMLPPYIVNRDSLYGTGQLPKFEEDLFKLR
FT                   DTEYYLIPTAEVPVTNYHREEIMNADQLPKYYVAYSSCFRSEAGSAGRDTRGLIRQHQF
FT                   NKVEMLKLVHPDTSYEELEKMTNNAERVLQLLGLPYRVLALCTGDMGFTSAKTYDLEVW
FT                   LPESGMYREISSCSNTEDFQARRANIRFRPDAKAKPEFVHTLNGSGLAVGRTVAAILEN
FT                   YQQEDGSIVIPEVLRSYMRGIEVITPKQ"
FT   gene            124560..124648
FT                   /locus_tag="PPSC2_00465"
FT                   /old_locus_tag="PPSC2_ct001"
FT   tRNA            124560..124648
FT                   /locus_tag="PPSC2_00465"
FT                   /old_locus_tag="PPSC2_ct001"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:124595..124597,aa:Ser,seq:tga)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            124794..125135
FT                   /gene="M1-240"
FT                   /locus_tag="PPSC2_00470"
FT                   /old_locus_tag="PPSC2_c0093"
FT   CDS_pept        124794..125135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-240"
FT                   /locus_tag="PPSC2_00470"
FT                   /old_locus_tag="PPSC2_c0093"
FT                   /product="M1-240"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54080"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEV7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427219.1"
FT                   /protein_id="ADO54080.1"
FT                   /translation="MNREMTVDQQKLVEAWQEQLPILLNSGDKTQVQADEADNRAIRIH
FT                   IEVEGRQMYSFDFACTYVDSREVQVSLVDVERDGRSVDERTDIIQQLVSDYTRHIHQCA
FT                   QTLQSLTHS"
FT   gene            125406..125561
FT                   /gene="M1-242"
FT                   /locus_tag="PPSC2_00475"
FT   CDS_pept        125406..125561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-242"
FT                   /locus_tag="PPSC2_00475"
FT                   /product="spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00475"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44172"
FT                   /db_xref="GOA:A0A0D5ZCB3"
FT                   /db_xref="InterPro:IPR012614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZCB3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599349.1"
FT                   /protein_id="AKA44172.1"
FT                   /translation="MGKPRAVPVPEAQDSGGSNEKRERSHQQEPLSGSKKVKQRNHVDH
FT                   HNRQGS"
FT   gene            125761..126822
FT                   /gene="M1-243"
FT                   /locus_tag="PPSC2_00480"
FT                   /old_locus_tag="PPSC2_c0095"
FT   CDS_pept        125761..126822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-243"
FT                   /locus_tag="PPSC2_00480"
FT                   /old_locus_tag="PPSC2_c0095"
FT                   /product="M1-243"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54082"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEV9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368728.1"
FT                   /protein_id="ADO54082.1"
FT                   /translation="MSKKLSVLMLTMVLLLTVALVGCSKKDELKEAITKGTANVTKLSS
FT                   YELKSQFKIKDLSISSNSLPAIQNAFITDTLKDADITLDGVYQKEPLQSEMTLGIHLKG
FT                   NYSTPYTIPMVVTKDKLYVKLPDLPSYRIPKKAIGKFLEIDPKQLAEQSGSKFNPEIMD
FT                   PTQVQKLVSEVVSALLSEYDQATYFFDINPKDAKLPQGVEAKQVVQFKVTNDNLKQAAG
FT                   VFITKALPKAIDVISKDEYANMFQVNKEKLAEAKKKLQSNTSEVSKKFNNLTVKQFDIN
FT                   TALDKNDIPMYQDLNANVEWNDPTSKDNVKLFVTGYMQYSKINEKTTFKLSVPTGDQVL
FT                   TIEQLQKMKTVAP"
FT   gene            126973..127272
FT                   /gene="tnpIS3C"
FT                   /locus_tag="PPSC2_00485"
FT                   /old_locus_tag="PPSC2_c0096"
FT   CDS_pept        126973..127272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpIS3C"
FT                   /locus_tag="PPSC2_00485"
FT                   /old_locus_tag="PPSC2_c0096"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54083"
FT                   /db_xref="GOA:E3E4L5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E3E4L5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368880.1"
FT                   /protein_id="ADO54083.1"
FT                   /translation="MAKKGQSFRQYSLDVKMEAIRLVNEEHMSIREVTKHLDIRNKSQV
FT                   QSWVTKYRAGENLQPTTTRQGRPKTKFSSMEEEMAYLRAEIEYLKKQYPNLHKE"
FT   gene            127269..128135
FT                   /gene="insK12"
FT                   /locus_tag="PPSC2_00490"
FT                   /old_locus_tag="PPSC2_c0097"
FT   CDS_pept        127269..128135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insK12"
FT                   /locus_tag="PPSC2_00490"
FT                   /old_locus_tag="PPSC2_c0097"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54084"
FT                   /db_xref="GOA:E3EC94"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC94"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013371758.1"
FT                   /protein_id="ADO54084.1"
FT                   /translation="MTRKEARFEIIEGMRTRYSLKWLLELAHVSRAGYYKWRKTQQTTQ
FT                   QRKQEEELLESHMLSIHRIHPYFGYLRMTVALRREGILVNHKKVYRLMKKLGIRSVIRK
FT                   KRRFFGKQASVVNANRLDRQFQADSPLSKLVTDITYIRAGERFVYLSVIQDLFNNEIVA
FT                   WRLSERNDLALVSETLDVLSKNVNMEGVILHSDQGFQYTSKPFNRKLKRLGMLGSHSRR
FT                   GNCLDNACIESFFSHLKTEKIYLTKPGTLAEVEQHVREYISFYNENRFQKKLNNRSPIE
FT                   YRETVAA"
FT   gene            complement(128237..128794)
FT                   /gene="yjcK1"
FT                   /locus_tag="PPSC2_00495"
FT                   /old_locus_tag="PPSC2_c0098"
FT   CDS_pept        complement(128237..128794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcK1"
FT                   /locus_tag="PPSC2_00495"
FT                   /old_locus_tag="PPSC2_c0098"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54085"
FT                   /db_xref="GOA:E3EEW2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEW2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368731.1"
FT                   /protein_id="ADO54085.1"
FT                   /translation="MPMSLYNTPQGIFLRPLSLEDGEALLALRLRNRDSHAPYEPLYED
FT                   SFFTLEKQQDYIRERLRQAEEDRGYLFGIFLLKQEQLIGYISISNLVRGVGQFADVGYM
FT                   MDQHEQGKGHMTAALKLIIQYAFRALSLHRLQAGTLLHNDRSQRVLQKCGFQPEGIARK
FT                   LVQIQGEWQDHQMFGILAEDHV"
FT   gene            complement(128854..129351)
FT                   /gene="yaaJ"
FT                   /locus_tag="PPSC2_00500"
FT                   /old_locus_tag="PPSC2_c0099"
FT   CDS_pept        complement(128854..129351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="PPSC2_00500"
FT                   /old_locus_tag="PPSC2_c0099"
FT                   /product="adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54086"
FT                   /db_xref="GOA:E3EEW3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEW3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368732.1"
FT                   /protein_id="ADO54086.1"
FT                   /translation="MTIMDHAYWMREAIQEAYKAEALGEVPIGAVIVKDNEIIGRGYNL
FT                   RETDTDPTAHAEMVAIRQASEHLGAWRLLDCRLYVTLEPCPMCAGAIVQSRVPHLIYGT
FT                   TDPKAGCAGTLMNLLQEPRFNHCTEVTSGVLQEECASMLTNFFRQLRQKRAAAKLSPPS
FT                   SS"
FT   gene            129680..131956
FT                   /gene="kinE"
FT                   /locus_tag="PPSC2_00505"
FT                   /old_locus_tag="PPSC2_c0100"
FT   CDS_pept        129680..131956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kinE"
FT                   /locus_tag="PPSC2_00505"
FT                   /old_locus_tag="PPSC2_c0100"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54087"
FT                   /db_xref="GOA:E3EEW4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEW4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308182.1"
FT                   /protein_id="ADO54087.2"
FT                   /translation="MSIKIRITIILSGSVLFILLLNIALNYYTTHENLRSDSETKMVLT
FT                   AKIIGGAIEQTRHSWEAVDKQLGYNLWLSATLAANQLDPDIRNIQQEQLQQIATLHRDI
FT                   NISLMIRDGQGYKVVKSSNPKELTSSDPLMGYWKNAVDQLYEHGQVAMAHGQNLDHFWT
FT                   SSFDYTDSASSHINKWGFYYDQKRNYLIRVSFQDTSVQDFIPILSPAEIVKQTQQVDYR
FT                   ILEITGINPATFGGATMDKNGNDRKHYYMYNEPIQFGTYQLTRMPEDRLAVSRAILSGE
FT                   SIVQDCYIKGERVLVSYIPFYPTNRDAYVIRIVMNYDTIASVISKQLISLVAISIVLLE
FT                   VVIIGSYVLASLFVRPIQSILGKVNEMADGHFDTRLEIKGGHELARLGERINAMAYNLG
FT                   MYTRRLEQMYEENRSVKEHLESVINQTADAIHVTDQEDRVIRVNHAFEALYGWTKKELV
FT                   GRKLEFVPPQQQEEYEFQKESLLQGESIVSSETLRMRKDGSTVEISMSTSPILDEQGEI
FT                   LGFICVSRDITGRNRMEELLRRSEKLTTVGQLAAGVAHEIRNPLTTLRGFLQLQQQNQV
FT                   LNMKHNDIMMSELDRINLIVSEFLILAKPQAVHFQKKDVRYIVSDVISLLDSQAHLLGI
FT                   VFNLQVTDEPALVYAEENQLKQVFINLLKNSMEAMSKGGIITIHLFLEGESVKIFIRDQ
FT                   GTGIPAEMLSKLGEPFVTNKETGTGLGLMVSQRIIQSHKGTLDIESTEGEGTTALVQLP
FT                   IAKPE"
FT   gene            132007..132708
FT                   /gene="rsuA1"
FT                   /locus_tag="PPSC2_00510"
FT                   /old_locus_tag="PPSC2_c0101"
FT   CDS_pept        132007..132708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA1"
FT                   /locus_tag="PPSC2_00510"
FT                   /old_locus_tag="PPSC2_c0101"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54088"
FT                   /db_xref="GOA:E3EEW5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEW5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308183.1"
FT                   /protein_id="ADO54088.1"
FT                   /translation="MRINKFISETGFCSRREADKLVESGRVTINGEVAVLGSQAEEGDD
FT                   VRVNGKPLRDKSDHVYIALNKPVGITSTTESHIRGNIVDFVGHPQRIFPIGRLDKDSEG
FT                   LILLTNDGDIVNKILRAEGKHEKEYIVTVDRPVTPSFVQGMSSGVKILGHRTLPCEVTR
FT                   VSEYVFRIILTEGKNRQIRRMCAAFGYEVKKLQRLRIMNIRLGSLQKGAWRDLTEAEKQ
FT                   ELGQMLDYTLS"
FT   gene            complement(132845..133672)
FT                   /gene="motB"
FT                   /locus_tag="PPSC2_00515"
FT                   /old_locus_tag="PPSC2_c0102"
FT   CDS_pept        complement(132845..133672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="PPSC2_00515"
FT                   /old_locus_tag="PPSC2_c0102"
FT                   /product="flagellar motor protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54089"
FT                   /db_xref="GOA:E3EEW6"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEW6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818543.1"
FT                   /protein_id="ADO54089.1"
FT                   /translation="MSKKRHEPHEEHADESWLLPYSDLMTLLLALFIVLFGMSSLDAKK
FT                   FETMAQSLSSAFSGGTGVLDHSAANPSSQSMDMGKNKEEVSQPLKSKATSTSDLQKQLA
FT                   QREEEDLKKLKKQMDQYIQNNGLSTLLNTKLNQSQLMITISDNALFSSGQAEVKPEARK
FT                   LAKSISSMLQQFPGYDVIVSGHTDNVPISNSQFPSNFDLSAKRSLNFLRILLLNPQLDP
FT                   TKFVSIGYGEYRPLAGNQTGAGRAKNRRVEISVLRKYQNGTQVISPTSSSNEG"
FT   gene            complement(133665..134459)
FT                   /gene="motA1"
FT                   /locus_tag="PPSC2_00520"
FT                   /old_locus_tag="PPSC2_c0103"
FT   CDS_pept        complement(133665..134459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA1"
FT                   /locus_tag="PPSC2_00520"
FT                   /old_locus_tag="PPSC2_c0103"
FT                   /product="flagellar motor protein MotA"
FT                   /note="With Mot B forms the ion channels that couple
FT                   flagellar rotation to proton/sodium motive force across the
FT                   membrane and forms the stator elements of the rotary
FT                   flagellar machine."
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54090"
FT                   /db_xref="GOA:E3EEW7"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEW7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428081.1"
FT                   /protein_id="ADO54090.1"
FT                   /translation="MQITTIIGLVLGLLSLVVGMILKGAPVVNLVNNPAAYMIIFVGTA
FT                   ASIFMAFPMDDMKRVPKLFKIIFTQQKLLDRKELIGTFTEWASITRREGLLALESKVEE
FT                   IDDPFMRGGMRMIIDGNDQEFVRDVLMEDINATEDRHRAGALIFSQAGMYAPTLGVLGA
FT                   VVGLIAALADLSDMEKLSHAIAAAFIATLLGIFTGYVLWHPMSNKLKRLSKKEVELKLM
FT                   MVEGLLSIQSGISTIAISQKLAIFLTPTERASMTQKDGDSSE"
FT   gene            134647..134940
FT                   /gene="M1-250"
FT                   /locus_tag="PPSC2_00525"
FT                   /old_locus_tag="PPSC2_c0104"
FT   CDS_pept        134647..134940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-250"
FT                   /locus_tag="PPSC2_00525"
FT                   /old_locus_tag="PPSC2_c0104"
FT                   /product="M1-250"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54091"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEW8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010346545.1"
FT                   /protein_id="ADO54091.1"
FT                   /translation="MGVKHGREYEQILNDLTEAVGRIPDSYEFFEMEAEDWDRLNPMGR
FT                   QEVNEALAEDLFYALGTEPIITVGSGVVIYEPEQHRIYVLIGDEELTSVPLI"
FT   gene            135058..135357
FT                   /gene="dcoH"
FT                   /locus_tag="PPSC2_00530"
FT                   /old_locus_tag="PPSC2_c0105"
FT   CDS_pept        135058..135357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcoH"
FT                   /locus_tag="PPSC2_00530"
FT                   /old_locus_tag="PPSC2_c0105"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54092"
FT                   /db_xref="GOA:E3EEW9"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEW9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428083.1"
FT                   /protein_id="ADO54092.1"
FT                   /translation="MPFTQEEIEAHLEKLEGWELEEGRWIVRKYNFSSFMKGIAFVDEV
FT                   AAISEAFNHHPFITIDYKTVTLRLTSWDDGGIMAVDIKEAQQYNEAFEKMRSSH"
FT   gene            complement(135436..135942)
FT                   /gene="natSF"
FT                   /locus_tag="PPSC2_00535"
FT                   /old_locus_tag="PPSC2_c0106"
FT   CDS_pept        complement(135436..135942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natSF"
FT                   /locus_tag="PPSC2_00535"
FT                   /old_locus_tag="PPSC2_c0106"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54093"
FT                   /db_xref="GOA:E3EEX0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEX0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368738.1"
FT                   /protein_id="ADO54093.1"
FT                   /translation="MPASISNYRIVPMDEHQAAEICEWRYDPPYNIYGWLPWEQMKALE
FT                   VEFGSPTLRQEQYVAVLNEENELTGFAQYFPMVGVTRLGLGMHPERCGHGTGSDFVRAI
FT                   AEEAGRRHPQNEIDLEVLTWNQRAIRAYKAAGFELTDTYERQTPDGRKPFYCMVYRPEQ
FT                   QNRVL"
FT   gene            complement(136246..136746)
FT                   /gene="spr1"
FT                   /locus_tag="PPSC2_00540"
FT                   /old_locus_tag="PPSC2_c0108"
FT   CDS_pept        complement(136246..136746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spr1"
FT                   /locus_tag="PPSC2_00540"
FT                   /old_locus_tag="PPSC2_c0108"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54095"
FT                   /db_xref="GOA:E3EEX2"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEX2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368740.1"
FT                   /protein_id="ADO54095.1"
FT                   /translation="MKKKLTIAAMGLAIAFTSFTFGGSSAFADSKMDQVIQDAKGTNYR
FT                   SGGTTLEGFDCSGFTMYVFNKLGIKLPHQSGSQFKMGASVSRDEMRPGDLVFFNTTGRG
FT                   VSHVGIFVGEGKFAHSSTSRGVVVSSLNENYYANRYVGAKRIMSTDAYHSVASDIPDDD
FT                   NVE"
FT   gene            complement(137166..137993)
FT                   /gene="M1-255"
FT                   /locus_tag="PPSC2_00545"
FT                   /old_locus_tag="PPSC2_c0109"
FT   CDS_pept        complement(137166..137993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-255"
FT                   /locus_tag="PPSC2_00545"
FT                   /old_locus_tag="PPSC2_c0109"
FT                   /product="M1-255"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54096"
FT                   /db_xref="GOA:E3EEX3"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEX3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818547.1"
FT                   /protein_id="ADO54096.1"
FT                   /translation="MRTVLKEGWALVRIRFYIVIILFLYRLLWGVFLYRLVQSAVVPLL
FT                   LRYPDQSQNELGKTLFWMEGQIALMDSREVHVYLWILLGATVLRVLITPFIRAGIYQSL
FT                   YTDASEPQSLSFFKGMKRHGMSSLLYYIIELGLLLLPAFWVVPRLYPIVAGTLQSSSYL
FT                   LHLLPYAIGWVAYGWFIRQCILYMQLGTVSGHAILSSLLAFFRQLLPAVSVSLLLGACV
FT                   LLVFGLFGTVAMIWTGMLALILQQSYHFVTSLVRLWHISSQYRLWHIDISSRG"
FT   gene            complement(138005..140017)
FT                   /gene="pepN"
FT                   /locus_tag="PPSC2_00550"
FT                   /old_locus_tag="PPSC2_c0110"
FT   CDS_pept        complement(138005..140017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="PPSC2_00550"
FT                   /old_locus_tag="PPSC2_c0110"
FT                   /product="EnpEP protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54097"
FT                   /db_xref="GOA:E3EEX4"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEX4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308190.1"
FT                   /protein_id="ADO54097.1"
FT                   /translation="MTPARAKIVLLSSLALGLLAGTLWFAWQPQSQSAPQSAGKPLYGS
FT                   ESESALAPDMGKPLGANIMPDLPKNPPQPASEILSKRVVEYHIDVSLEKGRVLRGTETL
FT                   TWKHPGKKTVNDLYLHLYPNAFSSMETTFMKESGGKLRGDTMPKDGFGSMTLTELKTED
FT                   GLSLMHRTQYVQPDDGNASDRSLMKVRLPKPVRGGEEITLYMKFEVKLPGIFARMGATD
FT                   DFVMAGQWFPKLSVYETAGQRGRADEGWNLHQYHGNSEFYADFGIYSIRIRVPETHIVA
FT                   ATGFPTRGAVRQNGQKIYQFYADDVHDFAWSASPNFVAVEEPFSSTEVPGVKIKLYLDP
FT                   SHKELKGRYMSAAKAALSYYSKWYGPYPYSTLSIVVPPKTGSGASGMEYPTLITAAAAD
FT                   QLNPGYNLERTLVHEIGHQYFYGMVANNEFEEPWLDEGFTSYAEERLMEQEYGLIPNLP
FT                   LQSGQVASPQPLNRESWKYGSSAEYAQNAYSRGKLVLRGIERQVGTKKMDRIMRTYVQT
FT                   YRFKHPTSQDFQRVVERVTGRSWSHYFEQYVYDGQMADFSVDRITNRKLENGYEAVVTL
FT                   SKKGADYPKIPVQFTFKDGTTIFKAWDGTGKSTSFRLKSTSPVSYVTVDPLYTIALENK
FT                   HINNSLKAELDEKQQTRWSVSVTKLLETLLGSLSW"
FT   gene            140142..140648
FT                   /gene="ywhD"
FT                   /locus_tag="PPSC2_00555"
FT                   /old_locus_tag="PPSC2_c0111"
FT   CDS_pept        140142..140648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywhD"
FT                   /locus_tag="PPSC2_00555"
FT                   /old_locus_tag="PPSC2_c0111"
FT                   /product="ywhD"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54098"
FT                   /db_xref="InterPro:IPR014852"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEX5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308191.1"
FT                   /protein_id="ADO54098.1"
FT                   /translation="MSENQPDGKKQIALNIVSGKSKHKGFGAGSIDLNSMSPVIIDRGE
FT                   AKIDIGAMHAKSKVERGIKFSTNKEDVPNGRQVWLVWVAVDRTPEGRMYGGATACEMLI
FT                   DDEAKRGWKILADHVNRMDYALKRRFMLDDLGSEDKAALKSLLISHNEEWWDASPEELK
FT                   QALEG"
FT   gene            140926..141432
FT                   /gene="bglP3"
FT                   /locus_tag="PPSC2_00560"
FT                   /old_locus_tag="PPSC2_c0112"
FT   CDS_pept        140926..141432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglP3"
FT                   /locus_tag="PPSC2_00560"
FT                   /old_locus_tag="PPSC2_c0112"
FT                   /product="PTS glucose transporter subunit IIA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54099"
FT                   /db_xref="GOA:E3EEX6"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEX6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428090.1"
FT                   /protein_id="ADO54099.1"
FT                   /translation="MFKWLKKKAAPRIEEFDMVAPIKGKVVSLEEVPDPAFSTKAMGDG
FT                   IAIHPSEGRVTAPFAGKVAHVMEKSKHALIIEHESGVQVLIHVGINTVSLKGQGFNPHV
FT                   KVGDSIKAGQLLMEFDLDAIQQGGLPVITPVIVPDGQEMISHVEILESSSATSDVPVLR
FT                   VHLKA"
FT   gene            complement(141532..142281)
FT                   /gene="yybB"
FT                   /locus_tag="PPSC2_00565"
FT                   /old_locus_tag="PPSC2_c0113"
FT   CDS_pept        complement(141532..142281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yybB"
FT                   /locus_tag="PPSC2_00565"
FT                   /old_locus_tag="PPSC2_c0113"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54100"
FT                   /db_xref="GOA:E3EEX7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEX7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368745.1"
FT                   /protein_id="ADO54100.1"
FT                   /translation="MQLDKGIHMLQVSANIMGSIESIHPTLMWDEDNMILVDTAYPGQL
FT                   SLLNEAILDTGLAIHKLTSILITHQDLDHIGSLADIIRASSSLVQVLASSIEKPYIQGE
FT                   KQLIKLTPEAIDQAVSSMPESVPVEWRYAFRRTLENPPKAIVNSTIVAGEELPFCGGIL
FT                   VIDTAGHTPGHLSFYHKFSQTLIAGDALRVVSGKLLAPDPQYCCDFNIAKESLKNLLPY
FT                   DIKKVICFHGGLYEGNCNQRISEICES"
FT   gene            142423..142968
FT                   /gene="gpmA1"
FT                   /locus_tag="PPSC2_00570"
FT                   /old_locus_tag="PPSC2_c0114"
FT   CDS_pept        142423..142968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA1"
FT                   /locus_tag="PPSC2_00570"
FT                   /old_locus_tag="PPSC2_c0114"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54101"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEX8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368746.1"
FT                   /protein_id="ADO54101.1"
FT                   /translation="MKKIYFVRHAQATGQEPDARLTDEGKRQAEQLADFMENVGVEYIV
FT                   SSPWKRAVRTIQPLAERRHLQVYTDLRLQERVLCRDHLDHWLDVLEQTYLDEDLKLEGG
FT                   ESSREAADRGIQLVQELIERAEKTVIIVTHGALLSLLIRHYDPQFGFEEWKKLSNPDVY
FT                   LLELNEAEAKIHRVWNID"
FT   gene            143026..143379
FT                   /gene="yunG"
FT                   /locus_tag="PPSC2_00575"
FT                   /old_locus_tag="PPSC2_c0115"
FT   CDS_pept        143026..143379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yunG"
FT                   /locus_tag="PPSC2_00575"
FT                   /old_locus_tag="PPSC2_c0115"
FT                   /product="yunG"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54102"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEX9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368747.1"
FT                   /protein_id="ADO54102.1"
FT                   /translation="MNTNRFVELEKALFQAWSLESSSKWTANNPAAGQCGVTALVVQDR
FT                   LGGDILKTWLDSGWHYYNRIGEDIIDFTKSQFLSLPQYQHVHSNREEAFSDTNAEQYAA
FT                   LSRRLEESLNEKV"
FT   gene            143461..144024
FT                   /gene="M1-262"
FT                   /locus_tag="PPSC2_00580"
FT                   /old_locus_tag="PPSC2_c0116"
FT   CDS_pept        143461..144024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-262"
FT                   /locus_tag="PPSC2_00580"
FT                   /old_locus_tag="PPSC2_c0116"
FT                   /product="M1-262"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54103"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEY0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368748.1"
FT                   /protein_id="ADO54103.1"
FT                   /translation="MILLAIVCGLLLNTSKQNPIILDQQESTPQSKKYSGEKYVSKYSY
FT                   KKVNDPKAALMTSNILHATSLEEETVAQFRGALITLFGQPQRTSQNFEEAYGYIIKATN
FT                   STGQSWILTAYEGPGGPAIGGDTEKDSIEEVAQDLLNLIEATKPADFEDVGYYEDTGST
FT                   IRYGCKAQVCFYQESTTEQHATDE"
FT   gene            complement(144128..144940)
FT                   /gene="yybG"
FT                   /locus_tag="PPSC2_00585"
FT                   /old_locus_tag="PPSC2_c0117"
FT   CDS_pept        complement(144128..144940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yybG"
FT                   /locus_tag="PPSC2_00585"
FT                   /old_locus_tag="PPSC2_c0117"
FT                   /product="yybG"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54104"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEY1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368749.1"
FT                   /protein_id="ADO54104.1"
FT                   /translation="MYTADCEKCFGLCCVALPYAKSADFAFNKDGGTPCQHLNADYRCD
FT                   IHKNLRNNGLRGCTVYDCFGAGQKISQVVYNGKSWRDNPAIADEMFNLFPIMQQLHEML
FT                   YYLNEALSLKETHSIYTELHKAMEKTEQLTDQDPKSLIDLHVPTHRALVNDLLVQTSEL
FT                   VREKFKKNMENHKLSKKIKNRDLIGANLRGVNLRGANLRGVLLIAADLREADLSMTDLI
FT                   GADFRDADLSGANLEGSIFLTQAQLNSAKGNSKTKLPPSLSFPSHWIN"
FT   gene            complement(145027..145419)
FT                   /gene="phnB3"
FT                   /locus_tag="PPSC2_00590"
FT                   /old_locus_tag="PPSC2_c0118"
FT   CDS_pept        complement(145027..145419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnB3"
FT                   /locus_tag="PPSC2_00590"
FT                   /old_locus_tag="PPSC2_c0118"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54105"
FT                   /db_xref="GOA:E3EEY2"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEY2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368750.1"
FT                   /protein_id="ADO54105.1"
FT                   /translation="MQDSSSKITTFFMFPGQAEEAMQYYTSVFKPSGIMSIFHQEDGTV
FT                   LHAVFNLKGQTFMAIDYNHQDKHPFTPALSLFVTCDSEEEIHRVFGQLSQEGRVLMPLE
FT                   ASPVSQQFGWVEDKYGVSWQLNLAKE"
FT   gene            145544..146593
FT                   /gene="M1-265"
FT                   /locus_tag="PPSC2_00595"
FT                   /old_locus_tag="PPSC2_c0119"
FT   CDS_pept        145544..146593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-265"
FT                   /locus_tag="PPSC2_00595"
FT                   /old_locus_tag="PPSC2_c0119"
FT                   /product="M1-265"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54106"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEY3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368751.1"
FT                   /protein_id="ADO54106.1"
FT                   /translation="MIDATARIIDMLGSGNKVDASIISAYTDVVAQYGTVKDAWELYRL
FT                   FVEDPHHYIRGLLLQPIMRCGDVALAQDMYERYVRNQTSSEHIPDGVLHVLGYLGYVEA
FT                   AADLVAWVNGPYGAASVDACLGLVHLPCESFRERLATELEQAVDQHLFDEFLPLLSFKC
FT                   TTEDMIPRLVHWGERHASVDCNAGIIAGIALFGEEQKDTIRSILWNPLWEAHGTATGSC
FT                   VWSYIAMQHVGLTFRELIQDIKSYDASKAGVQDLEYRLEVLYEMLELKLSYRVQPIRFA
FT                   RRNEESFAQIYSDLFSWSTEHKDDSIIGWMNDNLGYKHRLLKQYDELRKRVEIKMVHEI
FT                   ELEHVQTGS"
FT   gene            146729..147193
FT                   /gene="bag"
FT                   /locus_tag="PPSC2_00600"
FT   CDS_pept        146729..147193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bag"
FT                   /locus_tag="PPSC2_00600"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00600"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZC09"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599361.1"
FT                   /protein_id="AKA44173.1"
FT                   /translation="MSLLPQVPFGTQPGTPGPFTPSGPSIPQFPDIQDSFPSPVGPPPG
FT                   PGPFSPQPFSPPPQGPFGPQGGQQAQAPTSPPPQFTPPKPLVSAYAVDPGAIFGCLYRN
FT                   TFVWLTNGERFWMYPVFVGRTSVAGFRWSGRFWFYYGVDTNRIESFSCFW"
FT   gene            complement(147341..149398)
FT                   /gene="pbpG"
FT                   /locus_tag="PPSC2_00605"
FT                   /old_locus_tag="PPSC2_c0123"
FT   CDS_pept        complement(147341..149398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpG"
FT                   /locus_tag="PPSC2_00605"
FT                   /old_locus_tag="PPSC2_c0123"
FT                   /product="carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54110"
FT                   /db_xref="GOA:E3EEY7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEY7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599362.1"
FT                   /protein_id="ADO54110.2"
FT                   /translation="MTDTTGRSSKRKPLWVRCFQGLMSLTILTVIAACILLAYLYTTSL
FT                   PLADTDRNSRLLDSQGQVIATFSAGGKESIPVQLDHISPDLIAATLAVEDRKFYDHFGF
FT                   DFKGLGRAVIVNLTRWDMSQGASTLTQQLARNLYLSHEKTWTRKAKEAIYTAQLEMKYS
FT                   KDELLQMYLNEIYYGHGAYGIEAASQMYFGKSAKDLDLAESALLAGIPKGPTYYSPYNH
FT                   MKNAKDRQKIVLDSMALIGKITPAEASKAYEEILALRPESQRRTVEAAPWFRDYVRQLA
FT                   THQFGISEAVLEHGGLSIYTTLDMHMQQAAEAAVNEGMKNSNGLETALISMDPRNGHVK
FT                   AMVGGTNYVGNQYNHALATTRQPGSSFKPIMYLSALDSGQLTSTSKFESRPTLFHYDNN
FT                   RKTYKPKNFGDKYLGEIDLRRAIAASDNIYAVSTILQVGADKVMDLASKMGITSELKPV
FT                   PSLALGVSPVSPFEMASAFSVISSGGQKVAPVAVLRITDAAGRSLYEAPQAAPVQVVKP
FT                   ASAYVLTRLMEGVFEEGGTGNRVAKLIKRPVAGKSGTTNTDAWMVGFTPELSTAVWVGY
FT                   DKGKAISTQDARRAAPIFAQYTEKALENVPPKIFPIPDGVVSAYIDPASGKLAAPDSPD
FT                   KRLEVFVSGTEPKETLSGQNNPQASTPTDQAERQAEKKSWWGNFKRWWME"
FT   gene            149681..150508
FT                   /gene="speE"
FT                   /locus_tag="PPSC2_00610"
FT                   /old_locus_tag="PPSC2_c0124"
FT   CDS_pept        149681..150508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="PPSC2_00610"
FT                   /old_locus_tag="PPSC2_c0124"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="catalyzes the formation of spermidine from
FT                   putrescine and S-adenosylmethioninamine"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54111"
FT                   /db_xref="GOA:E3EEY8"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEY8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010346564.1"
FT                   /protein_id="ADO54111.2"
FT                   /translation="MDLWFTEKQTPSFGITAKIKQTYVSEKTDFQDLAMIETEEFGNML
FT                   VLDGMVMTTVKDEFVYHEMVAHPALNTHPNPKKVLVVGGGDGGVIREVIKHPEVEKAVL
FT                   VEIDGKVIEYSKKYLPEIAGKLDESNVEVLVNDGYMHIIEHKNEYDVIMVDSTEPVGPA
FT                   APLFERGFYQGIFEALKEDGIFVAQTDNPWFKADLIQKVNKDVKEIFPIVRVYGANIPT
FT                   YPSGLWTFTLGSKKYDPLEVDENQIPEMDTRYYSPRLHKAAFVLPKFVEDLTK"
FT   gene            150774..152060
FT                   /gene="yfmI1"
FT                   /locus_tag="PPSC2_00615"
FT                   /old_locus_tag="PPSC2_c0125"
FT   CDS_pept        150774..152060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmI1"
FT                   /locus_tag="PPSC2_00615"
FT                   /old_locus_tag="PPSC2_c0125"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54112"
FT                   /db_xref="GOA:E3EEY9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEY9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368757.1"
FT                   /protein_id="ADO54112.1"
FT                   /translation="MIRRSFYYLWGSQTISNAADIIYMLSVVVLVFSSSNSLMTTILIP
FT                   LFRLSAQVISGLVAPIVLGRFRLTQVLLFSQFGQFIIFTLLLLYLWIVPEQRSFLFIFV
FT                   MVFGMSFLDGWTNPARNALVPRLATGEGLMRANGMVAVSDQVVKCAGWALSGMIVAWLG
FT                   SLNTLAIASCCYLVAVTVTSFIRDPLDQKESNPESPESLTDAVEPAKEKGSHWKELGEG
FT                   WKIIWHNRRIRSLMIVDSVDSIGGVSWLGVFILAYVSQVLHRDASWWGFMNASFFSGTI
FT                   LGGLIVVGLVKRLQKNSFLYMLGALLVYVLITIVFALNTIPVAALVLFAVSGLPVQMAG
FT                   IIRRTLLQTSAPPAQLPKVMAGIDVLTNLAFGLALLFMGWYADRFGMVQVYLLAAAMTT
FT                   IAVLIGWWYRRAFQENEPIDQPTATSAGI"
FT   gene            complement(152223..153962)
FT                   /gene="yfiC1"
FT                   /locus_tag="PPSC2_00620"
FT                   /old_locus_tag="PPSC2_c0126"
FT   CDS_pept        complement(152223..153962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiC1"
FT                   /locus_tag="PPSC2_00620"
FT                   /old_locus_tag="PPSC2_c0126"
FT                   /product="sugar ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54113"
FT                   /db_xref="GOA:E3EEZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEZ0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818559.1"
FT                   /protein_id="ADO54113.1"
FT                   /translation="MSGKETWRRLLTYVGQYKTTTFWVIISAILSVLASLVGPYMIGRA
FT                   IDHMVNQGAVDFRGIAQILYGLGVVYVVGSLFSWLLTYLTNRIAFQTVNDMRRELFDHF
FT                   NILPLSFHDNHPQGDSISRFVNDMDAVSDGLLQGFSTLITGLITIIGSIVLMLYISPVM
FT                   TLVVLVSAPITYVVARFITTKSQRMFREQAKILGSLNGYVEEMIGGQRVVTAFHYENRS
FT                   LEEFSARNEQLYQAGVKSQFYGSLSNPSTRLVNNMTFSVTAMIGCISIILGGISVGGLS
FT                   SFLIYTNLFAKPFNEITGVLTQFQAATASAQRIFAILDSPPEQPEKSNAVQPERSKGTI
FT                   LFDHVKFSYNPERTLITNFSLEVKPGTRVAIVGQTGAGKTTLVNLLMRFYDVDSGSISI
FT                   DGVNINDMSRDSLRTNFGMVLQDTWLFSGTIRDNIAYGKPEATDEEVIAAATAANAHSF
FT                   IKRLPHGYDTVISGSGDSLSQGQRQLLTIARVILVDPPMLILDEATSSIDTLTEARIQK
FT                   AFMKMIDGRTSFVIAHRLSTIREADLILYMKNGDVVESGTHEGLLASGGHYASLYNSQF
FT                   TTA"
FT   gene            complement(153959..155710)
FT                   /gene="yfiB1"
FT                   /locus_tag="PPSC2_00625"
FT                   /old_locus_tag="PPSC2_c0127"
FT   CDS_pept        complement(153959..155710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiB1"
FT                   /locus_tag="PPSC2_00625"
FT                   /old_locus_tag="PPSC2_c0127"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54114"
FT                   /db_xref="GOA:E3EEZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEZ1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368759.1"
FT                   /protein_id="ADO54114.2"
FT                   /translation="MLKFAVFLKPYKKETILGPLFKLIEAILELLLPTMVALMINHGVG
FT                   KGDTHYVWQMGLLMLLMTILGFGSSLVCQFYAARASQGFGTTLRNTMFKHISSFSYADL
FT                   DKFGTPSLINRITNDVNQLQTAVAMLIRLVIRAPFICIGAIIMSMILDFRLALVLLAAT
FT                   PVLALILYVVITKASPLYRLYQKKLDKIALVLSENLTGVRVIRAFAKRGAERVKFNAAS
FT                   DDLTQTAIRVGRISALLSPATLLVVNGAIIAILWIGGIHIQYGSLTQGEIIAFINYITQ
FT                   ILLALIVVTNLIILFTKAATSAARIQEVLDTEASISDTANPVSLDQERTSKTGSVPAIS
FT                   FDHVSFGYNKTGQLALSDVVVDIYPGKTVGIIGGTGSGKSTFVNLIPRFYDAVEGCVQV
FT                   DGIDVRHYKLEQLRQKIGIVPQKALLFTGTIADNIRWGHEHATDEEVARAAAIAQADEF
FT                   ISNLPKKFDAPITRGGLNLSGGQKQRLTIARAIVGNPEILILDDSSSALDFATDAALRK
FT                   SLRENSTRMTVLLVSQRVSSVQHADKIIVFDEGRIVGIGTHDQLMSNSEVYQEINRSQL
FT                   STQEVDQ"
FT   gene            155861..156751
FT                   /gene="lysR5"
FT                   /locus_tag="PPSC2_00630"
FT                   /old_locus_tag="PPSC2_c0128"
FT   CDS_pept        155861..156751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR5"
FT                   /locus_tag="PPSC2_00630"
FT                   /old_locus_tag="PPSC2_c0128"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54115"
FT                   /db_xref="GOA:E3EEZ2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEZ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427235.1"
FT                   /protein_id="ADO54115.1"
FT                   /translation="MELRHLKYFLAIADAGQITAAAKKLQIAQPPLSQQLMQLEEELGV
FT                   KLVNRGSRSIQLTEAGIILRNRAKQILELTDATTREINDFAMGMKGTLTIGTVSSSGAT
FT                   LMKDRLSEFHKTYAGVKFEIHEGNTFRILDLLNKGIVEVGIVRTPFNTAGLGCRYASTE
FT                   PMVAVMTEEYDWNPEQKTISLAELKNRPLIIYRRFEQLIHDTCMKHGFEPNIFCKNDDA
FT                   RTTLHWANEGLGIGMISRSALSLGSNNHLIVKEISCEELHTRVAAVWLKDKYMSSLASR
FT                   FIESFSQASSAADLQ"
FT   gene            156861..157286
FT                   /gene="M1-274"
FT                   /locus_tag="PPSC2_00635"
FT                   /old_locus_tag="PPSC2_c0129"
FT   CDS_pept        156861..157286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-274"
FT                   /locus_tag="PPSC2_00635"
FT                   /old_locus_tag="PPSC2_c0129"
FT                   /product="M1-274"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54116"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEZ3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010346570.1"
FT                   /protein_id="ADO54116.2"
FT                   /translation="MPHNAKVRIRLHSHHDGEDVVQELPGEAIVRGKHLYIRYEEPQES
FT                   PEGGTTRNTVKIGPDELKLIRHGEVQSEQSFALGRRLPGFYRSPYLNLNMSAHTQKLDI
FT                   RMDGFTGHVSWTYDLYVFEDFSGHFAISLHIQEEQQS"
FT   gene            157283..158962
FT                   /gene="argS1"
FT                   /locus_tag="PPSC2_00640"
FT                   /old_locus_tag="PPSC2_c0130"
FT   CDS_pept        157283..158962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS1"
FT                   /locus_tag="PPSC2_00640"
FT                   /old_locus_tag="PPSC2_c0130"
FT                   /product="arginine--tRNA ligase"
FT                   /EC_number="6.1.1.19"
FT                   /note="'catalyzes a two-step reaction, first charging an
FT                   arginine molecule by linking its carboxyl group to the
FT                   alpha-phosphate of ATP, followed by transfer of the
FT                   aminoacyl-adenylate to its tRNA; class-I aminoacyl-tRNA
FT                   synthetase'"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54117"
FT                   /db_xref="GOA:E3EEZ4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEZ4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368762.1"
FT                   /protein_id="ADO54117.1"
FT                   /translation="MTSNPLELINQKVTSAIEAAVLAAGIVSREELPTITLEVPKDKSH
FT                   GDLATNVAMQLTRIAKKNPRQIAEDLIANMDLASASIESAEIAGPGFINFRLNKSYLYA
FT                   VIGQVQEQGADYGRVQVGAGKKVQIEFVSANPTGSLHLGHARGAAVGDALCNVLDFAGY
FT                   QVTREYYINDAGNQIYNMSRSIEARYLQELGQPAEMPEDGYHGEDIIGFAKELVAEKGD
FT                   SLLSMEPGDRAAYFREYGLEKELNKIKRDLERFRVPFDSWFSETSLYDNGEVLKALNEL
FT                   RDREEIYDKDGATWLNTTKYGDDKDRVLIKNDGTYTYLTPDIAYHRDKYARGYDTIINI
FT                   WGADHHGYIPRMKAAMEALGNDPDKLKVLIAQMVSLFQNGEKVKMSKRTGKAVTMEDLM
FT                   EEVGVDAIRYFFTMRSMDSHLDFDMDLAISTSNENPVFYVQYAHARACSVYRQAEEQGI
FT                   AVLPLAEVDLSKLTAEHEYDLLRKIGELPEEVSVAAANFAPHRMIRYVYELASMFHSYY
FT                   KAERVITEDAAQTQARLALFGAVRTTIANVLKLVGVSAPERM"
FT   gene            complement(159094..159954)
FT                   /gene="M1-276"
FT                   /locus_tag="PPSC2_00645"
FT                   /old_locus_tag="PPSC2_c0131"
FT   CDS_pept        complement(159094..159954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-276"
FT                   /locus_tag="PPSC2_00645"
FT                   /old_locus_tag="PPSC2_c0131"
FT                   /product="M1-276"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54118"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEZ5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010346572.1"
FT                   /protein_id="ADO54118.1"
FT                   /translation="MKTSLRITKFMSVVTLSAVLLATGWKGAEPVQAAANATPSYEVKL
FT                   LLDTAQVLNADGSLKSGIVNEFGISEDAQRLSVEFFDTDSLQLNDEGWNVRFRKKEDKK
FT                   NYELTYKKRYAITNGNIDAALTQANKEGFSASDDNYEAEVDWGYSKQTLSFSNDKKTNA
FT                   SKGLALPSPDQALKQLQDNLPGKLQNWKSSNWGKHTLANSRVRGPVQVSKYEGSFQGLD
FT                   TDVEVWPIRSANGSGTDNIIEISFKTSDYNTATSNRAKLINLLQSKGWLIPADSLKTNL
FT                   VLERY"
FT   gene            complement(160096..160974)
FT                   /gene="rbcR1"
FT                   /locus_tag="PPSC2_00650"
FT                   /old_locus_tag="PPSC2_c0132"
FT   CDS_pept        complement(160096..160974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcR1"
FT                   /locus_tag="PPSC2_00650"
FT                   /old_locus_tag="PPSC2_c0132"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54119"
FT                   /db_xref="GOA:E3EEZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEZ6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368764.1"
FT                   /protein_id="ADO54119.1"
FT                   /translation="MNLSLLKLHIVELLNKHHKITTVAELLGLKQPTVTFHMKNLEREF
FT                   GVKLFDTRMGKIILTDAGNALLHYATKINALAAEAERVVREFDTLQRGSIRIGASYVPA
FT                   TYLLPAVLHRFAREHPGIHISLSVKTAPVIKDMLARHEIDLGIISAEPFQSPTLLSESL
FT                   GEDELVLICSPTHPLASETDLTSERIASSSFVLHGKDSSTRHATDKWLERGRRRLPSYL
FT                   ELDSLEAIKQAVMLGEHISFVSRIAVQSEVERGLLVVRPIPGQPVERHIYMVSNRDRHR
FT                   SALIHRFTEYL"
FT   gene            161175..162173
FT                   /gene="phnT"
FT                   /locus_tag="PPSC2_00655"
FT                   /old_locus_tag="PPSC2_c0133"
FT   CDS_pept        161175..162173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnT"
FT                   /locus_tag="PPSC2_00655"
FT                   /old_locus_tag="PPSC2_c0133"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54120"
FT                   /db_xref="GOA:E3EEZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEZ7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368765.1"
FT                   /protein_id="ADO54120.1"
FT                   /translation="MNQDLYIRGVSKTFSQTTALHETNLIVRQGKFTTLLGPSGCGKTT
FT                   LLRLIAGLETPDIGTITMGEEILFSAKRKKDVPTHLRHFGMVFQDFALWPHMTVFENVA
FT                   FGLRASKRGKRAVNAQGKELRAVVLEALDKVRLSGLEDRYPHQLSGGQQQRVAFARAVA
FT                   IRPRLVLFDEPLSALDAVLREEMRIEMISLVRDLGLTALYVTHDQIEAMSMSDEVVVMK
FT                   SGHILQTGTPEVIYSRPAHPEVARFIGKSNWIELERTLFRPEHVRWEQEQADQHTFTVE
FT                   ILHVSYVGDRYEIRLLAENGEQWTAYHSTRLPIGEQMHIWVSPQYIHQLET"
FT   gene            162193..163266
FT                   /gene="ftpB"
FT                   /locus_tag="PPSC2_00660"
FT                   /old_locus_tag="PPSC2_c0134"
FT   CDS_pept        162193..163266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftpB"
FT                   /locus_tag="PPSC2_00660"
FT                   /old_locus_tag="PPSC2_c0134"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54121"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEZ8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368766.1"
FT                   /protein_id="ADO54121.1"
FT                   /translation="MMNRRVFRTGWKKGAMLALTLTFGLAVAGCGTATTSKDGAQADGT
FT                   AKPAGAAASTDQRLVVYSAGPDGLAKKLVAGYEAQSGVKVELFQGTTGKILARMEAEKT
FT                   NPVADVVVLASLPSVQGLKKEGLTLPYPDAKNADKLNPDWSDKEGNYFSTSASALGIAY
FT                   NTKLVKTRPTSWADLAKPEYKDQVNIPDPSLSGSALDFMTGYLSAKGDGGWTLFEQYKA
FT                   NGVAMAGANQEALDPVITGAKGVVVAAVDYMTYKAKAKGEPIDIVYPTEGTVISPRPAA
FT                   ILKSTQHEQNAKAFIDYLLSDEAQKLVADASLLPGRTDIKADKRANLDEIPLLKTNWEW
FT                   MGEHGSDVTEKFTQMFK"
FT   gene            163271..164941
FT                   /gene="ftpA"
FT                   /locus_tag="PPSC2_00665"
FT                   /old_locus_tag="PPSC2_c0135"
FT   CDS_pept        163271..164941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftpA"
FT                   /locus_tag="PPSC2_00665"
FT                   /old_locus_tag="PPSC2_c0135"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54122"
FT                   /db_xref="GOA:E3EEZ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3EEZ9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818568.1"
FT                   /protein_id="ADO54122.1"
FT                   /translation="MGGLSVKHIRGWSLTLALIALLFLILLPLLQIFIQSVYVEGKFQW
FT                   AAPFRTLAASQFAGVLFSSIWLGICVIAGTTALALPLAWIMSNTRLAHWRWLDVVLLIP
FT                   FMTPPYIGSMGWILFMQKNGYLEQLFPDLHFLTASFFSLGGMVMIMSLHLFPFLYLLLR
FT                   GALVRIGGSLEEAGAVMGGGFLYRFRRIILPLLLSAYGMGALLIFVKTIAEFGTPATFG
FT                   RRIGYEVMTSEIHKYISSWPIDFGKATSMASVLLTACLLMWYVQSVINRKFTYRLVGGK
FT                   GSRPSRLRVSSWTTALSVAFILLLLIAAIGIPYFSIIAASSMKLRGIGLAWNNLTLDYY
FT                   KELLSWGSESMEALLNSVFLSLGASTIAVVLGTWFALVIGGSRTKIQRTVDAFSLLPNT
FT                   VPGIVMVVGLILWWNSPWMPIPLYNTYGMVILTYVILFVPYTVQYVKSAFTQVDHTLFQ
FT                   AGQVFGGRPSYIFRRIVLPLIVPGMLAGWMMTFTIASRELVGSLLILPPSVQTSATYIF
FT                   AQFEQGQVSLGMAMAVISVGLTTLLLILMESLNSRRKWK"
FT   gene            164938..166323
FT                   /gene="ysh1"
FT                   /locus_tag="PPSC2_00670"
FT                   /old_locus_tag="PPSC2_c0136"
FT   CDS_pept        164938..166323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ysh1"
FT                   /locus_tag="PPSC2_00670"
FT                   /old_locus_tag="PPSC2_c0136"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54123"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF00"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368768.1"
FT                   /protein_id="ADO54123.2"
FT                   /translation="MMMTKLRIWGGAGEHGRSCYVFEGKQHRIMLDCGVKKEGIGQYPI
FT                   FPPQKVKELTTVLLSHAHEDHSMALPLLYKYGYRGEVWTTKATAEQLGSYFRSWQTYVE
FT                   SRGGELPYSEQDIQSITYRYLEDGAPSGVWCEACPGVRMMWGRSGHLAGAVWYIIEMEG
FT                   KRLFFSGDYSRESELLAADAPDLCMGEGINDLPECKPQSYLVDISIMDNAYGMDIDPQP
FT                   VKLERLRVEMEQILWSGGHVLLPVPAFGRGQELIVWASEQFPEQAIIVEPDLWHGLKQL
FT                   NRWREWLRPGASTRIKHVLNSDRVFVPRDAAERISLLERNTATIIVTRDGMMDSPQARW
FT                   YYQYLSDNRHMLNDMDSGENIRNSVILTGHASNGSFGKHLLERADSNDICIARHLTYKV
FT                   HQGLSDVRQMLKDLPSKQAVLVHAPKPQTDLVRDVLIREENNAHGGPAREVHSVEPGST
FT                   IEV"
FT   gene            complement(166341..167501)
FT                   /gene="epr"
FT                   /locus_tag="PPSC2_00675"
FT                   /old_locus_tag="PPSC2_c0137"
FT   CDS_pept        complement(166341..167501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epr"
FT                   /locus_tag="PPSC2_00675"
FT                   /old_locus_tag="PPSC2_c0137"
FT                   /product="peptidase S8"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54124"
FT                   /db_xref="GOA:E3EF01"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF01"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428111.1"
FT                   /protein_id="ADO54124.1"
FT                   /translation="MDYPDFLQRLHEGISEPSGSGRNKQIITFDKPHQYRECLSYLRKL
FT                   KPELVGLRQVQPARLIRALIAPLSGGDRLGKYHHGVTVEEDTRIKVHAETAYMPKAEKN
FT                   LSMPWGVKQVRAYKAWPSSTGNRVRIGVIDTGADFHHPDLRHSLARGINLLNRTMLPYD
FT                   DNGHGTHIAGTIAASNYDEGMVGVAPRALIHPVKAFDHNGAAYVSDIILGIDWCVLNRV
FT                   DIINMSFGMKSRSKALLDMVNKAYHNGIVIVASSGNEGKRRSIDYPARYSQTISVGATD
FT                   KYRRIAPFSNRGQFVDVYAPGEKIRSSWIHGKHHEMSGTSMATSHVTGSIALLLSLKPE
FT                   LEPGEIKALLKRTATPLRLRKSAGRSSISTKLGEVDAFRLMQEGTK"
FT   gene            167907..168458
FT                   /gene="rpoE1"
FT                   /locus_tag="PPSC2_00680"
FT                   /old_locus_tag="PPSC2_c0138"
FT   CDS_pept        167907..168458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE1"
FT                   /locus_tag="PPSC2_00680"
FT                   /old_locus_tag="PPSC2_c0138"
FT                   /product="DNA-directed RNA polymerase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54125"
FT                   /db_xref="GOA:E3EF02"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF02"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368770.1"
FT                   /protein_id="ADO54125.1"
FT                   /translation="MSTPLNLKIDPEKVHETPMVDLAFMVLKAANTPYYYRDLMNEVAK
FT                   LRGLSDEEINDVIAQLYTEINIDGRFACVGTNLWGLKRWYPVDKSEDALTGAKRPRIIN
FT                   DEDDDDEDDYHEEEETYNSDDDFDADSEDEDGEDELFDGEDDDDSDDDVVIDDEDLSDE
FT                   EDTDDENDDESIEDDDDSLR"
FT   gene            168860..170461
FT                   /gene="pyrG"
FT                   /locus_tag="PPSC2_00685"
FT                   /old_locus_tag="PPSC2_c0140"
FT   CDS_pept        168860..170461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="PPSC2_00685"
FT                   /old_locus_tag="PPSC2_c0140"
FT                   /product="CTP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54127"
FT                   /db_xref="GOA:E3EF04"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF04"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308217.1"
FT                   /protein_id="ADO54127.1"
FT                   /translation="MTKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTIQKFDPYLN
FT                   VDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSKNSNVTTGKVYSSVISKERR
FT                   GEYLGGTVQVIPHITNEIKERVYRAGREAGSDVIITEIGGTVGDIESLPFLEAIRQLKS
FT                   EVGRENVMYIHVTLIPYIKAAGEVKTKPTQHSVKELRSIGIQPNVIVCRTEHELSSDMK
FT                   AKIALFCDIDANAVVECRDASTLYEVPLNLREEGLDEIVVNHLKLTTPAPDMTEWEGLV
FT                   DRISKLDKTVEIAIVGKYVALHDAYLSVVESLSHAGFDANADVKIRWVNAEEVTDENVA
FT                   DMLGGIGGILVPGGFGDRGIEGKISTIRYAREQKIPFFGICLGMQVSVIEVARSLAGLE
FT                   GANSSEINPATDYPVIDLLPDQKDIEDLGGTMRLGLYPCKLVEGSLASACYNDELVYER
FT                   HRHRYEFNNEYREVIEKAGLRISGTSPDGRLVEIVELPEHPWFLAVQFHPEFTSRPNRP
FT                   QPLFREFVKAALQLQG"
FT   gene            170675..171043
FT                   /gene="spo0F"
FT                   /locus_tag="PPSC2_00690"
FT                   /old_locus_tag="PPSC2_c0142"
FT   CDS_pept        170675..171043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spo0F"
FT                   /locus_tag="PPSC2_00690"
FT                   /old_locus_tag="PPSC2_c0142"
FT                   /product="sporulation initiation phosphotransferase F"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54129"
FT                   /db_xref="GOA:E3EF06"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF06"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308218.1"
FT                   /protein_id="ADO54129.2"
FT                   /translation="MEKKKVLIVDDQNGIRILLMEVFGSEGYETFQAANGKIALEIVEK
FT                   EPPDLVLLDMKIPGMDGLEILKHLKSMNPDIKVIMMTAYGELDMIKEATELGALMHFTK
FT                   PFDIDEMRIAVNKQLRGD"
FT   gene            171292..172146
FT                   /gene="fbaA"
FT                   /locus_tag="PPSC2_00695"
FT                   /old_locus_tag="PPSC2_c0144"
FT   CDS_pept        171292..172146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="PPSC2_00695"
FT                   /old_locus_tag="PPSC2_c0144"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="'catalyzes the formation of glycerone phosphate and
FT                   glyceraldehyde 3-phosphate from fructose 1,6, bisphosphate;
FT                   induced by anaerobic conditions in Bacillus subtilis'"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54131"
FT                   /db_xref="GOA:E3EF08"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF08"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019914404.1"
FT                   /protein_id="ADO54131.1"
FT                   /translation="MPLVSMKDMLNKALEGKYAVGQFNINNLEWTQAILGAAEEEKSPV
FT                   ILGVSEGAARHMGGFYTVVKMVEGLIHDMKITVPVAIHLDHGSSFDKCKEAIDAGFTSV
FT                   MIDDSHSPIEKNIETTKKVVEYAHSKGVSVEAEVGMVGGQEDDVVGDVMYAKLDDCVRI
FT                   VKETGIDTLAPALGSVHGPYKGEPNLGFKEMEEIRNAVKLPLVLHGGTGIPTHDIQKSI
FT                   SLGTSKINVNTENQIAFAKVVREVLAAKPDAYDPRTFIQPGREAIKQTVIGKIREFGSN
FT                   NKA"
FT   gene            172374..173627
FT                   /gene="murZ"
FT                   /locus_tag="PPSC2_00700"
FT                   /old_locus_tag="PPSC2_c0146"
FT   CDS_pept        172374..173627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murZ"
FT                   /locus_tag="PPSC2_00700"
FT                   /old_locus_tag="PPSC2_c0146"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="adds enolpyruvyl to UDP-N-acetylglucosamine as a
FT                   component of cell wall formation; gram-positive bacteria
FT                   have 2 copies of MurA which are active"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54133"
FT                   /db_xref="GOA:E3EGA5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGA5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010346585.1"
FT                   /protein_id="ADO54133.1"
FT                   /translation="MEKLMITGGRPLQGTVSISGAKNSAIALIPAAILAESEVILDNLP
FT                   LLSDVAVYSEILEELGAKVAWEGSQMKIDPSSIKSIPMPNGPVKKLRASYYMMGAMLGR
FT                   FKEAIIGLPGGCNFEPRPIDQHIKGFEALGATVTNEHGAIHLHAKELRGTKIYLDVSSV
FT                   GATINIMLAAARAKGATTIENAAKEPEIIDVATLLNSMGAIIKGAGTETIRIEGVSELH
FT                   GCRHSIIPDRIQAGTYMIAAAATRGNVLIDNVIPKHMEALTAKMQEMGIGIEEYDESIR
FT                   VLGAPSYGHVDVKALVYPGFPTDLQSPMTSLLTQAQGVSVLSDFVYSNRFKHVPELVRM
FT                   GAKIRVEGRSAIIEGGQLNAAKVKAADLRAGAALVIAGLTVSEGVTEVAGVEYIDRGYD
FT                   HLVSNLRLLGADVWRQTE"
FT   gene            173891..175228
FT                   /gene="rho"
FT                   /locus_tag="PPSC2_00705"
FT                   /old_locus_tag="PPSC2_c0147"
FT   CDS_pept        173891..175228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="PPSC2_00705"
FT                   /old_locus_tag="PPSC2_c0147"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54134"
FT                   /db_xref="GOA:E3EGA6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGA6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368779.1"
FT                   /protein_id="ADO54134.1"
FT                   /translation="MDLQISDLEEMKLTDLYKLAKQYQIPYYGTLKKKELIFAILRAQA
FT                   EKSGLMFMQGVLEILPEGYGFLRPINYLPSTEDIYISASQIRKFDLRTGDLVSGKCRTP
FT                   KENERYFGLLQVNAVNGRSPEQAAERLHFPALTPLYPQTKLVLETSPNHLSTRIMDVLA
FT                   PVGLGQRGLIVAPPKAGKTLLLKEIANSISTNNPEIELFVLLIDERPEEVTDMQRSVKG
FT                   EVVASTFDELPENHIKVAELVLERALRLVEHKKDVVILLDSITRLARAYNLVIPPSGRT
FT                   LSGGIDPAAFHRPKRFFGAARNVEEGGSLTILATALIDTGSRMDDIIYEEFKGTGNMEL
FT                   HLDRKLAERRIFPAIDIRRSGTRREEVLLKKEELDTIWAIRKNMTESHDFVEGFLKKLR
FT                   NSKTNAEFLASFDLTAPSSSGSQGSSGGQQRRTTRSTTASVPATTN"
FT   gene            175323..176594
FT                   /gene="M1-291"
FT                   /locus_tag="PPSC2_00710"
FT                   /old_locus_tag="PPSC2_c0148"
FT   CDS_pept        175323..176594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-291"
FT                   /locus_tag="PPSC2_00710"
FT                   /old_locus_tag="PPSC2_c0148"
FT                   /product="radical SAM protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54135"
FT                   /db_xref="GOA:E3EGA7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGA7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368780.1"
FT                   /protein_id="ADO54135.1"
FT                   /translation="MYLVYADEKGNVYDHASLYGLARSADMIVEIMEDELIPLPEGATL
FT                   VSLPSTRPVGMNPETGEMVSLPGDVQAVGALLPQGFTRLCLPGYVKTDKDYKLPLFGYS
FT                   AVVWKDGAFYVTAEQSDSPSKWNPENCDRNQVKLGVQRMTEQYPENRLYQHLSNCALGY
FT                   ECLTSSNTFLNRWEGGVPVSYSCNAGCFGCISEQPDDSGFVSPQTRMNFRPRVEEIVEV
FT                   MLEHLKTPESIISFGQGCEGEPSTQAKLIIDAIKEVRSVTDMGYININTNAGLNDHIRG
FT                   IVDAGLDLMRVSTISALDDHYNAYYKPRGYTLANVEKSLRYASEKGVYTSINYLIFPGV
FT                   TDREEEIEAMIEFAKRTKLKLIQMRNLNIDPESYLELIPPAQGEILGMKQMLEIYREEL
FT                   PDVVIGSYTHVPPQGLARPKFART"
FT   gene            176747..176944
FT                   /gene="rpmE1"
FT                   /locus_tag="PPSC2_00715"
FT                   /old_locus_tag="PPSC2_c0149"
FT   CDS_pept        176747..176944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE1"
FT                   /locus_tag="PPSC2_00715"
FT                   /old_locus_tag="PPSC2_c0149"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54136"
FT                   /db_xref="GOA:E3EGA8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGA8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818578.1"
FT                   /protein_id="ADO54136.1"
FT                   /translation="MQQAIQPKYNVTNVTCACGNTFETGSVKESLRVEICSACHPFFTG
FT                   KQKFIDAGGRVDRFKKKYGI"
FT   gene            177478..179229
FT                   /gene="dnaX"
FT                   /locus_tag="PPSC2_00720"
FT                   /old_locus_tag="PPSC2_c0151"
FT   CDS_pept        177478..179229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="PPSC2_00720"
FT                   /old_locus_tag="PPSC2_c0151"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54138"
FT                   /db_xref="GOA:E3EGB0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGB0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427243.1"
FT                   /protein_id="ADO54138.2"
FT                   /translation="MEHIALYRAWRPQAFKDMVGQQHIIQTLQNAIRENRTSHAYLFSG
FT                   PRGTGKTSAAKILAKAINCEHGPAPEPCNECEACKRITAGAVMDVQEIDAASNRGVEEI
FT                   RDLRDKVKYAPTEVRHKVYIIDEVHMLTTEAFNALLKTLEEPPPHVMFILATTEPHRIP
FT                   ATIISRCQRFDFRRVSLEEQTERLDLICQQENIQADLDALQYIARLSDGGMRDAVSVLD
FT                   QISSFTDGRVTYQQVLDMTGGIASEQFGKLALALLKEDVGTVLQLIENFMQEGKSADKC
FT                   MENLLYYFRDLLMIKMVPQATKMTERVLNPEQFREVADAFTKEQLFAMIDTLNRYQGEM
FT                   KYAVQPQTLFEVALLKLCSIPGEAGTAAQPTAQRSGAVAGQEDVAMLKRQLAELEKKLE
FT                   RAMQGGLAVGAGQETPSGGRQASGGRAPAPRLSAPAKLPSQLDRYIAEKSSEAFAAVGR
FT                   KWSQILQGVKEAKVTVHAWFMDGEPVSVLEDSVLVAFKNNIHRETTEKPANKQVIEKVL
FT                   HEQLGHPYRLVTMMQKDWNAAIEGVSDQPAEELQLEPEHDAPGKSKEPWIDEAIQLFGE
FT                   DLVVIKE"
FT   gene            179270..179581
FT                   /gene="yaaK"
FT                   /locus_tag="PPSC2_00725"
FT                   /old_locus_tag="PPSC2_c0152"
FT   CDS_pept        179270..179581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaK"
FT                   /locus_tag="PPSC2_00725"
FT                   /old_locus_tag="PPSC2_c0152"
FT                   /product="nucleoid-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00725"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54139"
FT                   /db_xref="GOA:E3EGB1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGB1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019639926.1"
FT                   /protein_id="ADO54139.1"
FT                   /translation="MNNMNQMMKQVKKMQEQMLKAQEELGGKVIEGSSGGGVVTVEVSG
FT                   HKKVLSITIKPEAVDPDDVEMLQDLVLTAVNDALSKADELANDDMGKFTGGMKIPGLF"
FT   gene            179608..180207
FT                   /gene="recR"
FT                   /locus_tag="PPSC2_00730"
FT                   /old_locus_tag="PPSC2_c0153"
FT   CDS_pept        179608..180207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="PPSC2_00730"
FT                   /old_locus_tag="PPSC2_c0153"
FT                   /product="recombinase RecR"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54140"
FT                   /db_xref="GOA:E3EGB2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGB2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368785.1"
FT                   /protein_id="ADO54140.1"
FT                   /translation="MHYPEPIAKLIDAFTRLPGVGPKTAARLAFHVLKMKEDDVIDFAK
FT                   ALVNVKRNLHFCSVCGNITDTDPCRICQDKTRDASVICVVQDAKDLVAMERTKEFEGLY
FT                   HVLHGAISPMEGIGPEDIKLKELLTRLSDERVKELILATNPNIEGEATAMYISRLVRPF
FT                   EIKVTRIAHGLPVGGDLEYADEVTLSKALEGRRELN"
FT   gene            180420..180731
FT                   /gene="M1-297"
FT                   /locus_tag="PPSC2_00735"
FT                   /old_locus_tag="PPSC2_c0154"
FT   CDS_pept        180420..180731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-297"
FT                   /locus_tag="PPSC2_00735"
FT                   /old_locus_tag="PPSC2_c0154"
FT                   /product="M1-297"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54141"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGB3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279142.1"
FT                   /protein_id="ADO54141.1"
FT                   /translation="MWERMKQNFRRQENGKSEAEYRQELFAQIRASHAEWLRAHRLFHE
FT                   ATGKDEIDYAIFVLQAAERKYQIHLKSAKQQGLHRFHLPADEPGYANDTDRVHKRRAE"
FT   gene            180728..181003
FT                   /gene="M1-298"
FT                   /locus_tag="PPSC2_00740"
FT                   /old_locus_tag="PPSC2_c0155"
FT   CDS_pept        180728..181003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-298"
FT                   /locus_tag="PPSC2_00740"
FT                   /old_locus_tag="PPSC2_c0155"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54142"
FT                   /db_xref="GOA:E3EGB4"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGB4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368787.1"
FT                   /protein_id="ADO54142.1"
FT                   /translation="MRGVVWLVLIACAGILMYLILKKHLGIGWFVVFGAHMALAAIALY
FT                   VINYSGWITQVYIPINPVTMGAVTILGLPGIALLLGLKIILFGQAV"
FT   gene            181416..182974
FT                   /locus_tag="PPSC2_00745"
FT                   /old_locus_tag="PPSC2_r007"
FT   rRNA            181416..182974
FT                   /locus_tag="PPSC2_00745"
FT                   /old_locus_tag="PPSC2_r007"
FT                   /product="16S ribosomal RNA"
FT   gene            183083..183199
FT                   /locus_tag="PPSC2_00750"
FT                   /old_locus_tag="PPSC2_r008"
FT   rRNA            183083..183199
FT                   /locus_tag="PPSC2_00750"
FT                   /old_locus_tag="PPSC2_r008"
FT                   /product="5S ribosomal RNA"
FT   gene            183239..183315
FT                   /locus_tag="PPSC2_00755"
FT                   /old_locus_tag="PPSC2_ct002"
FT   tRNA            183239..183315
FT                   /locus_tag="PPSC2_00755"
FT                   /old_locus_tag="PPSC2_ct002"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:183273..183275,aa:Ile,seq:gat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            183336..183411
FT                   /locus_tag="PPSC2_00760"
FT                   /old_locus_tag="PPSC2_ct003"
FT   tRNA            183336..183411
FT                   /locus_tag="PPSC2_00760"
FT                   /old_locus_tag="PPSC2_ct003"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:183369..183371,aa:Ala,seq:tgc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            183540..186468
FT                   /locus_tag="PPSC2_00765"
FT                   /old_locus_tag="PPSC2_r009"
FT   rRNA            183540..186468
FT                   /locus_tag="PPSC2_00765"
FT                   /old_locus_tag="PPSC2_r009"
FT                   /product="23S ribosomal RNA"
FT   gene            186599..186690
FT                   /locus_tag="PPSC2_00770"
FT                   /old_locus_tag="PPSC2_ct004"
FT   tRNA            186599..186690
FT                   /locus_tag="PPSC2_00770"
FT                   /old_locus_tag="PPSC2_ct004"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:186634..186636,aa:Ser,seq:gct)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            186719..186795
FT                   /locus_tag="PPSC2_00775"
FT                   /old_locus_tag="PPSC2_ct005"
FT   tRNA            186719..186795
FT                   /locus_tag="PPSC2_00775"
FT                   /old_locus_tag="PPSC2_ct005"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:186753..186755,aa:Met,seq:cat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            186806..186881
FT                   /locus_tag="PPSC2_00780"
FT                   /old_locus_tag="PPSC2_ct006"
FT   tRNA            186806..186881
FT                   /locus_tag="PPSC2_00780"
FT                   /old_locus_tag="PPSC2_ct006"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:186839..186841,aa:Val,seq:tac)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            186886..186961
FT                   /locus_tag="PPSC2_00785"
FT                   /old_locus_tag="PPSC2_ct007"
FT   tRNA            186886..186961
FT                   /locus_tag="PPSC2_00785"
FT                   /old_locus_tag="PPSC2_ct007"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:186919..186921,aa:Thr,seq:tgt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            186981..187057
FT                   /locus_tag="PPSC2_00790"
FT                   /old_locus_tag="PPSC2_ct008"
FT   tRNA            186981..187057
FT                   /locus_tag="PPSC2_00790"
FT                   /old_locus_tag="PPSC2_ct008"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:187015..187017,aa:Asp,seq:gtc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            187135..187210
FT                   /locus_tag="PPSC2_00795"
FT                   /old_locus_tag="PPSC2_ct009"
FT   tRNA            187135..187210
FT                   /locus_tag="PPSC2_00795"
FT                   /old_locus_tag="PPSC2_ct009"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:187168..187170,aa:Phe,seq:gaa)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            187217..187302
FT                   /locus_tag="PPSC2_00800"
FT                   /old_locus_tag="PPSC2_ct010"
FT   tRNA            187217..187302
FT                   /locus_tag="PPSC2_00800"
FT                   /old_locus_tag="PPSC2_ct010"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:187251..187253,aa:Tyr,seq:gta)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            187310..187385
FT                   /locus_tag="PPSC2_00805"
FT                   /old_locus_tag="PPSC2_ct011"
FT   tRNA            187310..187385
FT                   /locus_tag="PPSC2_00805"
FT                   /old_locus_tag="PPSC2_ct011"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:187343..187345,aa:Lys,seq:ttt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            187540..188682
FT                   /gene="cdaR"
FT                   /locus_tag="PPSC2_00810"
FT                   /old_locus_tag="PPSC2_c0157"
FT   CDS_pept        187540..188682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="PPSC2_00810"
FT                   /old_locus_tag="PPSC2_c0157"
FT                   /product="polyketide synthase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54144"
FT                   /db_xref="GOA:E3EGB6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGB6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427887.1"
FT                   /protein_id="ADO54144.1"
FT                   /translation="MTLDTEWIQQQLQNIIQAPFTIVPWCPEMMAEGESTDSVIPDRSF
FT                   VSENKLYFPFRASVGELAAFAVEARYLSDRERKLIEALLGNMEQVWHNGPSLSVNRAYS
FT                   EEERMNHFGQWLIQQAANLSSKEEVPAELELRDPLSACMVPFLLNGEGTQDGAITYTQL
FT                   HRLLASYFGGDVLLTPLDEQSWLILARKELLLGADDERDKDTETRETDFAEPLEEVLTA
FT                   FSLGLYELIANEWVGVFHLAISKPSIPLQSLPHELNLLWETIHLGKLFHVTEHIHLSWE
FT                   HHLERLLNRIPKEQRVLFLEQVMKSSVILEDSETMATLDIFFQLDCNVSETAKRLYVHR
FT                   NTLIYRLDKIKQETGLDVRTFNDAVLVKLYLLLYKVTKRK"
FT   gene            188786..189910
FT                   /gene="msmX"
FT                   /locus_tag="PPSC2_00815"
FT                   /old_locus_tag="PPSC2_c0158"
FT   CDS_pept        188786..189910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msmX"
FT                   /locus_tag="PPSC2_00815"
FT                   /old_locus_tag="PPSC2_c0158"
FT                   /product="glycerol-3-phosphate ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54145"
FT                   /db_xref="GOA:E3EGB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGB7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308231.1"
FT                   /protein_id="ADO54145.1"
FT                   /translation="MAGVRLEHIFKKYPGAEKATVVDVNLDIQDKEFLVLVGPSGCGKS
FT                   TTLRMIAGLEEISDGKLYIGDRVVNDVAPKDRDIAMVFQSYALYPHMNVYQNMAFGLKL
FT                   RKVKKEEIDKRVREAAKILDIEHLLDRKPKALSGGQRQRVALGRAIVRDPQVFLMDEPL
FT                   SNLDAKLRGQMRAEITKLAKRLETTVIYVTHDQVEAMTMGDRIVVMKDGIIQQAASPDE
FT                   LYNRPVNLFVAGFIGSPTMNFISGKLVEKEGALHFAAPGLDLFVPEGKGQILKAKGYIG
FT                   KEVILGIRPEDIHEEPVFLEASPNTIFTSTVDVTENLGHEMLLYLSGAGNDTIIARVDG
FT                   RSNTRDGVKAKLAVDMNKVHIFDKESELSILVGE"
FT   gene            190263..191201
FT                   /gene="hprK1"
FT                   /locus_tag="PPSC2_00820"
FT                   /old_locus_tag="PPSC2_c0159"
FT   CDS_pept        190263..191201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK1"
FT                   /locus_tag="PPSC2_00820"
FT                   /old_locus_tag="PPSC2_c0159"
FT                   /product="serine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54146"
FT                   /db_xref="GOA:E3EGB8"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGB8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308232.1"
FT                   /protein_id="ADO54146.1"
FT                   /translation="MAKQVKVSELVQQFQMEVISGEKGLRRLITVDDLNRPGLEMAGYF
FT                   EYHTQERVQLLGRSELAFLGMLPPEERRDRMERLCTELTPCIIITRGLEVPAELVEASA
FT                   ERDIPVLRTNMATTILSSRITGFLERKLAPTATIHGVLCDVYGVGMLITGSSGIGKSET
FT                   ALELVKRGHRLVADDAVEIRQTSDFQLHGTAPELIRHLLEIRGVGIINVMTLFGAGAVR
FT                   NNKRITLVVRLEAWQQDKQYDRLGLDEETTRIIDTDVPLVTIPVRPGRNLAVIIEVAAM
FT                   NYRLKQMGVNAALQFTNKLTATISEDMEEMD"
FT   gene            191245..192300
FT                   /gene="lgt"
FT                   /locus_tag="PPSC2_00825"
FT                   /old_locus_tag="PPSC2_c0160"
FT   CDS_pept        191245..192300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="PPSC2_00825"
FT                   /old_locus_tag="PPSC2_c0160"
FT                   /product="diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00825"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54147"
FT                   /db_xref="GOA:E3EGB9"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGB9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308233.1"
FT                   /protein_id="ADO54147.1"
FT                   /translation="MSTATLLLNPIAFSIGAIKVHWYGLILGLAALVGLYLAIREGKRF
FT                   GIPQEFFMDMLLLGVPSAIIGARIYYVAFKWEDYRDNLWDVFKIWNGGIAIYGALIGAI
FT                   ICAVIYFRYKGYNFWRIADICAPGLLIGQAIGRWGNFVNQEAYGGPTEETFLRNQLHLP
FT                   DFIVNQMNVNGVFHHPTFLYESLWSIVGVILLLVIRRMKFVRAGEMFAFYFIWYSIGRF
FT                   FIERVRTDSLAFQGPDWLASFVNALWSPMVWLGFEPGYLDPNYGNVRISQLLAIFIIVA
FT                   AVIFILVRRRKGSAVARYSDPIVSSKTGIDQVPDVTPEQVSRPGQDAVSPTATVDKLSK
FT                   EDTDEDKKEHL"
FT   gene            192297..192950
FT                   /gene="hprP"
FT                   /locus_tag="PPSC2_00830"
FT                   /old_locus_tag="PPSC2_c0161"
FT   CDS_pept        192297..192950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprP"
FT                   /locus_tag="PPSC2_00830"
FT                   /old_locus_tag="PPSC2_c0161"
FT                   /product="pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54148"
FT                   /db_xref="GOA:E3EGC0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGC0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685785.1"
FT                   /protein_id="ADO54148.1"
FT                   /translation="MINTILFDLDGTIMDTNELIISTFLHILNHPDADPLTREHIIPHM
FT                   GGTLDDQLRTFTGLTDVSGLIKDYRAYNQIHHDQMVKPFPHVIEVIQELRARGIKLGVV
FT                   TTKIRPSTMRVLNLFDLTSSMDYIVTVDDVEHPKPHAEPVLKALAGLNAEAEHTLMVGD
FT                   SSFDILSAQAAGVKSAGVAWSLKGEETLRGYGPDYMLYDMRDLLKLELQGVNVS"
FT   gene            192944..193444
FT                   /gene="yvoF"
FT                   /locus_tag="PPSC2_00835"
FT                   /old_locus_tag="PPSC2_c0162"
FT   CDS_pept        192944..193444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvoF"
FT                   /locus_tag="PPSC2_00835"
FT                   /old_locus_tag="PPSC2_c0162"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00835"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54149"
FT                   /db_xref="GOA:E3EGC1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGC1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368793.1"
FT                   /protein_id="ADO54149.2"
FT                   /translation="MVRKVNRYPVEGPNALWQIYRTVSPWKGVKNFIFIQIARYCPVLS
FT                   LKNVIYRRMLGMKVGQHAAFGLMVMVDVFFPEHITIGNNSVIGYNTTILAHEYLIQEYR
FT                   IGKVVIGDRVLIGANTTILPGVTIGDGAVVAAGAVVHKDVPAGAFVGGNPLRDLRRSGV
FT                   DEK"
FT   gene            193588..194739
FT                   /gene="M1-305"
FT                   /locus_tag="PPSC2_00840"
FT                   /old_locus_tag="PPSC2_c0163"
FT   CDS_pept        193588..194739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-305"
FT                   /locus_tag="PPSC2_00840"
FT                   /old_locus_tag="PPSC2_c0163"
FT                   /product="acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54150"
FT                   /db_xref="GOA:E3EGC2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGC2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368794.1"
FT                   /protein_id="ADO54150.1"
FT                   /translation="MVKKERIPELDIYRGILIAAVITIHATSMALIDARHSLLFYPFLF
FT                   LNMFSSFAVPVFIFVSGFVLFYNYVDRPLRGKSMLLFFRKRLMFIVLPYVLFSLMYYLT
FT                   LVTRGLMPLSDLPLVLLTGKAYTHLYYVIIIIQFYLVFPLLLWGVQRLRHWISSPRRAA
FT                   FVILAVGLVIQWGFVLLNKYVWQEERGSLAITYISYFALGAAVAIGYEGFKKWLFPVPG
FT                   TVMGRGQLISWWALWAAWLLLGIVYVQIWFIAYRKAIYADSLVYELLHNAYALVSALVL
FT                   FQLSVLLYRHTSDRLRMFISWLGACSFGIYLLHPALLRVYRKLDLHGTPIEYVFSVAGG
FT                   WVLALFGSWLIVTLFFRYVPFSWIGLGTVPKFPSQSKDEQANC"
FT   gene            194964..196169
FT                   /gene="hisZ"
FT                   /locus_tag="PPSC2_00845"
FT                   /old_locus_tag="PPSC2_c0165"
FT   CDS_pept        194964..196169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="PPSC2_00845"
FT                   /old_locus_tag="PPSC2_c0165"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54152"
FT                   /db_xref="GOA:E3EGC4"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGC4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820113.1"
FT                   /protein_id="ADO54152.1"
FT                   /translation="MSKPKGFEIPIGVRDYLPRAVSKLRAIELNVLACMERWGYRQIMT
FT                   PTMEYYDTVGVASSTSDRKLFKLLNNRGTTLVLRSDMTAPIARVVSSLLKEEEVPLRLS
FT                   YHANVFRAIEEEAGREAEFFQTGVELVGDDSPEADAEVVALAIASLQAAGVTSFKIAMG
FT                   HVGFLNGLFEEIIPGRQAEQQALKELLLNRDVVGYRTAIEALGLAPEHRDKLEAILRLR
FT                   GGKEICEQATRLSVEQQTLQTIAHLCEVWEVLEAYGVSEHVLIDLTMIGDFSYYTGMTF
FT                   EGYAAEIGFPVCNGGRYDNLLQQFGRSVPATGFALKTNRIVDGVDGIAIETKRPVLIRY
FT                   DEQERREALSAAAQLRAEGLNVVTGLTGGPEDRRREQQDLYAEVYSYTAEGRQPVQRRE
FT                   LP"
FT   gene            196166..196810
FT                   /gene="hisG"
FT                   /locus_tag="PPSC2_00850"
FT                   /old_locus_tag="PPSC2_c0166"
FT   CDS_pept        196166..196810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="PPSC2_00850"
FT                   /old_locus_tag="PPSC2_c0166"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54153"
FT                   /db_xref="GOA:E3EGC5"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGC5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368797.1"
FT                   /protein_id="ADO54153.1"
FT                   /translation="MTETLKVAMPKGRIYKQASKLFRQAGVPIPLDVDETRKLVIPLPE
FT                   LGMEFIMAKPVDVPTYVEYGAADIGIVGKDVLLEENKDVYELLDLGIARCRMSVIALPD
FT                   WQPGIRQRVATKYPNVASQYFREQGQQVEVIKLNGSIELAPLIGLADRIVDMVETGQTL
FT                   RENGLVEQISILDITSRLIANRVSYRMKNGPIQALCDRLHQVIPTEVVPKG"
FT   gene            196874..198187
FT                   /gene="hisD"
FT                   /locus_tag="PPSC2_00855"
FT                   /old_locus_tag="PPSC2_c0167"
FT   CDS_pept        196874..198187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="PPSC2_00855"
FT                   /old_locus_tag="PPSC2_c0167"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00855"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54154"
FT                   /db_xref="GOA:E3EGC6"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGC6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685789.1"
FT                   /protein_id="ADO54154.1"
FT                   /translation="MKIVAARDFNLQREVDYGTPEQNEAVRTIIQSVRQEGDEAVLRYT
FT                   EMFDGVSLTAEQLRVTDGELKLAYDKVEPSFIQAIREAAAHIRAFHTKQKRNSWIDLQS
FT                   DGSLLGQIIRPLKRVGVYVPGGKAAYPSSVLMNVIPAQVAGVPEIVMVTPPATGGKAGI
FT                   DPYTLVAAAEAGVTEIYRVGGAQAIASLAYGTHSIEPVDKICGPGNIYVALAKREVYGA
FT                   VDIDSIAGPSEIVVLADDTANPSYVAADLLSQAEHDEMASAILVTPSQRLAEEVSAEVQ
FT                   RQLAELPRRDIAAASVEAYGAIIVVDNLEEGIRIVNRLAPEHLEIMTEQPMEHMGQIEN
FT                   AGAIFLGAYSSEPVGDYFAGPNHIIPTNGTARFSSPVDIDDFIKKSSMIYYSKEALLRN
FT                   GETIMQLARHEGLEGHARAIQVRLDNEKKAVDGDGERK"
FT   gene            198171..198779
FT                   /gene="hisB"
FT                   /locus_tag="PPSC2_00860"
FT                   /old_locus_tag="PPSC2_c0168"
FT   CDS_pept        198171..198779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="PPSC2_00860"
FT                   /old_locus_tag="PPSC2_c0168"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54155"
FT                   /db_xref="GOA:E3EGC7"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGC7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368799.1"
FT                   /protein_id="ADO54155.1"
FT                   /translation="MGNENNKAERTGSVSRKTNETDIQLSFAVDGTGQAEIETDVPFLN
FT                   HMLDLFTKHGQFDLNVQARGDVDIDDHHTVEDIGICLGQTLLEALGDKKGIKRYASVFV
FT                   PMDEALAQVVIDLSNRPHFEYRAEYPSQQVGSFSTELVHEFLWKFALEARMTLHVIVHY
FT                   GQNTHHMIEAVFKALGRALDEATSIDPRVTGVPSTKGVL"
FT   gene            198783..199412
FT                   /gene="hisH"
FT                   /locus_tag="PPSC2_00865"
FT                   /old_locus_tag="PPSC2_c0169"
FT   CDS_pept        198783..199412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="PPSC2_00865"
FT                   /old_locus_tag="PPSC2_c0169"
FT                   /product="imidazole glycerol phosphate synthase"
FT                   /EC_number="2.4.2.-"
FT                   /note="'with HisF IGPS catalyzes the conversion of
FT                   phosphoribulosyl-formimino-5-aminoimidazole-4-carboxamide
FT                   ribonucleotide phosphate and glutamine to
FT                   imidazole-glycerol phosphate, 5-aminoimidazol-4-carboxamide
FT                   ribonucleotide, and glutamate in histidine biosynthesis;
FT                   the HisH subunit provides the glutamine amidotransferase
FT                   activity that produces the ammonia necessary to HisF for
FT                   the synthesis of imidazole-glycerol phosphate and
FT                   5-aminoimidazol-4-carboxamide ribonucleotide'"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00865"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54156"
FT                   /db_xref="GOA:E3EGC8"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGC8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368800.1"
FT                   /protein_id="ADO54156.1"
FT                   /translation="MSIAIVDYGRGNLHSVSRAVERLGYEAVVTGDAQVIRTSSGVILP
FT                   GVGAFGDAMEHLRSSGLDRVIQEVASAGQPLLGVCLGMQLLFTRGEEYGSHEGLNILPG
FT                   EVVRFAPDLGVKVPHMGWNRLHITQPEHPLLQGLEEGHVYFVHSYHAKPEIESDLLAVT
FT                   DYGGPVTAIVGRGHVYGMQFHPEKSGEMGMRLLRQFLELAEAEKRA"
FT   gene            199505..200236
FT                   /gene="hisA"
FT                   /locus_tag="PPSC2_00870"
FT                   /old_locus_tag="PPSC2_c0170"
FT   CDS_pept        199505..200236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="PPSC2_00870"
FT                   /old_locus_tag="PPSC2_c0170"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54157"
FT                   /db_xref="GOA:E3EGC9"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGC9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308247.1"
FT                   /protein_id="ADO54157.1"
FT                   /translation="MFTIYPAIDIRDGKCVRLVQGDYNQETIYNENPVEVAREWERLGG
FT                   SYIHLVDLDGAKAGQPVNDALIGRIASAVQVPVQVGGGLRTLEHVERLLSLGVSRVILG
FT                   TAAIEDRAFTEAVLGTYGDRIAIGLDARNGYVATRGWLETSEVRADELAAELASKGAET
FT                   FIFTDISRDGMMQGPNVEAIAALAKSSGRTVIASGGVSKMDDLITLSTYAKEGVGGAIV
FT                   GKALYTGSIDLQVAVQAVAKA"
FT   gene            200248..201006
FT                   /gene="hisF"
FT                   /locus_tag="PPSC2_00875"
FT                   /old_locus_tag="PPSC2_c0171"
FT   CDS_pept        200248..201006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="PPSC2_00875"
FT                   /old_locus_tag="PPSC2_c0171"
FT                   /product="imidazole glycerol phosphate synthase"
FT                   /EC_number="4.1.3.-"
FT                   /note="'catalyzes the conversion of
FT                   5-[(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino]-
FT                   1-(5-phosphoribosyl)imidazole-4-carboxamideand glutamine to
FT                   imidazole-glycerol phosphate,
FT                   5-aminoimidazol-4-carboxamideribonucleotide and glutamate;
FT                   the HisF subunit acts as a cyclase'"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54158"
FT                   /db_xref="GOA:E3EGD0"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGD0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428141.1"
FT                   /protein_id="ADO54158.1"
FT                   /translation="MLAKRIIPCLDVKDGRVVKGVNFVNLRDAGDPVELAALYDQEGAD
FT                   EIVFLDISASVEGRATMEEVVRQTAGEIAIPFTVGGGISHVDDMKRILRAGADKIGVNT
FT                   AAVRNPQLIAEGARSFGSQCIVVAIDAKYNEAWGEWEVYTHGGRTPSGIRALAWAKEAE
FT                   QLGAGEILLTSMNADGTKDGFDLPLTSAVSDIVGIPVIASGGAGKQEHFYDVFTSGKAD
FT                   AGLAATIFHYKEIGIPELKRDLKRRGVEIR"
FT   gene            201003..201743
FT                   /gene="hisI"
FT                   /locus_tag="PPSC2_00880"
FT                   /old_locus_tag="PPSC2_c0172"
FT   CDS_pept        201003..201743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="PPSC2_00880"
FT                   /old_locus_tag="PPSC2_c0172"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54159"
FT                   /db_xref="GOA:E3EGD1"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGD1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427879.1"
FT                   /protein_id="ADO54159.1"
FT                   /translation="MSNELNQQLSLEQILDNVRWNEAGLVSAIVQDDATLQVLTLAYMN
FT                   RESLKRSLESGETWFWSRSRQELWHKGATSGNTQKISSIQLDCDGDALLVRVIPSGPAC
FT                   HTGATSCFSRDISVPGTAVTPVAGKAGAQVSVTRTDAIPIASEGRFEVLAQLEAIIKER
FT                   EETRPEGAYTTYLFDKGVDKILKKVGEEASETIIAAKNKDNEELRLEVSDLIYHLLVLL
FT                   QERKLPLDDVLAELNRRHERPRRD"
FT   gene            201779..202603
FT                   /gene="hisJ1"
FT                   /locus_tag="PPSC2_00885"
FT                   /old_locus_tag="PPSC2_c0173"
FT   CDS_pept        201779..202603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisJ1"
FT                   /locus_tag="PPSC2_00885"
FT                   /old_locus_tag="PPSC2_c0173"
FT                   /product="histidinol phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00885"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54160"
FT                   /db_xref="GOA:E3EGD2"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGD2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427878.1"
FT                   /protein_id="ADO54160.1"
FT                   /translation="MKIDYHTHHSRCGHAIGSLEEYVQQGIRLGLDQLGLSDHMPLLHV
FT                   EPANYYPEMAMPMDELPRYVEECLDLKERYKGQIDIRVGLEGDYIEGWEREIEDIVHAY
FT                   PWDYVIGSVHFLGEWDVTDFRQVHHWEGKNVLEVYRTYYDAVSKAAATGLYDIMGHLDV
FT                   IKRFGYHPKPEEEEELRELERSALSAVARSGRAMELNASGLSKPCAEMFPSRRMLEQAF
FT                   TLGIPLTIGSDAHDPAKLTEHLEKARALLHEVGYRELAVFEQRERSQVPLTL"
FT   gene            202828..204597
FT                   /gene="ogt1"
FT                   /locus_tag="PPSC2_00890"
FT                   /old_locus_tag="PPSC2_c0174"
FT   CDS_pept        202828..204597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt1"
FT                   /locus_tag="PPSC2_00890"
FT                   /old_locus_tag="PPSC2_c0174"
FT                   /product="ogt1"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54161"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGD3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427877.1"
FT                   /protein_id="ADO54161.1"
FT                   /translation="MKGKHLRVSEPSPKIIALRFDASFFFEKAVRSLDRNHYDKALKYF
FT                   RKAVEYEPDNPVNHCNMAGILSEMGDYAGSNEILSSVLSDVDSSMTECYFYMANNYANM
FT                   EQFEEAEKALVTYLEEDEEGQFLDEAEEMMELLYYELDRPTKLNRIKARQGVVEHDQAR
FT                   VLLEEGKFAQAAQLLKQISEEQPDMFAARNNLALAYYYMGLFQNAKATIIQVLEDEPGN
FT                   LHALCNLAIFYQHEGGGPELDRLVQTLAVTIPFQEEQVFKLATTMGILGRHEEAYRHFR
FT                   RLLHGNGENNADASLYHYTAVAASNTGRYAEARRLWSHLQKQDASSEVPRFFLSRLEEL
FT                   QQEGTPLQVLSYHYHLPFEEQFRMWEKFGAEQVPDSMKKDPLIRSSFFWALRHGDRATQ
FT                   LQVIQALSLIGDDEVRQALESFVEDPDQESELKRRALQVLQELAEQEVQNTHTETEHPE
FT                   RLEAEKDPYTTEGDISASSVDPQWQAVLDKVLTVMSKSSDPAMQHDLRSLWQEYLDRLA
FT                   PEVPMVQHTEGWAAALEYLTAKMHHHSVTYQEVADRYGISVSTVSRYARQIDSVCGIKQ
FT                   KLKQPLSTFKKQV"
FT   gene            204637..205590
FT                   /gene="trxB1"
FT                   /locus_tag="PPSC2_00895"
FT                   /old_locus_tag="PPSC2_c0175"
FT   CDS_pept        204637..205590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="PPSC2_00895"
FT                   /old_locus_tag="PPSC2_c0175"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00895"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54162"
FT                   /db_xref="GOA:E3EGD4"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGD4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018888151.1"
FT                   /protein_id="ADO54162.1"
FT                   /translation="MYKSIIIGTGPAGYTAAIYLARANMNPLIIEGMQPGGQLTTTTEI
FT                   ENFPGFEQGILGPELMDNMRKQAERFGAEFTSGWVEEVDFSKRPFKVKVEGKGIIEAES
FT                   VIIATGASAKYLGIPGEQDNVGRGVSTCATCDGFFFRGKKIIVVGGGDSAMEEASFLTR
FT                   FASSVTLVHRRDELRASKIMQDRARENEKVHWALNRTPLEVVTGETGLKGLKVHNNETN
FT                   QDELIEADGVFVAIGHTPNTGFLNGQIHTDEHGYIEVKPGTTETNIPGVFACGDVQDNR
FT                   YRQAITAAGTGCMAAMDCEKYLEGSAVHDWSETLDQ"
FT   gene            205990..206940
FT                   /gene="glcK1"
FT                   /locus_tag="PPSC2_00900"
FT                   /old_locus_tag="PPSC2_c0176"
FT   CDS_pept        205990..206940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcK1"
FT                   /locus_tag="PPSC2_00900"
FT                   /old_locus_tag="PPSC2_c0176"
FT                   /product="glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54163"
FT                   /db_xref="GOA:E3EGD5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGD5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308253.1"
FT                   /protein_id="ADO54163.1"
FT                   /translation="MSESIYVGVDLGGTAIKVGICNENGQLLHTYEGPTETDKGVDVVI
FT                   GNIEKYVRHIVEESPYEWDQLKGVGAGVAGFTNVRDGIIVLAPNIGFRDVPIRALLENR
FT                   IGKPVKIDNDANVAALGEAWAGAGKGIENCVCYTLGTGVGGGIIINGKIYQGSSGMAGE
FT                   IGHISVVPDLEAIQCGCGKMGCLETVSSATGIIRMAKDAVERGDRTSLALEDHIAAKEV
FT                   FDAAKAGDEVALRIVNRAAFYLGKSMAAVAAVLNPELFIIGGGVSKAGDFLFEEMRRVY
FT                   AKLAPEPLQKGVYIVPAVLGNDAGIVGAAGLLLRS"
FT   gene            207004..207903
FT                   /gene="yvcJ"
FT                   /locus_tag="PPSC2_00905"
FT                   /old_locus_tag="PPSC2_c0177"
FT   CDS_pept        207004..207903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvcJ"
FT                   /locus_tag="PPSC2_00905"
FT                   /old_locus_tag="PPSC2_c0177"
FT                   /product="glmZ(sRNA)-inactivating NTPase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00905"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54164"
FT                   /db_xref="GOA:E3EGD6"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGD6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279169.1"
FT                   /protein_id="ADO54164.1"
FT                   /translation="MTDNLKNAAPWATLIIITGMSGAGKTIAVQSLEDLGFFCVDNLPP
FT                   VLIPKFAELIEQSNGKIGKVALVIDLRGREFFTALSESLNYIKDHFTIHCEILFLNAND
FT                   GVLVQRYKESRRRHPLAPDGMPLDGIRLERKMLEELKSSATQVIDTSTMKPATLKARII
FT                   SRFSHLESSMLSVNITSFGFKYGIPIDADLVFDVRFLPNPHYVDQLRPHTGQDSDVYDY
FT                   VMKWPETQAFLTKLLDMLHFLIPQYRKEGKSQVIIGIGCTGGKHRSVAISEYLGKMLGA
FT                   SETESVSVSHRDADRDRH"
FT   gene            207916..208902
FT                   /gene="yvcK"
FT                   /locus_tag="PPSC2_00910"
FT                   /old_locus_tag="PPSC2_c0178"
FT   CDS_pept        207916..208902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvcK"
FT                   /locus_tag="PPSC2_00910"
FT                   /old_locus_tag="PPSC2_c0178"
FT                   /product="yvcK"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54165"
FT                   /db_xref="GOA:E3EGD7"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGD7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427874.1"
FT                   /protein_id="ADO54165.1"
FT                   /translation="MKETGSQRERPRIVVMGGGTGLSVMLRGLKQKPLDITAIVTVADD
FT                   GGSSGILRSELQMPPPGDIRNVLTALADVEPVMSDMLKYRFGAGSGLSGHSLGNLILAA
FT                   MTDISGDFVTAVRELSRVFAVRGRVLPAAEEGVVLSAEMEDGTVITGESKIPEAGGRIK
FT                   RVFLEPTHVEPLPEAVEAINEADAILIGPGSLYTSILPNLLVPKLAEAVVKSDAIKIFV
FT                   CNVMTQPGETDGYTVGDHLQAIYEHVGHHLFDYVIVNNGEIPPQVQEMYAEQGAKPVQV
FT                   DMGELADRGYKVVADTLVLFRTYLRHDADKLSQHIYQLVQNWMLRRR"
FT   gene            208908..209852
FT                   /gene="yvcL"
FT                   /locus_tag="PPSC2_00915"
FT                   /old_locus_tag="PPSC2_c0179"
FT   CDS_pept        208908..209852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvcL"
FT                   /locus_tag="PPSC2_00915"
FT                   /old_locus_tag="PPSC2_c0179"
FT                   /product="sporulation regulator WhiA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00915"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54166"
FT                   /db_xref="GOA:E3EGD8"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGD8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428149.1"
FT                   /protein_id="ADO54166.1"
FT                   /translation="MSFAAQTKKELTMIESQPCCEKAELSALIRMLGSVQLSNKRVILD
FT                   VSTENAAIARRIYSLIKKHFQLHIELLVRKKMRLKKNNVYIVRIPNGVQELLKELYIVS
FT                   EGFLFTDGINRDIIRKNCCKRAYLRGAFMAGGSVNNPEGSSYHLEISSMYEEHCQALVD
FT                   LANEFHLNARCIERKKGFILYIKEGEKIIELLSIIGAHQALFKFEDVRIMRDMRNSVNR
FT                   IVNCETANLNKTIGAAVRQIENIKLLEREVGLETLPDKLREVAEIRLAHPDLNLKEVGE
FT                   MLKGVVSKSGVNHRLRKIDEMADKIRGENGLIP"
FT   gene            209988..210257
FT                   /gene="crh"
FT                   /locus_tag="PPSC2_00920"
FT                   /old_locus_tag="PPSC2_c0180"
FT   CDS_pept        209988..210257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crh"
FT                   /locus_tag="PPSC2_00920"
FT                   /old_locus_tag="PPSC2_c0180"
FT                   /product="PTS sugar transporter subunit IIA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54167"
FT                   /db_xref="GOA:E3EGD9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGD9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018888156.1"
FT                   /protein_id="ADO54167.1"
FT                   /translation="MSKHPVVVRLKTGLHARPAALFVQEANKYSSEIFVEKEDKKVNAK
FT                   SIMGIMSLAISTGTEINISAEGADAEQAVNALVSLVSKVELENQ"
FT   gene            210530..211285
FT                   /gene="bp26"
FT                   /locus_tag="PPSC2_00925"
FT                   /old_locus_tag="PPSC2_c0181"
FT   CDS_pept        210530..211285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bp26"
FT                   /locus_tag="PPSC2_00925"
FT                   /old_locus_tag="PPSC2_c0181"
FT                   /product="bp26"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54168"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGE0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685794.1"
FT                   /protein_id="ADO54168.1"
FT                   /translation="MRVWTKTVSTAILAGALLAGGVAGGLWTGADRAYAATATTANGVI
FT                   NVSGSGEIMAKPDIAYLSIGVQSEGNTAAAAQKANAAKINKVTQLLKEKWSISADDIQT
FT                   SQFSVQPNYTYNEKEGQKLKGYMANHTLSVKYRNLDKIGQLLDEATNSGANNVDNIQFS
FT                   VENPSAYEEAAIAKALDNAQSKASAVAKSAKRGLGALVNVTVDGGEAQVYTQRENAMSK
FT                   ALMDMSGGTEIQSGQVTVKVQVSAQYEMN"
FT   gene            211523..212632
FT                   /gene="M1-323"
FT                   /locus_tag="PPSC2_00930"
FT                   /old_locus_tag="PPSC2_c0182"
FT   CDS_pept        211523..212632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-323"
FT                   /locus_tag="PPSC2_00930"
FT                   /old_locus_tag="PPSC2_c0182"
FT                   /product="cu amine oxid N1"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54169"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGE1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368813.1"
FT                   /protein_id="ADO54169.1"
FT                   /translation="MNKHTKKWGSALLAAGILAGVAVIPVSYIGAASTKQQQATTQQPG
FT                   IAIQWNGKTLAAKGIQVNGNTMIPVAALRDSLGIPVSYDTKEGTYTVGSGYNKLYIVVS
FT                   SSDAYVNVNGINTRSMDAKMIAGKLYIPMSLLKDYLGIDAQWNAAQKTVTLSKSQLNPI
FT                   TIASQTLPASSNAKVSYKIKYPQISGSQLNPEAQQTINNVLKKHAETVLAAGKKMVAEG
FT                   EVTAERPYDFENDFAIAYNKDGILSVIMQDYSYTGGAHGMTARKGYTFSLADGKLLQLS
FT                   DVLKANPNYKKFLNADLKKKIDALQAGEGFEKFKELAADQNFYVTNSGVTIVFDLYDYA
FT                   PYAYGIPEFTYSFAQLLPQGGKPFAGQNQ"
FT   gene            complement(212745..213341)
FT                   /gene="clpP1"
FT                   /locus_tag="PPSC2_00935"
FT                   /old_locus_tag="PPSC2_c0184"
FT   CDS_pept        complement(212745..213341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP1"
FT                   /locus_tag="PPSC2_00935"
FT                   /old_locus_tag="PPSC2_c0184"
FT                   /product="Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00935"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54171"
FT                   /db_xref="GOA:E3EGE3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGE3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368815.1"
FT                   /protein_id="ADO54171.1"
FT                   /translation="MSYVPMVVEQSNRGERAYDIYSRLLKDRIILLGSDVNDVVANSII
FT                   AQMLFLAAEDPEKDIHLYINSPGGSITAGMAIFDTMQYIKPDVSTICVGMAASMGAFLL
FT                   NAGAKGKRFALPNSEIMIHQPLGGAQGQATDIEIRARRILKMRDKLNRILADRTGQPLE
FT                   RIEKDTDRDYFMSADDAKEYGIIDKVLTSSSPEGV"
FT   gene            complement(213553..213624)
FT                   /locus_tag="PPSC2_00940"
FT                   /old_locus_tag="PPSC2_ct012"
FT   tRNA            complement(213553..213624)
FT                   /locus_tag="PPSC2_00940"
FT                   /old_locus_tag="PPSC2_ct012"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:213589..213591,aa:Arg,seq:ccg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            213884..214921
FT                   /gene="cggR"
FT                   /locus_tag="PPSC2_00945"
FT                   /old_locus_tag="PPSC2_c0185"
FT   CDS_pept        213884..214921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cggR"
FT                   /locus_tag="PPSC2_00945"
FT                   /old_locus_tag="PPSC2_c0185"
FT                   /product="central glycolytic genes regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54172"
FT                   /db_xref="GOA:E3EGE4"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGE4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368816.1"
FT                   /protein_id="ADO54172.1"
FT                   /translation="MRKILEIQKQLLPDLMDVLKKRYTILHQIMLSEVIGRRTLAASLD
FT                   MTERVLRAETDLLKAQGLIEIESVGMKVSKAGLDLLEQLEPIANNLFGLSQLEDQIRQA
FT                   YGLRKVVVVPGDSDASPLAKQELGRAGAKALLSVMDDEDVVAVTGGTTIADVAEQLTLP
FT                   ANGPLKGGWFVPARGGLGESMEMQANTIASTMARKVGAQYRLLHVPDLLSNHAYNSLLE
FT                   DTNIQDILSLIRESRIIIHGIGNAIAMAHRRKLDPETFAQISNEGAVAESFGYYFNEDG
FT                   VVVHRMLTLGLRLEDIRRTETVLGVAGGKSKAAAIHAVLRFGQEDILVTDEGAAAEIVS
FT                   RYLRD"
FT   gene            215014..216024
FT                   /gene="gap"
FT                   /locus_tag="PPSC2_00950"
FT                   /old_locus_tag="PPSC2_c0186"
FT   CDS_pept        215014..216024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="PPSC2_00950"
FT                   /old_locus_tag="PPSC2_c0186"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="NAD-dependent; catalyzes the formation of
FT                   3-phospho-D-glyceroyl phosphate from D-glyceraldehyde
FT                   3-phosphate; active during glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54173"
FT                   /db_xref="GOA:E3EGE5"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGE5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428155.1"
FT                   /protein_id="ADO54173.1"
FT                   /translation="MTVKVGINGFGRIGRLAFRRIQDVEGIEVVAINDLTDSKMLAHLL
FT                   KYDTTQGTFQGEVEVHDGFFKVNGKEVKVLANRNPEELPWGDLGVDIVLECTGFFTTKE
FT                   AAEKHLKGGAKKVVISAPATGDMKTVVYNVNHEILDGSETVISGASCTTNCLAPMAKTL
FT                   QDKFGIVEGLMTTIHAYTGDQNTLDAPHAKGDFRRARAAAENIIPNTTGAAKAIGLVIP
FT                   ELKGKLDGAAQRVPVPTGSLTELVTVLEKNVTAEEINAAMKEASDPETYGYTEDQIVSS
FT                   DIKGLTFGSLFDATQTKVLTVGDKQLVKTVAWYDNEMSYTAQLIRTLEYFAKLAK"
FT   gene            216148..217329
FT                   /gene="pgk"
FT                   /locus_tag="PPSC2_00955"
FT                   /old_locus_tag="PPSC2_c0187"
FT   CDS_pept        216148..217329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="PPSC2_00955"
FT                   /old_locus_tag="PPSC2_c0187"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="Converts 3-phospho-D-glycerate to
FT                   3-phospho-D-glyceroyl phosphate during the glycolysis
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00955"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54174"
FT                   /db_xref="GOA:E3EGE6"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGE6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368818.1"
FT                   /protein_id="ADO54174.2"
FT                   /translation="MNKKSVRDIELNGKRVFVRVDFNVPVEDGKITDDKRIRETLPTIN
FT                   YLIEKGAKVILASHFGRPKGQVVESMRLTAAGVRLSELLKKPVVKVDEAVGEAVKAKVA
FT                   ELQNGDVLLLENVRFYPGEEKNDPELAKQFAELADIFVNDAFGAAHRAHASTEGIAHFL
FT                   PAVSGLLMEKELSVIGKALSNPDRPFTAIIGGSKVKDKIDVIDNLLNIADNVIIGGGLT
FT                   YTFFKAQGHEVGQSLLDESKLDVALGFIEKAKKLGKNFYLPVDIVISDDFSATANTNIV
FT                   DIDGIPADWEGVDIGPKTRKIYADVIKNSKLVVWNGPMGVFEIEPFAGGTREVAEACAT
FT                   TDAYTIIGGGDSAAAAEKFHLADKMDHISTGGGASLEFMEGKALPGVVALNDK"
FT   gene            217389..218141
FT                   /gene="tpi"
FT                   /locus_tag="PPSC2_00960"
FT                   /old_locus_tag="PPSC2_c0188"
FT   CDS_pept        217389..218141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /locus_tag="PPSC2_00960"
FT                   /old_locus_tag="PPSC2_c0188"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="Reversibly isomerizes the ketone sugar
FT                   dihydroxyacetone phosphate to the aldehyde sugar
FT                   glyceraldehyde-3-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54175"
FT                   /db_xref="GOA:E3EGE7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGE7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018888163.1"
FT                   /protein_id="ADO54175.1"
FT                   /translation="MRTPIIAGNWKMFKTVPEAKTFIEEIKGKAEVAGVESVICAPFTN
FT                   LPALVEAVKGTSIKIGAQNLHFAEDGAFTGEISGGMLKDLGVDYVVIGHSERREYFNET
FT                   DETVNKKVHAAFRHGLTPIVCVGEKLEDREAGQTKEVVKVQTVAAFAGLAKDQAAQVVV
FT                   AYEPIWAIGTGKSSTSQDANEVISYIRSLIKELYDENTASAVRIQYGGSVKPENVTEYL
FT                   GQSDIDGALVGGASLQPASYIALVEGAK"
FT   gene            218143..219687
FT                   /gene="pgm1"
FT                   /locus_tag="PPSC2_00965"
FT                   /old_locus_tag="PPSC2_c0189"
FT   CDS_pept        218143..219687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm1"
FT                   /locus_tag="PPSC2_00965"
FT                   /old_locus_tag="PPSC2_c0189"
FT                   /product="phosphoglyceromutase"
FT                   /note="catalyzes the interconversion of 2-phosphoglycerate
FT                   and 3-phosphoglycerate"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00965"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54176"
FT                   /db_xref="GOA:E3EGE8"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGE8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428158.1"
FT                   /protein_id="ADO54176.1"
FT                   /translation="MTAPKPVALIIMDGFGLRDTVEGNAVAQANKPNYDRYLKQYPHTT
FT                   LTASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQDLTRISKSIREGEFFDNETLVKAVQH
FT                   AKKNNTKLHLYGLLSDGGVHSHISHLFAMLDLAKKEGLTEVYIHAFMDGRDVMPDSGVG
FT                   FMQQLVAKIQEVGIGQIATVQGRYYAMDRDKRWERVEKSYRAIVYGEGPQYTDPLEALK
FT                   ESYEKSVFDEFVEPTVIVKADGSPVGLVESNDSVVFLNFRPDRAIQLSQVFTNEDFRGF
FT                   DRGPKWPKDLHFVCLTLFSETVGGFVAYEPKNLDNTFGEVLVQNNKKQLRIAETEKYPH
FT                   VTFFFSGGRDVELPGETRILINSPKVATYDLQPEMSAYEVADAAVKEIEADKHDAIILN
FT                   FANPDMVGHSGMLEPTIKAVETTDECVGRVVDAVKAKGGVVIIIADHGNADMEIDEQGR
FT                   PFTAHTTNPVPFILTDENIVLREHGILADVAPTLLDLMQLPQPAEMTGKSMIASRK"
FT   gene            219751..221037
FT                   /gene="eno"
FT                   /locus_tag="PPSC2_00970"
FT                   /old_locus_tag="PPSC2_c0190"
FT   CDS_pept        219751..221037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="PPSC2_00970"
FT                   /old_locus_tag="PPSC2_c0190"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="catalyzes the formation of phosphoenolpyruvate from
FT                   2-phospho-D-glycerate in glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54177"
FT                   /db_xref="GOA:E3EGE9"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGE9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018888165.1"
FT                   /protein_id="ADO54177.1"
FT                   /translation="MTIISDVYAREVLDSRGNPTVEVEVYLESGAIGRAIVPSGASTGA
FT                   HEAVELRDNDKSRYLGKGVLQAVKNVNEIIAPEVIGLDAVNQVEIDTLMIKLDGTPNKG
FT                   KLGANAILAVSMAVARAAAEALGLPLYTYLGGFNAKQLPVPMMNIVNGGAHADNNVDVQ
FT                   EFMVLPVGAPTFKEALRVGAEIFHNLKSVLNSKGLNTAVGDEGGFAPNFKSNEEALSTI
FT                   IEAIEKAGYKPGVDVFLGMDVASTEFFKDGKYTLEGEGKSFTSAEFVDLLASWVDKYPI
FT                   ITIEDGCSEDDWEGWKLLTEKLGNKIQLVGDDLFVTNTERLAKGIDENIGNSILIKVNQ
FT                   IGTLTETFDAIELAKRAGYTAVISHRSGESEDSTIADIAVATNAGQIKTGAPSRTDRIA
FT                   KYNQLLRIEDQLGELAQYHGLKSFYNLKK"
FT   gene            221363..221596
FT                   /gene="secG"
FT                   /locus_tag="PPSC2_00975"
FT                   /old_locus_tag="PPSC2_c0192"
FT   CDS_pept        221363..221596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="PPSC2_00975"
FT                   /old_locus_tag="PPSC2_c0192"
FT                   /product="preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00975"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54179"
FT                   /db_xref="GOA:E3EGF1"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGF1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428160.1"
FT                   /protein_id="ADO54179.1"
FT                   /translation="MEIFLKVLLVVFSIAVIAVVLLQKGKSAGLSGAISGGAEHLFGKT
FT                   KARGMDLILQRVTAVLGACFMIVSVLVAFFAK"
FT   gene            221785..224394
FT                   /gene="vacB"
FT                   /locus_tag="PPSC2_00980"
FT                   /old_locus_tag="PPSC2_c0193"
FT   CDS_pept        221785..224394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="PPSC2_00980"
FT                   /old_locus_tag="PPSC2_c0193"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54180"
FT                   /db_xref="GOA:E3EGF2"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGF2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820127.1"
FT                   /protein_id="ADO54180.1"
FT                   /translation="MITEQQLLDFMRETAYKPMTYQELEQHFDIKDAEEFREFLKLLNA
FT                   LEEDGKILLTRTNRYGVPERMDLQRGRLQAHAKGFAFLIPEDREHPDVYIHANDLKSAM
FT                   NGDTVLVRVTSKGPAGGRLEGEVVRIVKRAVLQVVGVFQSHEAYGFVLPDDKRINRDIF
FT                   IPKDSFNGAVNGQKVVVRIVSYPEGRAAAEGEVLEVLGHKDDPGVDILSVIRKHQLPEA
FT                   FPDEVMAEADQAPDAITEEEIIRQGRRDLRDRIIVTIDGEDAKDLDDAVNVERLPNGNY
FT                   RLGVHIADVGYYVRENSKLDLEAYNRGCSVYLVDRVIPMLPHRLSNGICSLNPQVDRLT
FT                   LSCEMEFNEHMKVVKHDIFTSVIKTKERMTYTNVRKILEEEDAELMERYKDLVDVFRTM
FT                   KDLALKLRANRMRRGAVDFDFDEAKVIVDDEGKAVDIVKRDRTIAEQIIEEFMLAANET
FT                   VAEHFHWLKVPFLYRIHEDPDPEKLQNFMAFAANFGHQIKGRGNSIHPRALQTLLEDIQ
FT                   GTKEQTVLSTMMLRSMKQAKYDAESTGHFGLAAEYYSHFTSPIRRYPDLVIHRVIREVL
FT                   ENGGALTDERQEYLTARMPDIAQQSSERERVAVDAERDTEQMKKAEYMLDKVGEEFEGI
FT                   ISSVTSFGMFIELDNTVEGLTRLSALTDDYYHFDEQHMALIGERTSKVFRIGDEVKVRV
FT                   ARVNMEDYTIDFELVDMKQRQRRERTGGSGQGGDFARGEGRAKGRGREGRDRKGGKDKA
FT                   GRERKGGREAAGKPKEGGNGGISTTGRAGRGGGNGVGTGSPGSFGFGSGKGGYNSPATG
FT                   ASKRRKKTSASGIFIGDAATPGSDARPGGEGAARRKRKKKGANGGNSTAGFVRKKKK"
FT   gene            224658..225137
FT                   /gene="smpB"
FT                   /locus_tag="PPSC2_00985"
FT                   /old_locus_tag="PPSC2_c0194"
FT   CDS_pept        224658..225137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="PPSC2_00985"
FT                   /old_locus_tag="PPSC2_c0194"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00985"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54181"
FT                   /db_xref="GOA:E3EGF3"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGF3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007132695.1"
FT                   /protein_id="ADO54181.1"
FT                   /translation="MGKKADGKVLAQNKKASHDYFIEDTYEAGMVLTGTEIKSLRNGRS
FT                   NISDAFATIRNGEIHIHNMHISPFEQGNRNNPTDPTRTRKLLLHKEQIRKLIGLSKQEG
FT                   YTIVPLKIYVRNGYAKLLLGLGRGKKQYDKRETAAKRDAQRDIQRALREKQKIAR"
FT   gene            226376..227050
FT                   /gene="M1-334"
FT                   /locus_tag="PPSC2_00990"
FT                   /old_locus_tag="PPSC2_c0195"
FT   CDS_pept        226376..227050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-334"
FT                   /locus_tag="PPSC2_00990"
FT                   /old_locus_tag="PPSC2_c0195"
FT                   /product="M1-334"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54182"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGF4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368825.1"
FT                   /protein_id="ADO54182.1"
FT                   /translation="MNYMDEHILSLKNKLNHDAASNNVNTNLSQADVPGQDNSVAEQNR
FT                   VLRMGDELIPLEWKTILDGQVAVSIPKLFSLMPLEQAKFKYPSEHRPQVIYTSLEGTVN
FT                   ITFNSTESALEVDELPEFVEQMADVLRSVQPVRNWIGTEMIMNPYGLSIGMIRFVAAGV
FT                   DTNLYNEMLLFVHEGQVTMGTFNCMESDMEAWLPVAENTVQSLHIVPSPSDSTFEKGVA
FT                   FL"
FT   gene            227047..228462
FT                   /gene="M1-335"
FT                   /locus_tag="PPSC2_00995"
FT                   /old_locus_tag="PPSC2_c0196"
FT   CDS_pept        227047..228462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-335"
FT                   /locus_tag="PPSC2_00995"
FT                   /old_locus_tag="PPSC2_c0196"
FT                   /product="M1-335"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_00995"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54183"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGF5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685800.1"
FT                   /protein_id="ADO54183.1"
FT                   /translation="MSLGYDQIQIYPFELVELEQLTLTKKINEHTRLYFTGIIPEDMQD
FT                   SYVETTEKNTVIQVSQRNESGESKPLFSGIALSVEVKVVRDVYYLEVEAISHTYRMDIQ
FT                   QRTRSFQYTKMTIPQMLEQIGKDYEGLDVIDGATGGEQIGRLAIQYQETDWAFLRRMAS
FT                   RYHTSLMPVARFDSPKFYFGIEDSPAQVVLDHTRYTVRKQMLPFRYFQENEQAKVTEND
FT                   FIFYEVETDEVLDLGAQMTFQGHSLYVVEAYTEMRQGLLRHQYVLASYKGLRQKSYYQE
FT                   KLAGASLSGMVVDIRQDQVRIHLDCDEKQDVDKAHWFNYSTVYSAGGHTGWYVMPEKGD
FT                   PVSLYFPGSREEDGIAGSAVRRAGRGGGHNKFSNPQMKIWRTPHGKEIRLGPDELVVTG
FT                   KDGAIFIKLDDKEGIHIVSSKQVSISAGGNLSLSAGKTMSLSAGSELRMDCNGSHIQLS
FT                   GSADMKGSEVKSN"
FT   gene            228525..229817
FT                   /gene="M1-336"
FT                   /locus_tag="PPSC2_01000"
FT                   /old_locus_tag="PPSC2_c0197"
FT   CDS_pept        228525..229817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-336"
FT                   /locus_tag="PPSC2_01000"
FT                   /old_locus_tag="PPSC2_c0197"
FT                   /product="M1-336"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54184"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGF6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368827.1"
FT                   /protein_id="ADO54184.1"
FT                   /translation="MEKPIDELNPQQQVILNQAWFLIRRDWALKFKAKQGQRIQACVEE
FT                   FRGYCRDIRQEQLQGRKGKIGYITYSMLRTTWLEERPTYLVEAANALWVLDPEPIRFEW
FT                   DTSWTYSYWTDLQQKLRREVEKQHVSLPELEWEQVMLEAAVHIHVLVVNMMRLAIKKAM
FT                   CLPEFQELDREETFEIRVGEYMDHTISVYKEDRRALEASEIRSWLEEQEEHAYSYQALE
FT                   KIQLSDGDYSQLDFRYTAFRQIEMEHSRLHGCVLVGTMWEESQLDGIDLTYSLLHGADF
FT                   SGCSMKGAILDAVMGNAGYGSDAALDWEPLGFAGVDFTRASLQGARFQDAQLREAVFQD
FT                   ASLQRAFLNGADLTDACFAGADVSGASFKGACLIGADFTGANVQGAMFTDAQRRGAIGL
FT                   EWAILEASLSHKEPSASVQARDAAGKREWLH"
FT   gene            229832..230332
FT                   /gene="M1-337"
FT                   /locus_tag="PPSC2_01005"
FT                   /old_locus_tag="PPSC2_c0198"
FT   CDS_pept        229832..230332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-337"
FT                   /locus_tag="PPSC2_01005"
FT                   /old_locus_tag="PPSC2_c0198"
FT                   /product="M1-337"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01005"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54185"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGF7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368828.1"
FT                   /protein_id="ADO54185.1"
FT                   /translation="MVDERVKHRVEPAALSPLQVEDILTGAQGQQDDPLFLAVYTDPRT
FT                   VYPDFLEYPLPLVSDRMKALLEKYMPGLEWRAAILTDFQQARQEVYWVLRPPKMDRLSA
FT                   QTEWYPNETLKRLILRQGEMESPVFRIVGLIEPHIYIHLAVAESLLRRSFTGIRVQRIE
FT                   MEH"
FT   gene            230348..230764
FT                   /gene="M1-338"
FT                   /locus_tag="PPSC2_01010"
FT                   /old_locus_tag="PPSC2_c0199"
FT   CDS_pept        230348..230764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-338"
FT                   /locus_tag="PPSC2_01010"
FT                   /old_locus_tag="PPSC2_c0199"
FT                   /product="M1-338"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54186"
FT                   /db_xref="InterPro:IPR025460"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGF8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368829.1"
FT                   /protein_id="ADO54186.1"
FT                   /translation="MGEAQVKPGTGAKKSYVVAGAILSCSYGTQPTRLKRPFSHGVYVK
FT                   NKAQMNIGDYVPGVNIQSFGNCSSPLNPAVQASEMVDIYGVKKAPCIPVLTMPWLNGKS
FT                   DVKIEGQPALTQNCTHQCLYCGHIQIENDGQELD"
FT   gene            230840..233950
FT                   /gene="M1-339"
FT                   /locus_tag="PPSC2_01015"
FT                   /old_locus_tag="PPSC2_c0200"
FT   CDS_pept        230840..233950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-339"
FT                   /locus_tag="PPSC2_01015"
FT                   /old_locus_tag="PPSC2_c0200"
FT                   /product="M1-339"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01015"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54187"
FT                   /db_xref="GOA:E3EGF9"
FT                   /db_xref="InterPro:IPR033806"
FT                   /db_xref="InterPro:IPR040559"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGF9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368830.1"
FT                   /protein_id="ADO54187.1"
FT                   /translation="MSVLQNGIGYESLRFYGSFQPQHIEKLQITRAINDHAYLMVSGML
FT                   SEEQGAVCIGQNMEDEPIVILQLDEQGQSLRRLFHGIVTRLSVHCTRGVYTFELEAASH
FT                   SYQMDIKLKKRSYQDIHRTYDDLVTAMVRKYQYGDAIDTVTNYAKLDTFVLQYEETDWA
FT                   FLKRLASRFGSVLVPEVTAASPKVFFGMPEGKPYKVERDVFYRVRKTFHELDEGKPGER
FT                   AGSYVTYVIESLLYVALGDLITLPIGSGKELVVVRAVTRLEDGLLLTRYDLQAEQDIRY
FT                   ARYENDQATGITLTGSVLKVQQDFIQLQLDIDPKQDLAKACWFPVATRYVAEEHSGWYD
FT                   MPEIGERVELYLPTSREHEAYVADSLRQHRYTMGQPDVKAWRHAQGSGVDMSKQELTLS
FT                   TSGAFSIALHEGSGITVSSPGNVQIQGGHVQLDAGQELSLEAGSALYLKGGASSMVLDG
FT                   ETDIKAPVIDQEGTVKAPVFVMDLPPVPEPPLMNIKAYEAAQSAAAKASSNSTAKPPTA
FT                   KITSPTAQKKADALLGTVSKLLGSIPVVGVVAGVAMGAASLIGPMGIAAGSILLATAAI
FT                   PVRSTGTSRAGGGGAKGGLHPLKYLANLALQGLISQYEHEQARDAYYKKWILGKVFTSA
FT                   RELGLPTSLEDIVPYIRKLANEVGEAYQQIPADLRQRWKVNSENYMAQQLEPKKEEKEQ
FT                   SWWDLMAEAQFQNSENEAIMAKQMANELEYAADVSGEVVLGSASAVVTDYSYGLMNKEY
FT                   ASDHPKARKTGEVIGHALTTVAGAVETVGAVGEGFLGGLITTTGVGAPVGVLAMAQSAF
FT                   MGVQGTTVMYTGASNSVESTKDLYRMFESEGPSPNRSTPSKPSSSKSGKSEGTPSSQKP
FT                   SKPNEKPTGTKGTGNVNLTEPSLPKGGKPKGNYTKGDSHGIKKESETADLMADQGYDIE
FT                   MLDEVNGGNGYGIKESSNPDFLIEGKVFDCYAPTIETNVDNILRNITKKTKTQAERIVL
FT                   NVDQFPSEKVAEIIQGILRKANPNGDLKNLKELSIVKDGEITRVFGG"
FT   gene            233957..234430
FT                   /gene="M1-340"
FT                   /locus_tag="PPSC2_01020"
FT                   /old_locus_tag="PPSC2_c0201"
FT   CDS_pept        233957..234430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-340"
FT                   /locus_tag="PPSC2_01020"
FT                   /old_locus_tag="PPSC2_c0201"
FT                   /product="M1-340"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54188"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGG0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368831.1"
FT                   /protein_id="ADO54188.1"
FT                   /translation="MDYELFLLSNVGINSLGEMMERFTTEYANKKASLSCNDEEIVIGS
FT                   ELFSLALEIEDISDIAFVRNHYNLDVNVCIRIQLFGNTFHQGLELLFKIMGRLIRHIDG
FT                   NLLFLEDGSAQLLRIEDGQLIVNNTLDQYQTKYLTTSLLSLLDRPYIEKELSN"
FT   gene            234943..235272
FT                   /pseudo
FT                   /locus_tag="PPSC2_01025"
FT                   /note="hypothetical protein; disrupted"
FT   gene            complement(235936..237756)
FT                   /gene="M1-341"
FT                   /locus_tag="PPSC2_01030"
FT                   /old_locus_tag="PPSC2_c0202"
FT   CDS_pept        complement(235936..237756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-341"
FT                   /locus_tag="PPSC2_01030"
FT                   /old_locus_tag="PPSC2_c0202"
FT                   /product="M1-341"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54189"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGG1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368832.1"
FT                   /protein_id="ADO54189.1"
FT                   /translation="MIIEKDLLALSDVAKLCGTSNSNVSNWRTRDSNFPDPFTETSAGP
FT                   IWKAEDIVTYLRKKFDDGYDVISTGNISSKRMAIIGRARGGKSFLISRFVSDRTGFVKL
FT                   FCGNSADKTACPIYIKISEYITLEYYVFHTDFNSIYLADDNDDELKKLRERVSSLVDQP
FT                   YWQDNIEKMVEIEGVIREIRAVEDRYPNRKNSNTYIDTFQRPSTFCKEILRECGLGSIE
FT                   IVDTPGVSGNVEASKIAKSDIYLFLLKPENSDESQTLRKIVTEIKADVATSKAVFLYKK
FT                   EAILFTKQEYEDERLSIRKDMAAFSELFKDFKGNIISTELDVLDPASHCILFPTMSRDR
FT                   ITLPEELFLEDIKGKLLEAFKPEDESSKDNEFKKIVSKLGGKAEEFALNIMRNIPVHGL
FT                   GADEKEYSVEQVIAEQHDRVMTKDNYRLRNDLDCAYSRESSILDNYFSSFTAADHPEEW
FT                   QQIIIKYVHKKLTTSVRTDRGLGVGTHHWEERPARTMLIEESILADRILAKILDKDERY
FT                   RNEPYRMAFKESNITSATWNYVGCINDNDAVTKLKIIKECLLNVSVSYREEMVLCRYVG
FT                   GLRKIAEYKILENMGYKKDKCMEELKTMPF"
FT   gene            complement(237995..238708)
FT                   /gene="queE1"
FT                   /locus_tag="PPSC2_01035"
FT                   /old_locus_tag="PPSC2_c0203"
FT   CDS_pept        complement(237995..238708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queE1"
FT                   /locus_tag="PPSC2_01035"
FT                   /old_locus_tag="PPSC2_c0203"
FT                   /product="7-carboxy-7-deazaguanine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01035"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54190"
FT                   /db_xref="GOA:E3EGG2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017742"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGG2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368833.1"
FT                   /protein_id="ADO54190.1"
FT                   /translation="MSKLPVIELFGPTIQGEGSVIGLKTMFVRLYGCDYKCSWCDSAFT
FT                   WDGSSKSSIQRLTSLEIIDKLNSIGLDGCTYVTISGGNPALYNEPLYDLISELHKRSKK
FT                   IIVETQGSIWKDWFNDVDILTISPKPPSSLMTTDWKVLRFIFANLQHSKVSLKVVIFDE
FT                   TDYLFAKKIQVLFPDIPLYLQVGNAEVTRSECIAGQLLNKLEWLFNLVINDPELQTARV
FT                   LPQLHTLIWNNERGK"
FT   gene            complement(238701..239183)
FT                   /gene="ygcM"
FT                   /locus_tag="PPSC2_01040"
FT                   /old_locus_tag="PPSC2_c0204"
FT   CDS_pept        complement(238701..239183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygcM"
FT                   /locus_tag="PPSC2_01040"
FT                   /old_locus_tag="PPSC2_c0204"
FT                   /product="6-pyruvoyl tetrahydrobiopterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54191"
FT                   /db_xref="GOA:E3EGG3"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGG3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368834.1"
FT                   /protein_id="ADO54191.1"
FT                   /translation="MKNEVSVCKIFQFDAAHQLIGHNGKCANVHGHTYKLEVVIRGKAY
FT                   GPEDVSNEGFVMDFSDLKKIVNEVIIDKFDHAFLAAGNEPVLQTLESTGSKICIVGCRT
FT                   TAENMSKYICFELIKANLPVWSIKLWETPTSWVEVFASDIDHKGPFYVQSGVCDYE"
FT   gene            complement(239180..239839)
FT                   /gene="queC"
FT                   /locus_tag="PPSC2_01045"
FT                   /old_locus_tag="PPSC2_c0205"
FT   CDS_pept        complement(239180..239839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="PPSC2_01045"
FT                   /old_locus_tag="PPSC2_c0205"
FT                   /product="7-cyano-7-deazaguanine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54192"
FT                   /db_xref="GOA:E3EGG4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGG4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368835.1"
FT                   /protein_id="ADO54192.1"
FT                   /translation="MNKKALVVFSGGQDSTTCLLWALKEYDEVQTVSFQYGQRHKLELE
FT                   CASEIAKELNVKHHVLDLNLLNQLAPNALTREDIEIEAGSEGALPNTFVDGRNMLFLSF
FT                   AAILAKQLGYYHIITGVCQTDFSGYPDCRDVFVKSLNVTLNLSMDYNFVIHTPLMWLNK
FT                   KQTWELADQLGHLDFVRTKTLTCYNGIIGDGCGECPACLLRRAGLEQYLQERGNTL"
FT   gene            240115..240657
FT                   /gene="M1-344"
FT                   /locus_tag="PPSC2_01050"
FT   CDS_pept        240115..240657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-344"
FT                   /locus_tag="PPSC2_01050"
FT                   /product="M1-344"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01050"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44174"
FT                   /db_xref="GOA:A0A0D5ZC73"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZC73"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368836.1"
FT                   /protein_id="AKA44174.1"
FT                   /translation="MKYLVILLYLTAIVTANVVTAGTNPIQLGIFIIPAGSFIIGATFI
FT                   LRDFVQIYVGRRTVYILIIMAMILSGVTSYLLGDGLWITFASVLTFLVSETTDTEIYTR
FT                   LKFPFYLRVMYSGIVGGFLDSIIFVVVGLSPLGANFIPWNAVIYAILGQIIVKTVVQLL
FT                   ASGVIRLALNKRLERFN"
FT   gene            240742..242796
FT                   /gene="tgtA"
FT                   /locus_tag="PPSC2_01055"
FT                   /old_locus_tag="PPSC2_c0207"
FT   CDS_pept        240742..242796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgtA"
FT                   /locus_tag="PPSC2_01055"
FT                   /old_locus_tag="PPSC2_c0207"
FT                   /product="queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54194"
FT                   /db_xref="GOA:E3EGG6"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGG6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368837.1"
FT                   /protein_id="ADO54194.1"
FT                   /translation="MEKRILVVTSCTGEKVSKPENQLLFEDFQDANRLHQRESELSPYR
FT                   TTAKDMYTGSQHLALMEGINLYREYGGKIDVNIISAGYGLLSENEEIVPYEVTFNNMNS
FT                   QTIKNWSKRQRITETLQERIREYDLVFFLLGDKYLQSVEWPLSISSQQRLFFFAGNSSR
FT                   TRVMVEENYHLLSIGEDEAKVFRFGLIGIKGFLFAQLLKQASAVGHHKIWEDLYLNPAK
FT                   VRDYVMESFASKDKQLTLSDFSEKENRVDSLKASNLLNFYSELFPVPDSLIAINYKAEL
FT                   NFFLPENDDRVDPNYDFINDVSHKDRNPLLHDVYSHQIYGTPQYDGLLVSKVNIDNATK
FT                   QKVQLIKEMGGIHKFLHLPEDFPIMGDCGAFSYISNEVPPYTTKQIIDYYDELGINYGV
FT                   SVDHLVVGPFKKDLDTRQFRYELTLKRAEEFIVEYRKGTHKFHPIGIIQGWDPQSFKEA
FT                   ALHLINLGYDYIAIGGLAREQSGKIYEILREISPIIPNEKFRLHLFGVARDIRTMRSFH
FT                   KLGVTSFDSSSPLRRAWLGTGHNYHALSGKHYTAIRIPEAKETSGRVKKMVQEGKGEFL
FT                   QYKELEQSALKALRAFSNGELGLEEALSAILRYDELLGEKREVHEDLYREVLAERPWET
FT                   CGCEICKTIGIDTIVFRGNNRNRRRGFHNTHVYHEQVKALRKSLDIPHG"
FT   gene            242890..243681
FT                   /gene="tgtB"
FT                   /locus_tag="PPSC2_01060"
FT                   /old_locus_tag="PPSC2_c0208"
FT   CDS_pept        242890..243681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgtB"
FT                   /locus_tag="PPSC2_01060"
FT                   /old_locus_tag="PPSC2_c0208"
FT                   /product="tgtB"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54195"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGG7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368838.1"
FT                   /protein_id="ADO54195.1"
FT                   /translation="MQFSIDEVRRLNRNNDTVFFSVNTLHKLRLWNFPVINTATFNQNV
FT                   VTVSYEEMISQTTDRIQVSNPVFLYPLPEGEEGDEYVTLFVSSKHYLAEYCEKVTLSYD
FT                   FINRIVERKDKLSSNSTKLLTLHSFQGILKMFNDVKIKNEEWPNYCSDFIQYLKCLIKE
FT                   YPFLGYLPIAERKDFREKSVADMSFAWEFYIKFFVDEWSSKDYVVKIPNLSKPFHHMSW
FT                   TGDFFQRDNPFWQSYLSVNGKFRFHRAVRESIYQIWKEWIE"
FT   gene            243792..244721
FT                   /gene="tgtC"
FT                   /locus_tag="PPSC2_01065"
FT                   /old_locus_tag="PPSC2_c0209"
FT   CDS_pept        243792..244721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgtC"
FT                   /locus_tag="PPSC2_01065"
FT                   /old_locus_tag="PPSC2_c0209"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01065"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54196"
FT                   /db_xref="GOA:E3EGG8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGG8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368839.1"
FT                   /protein_id="ADO54196.1"
FT                   /translation="MQFYVGWSHSDAIFTDYYPDCSILVSAVPDNKGTIGRFKTKPKKL
FT                   ILDCGSVYYVKQETRPSLKDIFQIQISFLESCDPYEAYMVHFDEPMLNKTSLSERYMAM
FT                   EKTLFNAYEYMNLFNSKNFPRHVVPMGVIQGYDRASIEFSAKELSRIGYRSFGIGSLLS
FT                   QNQNKQIEMINYAADIVGSSNLHVFGVTGVPQMQAMINIGVKSFDSTRPTMAAAFFQVF
FT                   YSRPFKTFFLSKSHAKLSSPRLSEPLPCNCPVCQINAYDLFIPSPRKHMRLRSIHNYYH
FT                   LSIVINDLLKEKNGGEAYALPDVLWTRN"
FT   gene            244687..245451
FT                   /gene="M1-348"
FT                   /locus_tag="PPSC2_01070"
FT                   /old_locus_tag="PPSC2_c0210"
FT   CDS_pept        244687..245451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-348"
FT                   /locus_tag="PPSC2_01070"
FT                   /old_locus_tag="PPSC2_c0210"
FT                   /product="M1-348"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54197"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGG9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368840.1"
FT                   /protein_id="ADO54197.1"
FT                   /translation="MLFQMCYGPEIESIYETIREQSGIKINTLREYYQYTEEGDITSLI
FT                   EGVITILLDLHFIRKEEGVLFAVEDKEWSNKEVFKRLSKISLSQNEDEESLNYIFSSLY
FT                   NQVFVKQDKMFETNIHYHVNKNFTKTMIGHEKINAWKRMMESWGLGRRVYTGFYALPHI
FT                   SLLQEIVEEVGEWEGALHLFCEEKIHPVLPCITSEGMIFRGAIFGLMGLQHKSLEISYK
FT                   QDLPFKSYGPNQEWNWIQLKKKQGDNDDTMSK"
FT   gene            245432..248611
FT                   /gene="M1-349"
FT                   /locus_tag="PPSC2_01075"
FT                   /old_locus_tag="PPSC2_c0211"
FT   CDS_pept        245432..248611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-349"
FT                   /locus_tag="PPSC2_01075"
FT                   /old_locus_tag="PPSC2_c0211"
FT                   /product="M1-349"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01075"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54198"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3EGH0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368841.1"
FT                   /protein_id="ADO54198.1"
FT                   /translation="MIPCLNKDALKLLVGTADERYNYSPDYFQKTHFPQVMHRYHGNQL
FT                   LEEITENELFKNLLEVDAEGNRVFFLFGSTGSGKSELLCWIKDKWQLHEVNRPVVRISR
FT                   TELNPQVLIKKCYAAIGIPLGISIDETRWDLLLKKPITLINQIVWSTLSEILPTDEEIV
FT                   PTALLIRPVIEKNVTEFILQVQNGRIKKPLEVLHQNQFDDLISNTTLQIPIDYSLLRKK
FT                   LSQKLDQFLFEGKDIASLFKELTEQIKRMNIRPLLLIDDLVQSVNIYATDLLDQIITLE
FT                   EGKWDVVIGLTPGVVRDTDKGFDLTQRIQNLDTITDRVKKLWLSDESGKDFYNLDRSQV
FT                   SSYMSNYLVQLKASQGFACGNQCPHYWECKGYSISEEEEVDDEKIVQEVNLLPFNRHLI
FT                   RRTFDAIPVGKGKLRYMILNSKEIIRFFQNGKREKISRVLPLVKREKFSDHPELFIKTY
FT                   AEWYVPEEKDECLIPQKILRYFGYLDEEVKVSLNTLETKSEINSVLMTKGDPQQPNVVK
FT                   SSVRDWVEGKKVNPELLDSVRLGVSSLIHEVVKGVNMSLPSTPRMTSTIQRRSVVNRTR
FT                   YPITLDSKGTGIRSIVVKRGFAALQISNFQSLKYSEKARVFQQIANEYETARWIYNSED
FT                   IKRSWHCELEKGLGMSIDSFVYLLKNWAETCLEIGNARWSSEVQKQFHLTQDVLNLIEE
FT                   SYKDWHLLRDNLIRFPKSNGKRELAFEFDLWLESYQPVKELEQYQIGEESLYVFLLRLK
FT                   NNYLTYLGLLDKYLKQKIQTAKGMLPFLLGSRNKKYLLHAERIRGFDVTTTYTLQDYLN
FT                   YSEFEESLEQEGIMNRFSVNASLYRDVMDLSKQFESVCLEVEKQMGEFNKILSEDWSND
FT                   RPDWSKLSIEKEELIKTIDDLSMLIHCLSISRNAWTQVLRSNHVIDDVKLVKAIWARLV
FT                   QTAKQLVRRKGANLDIQNNIVEWQSIDFYELKTRLEVMDIREFEQQNVIKHLKNDLGCE
FT                   GVKSLDDLIMKIELNDDLRPSVKRHLKLLLEQGSTTLPPMQWKRLLDELKMRFPALFEV
FT                   VEIRLVASGCK"
FT   gene            248808..251675
FT                   /gene="M1-350"
FT                   /locus_tag="PPSC2_01080"
FT                   /old_locus_tag="PPSC2_c0212"
FT   CDS_pept        248808..251675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-350"
FT                   /locus_tag="PPSC2_01080"
FT                   /old_locus_tag="PPSC2_c0212"
FT                   /product="M1-350"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC56"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368842.1"
FT                   /protein_id="ADO54199.1"
FT                   /translation="MLTLFTYSNQRPAESQVRDLIIKGRSYTYLTATMAIAIQREKDGL
FT                   IPAEQVFQDDEGKDRKKALFADVLREWTKREYLLAPRGEAKTMLFRAMDEVSKDDISLR
FT                   NLLRHDFMSWSRLLYDLAAQGIDLRIEELSKIKKDQLVNPKIEDYLKEIQKTFYDNLRR
FT                   ENKKIFEQAIREYLKNNQITTDIVIMEGFTFLTDLQKWFIEQCEKQGKEVFFLAPYNDN
FT                   QKQAYQIIRNTYDFIWAGRSSIKTSELSTKEDIEYIQKKLFSDSETQIFPKQVENVSLR
FT                   QFVNRDRELQGCLEQIEKWFSEGLYQPEEIVIVTRRAKEFNDRFQDYLSMNPLEFTDQD
FT                   GNKHLVTLPINPRLLLLTPVGRFILNLYQLWHEEGFLLESNEFESIIASGWLGASIQDS
FT                   TSLFRAAKNQYFTACKTKEEWIEKLEQLERYSEETDDVRLPTKLIDSETVRNWIKVVKM
FT                   LESVCFRLFSNKKSPVAEHIEKLQEQLNEMLPEDIRKSEKEVLEKIREVFDELSNYYSI
FT                   DLTTTEFGDALHAITRGESDNEDEEEQEKSNVTSHNLRIVIPETLDGMQFKAVIYVGCD
FT                   NVHAPVLYPEPWPFYGDGRREHLYKERYMFLTVVKSVQENLVISYAQKDGDHSFQPSTY
FT                   FQEIERILGANREKRALLDTLDVSKAPEDIKQSKARSAKRKEYSLSEIAHYGLCPLRYR
FT                   LEMLHPEVRMYRNGWQLEIYAQGVWLNRIFSLIERNKEEKPYSLPTSQFLMKYMQSSKE
FT                   GMLKLFPAFGSITWHSIENQVKNQILYFEDVTKHYFKGVKKGKKESFRVMLSGTNEERT
FT                   VKINLDVPFIADRTKIQSPLINYLQTEEWLLPGSIKDEKGGNGTVEDIDIEGVSLFPTQ
FT                   KRAVDWWRDTINSYYMVEVEKKSGSNWYTNKLEKHYSGVREKIVHWINNIESSNFPKNT
FT                   GDHCKSCPVRLECLGITVAKEDFTE"
FT   gene            251672..253915
FT                   /gene="pcrA1"
FT                   /locus_tag="PPSC2_01085"
FT                   /old_locus_tag="PPSC2_c0213"
FT   CDS_pept        251672..253915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA1"
FT                   /locus_tag="PPSC2_01085"
FT                   /old_locus_tag="PPSC2_c0213"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54200"
FT                   /db_xref="GOA:E3EC57"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC57"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368843.1"
FT                   /protein_id="ADO54200.1"
FT                   /translation="MSILRGGISVSEEQAAIVDSVRDTEKITIVSAGAGSGKTRTMVAT
FT                   VLQLIDDGEVNIDDFALITFTNKASDEMRERLENGVYDRVKEAEKNNDFTQRTRWIEQK
FT                   ERIASTFIGTIHKFCTMLLLNFGYTEHIAHESQILMAKHYFKTALKKTMSEALDNPDTK
FT                   CLFDIEKVEWATHEMANKIEKWYEEIRSRGYSVKDMVENTFAQDEKDDNQNYRNAIAHI
FT                   LNMLESNYQEVKNSVNGMDTNDLLHKSATLIEHHRDQITPLVASRFQYLFVDEFQDTDE
FT                   LQMRIIQELSPKLQHVLVVGDRKQAIYAFRGSDHRVLEKIANDNKKPLLSLSASRRPTM
FT                   PLFQAQTSLFTHMGERYNFLLDKSTQADDAHNPTDSLVPFQYEHINVYSERTLPIAQRL
FT                   VEKINEFIGQQIDDRSEGLRQIEYRDICVLFRSNYQLSQYASLMPESIPIQTDFGGGFF
FT                   RKPEIISCYYMLQAIIKYPDDVSLDLALGTPFLPFKASSSIYRSTGENLVLCDWFENEE
FT                   DCQEWYEGIQKIRKQMKLDLVPKLLTDIYEFTKVRESYGKLGDLQAVANLEKLVMWSRD
FT                   LMNTEALTLQQFFDRFQSALLSGMETDEASTGEEEIRSNKVRFSTIHSAKGLEYPIVII
FT                   PDIGRPLLMEDNIPDFIPHPEWGIDLKLPGEVGSSSKYNEWIGSYRSNFLEEEARIFYV
FT                   AVTRAEHVICLIGHGKTKAGQIGDQNWSWQDEVLSARSALERLGSSVVKINLN"
FT   gene            255083..255310
FT                   /gene="M1-352"
FT                   /locus_tag="PPSC2_01090"
FT                   /old_locus_tag="PPSC2_c0214"
FT   CDS_pept        255083..255310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-352"
FT                   /locus_tag="PPSC2_01090"
FT                   /old_locus_tag="PPSC2_c0214"
FT                   /product="M1-352"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54201"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC58"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368844.1"
FT                   /protein_id="ADO54201.1"
FT                   /translation="MEITLKQVSREYTVYGGTIKDEKIYYSYMVRVEGGDVSQAVIMEM
FT                   VNGLPLAVTEKTFKEIVSRIEQRIRQNESL"
FT   gene            256056..256655
FT                   /gene="radC1"
FT                   /locus_tag="PPSC2_01095"
FT                   /old_locus_tag="PPSC2_c0215"
FT   CDS_pept        256056..256655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC1"
FT                   /locus_tag="PPSC2_01095"
FT                   /old_locus_tag="PPSC2_c0215"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01095"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54202"
FT                   /db_xref="GOA:E3EC59"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC59"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368845.1"
FT                   /protein_id="ADO54202.1"
FT                   /translation="MYSEKLRTLISTFMNKRAEDDLIEELLIQFPTLTQLMNATEQQLI
FT                   SIKGIKHSKAKKIMTLLQLANTLTLPESNPYFISHPRDVYNLLEPEFRFSTKEHFICLL
FT                   LNTKNRVIHKEIVSIGSLNATVIHPREVFGAAIRHCSASIVCVHNHPSGDPKPSEQDIM
FT                   ATKRLAKAGDIIGIDVLDHVIIGESTFYSIKEHGHF"
FT   gene            complement(256673..257023)
FT                   /gene="M1-354"
FT                   /locus_tag="PPSC2_01100"
FT                   /old_locus_tag="PPSC2_c0216"
FT   CDS_pept        complement(256673..257023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-354"
FT                   /locus_tag="PPSC2_01100"
FT                   /old_locus_tag="PPSC2_c0216"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54203"
FT                   /db_xref="GOA:E3EC60"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC60"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368846.1"
FT                   /protein_id="ADO54203.1"
FT                   /translation="MNYADLGTRIRQERQRLNLTQEKLAERVDLSHAYIGQIERGERSL
FT                   SLETLVKLANELGSTVDYLLSEAVEVKDEALINKIKQTIISRSLEEQQMALEMIELMFS
FT                   HIDKLGAFKDKV"
FT   gene            257245..258105
FT                   /gene="M1-355"
FT                   /locus_tag="PPSC2_01105"
FT   CDS_pept        257245..258105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-355"
FT                   /locus_tag="PPSC2_01105"
FT                   /product="M1-355"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01105"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44175"
FT                   /db_xref="GOA:A0A0D5ZBL7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZBL7"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="AKA44175.1"
FT                   /translation="MIFHNMYEEKHNRAGVFVVFIIFITLALLTGFIHPLITAFLIPII
FT                   IWSTLKFAKEEKARVLHHNMVVQIRIPQKAKFVTFVDGHSSLARSMKHFVWCDNAFLFI
FT                   FPEEYPKSYSKSDVSKIELVRVPLVDVEYYTTHGDFYTETTVSGGDGGGVSVTGAVVGS
FT                   MLGSAMGGKTMGAAGAVIGSRKKVNAVKSETMLHDTRVTMLFYNDAGETRSLKFRYEDY
FT                   DTFYRLLPDKSYEAHVFRHMNGAITKESHETIGEKLKMLKKLADEELISPQEFETSKKA
FT                   LLDKM"
FT   gene            258142..258375
FT                   /gene="M1-356"
FT                   /locus_tag="PPSC2_01110"
FT                   /old_locus_tag="PPSC2_c0218"
FT   CDS_pept        258142..258375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-356"
FT                   /locus_tag="PPSC2_01110"
FT                   /old_locus_tag="PPSC2_c0218"
FT                   /product="M1-356"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54205"
FT                   /db_xref="GOA:E3EC62"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC62"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368848.1"
FT                   /protein_id="ADO54205.1"
FT                   /translation="MPDEYLERIGKTALSAGAALGSGGAGAAIGTVIFPGVGTAVGYLI
FT                   GIGSGILLGNSLGKKIVDKRRLHNRWITNGSK"
FT   gene            258946..259932
FT                   /gene="M1-359"
FT                   /locus_tag="PPSC2_01115"
FT                   /old_locus_tag="PPSC2_c0220"
FT   CDS_pept        258946..259932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-359"
FT                   /locus_tag="PPSC2_01115"
FT                   /old_locus_tag="PPSC2_c0220"
FT                   /product="copper amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54207"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC64"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368850.1"
FT                   /protein_id="ADO54207.1"
FT                   /translation="MKRLLITALLVVGLMNWNTDSIFAEEEIDAIGTQIILQVANPNIL
FT                   VNGEEKLLDSATGAAPISYKGTTFLPVKNLVELLGGSLEYSKLAQRYQIQLDGKTVQLR
FT                   ADSKQATVDGQVRMLSIAPVNIRGTLLVPLRVLSEHLDVKMKWDKVQQRAVLYHGGMGE
FT                   RWYEDNYTSKVSNKYGRYSDQSIGYKVNYPLSWGDPLVIQKNNATIETIFYESPFVKIS
FT                   SYSDHMLSSYSENEGLKLEETYEQYLDRHGFLDGEIKEKRTFVDKAYDIFIDDGENSYI
FT                   YLVIFKEDEVGVFCIKLNQNMTSEDYKATKEWGNLLNNTFEADSAVG"
FT   gene            259960..260901
FT                   /gene="M1-360"
FT                   /locus_tag="PPSC2_01120"
FT                   /old_locus_tag="PPSC2_c0221"
FT   CDS_pept        259960..260901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-360"
FT                   /locus_tag="PPSC2_01120"
FT                   /old_locus_tag="PPSC2_c0221"
FT                   /product="M1-360"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54208"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC65"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599373.1"
FT                   /protein_id="ADO54208.2"
FT                   /translation="MKKTLLSLCSLIVLTVSFNFTTVVTAASNYNGHWEDHNSVGQYGM
FT                   DQMMLDMKSKGNQVTVEVSNDYFIPFEDSRESFKNSVGRMRSSVVNGTVVFNPKGQASF
FT                   KYKDEYNNGQMSIQMQNDGVKITWTGKEVSEFSFPQGTFKLYKKINVGAAEMEKLGTFL
FT                   SNFTELNLDEFDAKRVNNAELIRFGVWHNYINNFNSRISISNGKLYILKTHVEASIQKY
FT                   FNIQFRNHHSVNGFKFNGKGYIFDGADGMPVYYVRAQDVFDLGQNKLRVRGVLFDADSP
FT                   STEMVSEVEAVVKKVKVQNNISYSLVTLKVKR"
FT   gene            261023..262153
FT                   /gene="M1-361"
FT                   /locus_tag="PPSC2_01125"
FT                   /old_locus_tag="PPSC2_c0222"
FT   CDS_pept        261023..262153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-361"
FT                   /locus_tag="PPSC2_01125"
FT                   /old_locus_tag="PPSC2_c0222"
FT                   /product="M1-361"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01125"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54209"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC66"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368852.1"
FT                   /protein_id="ADO54209.1"
FT                   /translation="MKVKYTVGLILLLLLSACNTESEQAVKDVTSKVEDQVSNVSDKDN
FT                   EHVLAVKNGHFKAYVNQPIGETFSKFFSDNTWKYFKAQSGEDIVEFTGYMMYRHTKVKA
FT                   RLQFIVGKEDEFEASALSFNDVPQDELMKASVLKTVFEENEVDDGGNTEGNKAQATEKS
FT                   TAHKNDPSKEQPKAEDKKTTSRKDIFSTFDYDQKKKLNLFFSNLSEAYMGNFNINDYDK
FT                   EVLIDFAVKHNQINYGKRITTVENNQQFTDKLNSKYVVQTIKRFFDISVKPESTSTYPL
FT                   VGSSYQWDTADGEQYMDFSQVENFYDNGNGTYKAKIQIYTSDFESQGDSILYEPKDQAW
FT                   GNDVGFDTRGVAEAIVKKAKVGSKDTYQVIDYRVRY"
FT   gene            262247..263530
FT                   /gene="M1-362"
FT                   /locus_tag="PPSC2_01130"
FT                   /old_locus_tag="PPSC2_c0223"
FT   CDS_pept        262247..263530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-362"
FT                   /locus_tag="PPSC2_01130"
FT                   /old_locus_tag="PPSC2_c0223"
FT                   /product="M1-362"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54210"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC67"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368853.1"
FT                   /protein_id="ADO54210.1"
FT                   /translation="MKYIHLMDEAQRLKILKKFKLPLGKPLQGYSQEEADELTEDDIFA
FT                   FVYKQCEKYIPDRLIRLFENVDELASFKKGVKEHLIMNSYIVSNINILTGPEEKDTSNT
FT                   RGIARIGKEIKRLGNELLPDMNNGNYVAHIVEEELVGVLQRYFDLEPYKRESSKAKGGF
FT                   KDDVKVPYLVKPFIYFVTCINSIYKKLEKKEYSRELFGGISALFEEILKSYTEEQQIVS
FT                   RYLFEREYSVRLINRINDNVELHGDQDIRELKKLFGFFAVLPNVDSRLEYLDVINKSLL
FT                   NGSFTKSSSGKYGEHSYNEKIDNPSIWFDEVRLIILQFALVTLPLMELYHYELIYRYER
FT                   SLTLTLRSEYDKQENIFETMKIVEGYKSTIDSDESYLLKNFVKQYPSKKRVIDSELAYD
FT                   LVKRFHELDSNMDDFIAKIEQALLNTEK"
FT   gene            263706..264281
FT                   /gene="M1-363"
FT                   /locus_tag="PPSC2_01135"
FT                   /old_locus_tag="PPSC2_c0224"
FT   CDS_pept        263706..264281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-363"
FT                   /locus_tag="PPSC2_01135"
FT                   /old_locus_tag="PPSC2_c0224"
FT                   /product="M1-363"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01135"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54211"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC68"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368854.1"
FT                   /protein_id="ADO54211.1"
FT                   /translation="MSNDNNNYQINDFLRNMSKKEIKGIAEIVQGQTSVSLLVQSASFS
FT                   HSTVAGINIKPYISVVCSIMGNKRTCFASLGTNNPIAIGEEISNKDFVRVIVDSKGKAN
FT                   KKIYLHFKEKTTEYSNEDEENDNCLLVYVETKNYAHFCLYEGFLPNKVTELYVKDVKGK
FT                   LAIRTVALSFLKRTFPELETSYFYGERN"
FT   gene            264281..265978
FT                   /gene="M1-364"
FT                   /locus_tag="PPSC2_01140"
FT                   /old_locus_tag="PPSC2_c0225"
FT   CDS_pept        264281..265978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-364"
FT                   /locus_tag="PPSC2_01140"
FT                   /old_locus_tag="PPSC2_c0225"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54212"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC69"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599374.1"
FT                   /protein_id="ADO54212.2"
FT                   /translation="MPNDKRIRINLMDSNASVELSEEQTDTNYEFFGEYSDSVTCEDIE
FT                   TLQYSEDIDILTLCTEKLSYEDEIEQFDEHDDHSTLREETIFYEVEEISKAVEAENVEN
FT                   FKVKDNNTRFYKTSSDRGNFVPRVEWLMLNSFEMISSADGISIYQTKQGYYKHHSDSEL
FT                   AVLIRKNLTEDQNREVSRRKMDEVAYRLKTHPDLWRKFNDLNTDTNLINFRDGVLNLRE
FT                   RRMLPHDPKYCFTSFIDADCKVIPQQNTNNRDYSYSSVFECFLTDCTEGDKAKQASLQQ
FT                   MVGYIISNHFNAKKMFVLIGEPHTGKSVWLSLLQILIGKEHTTSMTLKQLGVNRFMQTR
FT                   LAHSKLNISPEMSDDGDLKGVEFIKAVTGGDLITGDRKGEAAIDFYGRTKLVAAGNHMP
FT                   KLAKHDGTTAFIDRLLFITFNNSIPERQRDRFLLQKLLEERDIIIKWALEGLYQLIDNN
FT                   FIFTECNEAIQFKKKYMAELDNVTEFVNDMCVVEPENDKSRVHRTRLYDAYIIYCKANG
FT                   LTSVKKTEFWREIEKFRVRSGKIRVEGSTPLMGYRGIRLLSPDEYTHT"
FT   gene            266166..266345
FT                   /locus_tag="PPSC2_01145"
FT                   /old_locus_tag="PPSC2_c0226"
FT   CDS_pept        266166..266345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_01145"
FT                   /old_locus_tag="PPSC2_c0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01145"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54213"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC70"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014041898.1"
FT                   /protein_id="ADO54213.1"
FT                   /translation="MSNTEKLCYTVAELHDILPLGMNSLYKLVNREDFPKIRVGKKIII
FT                   PAKGLKLWLEKQVQ"
FT   gene            266568..267692
FT                   /gene="xerC3"
FT                   /locus_tag="PPSC2_01150"
FT                   /old_locus_tag="PPSC2_c0227"
FT   CDS_pept        266568..267692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC3"
FT                   /locus_tag="PPSC2_01150"
FT                   /old_locus_tag="PPSC2_c0227"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54214"
FT                   /db_xref="GOA:E3EC71"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC71"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368857.1"
FT                   /protein_id="ADO54214.1"
FT                   /translation="MAGSIKKIGTKYRVTFELGKDLNGKRLRDYATVNSEAEAKKLLTE
FT                   FEHNQNRNLLVQSNAMSLIEFLNHWMDNYVKYNCEETTTYGYKNILYKHISHFFGGIEL
FT                   QKLQSGHIQQYYKHLMDEKNLSPNTVHKHHSLIRKALDYGLKQQLVYRNVADAVELPKR
FT                   KRYEGKSYTKEQLIELLKKVKNTKLEIPIYLAVYLGLRREEIIGLKWKYVDFESRTLHI
FT                   FEVRTSAGKAIITKAPKTEKSRRSLHINDDLYSLLKMHKVKQEELKNMLGSAYDNAGYV
FT                   YSHDNGKPYRVNSVTEQFKTFLEKQQLPKIRLHDLRHSFASVLYNQGTDLKAISEALGH
FT                   SDIGTTNKIYTHRFDKTHKNTINAMSQALKGDFT"
FT   gene            267689..268078
FT                   /gene="M1-366"
FT                   /locus_tag="PPSC2_01155"
FT   CDS_pept        267689..268078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-366"
FT                   /locus_tag="PPSC2_01155"
FT                   /product="M1-366"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01155"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44176"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZC81"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599375.1"
FT                   /protein_id="AKA44176.1"
FT                   /translation="MRELKQQTKARAFMYFGYHICYNWEECSSMNREVIQMKQVGDQSL
FT                   FLPEFQRLIGSQKFDFMAINEDENEMVIRLRKQDGSERIQKRERLLKALEQPGGVLKRY
FT                   PGASEELHAIARRDEEDDRDGSHFE"
FT   gene            268050..268493
FT                   /gene="M1-367"
FT                   /locus_tag="PPSC2_01160"
FT                   /old_locus_tag="PPSC2_c0229"
FT   CDS_pept        268050..268493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-367"
FT                   /locus_tag="PPSC2_01160"
FT                   /old_locus_tag="PPSC2_c0229"
FT                   /product="twitching motility protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54216"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC73"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599376.1"
FT                   /protein_id="ADO54216.2"
FT                   /translation="MIGTVVTLSRFLLDTNVCIYCLDGNPKIINYLGDIIRNPHNELIL
FT                   SVITEAELFSSTKVYNNPSLKAEISSFIDSTDEVKEITREIACTAGEIRAYFHQNLGKK
FT                   IKLPDALIAATAIHLKATLVSNNDRDFTDALSRYETVYYNPVK"
FT   gene            269425..269625
FT                   /gene="M1-368"
FT                   /locus_tag="PPSC2_01165"
FT   CDS_pept        269425..269625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-368"
FT                   /locus_tag="PPSC2_01165"
FT                   /product="M1-368"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01165"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZCB8"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="AKA44177.1"
FT                   /translation="MSVRILLLILYLHKAFPNDGNVVGKSTETGAARGAVTGGIAGAAA
FT                   GGAITGGTRYGIGVAIWGKGN"
FT   gene            269709..270134
FT                   /gene="M1-369"
FT                   /locus_tag="PPSC2_01170"
FT                   /old_locus_tag="PPSC2_c0231"
FT   CDS_pept        269709..270134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-369"
FT                   /locus_tag="PPSC2_01170"
FT                   /old_locus_tag="PPSC2_c0231"
FT                   /product="M1-369"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54218"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC75"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368861.1"
FT                   /protein_id="ADO54218.1"
FT                   /translation="MNIESITVCEDTTSDFKPINITNTFYPEQSGSVQVLVQLSEIHTT
FT                   TDVNFQWYISDEPEVPLATYTFSLERKSKKTRYAVGALDLRALLQLKEFNIFQKWFTII
FT                   EVEDSKRRVDFFLKKMGYGPSTLSNNFVNVPRINLKG"
FT   gene            complement(270392..270907)
FT                   /gene="M1-370"
FT                   /locus_tag="PPSC2_01175"
FT                   /old_locus_tag="PPSC2_c0233"
FT   CDS_pept        complement(270392..270907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-370"
FT                   /locus_tag="PPSC2_01175"
FT                   /old_locus_tag="PPSC2_c0233"
FT                   /product="M1-370"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01175"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54220"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC77"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368863.1"
FT                   /protein_id="ADO54220.1"
FT                   /translation="MAKRTSRSLKANEENILNKLKEVIEYNGDVVNNPESYGNTWIMAL
FT                   AVRPFTHNQKQLLPACLEEHEVLHPEQAFFVRMIIRTTHRNGTNRYVDGTNLCVTIDQD
FT                   TGIVDIAKEDEALSDSPVFHGGEIADALRWVNELADPYYIALEDPFLTPEQRLLFMQSA
FT                   KEDDPFTL"
FT   gene            complement(270952..271275)
FT                   /pseudo
FT                   /locus_tag="PPSC2_01180"
FT                   /note="hypothetical protein; disrupted"
FT   gene            complement(271552..273786)
FT                   /gene="asnH"
FT                   /locus_tag="PPSC2_01185"
FT                   /old_locus_tag="PPSC2_c0234"
FT   CDS_pept        complement(271552..273786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnH"
FT                   /locus_tag="PPSC2_01185"
FT                   /old_locus_tag="PPSC2_c0234"
FT                   /product="asparagine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54221"
FT                   /db_xref="GOA:E3EC78"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC78"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368864.1"
FT                   /protein_id="ADO54221.1"
FT                   /translation="MCGIAGVVRLDGTSLSQNVDTILQNMAEEISYRGPDDEQFFIKGP
FT                   LGFAFRRLSIVDINGGKQPLTNEDGTIVLIANGEIYNSTELRAKLSSRHQYKTNSDCEI
FT                   ILHLYEEKGIDLLQDLIGMYAFALWDSRKQKMFIARDRFGIKPLFFTANRERLVFASEI
FT                   KSLMKYPDCPRSLDWNKALTDPWLSGYTATDLSDPSSFFEGIEHLPAGCAVEVDVKKGS
FT                   WKQIRYWDLLANNNQSFAELSDQEIINYYANLLEDSVQKCLQSDVEIGLFLSGGIDSAS
FT                   IAAITSERQNIHTFSVLSQSTLTNEDAKYAHITAKYLGLPNHQVLFHWDENDFEPNHWR
FT                   KLLWLCESPLCGPEQLYKFHLHRYARSVCPDLKVILTGQGSDEFNGGYSSVLAPAWENN
FT                   WEGFTKNLNRLEMGRYMSNLPSKLFVWEEHFEQSPLSEKFILSKSSEVRRESSWEAYIL
FT                   TKFRDIQMYNCWLEDRIAAGNSIENRVPFLDHRIVEFALSIPSARRKGLFWDKKLLRSG
FT                   IQNRLPSELYKRSKVPFFYGEDARFTLRMMLDLLLKQKSVLLEEAVASSKFSDFIDTDA
FT                   FFSIAQQLSQDPEVTNMEYFLRIVNMGLLQHMVEQTNVKYEDSDNFIILSNHPIENWEK
FT                   NEEEIHLKLSKRREAIKLEDIPLFAPEVFLVQRDDIQKDNHAYLVVDNHLTYALSEDEA
FT                   GQWLRVLRKINGEQSLKEILSDLDITESEIRKFLEEAIDFGVITMKPIAN"
FT   gene            complement(273895..274401)
FT                   /gene="yxnB"
FT                   /locus_tag="PPSC2_01190"
FT                   /old_locus_tag="PPSC2_c0235"
FT   CDS_pept        complement(273895..274401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxnB"
FT                   /locus_tag="PPSC2_01190"
FT                   /old_locus_tag="PPSC2_c0235"
FT                   /product="yxnB"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54222"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC79"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368865.1"
FT                   /protein_id="ADO54222.1"
FT                   /translation="MRKLTIDELRQLVPEYNNDLAKERASGIFNYIIMMVALARDHHMQ
FT                   HQDLVNWIHRHFEERGYYEETLLKFGSGNTKLFLQDFVIGRSLLYENIEVFIHENGNYE
FT                   VQSTSWWLNQPTEACFYFDMEPEEIVKYVQSLACSKADRLGITLKISHKNGIEQALICK
FT                   KGTII"
FT   gene            complement(274418..274681)
FT                   /gene="aslA"
FT                   /locus_tag="PPSC2_01195"
FT                   /old_locus_tag="PPSC2_c0236"
FT   CDS_pept        complement(274418..274681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aslA"
FT                   /locus_tag="PPSC2_01195"
FT                   /old_locus_tag="PPSC2_c0236"
FT                   /product="aslA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54223"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC80"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368866.1"
FT                   /protein_id="ADO54223.1"
FT                   /translation="MNFNENTILRKNPDISTRNYLKSTIIEPGITLNEVATNLFERIDG
FT                   IRTLAEICKDMVKEYEVDYQTILGDSVELVQGLIEKNIILVE"
FT   gene            complement(274720..275424)
FT                   /gene="yxbB"
FT                   /locus_tag="PPSC2_01200"
FT                   /old_locus_tag="PPSC2_c0237"
FT   CDS_pept        complement(274720..275424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxbB"
FT                   /locus_tag="PPSC2_01200"
FT                   /old_locus_tag="PPSC2_c0237"
FT                   /product="yxbB"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54224"
FT                   /db_xref="GOA:E3EC81"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC81"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368867.1"
FT                   /protein_id="ADO54224.1"
FT                   /translation="MITAEECQTYNKFIKKYQPHLYPLLGAHISRLYERKGGVVIDMGT
FT                   GPGYLTVELAERLKANVHAVDINPAMHDLARRLVEERGLSKSVHFDVIDVHNQIYPDNY
FT                   ADLVVSYSCLHHWENPVRALLECYRVLSPNGLLIIIDTLPNNKDTLNALKRSIPEPEYF
FT                   RFIREAFEESYSMSKIEEMIHEAGIVDFELNLFKFNEEDIADCIEVLEDLHIPEVEAEA
FT                   NTENWILTACKK"
FT   gene            276091..277092
FT                   /gene="yxbC"
FT                   /locus_tag="PPSC2_01205"
FT                   /old_locus_tag="PPSC2_c0239"
FT   CDS_pept        276091..277092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxbC"
FT                   /locus_tag="PPSC2_01205"
FT                   /old_locus_tag="PPSC2_c0239"
FT                   /product="yxbC"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54226"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC83"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368869.1"
FT                   /protein_id="ADO54226.1"
FT                   /translation="MSTIDKKDTVLSKVLNPFSSDIFIREHWAPSKHLVIHGNVERFHQ
FT                   LPGISNVQSLDNIIDLYKGPVMVVGNAVIEETGGIADRFLVSTEEAKDWYERGAALEFD
FT                   FSDMFLPQLHSWMDSLRKELSLPSGSGIKAIVYAAKNGGGFKAHFDAYTNFIFHLQGTK
FT                   TWKLLANENVTNPIQHYDLAEKPYIPDELATYWKGEHPQTDLPGADIVNLLPGSFLYLP
FT                   RGIWHSTSSTEETLSLNITFSHPAWLELLLAEIRSRLTQHDTWRELACDINLLSPEEQE
FT                   SLKSKLNQELNQVLPGFSSISAEDIFKRHTEEFDIYHVTQAVFRQLLATREL"
FT   gene            277130..278335
FT                   /gene="yxaM"
FT                   /locus_tag="PPSC2_01210"
FT                   /old_locus_tag="PPSC2_c0240"
FT   CDS_pept        277130..278335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxaM"
FT                   /locus_tag="PPSC2_01210"
FT                   /old_locus_tag="PPSC2_c0240"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54227"
FT                   /db_xref="GOA:E3EC84"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC84"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368870.1"
FT                   /protein_id="ADO54227.1"
FT                   /translation="MNIFSILSALRGLAIGFFSPIWIIHLNDQGFDLLAIGILGTVFEV
FT                   ARLLFEIPTGTFADNNGVRRSIMLSYIFSMATWLIFPFIGITWVCVIAMIIWALAEALI
FT                   SGAFETWMSQVTPKEEFSKRLMRNAQVLIASIILTSLLSGHIYKFNSMLPFIFVALIYA
FT                   IMLAIILIYLKSDQQIIKNQKKNTPKESFIEITGKSFQIVFKHRRILNVVLAGFFAALS
FT                   YDVIMRYWQPYLIQIGNSKEFLGYVMAIAGVLAFILLHFTAKAHKIIEKNTLLSLIMVE
FT                   SISILMIFSTAFGLKAIGLVAISFLLSVEDIRNPIVNGYLNKFFPDSYKATLFSVNSVT
FT                   GAAGEILSGIIFGLIAVKFGIIATFIVAAIFLIPSILLYYNTAQNTDINYSEKRDNMTF
FT                   KS"
FT   gene            278452..278931
FT                   /gene="yxbD"
FT                   /locus_tag="PPSC2_01215"
FT                   /old_locus_tag="PPSC2_c0241"
FT   CDS_pept        278452..278931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxbD"
FT                   /locus_tag="PPSC2_01215"
FT                   /old_locus_tag="PPSC2_c0241"
FT                   /product="yxbD"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01215"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54228"
FT                   /db_xref="GOA:E3EC85"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC85"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368871.1"
FT                   /protein_id="ADO54228.1"
FT                   /translation="MRIINIKEFDKKMITNFFICNWGTPQMVISSGIYQCDELDGFAIL
FT                   DHKEKIMGLITYVISDNECEIISLDSKDENKGIGTALLNQVEAVSKKSGCCKLKIVTTN
FT                   DNLHAFLFYQKKGYQIARIFPNSVEKARIIKPEIPKISNNGIPIRDEILFEKCIL"
FT   gene            279117..280217
FT                   /pseudo
FT                   /locus_tag="PPSC2_01220"
FT                   /note="DNA-binding protein; disrupted"
FT   gene            complement(280877..281812)
FT                   /gene="M1-382"
FT                   /locus_tag="PPSC2_01225"
FT                   /old_locus_tag="PPSC2_c0245"
FT   CDS_pept        complement(280877..281812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-382"
FT                   /locus_tag="PPSC2_01225"
FT                   /old_locus_tag="PPSC2_c0245"
FT                   /product="M1-382"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01225"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54231"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC88"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368874.1"
FT                   /protein_id="ADO54231.1"
FT                   /translation="MDKKELITKAQLKNLPITESKLNRYINLGLICSDTKGRGRAKGTL
FT                   SHFTEESLDILKEIQSLKGINQKHIIFTLFWRGYNISWHKLKDAVYNFTLEIEDKFTEV
FT                   NNKTKDPEFADYILNEMIEESVPKKKPGRPSNQDLKELKQQQEAEKESFRNILSVVQLL
FT                   AAGSSMTCQGLKLFSRPNPNVTTQTIADADMFLDWLNLRTIKESIQRSEKNDYDNILEI
FT                   IHCIQQYWNEIEAVSKSPTVNSAIKEIVQQINRFYPGGFTFRNVTLIRYLILAMLAFGK
FT                   HQMILEFLKSDQTKTLFNQFVNLPFEKNKQ"
FT   gene            282495..283349
FT                   /gene="soj1"
FT                   /locus_tag="PPSC2_01230"
FT                   /old_locus_tag="PPSC2_c0246"
FT   CDS_pept        282495..283349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soj1"
FT                   /locus_tag="PPSC2_01230"
FT                   /old_locus_tag="PPSC2_c0246"
FT                   /product="chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54232"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC89"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368875.1"
FT                   /protein_id="ADO54232.1"
FT                   /translation="MSATCVSLINMKGGVGKTTLAFNLAWYAAYKRRMRVLVVDLDPQA
FT                   NASQYLMGAEAYKTYLDENRPTVFHIFEQYTPSGFDGSMGPSSLDVSTVIYPVKKWSNS
FT                   SFIHLIPSRLELSWTLKNPTNKDHLLARFLTNVQNDYDLILIDCAPTESILTTAVYRAS
FT                   RFVVIPIKPEFLASIGLPLLVRSLESFKHSLGDQDIEIAGIVFNDTDPTLTYEEHNISR
FT                   SEVRNYASKQGWHVFENEVRHSNSYPKGARNKKPIFLTDYARSNVINEFTAFGREFLER
FT                   VGF"
FT   gene            283350..283874
FT                   /gene="M1-384"
FT                   /locus_tag="PPSC2_01235"
FT                   /old_locus_tag="PPSC2_c0247"
FT   CDS_pept        283350..283874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-384"
FT                   /locus_tag="PPSC2_01235"
FT                   /old_locus_tag="PPSC2_c0247"
FT                   /product="M1-384"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01235"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54233"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC90"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368876.1"
FT                   /protein_id="ADO54233.1"
FT                   /translation="MSLKQELLLDLLQLKVKYTEKEFNEVFSFLQNERVDHSFDEIVRL
FT                   LNLIDINKKTTNQRTKKKLSNLEKVHNADQDHYLNLINFRDKLLNRSIAAETRELNRFS
FT                   AEIGIPSSKGRKREQTIKLIIEFLAGLRPEEANHLIEEGLIFANETNSKFELLADAILQ
FT                   RSQTNEINKIE"
FT   gene            283970..284170
FT                   /locus_tag="PPSC2_01240"
FT   CDS_pept        283970..284170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01240"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44178"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZC14"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="AKA44178.1"
FT                   /translation="MTESNKSDVKPKLRDLPSIKEAEHQANNLKMVKAAMPVLSPFLKM
FT                   LGVDSELIKKHFKKQRIVWVI"
FT   gene            284206..285255
FT                   /gene="M1-385"
FT                   /locus_tag="PPSC2_01245"
FT                   /old_locus_tag="PPSC2_c0248"
FT   CDS_pept        284206..285255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-385"
FT                   /locus_tag="PPSC2_01245"
FT                   /old_locus_tag="PPSC2_c0248"
FT                   /product="M1-385"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01245"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54234"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC91"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368877.1"
FT                   /protein_id="ADO54234.1"
FT                   /translation="MFAERGWILYDMMSLATAEEAVKRAEDGDIEGAEQKLVEYYDAET
FT                   TRLHLSMMQAIKAFRPRLRLAYRALTDYEEERYHACIPVVLALLDGLVNDIHQNRKGFF
FT                   AEDIEFEAWDSLAAHSKGLGQLASIFRKGRRSTTTDPLTLPYRNGILHGTDLGYDNRLV
FT                   AAKTWATLFSLRDWALKVENGKDKPPVEKPKESLRKVMSKYSETLKEHNELQKWKPREI
FT                   ILNDEFVFQEGSPEFVLNEFMELWKRKNYGYMSKLVQLNKVDDKQKPKKVKEKLADCLL
FT                   KDFKFLSINDIAAATAIELSMQIEKNNIITEYQYAYSLINIDEENKFVRRGKPGSKWKI
FT                   EKWNYQSAF"
FT   gene            285716..287641
FT                   /gene="M1-386"
FT                   /locus_tag="PPSC2_01250"
FT                   /old_locus_tag="PPSC2_c0250"
FT   CDS_pept        285716..287641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-386"
FT                   /locus_tag="PPSC2_01250"
FT                   /old_locus_tag="PPSC2_c0250"
FT                   /product="M1-386"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54236"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC93"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368879.1"
FT                   /protein_id="ADO54236.1"
FT                   /translation="MHLFELEQLIRKDKNKFLNLVKKTYSNLGLEDTLRLIKKSGICIN
FT                   PYGTGEPKDKKLFNQVFEFLQSKEHDSKSLSDFLNEINILNAIYRRFDQKYMKKIEKLI
FT                   DADIHVNSYLIALEINLSEFQYQSFFNLISGRINGLNHNSQDIYENIVQSSGLILKYFM
FT                   YKKYKFGGISNRIDKQDVISASEHLTNSSIRVYMDNIMYLWDYFDVNISVLNKDKVYIK
FT                   TVGDDALGKHISHLSFMDIRNAKMSRQGLEQAIFKPKYNITNNLPPEYISSKEELACEF
FT                   IEEYFSTKDLNIEFNGILLSELIRAYSLVSIECEKFLKNRKNIGYGFNDVALNEVCIVK
FT                   SKIKWINKLTEVGIRKSKADEILKLMTFNNSSNDLFDCPFIQMGNNLVVLPSASIMTDS
FT                   SRAILLNLNSREINISKKGDEFERLIREVISKRGIRCINLQKKDYECDAVFALGNDLFF
FT                   LETKHLNHPTSYREYMRHLDDIREASSQLNRIVEFYTTDVNLEEIKSKLDIETVDSISK
FT                   LVVTNTSQGQKLKIGDTYITDDTCFVGYFERRPPQIVAFQKGSIVTRSLFSEYFMGNLN
FT                   KEQFMNLLEKSPLIEQNKRRIGYAMYDFSEQIGVEFEDFSVKVNTVVYEDFLTDDERTE
FT                   LSNIYK"
FT   gene            complement(287863..288729)
FT                   /gene="insK12"
FT                   /locus_tag="PPSC2_01255"
FT                   /old_locus_tag="PPSC2_c0251"
FT   CDS_pept        complement(287863..288729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insK12"
FT                   /locus_tag="PPSC2_01255"
FT                   /old_locus_tag="PPSC2_c0251"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54237"
FT                   /db_xref="GOA:E3EC94"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC94"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013371758.1"
FT                   /protein_id="ADO54237.1"
FT                   /translation="MTRKEARFEIIEGMRTRYSLKWLLELAHVSRAGYYKWRKTQQTTQ
FT                   QRKQEEELLESHMLSIHRIHPYFGYLRMTVALRREGILVNHKKVYRLMKKLGIRSVIRK
FT                   KRRFFGKQASVVNANRLDRQFQADSPLSKLVTDITYIRAGERFVYLSVIQDLFNNEIVA
FT                   WRLSERNDLALVSETLDVLSKNVNMEGVILHSDQGFQYTSKPFNRKLKRLGMLGSHSRR
FT                   GNCLDNACIESFFSHLKTEKIYLTKPGTLAEVEQHVREYISFYNENRFQKKLNNRSPIE
FT                   YRETVAA"
FT   gene            complement(288726..289025)
FT                   /gene="orfX1"
FT                   /locus_tag="PPSC2_01260"
FT                   /old_locus_tag="PPSC2_c0252"
FT   CDS_pept        complement(288726..289025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfX1"
FT                   /locus_tag="PPSC2_01260"
FT                   /old_locus_tag="PPSC2_c0252"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54238"
FT                   /db_xref="GOA:E3EC95"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC95"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368880.1"
FT                   /protein_id="ADO54238.1"
FT                   /translation="MAKKGQSFQQYSLDVKMEAIRLVNEEHMSIREVTKHLDIRNKSQV
FT                   QSWVTKYRAGENLQPTTTRQGRPKTKFSSMEEEMAYLRAEIEYLKKQYPNLHKE"
FT   gene            289483..290157
FT                   /gene="M1-390"
FT                   /locus_tag="PPSC2_01265"
FT                   /old_locus_tag="PPSC2_c0255"
FT   CDS_pept        289483..290157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-390"
FT                   /locus_tag="PPSC2_01265"
FT                   /old_locus_tag="PPSC2_c0255"
FT                   /product="M1-390"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54241"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC98"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368883.1"
FT                   /protein_id="ADO54241.1"
FT                   /translation="MNYMDEHILSLKNKLNYDVASNNVNTSLSQTVISEQDHSVSEKSL
FT                   ALRLGDELIPLELRVILDGQMQVSVPKSFSLMPLEQAKFKYPSEYRPEAIYTSEDGTVN
FT                   ITFSRTESFLADEELPDFVEQMADTLRAVQPIRNWLGTQVIVNHSGLSIRLIRFVAAGV
FT                   DTNLYNEILLFTHAGQVMMGTFNCMESDMEAWLPVAENTVHSLHAVSLLLHPTLEKEAN
FT                   QI"
FT   gene            290154..291569
FT                   /gene="M1-391"
FT                   /locus_tag="PPSC2_01270"
FT                   /old_locus_tag="PPSC2_c0256"
FT   CDS_pept        290154..291569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-391"
FT                   /locus_tag="PPSC2_01270"
FT                   /old_locus_tag="PPSC2_c0256"
FT                   /product="M1-391"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54242"
FT                   /db_xref="UniProtKB/TrEMBL:E3EC99"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685800.1"
FT                   /protein_id="ADO54242.1"
FT                   /translation="MSLGYDNIQIQPYELVELEHLTLAKKINEHTRLYFTGIIPEEMQD
FT                   SYVETTEKNTVIEVSHRNESGESKPLFSGIALSVEVKVVRDVYYLEVEAISHTYRMDIQ
FT                   QRTRSFQYTKMTIPQMLEQIGKDYEGLDVIDGATGGEPIGRIAIQYQETDWAFLRRMAS
FT                   RYHTSLMPVSRFDSPKFYFGIEDSSAQAVLDHTRYTVRKQMLPFRYFQENEQAKVNEND
FT                   FIFYEVETDEVLDLGAQLTFQGHSLYVMEAYTEMRQGLLRHQYVLASYKGLRQKGYYQE
FT                   KLAGASLGGVVVDVRQDQVRIHLDCDEKQAVDQAHWFNYSTVYSGGGHTGWYVMPEKGD
FT                   PVSLYFPGSREEDGVAGSAVRRTDRGSGHNKLSNPQMKIWRTPHGKEIRLGPDELVVTG
FT                   KDGAIFIKLDDKEGIHIVSNKQVSISAGGNLSLSAGKTMSLSAGSELRMDCNGSHIQLS
FT                   GSADMKGSEVKSN"
FT   gene            291647..292894
FT                   /gene="M1-392"
FT                   /locus_tag="PPSC2_01275"
FT                   /old_locus_tag="PPSC2_c0257"
FT   CDS_pept        291647..292894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-392"
FT                   /locus_tag="PPSC2_01275"
FT                   /old_locus_tag="PPSC2_c0257"
FT                   /product="M1-392"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01275"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54243"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECA0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368885.1"
FT                   /protein_id="ADO54243.1"
FT                   /translation="MKKSIDELEPQWRAILNQAWFLISRDWALKFKTTQEQRIQACVEE
FT                   FRGYCRHIRQEQLQGKERIGYITYSMLRTTWLEERPAYLVEASDALWMLDPQPIRLEWD
FT                   TSWAYSYWTDLQRQLRGEVEKQQVSLSELEWEQVMLEAAVHIHALVVNVVRSAMKQAVY
FT                   LSEFQELEREETFEIRVGEYLDHSVSVYREDRRAMEANEIRSWLEEKEEHAYSYQALTQ
FT                   VHLSDGDFSLLDFRYTAFRQIRSEHSRLHGCVLVGTVWQESELNGIDLTYSLLHGANFS
FT                   GCSMKGAILDVVIGNARYGSDASLDWEPLGFAGVDFTGASLQGARFHDAQLRGAIFQEA
FT                   LLQKASLDGADLTDACFVGANVTGASFKEACLIGANFTGANVQGVIFTDEQRRGAIGLE
FT                   WSTQVRDVGSKGEWLH"
FT   gene            292909..293430
FT                   /gene="M1-393"
FT                   /locus_tag="PPSC2_01280"
FT                   /old_locus_tag="PPSC2_c0258"
FT   CDS_pept        292909..293430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-393"
FT                   /locus_tag="PPSC2_01280"
FT                   /old_locus_tag="PPSC2_c0258"
FT                   /product="M1-393"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54244"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECA1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368886.1"
FT                   /protein_id="ADO54244.1"
FT                   /translation="MIDERVKHRVEPAALSPLQVEEILTEAEGEQQQDDPLFLAVHTDP
FT                   RTVYPDFLEFPLPLVSDRLKVLLEKYMPGLKWKAAILTDFQQARQEVYWVLRPPLVDCL
FT                   SAQTEWYPSGTLKHLILRQGEIEPPVFRIEGLIEPHIYIHLAVAESLLRRSFTGIRVQR
FT                   VEMEALRRMG"
FT   gene            293431..293847
FT                   /gene="M1-394"
FT                   /locus_tag="PPSC2_01285"
FT                   /old_locus_tag="PPSC2_c0259"
FT   CDS_pept        293431..293847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-394"
FT                   /locus_tag="PPSC2_01285"
FT                   /old_locus_tag="PPSC2_c0259"
FT                   /product="M1-394"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01285"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54245"
FT                   /db_xref="InterPro:IPR025460"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECA2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368829.1"
FT                   /protein_id="ADO54245.1"
FT                   /translation="MEEAQVKPGTGAKKSYVVAGAILSYSYGTQPTRLKRPFSHGVYVK
FT                   NKAQMNIGDYVPGVNIQSFGNCSSPLNPAVQASEMVDIYGVKKAPCVPVLTMPWLNGKS
FT                   DVKIEGQPALTQNCTHQCLYCGHIQIENDGQELD"
FT   gene            293958..294443
FT                   /gene="yezG1"
FT                   /locus_tag="PPSC2_01290"
FT                   /old_locus_tag="PPSC2_c0260"
FT   CDS_pept        293958..294443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yezG1"
FT                   /locus_tag="PPSC2_01290"
FT                   /old_locus_tag="PPSC2_c0260"
FT                   /product="yezG1"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54246"
FT                   /db_xref="InterPro:IPR006728"
FT                   /db_xref="InterPro:IPR036170"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECA3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368888.1"
FT                   /protein_id="ADO54246.1"
FT                   /translation="MEKQMDQLYPQIAEHILDMIPEDKWHEIYLYAEILDGSSNVYFYF
FT                   NASEDGDNIYSHDISDKYGVSGEVYDDLLLGLQSKFEKLRKIFIDNDQEAWTNLTLALK
FT                   YPGKLNIQYSYEDMITSELTSTQRQIIFEYQHLGLLPISERNIQFLEGYLDNQDKSR"
FT   gene            294848..295075
FT                   /gene="M1-396"
FT                   /locus_tag="PPSC2_01295"
FT                   /old_locus_tag="PPSC2_c0261"
FT   CDS_pept        294848..295075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-396"
FT                   /locus_tag="PPSC2_01295"
FT                   /old_locus_tag="PPSC2_c0261"
FT                   /product="M1-396"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01295"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54247"
FT                   /db_xref="GOA:E3ECA4"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECA4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368889.1"
FT                   /protein_id="ADO54247.1"
FT                   /translation="MIAILERINQLAKKAKEVGLTEIEKTEQMDLRKEYLQIFRGSIKS
FT                   ILLNATIYDPNGDDVTPEKLRKEQAQIVKP"
FT   gene            295145..295543
FT                   /gene="ydfP"
FT                   /locus_tag="PPSC2_01300"
FT                   /old_locus_tag="PPSC2_c0262"
FT   CDS_pept        295145..295543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfP"
FT                   /locus_tag="PPSC2_01300"
FT                   /old_locus_tag="PPSC2_c0262"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54248"
FT                   /db_xref="GOA:E3ECA5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECA5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368890.1"
FT                   /protein_id="ADO54248.1"
FT                   /translation="MLASGLLLIRLVVGLLFVGHGAQKLFGWFGGYGPKGTGGWMESIG
FT                   IKPGVLMAVAAGLMELLGGALFTVGLLTPLAALLITMAMLGAIVKVHGQNGIWATANGY
FT                   EYPLVLIAVVIGIALTGAGSYSIDAILH"
FT   gene            295619..296569
FT                   /gene="ydfO1"
FT                   /locus_tag="PPSC2_01305"
FT                   /old_locus_tag="PPSC2_c0263"
FT   CDS_pept        295619..296569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfO1"
FT                   /locus_tag="PPSC2_01305"
FT                   /old_locus_tag="PPSC2_c0263"
FT                   /product="ring-cleaving dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01305"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54249"
FT                   /db_xref="GOA:E3ECA6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECA6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427866.1"
FT                   /protein_id="ADO54249.1"
FT                   /translation="MSLQTTGIHHITAFAGNPQANVDFYAGILGLRLVKKTINFDAPEV
FT                   YHLYFGNEAGSPGTIITFFPAPGTPKGRIGGGQVGTTSYVVPLGSLDFWQHRLKSFGIQ
FT                   VTKTSRFNEQYLQFEDNEGLRLELVERAEGASSTWSYDGISADKAIKGFGGAVLFSANP
FT                   QKTMDALESILGFTKIDEDAEYARYQSAGEIGNIVDVPLVKMGLGFGGAGTVHHIAWRA
FT                   KDFEQHEEWRSAVQHYGYQPTPIIDRQYFNAIYFREAGGILFEIATDPPGFANDEPAES
FT                   LGQKLMLPEWYEPQRAQIEANLHPIEVRTLTDKQK"
FT   gene            complement(296791..297942)
FT                   /gene="wcaA"
FT                   /locus_tag="PPSC2_01310"
FT                   /old_locus_tag="PPSC2_c0264"
FT   CDS_pept        complement(296791..297942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaA"
FT                   /locus_tag="PPSC2_01310"
FT                   /old_locus_tag="PPSC2_c0264"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54250"
FT                   /db_xref="GOA:E3ECA7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECA7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368892.1"
FT                   /protein_id="ADO54250.1"
FT                   /translation="MAIRYSVIIPTYNRAQQLLLTLASFEAQTYSKQLFEVIVADDGST
FT                   DGTKEMVEDFKASYPLIYVSHPEQRGRSAVRNLGLRQAKGIYIIFCDADFLVLPHFIKT
FT                   VSRYHRKYPKSVLSGIPHSWDDAFTHYHPDFSVEEKEHCRSILTQSGLWNPDFETANEI
FT                   IPIITPHDVLHQTGALPKVVSPTRVPPSTQKQFASTDVAPWMMLVTRCVAIRRNHLIRI
FT                   GGFNERFVLYGLEDWDLGYRLHRLKIPFYCIKELVGYHQEHPTHLRGNVLNTENLRIMY
FT                   ETYGFNDSSLNLFALIPPSEDFETYKNTLRVLRRGLRSRLTRSSAMLLRRTLRIAAKQF
FT                   YYHNNTPAYQQSLRAIKKKAENRKSRVAHVLREMLVKSEKLLE"
FT   gene            298259..298981
FT                   /gene="gntR1"
FT                   /locus_tag="PPSC2_01315"
FT                   /old_locus_tag="PPSC2_c0265"
FT   CDS_pept        298259..298981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR1"
FT                   /locus_tag="PPSC2_01315"
FT                   /old_locus_tag="PPSC2_c0265"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01315"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54251"
FT                   /db_xref="GOA:E3ECA8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECA8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019914297.1"
FT                   /protein_id="ADO54251.1"
FT                   /translation="MTQFVYKQIIDDLKMKIFAGKFADMRLPDERSLSETYQVSRSSIK
FT                   RALTKMESVGIIFKKQGSGTFINPLYIRNESIFNYEGSNLGVTDNFQMHGKKPKIKVLS
FT                   FEVIPPTEELQRDLFLDTHDFVYKIVRLRLFDDDPFMIETGYIPIKIVQDLNQTIIEGS
FT                   IFNYLEDSRNLAVTKSFLSIFAEPSQENDQKLLQLKENEPVGIMEGVFFLDNGTPFEFS
FT                   HMRFHYKYLKFNTFVSVH"
FT   gene            299286..301670
FT                   /gene="xfp"
FT                   /locus_tag="PPSC2_01320"
FT                   /old_locus_tag="PPSC2_c0266"
FT   CDS_pept        299286..301670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xfp"
FT                   /locus_tag="PPSC2_01320"
FT                   /old_locus_tag="PPSC2_c0266"
FT                   /product="phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54252"
FT                   /db_xref="GOA:E3ECA9"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECA9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820142.1"
FT                   /protein_id="ADO54252.1"
FT                   /translation="MALTPVLAEYSSQTYLKKLDAYWRATNYISVGQLYLKDNPLLREP
FT                   LKDSDVKVKPIGHWGTIPGQNFIYAHLNRVINKYDLNMLYIEGPGHGGQVMVSNSYLDG
FT                   SYTEIYPQITQDIPGMKKLFKQFSFPGGIASHAAPETPGSIHEGGELGYSLSHGVGAIL
FT                   DNPNLISAVVIGDGEAETGPLAASWFSNRFINPITDGAVLPILHLNGFKISNPTIMSRQ
FT                   SKEELTSFFKGLGWEPFFVEGEDPDHMHPEMAKVLDTAIEKIEAIQKNARENNDLTRPA
FT                   WPVLIFRSPKGWTGPKEWDGVPNTNSFRAHQVPIPVDQKNMQHAPALLEWLNSYRPEEL
FT                   FDENGRLKAEIAEILPTGEKRMGMNPVANAGNLIKDLKLPDFRNYALDNSTPGKVIAQD
FT                   MSVLGKYVKDVVVLNEENRNFRIFGPDETMSNRLAPVFEVTKRQWMDQIIEPNDEFLSS
FT                   YGRVIDSQLSEHQAEGLLEGYVLTGRHGFFASYEAFLRVVDSMITQHFKWLRKATDQGW
FT                   RADIPSLNVVATSTVFQQDHNGYTHQDPGLLGHLADKKPEFIREYLPADANSLLAVFDT
FT                   ILNDRQKINLVVSSKHPRPQWFSADEAKELVDKGLKIIDWASTDQGGEPDIVIASAGTE
FT                   PTIESLAAISILHKKLPDLKIRYINVVDLLKLRSQKLDPRGLSDAEFDQFFTKDKPVVF
FT                   AFHGYEGLIKDLFFDRHNHNLHVHGYRENGDITTPFDMRVLNQMDRFDLVKEAVLNLPD
FT                   AGKYANIADEMDAMVKKHHQFIREEGIDLPEVENWVWEGLK"
FT   gene            301940..302781
FT                   /pseudo
FT                   /locus_tag="PPSC2_01325"
FT                   /note="'2,5-diketo-D-gluconic acid reductase'; disrupted"
FT   gene            302959..303618
FT                   /gene="pspA1"
FT                   /locus_tag="PPSC2_01330"
FT                   /old_locus_tag="PPSC2_c0268"
FT   CDS_pept        302959..303618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA1"
FT                   /locus_tag="PPSC2_01330"
FT                   /old_locus_tag="PPSC2_c0268"
FT                   /product="phage-shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54253"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECB0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368895.1"
FT                   /protein_id="ADO54253.1"
FT                   /translation="MGILSRFRDIMKMNINALMDKASDPEKTIDDYMQNLNSDLGKVKA
FT                   ETASVLADEKRAKRALDECRTEIKKLQHYASKSVEAGNEEEARKFLERKGLQAEKLESL
FT                   QTSYDLASANAVHMKQMQEKLVSDIGQLELRRAELKGKLAIAKAQQTLNSMGDHDSVFE
FT                   ALEEKVNRAYDEAMAIAELRTGTKDDLDALFAQYEKSTNPEDELAAIKKKINPKES"
FT   gene            303645..304679
FT                   /gene="ydjG"
FT                   /locus_tag="PPSC2_01335"
FT                   /old_locus_tag="PPSC2_c0269"
FT   CDS_pept        303645..304679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjG"
FT                   /locus_tag="PPSC2_01335"
FT                   /old_locus_tag="PPSC2_c0269"
FT                   /product="ydjG"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01335"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54254"
FT                   /db_xref="GOA:E3ECB1"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECB1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368896.1"
FT                   /protein_id="ADO54254.1"
FT                   /translation="MPVIEYKCPNCGSGMVFDSETGMLSCHSCGREDNIDTIPDPLTNR
FT                   IFSEDEAHEYHCNNCGAVIMTEVETSATVCSFCGSAVVLGDRLTGELAPAQVIPFSISK
FT                   EEAIAAFKKWCKNGRLTPNRFMMADRIKGITGMYVPFWLYELHNHIEVQGEGTQVRTYT
FT                   SGDYEYTETKHFDVYRKIRLNYVKVPIDAAEKMNDELMDKLEPFPYDQLKPFKTPYLAG
FT                   YIAEKYSYNEEELFPRVKDKVKEYIDAYIQSTVSEYTFVSYTEKQIDTTLKQADYVLLP
FT                   VWVIHYDYNQLEHTFAMNGQTGKVVGKPPISKFKVTAWFAGIFGITLFSLRLITWLIMG
FT                   GEFY"
FT   gene            304676..305470
FT                   /gene="ydjH"
FT                   /locus_tag="PPSC2_01340"
FT                   /old_locus_tag="PPSC2_c0270"
FT   CDS_pept        304676..305470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjH"
FT                   /locus_tag="PPSC2_01340"
FT                   /old_locus_tag="PPSC2_c0270"
FT                   /product="ydjH"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54255"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECB2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685809.1"
FT                   /protein_id="ADO54255.1"
FT                   /translation="MKKYRAIVAVLLFFAAFLAVPMEMKGEAATTEMKPLIFDEAGLLN
FT                   QEEYDVLNTMANQYGAERETDIIVYTTNNPDNMDVMKMTQDFYDDHGPGYDRSHGNAVI
FT                   LTMDMRNREVYLAGFYKAERYLDDDRLTKIRHEITPDLTNGNYGLAFQKYILGARKYLA
FT                   IRPGVNPDSIFFKGWLHLAVALGLASIIVGKMVSSSGGRVTVNRQTYEDASTSGVLAHQ
FT                   DLYTHTTTTKRKIEKSSSSSSSGGGGGTTSGGHSHSGSRGSF"
FT   gene            305492..306484
FT                   /gene="ydjI"
FT                   /locus_tag="PPSC2_01345"
FT                   /old_locus_tag="PPSC2_c0271"
FT   CDS_pept        305492..306484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydjI"
FT                   /locus_tag="PPSC2_01345"
FT                   /old_locus_tag="PPSC2_c0271"
FT                   /product="ydjI"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01345"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54256"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECB3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820147.1"
FT                   /protein_id="ADO54256.1"
FT                   /translation="MGFFRNQFGNVVEWEEFRDDMIFWKWSNREIKKGSKLIIRSGQDA
FT                   IFVNNGKIEGIFENEGSYNMDSDIIPFLSTLKGFKFGFNSGMRVEVLFVNTKEFTVKWG
FT                   TQNPVLIPTPQLPGGMPIRANGTFNFKVNDYVTLIDKIAGVKDSYLVEDVKIRITSVLD
FT                   QLLMKWISREGKDMFNLQANASDISKGIQEDLDMQVMDKGMTITGFHVMSFNYPQEIQD
FT                   MITKTASHEMIGNLQKYQQVTMTDGIASGNVKGGGAASDMASMMMGMNIANEMMKNLNP
FT                   SQKSPAETQPASDAPTPSGEGKRPNFCPNCGTKNEGANFCPNCGQKLNG"
FT   gene            306745..310485
FT                   /gene="araF"
FT                   /locus_tag="PPSC2_01350"
FT                   /old_locus_tag="PPSC2_c0272"
FT   CDS_pept        306745..310485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araF"
FT                   /locus_tag="PPSC2_01350"
FT                   /old_locus_tag="PPSC2_c0272"
FT                   /product="alpha-L-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54257"
FT                   /db_xref="GOA:E3ECB4"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECB4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368899.1"
FT                   /protein_id="ADO54257.1"
FT                   /translation="MTKFQDQIIARYKFDDAENVGKDSSGQGNDGIASGTAAPTISHTT
FT                   GRAALALEGGPNGTSYIQLPSDLFKDVSDNTGVTVTAWVNFGRFTDMWERVFDFGKSHT
FT                   GPYMFMTRNLRGTLFTEADLSVDPGRGFVRDEWMHIALSVIGTEGGTLSSAGPVVYVNG
FT                   EVAADGSISQTSSGNYAKLRKWFETFADSTNYSNNFIGRSQHAADVDFAGLVSDFRIYK
FT                   AGLTADEVIEVMCDSLTDEEIVKLARDKYLSFPTTIITKDISLPTVLMGGRVEVTWKSS
FT                   QPSILSDNGRVQAITSAQGVTVTALLTRGSSRIEESFEVSVLPEQLPPYTLTIHGNKEV
FT                   VDVSEVMYGLFYEDINNAADGGIYAELVQNRSFESFEFDTYSHASGECGCSTGRNRNPL
FT                   FAWSGDTDKMNPQHSGGLNEFLGAKDKDVNSYYVTVADGATIRNKGFSDSNQNCAMSIQ
FT                   EGAKYEFTIWAKADSTGTITLQLQDSKEKDISDSVTVQVEGGSTWKKYGVDSKLVLTGT
FT                   ATVLGQLALTFEGDISIDMVSLFPQDVWGAGEEEQSPSAHANYQGNPNYRLRKDLVNAL
FT                   VGMHPKFLRFPGGCISEGSFIWENVYDWKESIGDIELRKENFNVWGYMMTMGLGYMEYF
FT                   QLAEDLNAAPLPVMACGVLCQARSDYAHPAGGALREYYIKNFTDLIDFAISVDFEHNEW
FT                   AAMRKKMGHEAPFDLRYLGVGNENWGTEFFANFEVFKTSIDEYMEKNYPGYELHIISTV
FT                   GAQADDDAYQQGWKFLSGNMKGSAKVAFADGNQVTEETVTWYEKQKDYMDTIADEHYYR
FT                   SNEYLLNNVDRYNYYYRAYNADGSVNWKETSKVFVGEYASTDKNTLAGAVAEAAVMTGF
FT                   ENNADVVRLAAYAPLFNKVLTDGTYRWTPDCIWFDDETVWFTPNYYVQQMYAQYLGDKV
FT                   LATSFSTYKNGKPIDLIPQGGIEIATGNAEVVVKRVTVTSNKDGSVLLDQDFTKELNSL
FT                   WKVIPGSVGSTLEEGKGLVLKAQDSGLNGLYILNDSWNNYKVEVVASRLSGTDGFYVGI
FT                   GLTDITTEKKNVIEYAIGYGGNATGVKVYKQGIEGYTMGDYSSSTAAGNLRAASYEELA
FT                   DNTDYTITVNYGGETGNNLICSYTDGKTTSKVLDYKLEAYNRDVFNSVTQDAEHVYVKL
FT                   VNADNVDKATQLNLEDMSVESIAKLITLTGDSSLVHVPNVNKKNDEKIVPTEQQVTLHT
FT                   NSVLLQLPANSVNVLVLDLKA"
FT   gene            complement(310627..312024)
FT                   /gene="phy"
FT                   /locus_tag="PPSC2_01355"
FT                   /old_locus_tag="PPSC2_c0273"
FT   CDS_pept        complement(310627..312024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phy"
FT                   /locus_tag="PPSC2_01355"
FT                   /old_locus_tag="PPSC2_c0273"
FT                   /product="3-phytase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54258"
FT                   /db_xref="GOA:E3ECB5"
FT                   /db_xref="InterPro:IPR003431"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECB5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599384.1"
FT                   /protein_id="ADO54258.2"
FT                   /translation="MKATKIALLTMLTGILVSPAIPHVAVAQPTGYESLRTQADKLGAK
FT                   ITWDSDDHSVLIKLKNGIVGTFTVGEKQYRLAGQSGKADREIKMINGNVYLPTKVITTL
FT                   EAENSKYTDPKDAVPTYKVLPSVETEAVEDGEDAADDPAIWLNPVDPDKSRILATNKGG
FT                   GILVYDLDGKQLQNMKVGKMNNVDLRYGFTLGGKKVDIAGATNRTNNTIDIFTIDGVSG
FT                   TLTNVVDKPIKATMKEVYGFSLYHSLKTGKFYALVLGKEGEFEQYELIDNGNDKIAGKL
FT                   VRQFKLATQSEGMVADDEYGTLYIAEEDYAIWKYSAEPDGPSKPLRRVDIADGRRLHDD
FT                   IEGLTLYYGKDGKGYLMASSQGNSSYAIYERQGDNAYISNFTIGDSPTVDGTSVTDGID
FT                   VLGYGLGKNFPHGIFVAQDDENLENGKKLNQNFKMVPWERIATGAPTPLTMDDGTNPRE
FT                   LVNRSSK"
FT   gene            complement(312124..312999)
FT                   /gene="araC5"
FT                   /locus_tag="PPSC2_01360"
FT                   /old_locus_tag="PPSC2_c0274"
FT   CDS_pept        complement(312124..312999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC5"
FT                   /locus_tag="PPSC2_01360"
FT                   /old_locus_tag="PPSC2_c0274"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54259"
FT                   /db_xref="GOA:E3ECB6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECB6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820150.1"
FT                   /protein_id="ADO54259.1"
FT                   /translation="MSKTDFLSFLVPPLPYFIEGNFTTYQKGDWHPNRYHLGYFDVIII
FT                   KEGLLHIGEEDESWKITENHALILEPDKHHFPIEACTEQTSFYWFHFQTNSMWCAQSSP
FT                   NLIIPSTPIPELHFHSEHTTIHLPKYQKLINPHELFSKLDYLLASTLKTRKLALWETQQ
FT                   TFVNIFQSLEYDENYKSSSSKLAEQIEIFLKQNYRNAITNKDLEAHFHVHQNYLARCMK
FT                   ATFQRTPLEYLMDYRLDQGRSLLLQTDWSIQQITEETGFSQASYFSKCFKERFGMSPKN
FT                   YRQQYWKPAN"
FT   gene            313193..315136
FT                   /gene="araC5"
FT                   /locus_tag="PPSC2_01365"
FT                   /old_locus_tag="PPSC2_c0275"
FT   CDS_pept        313193..315136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC5"
FT                   /locus_tag="PPSC2_01365"
FT                   /old_locus_tag="PPSC2_c0275"
FT                   /product="araC5"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54260"
FT                   /db_xref="GOA:E3ECB7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECB7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368902.1"
FT                   /protein_id="ADO54260.1"
FT                   /translation="MKTAKPVKHVIVDDSFWKKYKQVVAEEVIPYQWKALNDELPDTEP
FT                   SHAIENFRIAAGESSGEYYGTVFQDSDLAKWLETVAFSLRDHPNSALEERADEVIDLLG
FT                   RAQAEDGYLNTYYLLKEPDNRWTNLRDNHELYCAGHFIEAAVAYYETTGKTKFLNIMEK
FT                   YVDLIQQIFGTEEGKRKGYPGHEEIELALIKLYDVTAKDQYLKLAQYFIEQRGQHPIYF
FT                   VEEQEKRKHIQTEPTWNDDNNINFGLGFEYQQAHQPVREQKEAVGHAVRAVYLYIAMAD
FT                   LAAKTGDASLLQTCETLWDDVTNHKMYITAGIGSTVNAEAFTCHHDLPNDSMYCETCAS
FT                   VGLAFWANRMLRLAPDRKYADVLERALYNGTISGMDLDGKRFFYVNPLEVNPFQKSRKD
FT                   QEHVKTERQKWFFCACCPPNLARMIASVEDNMYTQTEDTLYTHLYIASKVNMTLSGQEI
FT                   EITQTHHYPWDADLALSIHVTEPTAFKWALRIPGWCKQAEVKVNGEVISLDHLEKGYVE
FT                   IQRTWKDGDMVTLHLAMPVERIRSNPLVSMNQQQVALQRGPVVYCLEEADNGANLAGLR
FT                   LPKDNPVTEEFSENLLGGIVKLTIEGYRVKGSNALYSSEPPELVPQQITAIPYYAWCNR
FT                   AKGEMRVWFYES"
FT   gene            315164..316534
FT                   /gene="melB"
FT                   /locus_tag="PPSC2_01370"
FT                   /old_locus_tag="PPSC2_c0276"
FT   CDS_pept        315164..316534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="melB"
FT                   /locus_tag="PPSC2_01370"
FT                   /old_locus_tag="PPSC2_c0276"
FT                   /product="sodium:solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54261"
FT                   /db_xref="GOA:E3ECB8"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECB8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427857.1"
FT                   /protein_id="ADO54261.1"
FT                   /translation="MSTRIVSTEPPEKAASTVPFHRKISYSLTDTAGNLLYCVISSYLL
FT                   YFYTDVFGLSIGIAGTLLFITRFIDAIDAPIWGILIDRTKSKYGQSRPYFLWLAVPFAV
FT                   FMVLTFTTPNWSESGKIAYAAITYIIAGILYTGISTPITSILPNLSTNSNERVVLNSFR
FT                   MVGGNVGFFIATTFTLPLVAFFGQGNDQKGFSLTLVLFGIMAIIMFFIAFADLRENAAV
FT                   KTKSVPIAKSFTAIKRNWPWMLVVAANLCYWIGLNIRSATLIFYLQYNLDSKDLVPLIN
FT                   GLTSLQLISMVLIPLFARKLSKNTIMIIGLILAALGQVVILMGSTNLTLIIAGWIIGAL
FT                   GSGFACSMPFAMLSDTVDYGEWKNGIRASGFLTSIGSAFCIKAGSGIGGLLPAWVMGST
FT                   GYIAGKVQTPTALSGIQFSFIWLPFIVFLIGIIPMFFYKKFEKNEASIQQDLIARRS"
FT   gene            316811..318202
FT                   /gene="yeeO"
FT                   /locus_tag="PPSC2_01375"
FT                   /old_locus_tag="PPSC2_c0277"
FT   CDS_pept        316811..318202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeO"
FT                   /locus_tag="PPSC2_01375"
FT                   /old_locus_tag="PPSC2_c0277"
FT                   /product="multidrug transporter MatE"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01375"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54262"
FT                   /db_xref="GOA:E3ECB9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECB9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368904.1"
FT                   /protein_id="ADO54262.2"
FT                   /translation="MSQLSVRMRTHGFLNRHFSGESIDYRQMIALFIPLLIDQAFIVGL
FT                   NLVNTAMISSSGMAAVSAVNMIDSLNIFLINVFVAVSTGGTVVVAQYKGSGNDLMVSKA
FT                   TSGTISSVSLLALCISLFMILLYNPILSVLFGSASADVLANGKVYLLGSCMSFVGIAIV
FT                   EAVCGALRGIGKTRASLALSLIMNLSYVLLNVVFINLLDMGVLGMTIAVNVSRYAGAAC
FT                   ALIYLVRVDDDLRVQLRDMLYFNLAMLKKILFIGLPFAAEQMFFNGGKILTQIFIVNLG
FT                   TNALATNAICSSLANVFQIPANALALTIVTVVGQCMGRRNVHDARKFTKSFIWLSSGSF
FT                   IVMGLILMPLFKPMVGLFHPPAEIVDDIFMVMLINTLAQIPLWSIAFITPSALRAAGDS
FT                   KFTSLTSMLSMWLCRVVLGYVLGIVFNLGIVGVWLAMDIEWGVRGIVFLWRFRGNKWVQ
FT                   HRLID"
FT   gene            complement(318289..319278)
FT                   /gene="yogA"
FT                   /locus_tag="PPSC2_01380"
FT                   /old_locus_tag="PPSC2_c0278"
FT   CDS_pept        complement(318289..319278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yogA"
FT                   /locus_tag="PPSC2_01380"
FT                   /old_locus_tag="PPSC2_c0278"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54263"
FT                   /db_xref="GOA:E3ECC0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECC0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368905.1"
FT                   /protein_id="ADO54263.1"
FT                   /translation="MKAVIHTDKHGLEGLMYKDVTDRQPGHSEVKVRLKAAGLNHRDLF
FT                   LMADRTANDAPLILGSDGAGVIEAVGAGVPTSLVGTDVIINPCIGWEKTNHVPLVPAIL
FT                   GVPSDGTLAESVIVPVQNAVSKPAYLSWEEAGVLPLSALTAYRALFTRGQLQQGDHVLI
FT                   PGIGGGVATYAMLMALAAGARVSVTSRSEAKKQAALAHGAHHAFDSDSDWKESMNGDTV
FT                   DLILDSIGPATFDKYLDVIKPDGRIITFGASSGDQIEIPLRSIFFPQISIIGTSMGSGE
FT                   EFADMLQFMERHSLHPIIDSVFPLQDTAQAFYRMQQGVQLGNIGIRIE"
FT   gene            319413..320285
FT                   /gene="gltR1"
FT                   /locus_tag="PPSC2_01385"
FT                   /old_locus_tag="PPSC2_c0279"
FT   CDS_pept        319413..320285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltR1"
FT                   /locus_tag="PPSC2_01385"
FT                   /old_locus_tag="PPSC2_c0279"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01385"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54264"
FT                   /db_xref="GOA:E3ECC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECC1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368906.1"
FT                   /protein_id="ADO54264.1"
FT                   /translation="MESSDLKIFRAVAREGSITRAAQVLNYVQSNVTSRIQQLEAQLNV
FT                   PLFRRSNRGMTLTSAGENLLEYAESILTLLDEAEKSTQYSDQPAGPLRLGSIETTAVTH
FT                   LTTLLTGYYAEYPNVQLSLMTGGTHALVQKVLNYELDGAFVYGPVDDPNIEHVAAFEEE
FT                   LVLISEPGESDMSKLLAKPMLFFDVGCTHRARAESFLSDAGVDAYQIMEFGTLEVILGG
FT                   VASGLGVSMLPHSSIVKAKKEGSIASHRLPETYRKLEVWFVHRRDSVYSSALSGLLHWM
FT                   KKDVILNWD"
FT   gene            320308..321411
FT                   /gene="M1-418"
FT                   /locus_tag="PPSC2_01390"
FT                   /old_locus_tag="PPSC2_c0280"
FT   CDS_pept        320308..321411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-418"
FT                   /locus_tag="PPSC2_01390"
FT                   /old_locus_tag="PPSC2_c0280"
FT                   /product="M1-418"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54265"
FT                   /db_xref="GOA:E3ECC2"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECC2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427853.1"
FT                   /protein_id="ADO54265.2"
FT                   /translation="MEEHNLSKNPSTVAPGEFVRNGGYQRREPDRMAVLSETYGASIFF
FT                   RRWAAWMIDFILIVFGYGGLVYFIAKKVAEAEIPNMGMVVILFLIGSFCYYLLLEGLTG
FT                   YTLGKFVLRIQVVNGEGMPPGMIKSLIRTLIHLVDTNPLLFWGLPAGICVLVTPRKQRI
FT                   GDMAANTYVVRTRDLGKVSKKKTGIIAGAIILMTITSIVFAVSLISTLITQIVKPEVFT
FT                   SKDNQFAVTAPWNWSRDNRINEEADISIKNEFTDRYLIVLSEPKSDFDSSMTLQEYKGI
FT                   IEDHLVSGITDPELGTASDMVVNGYPAIEFTLKGEIDGNLAMYNVTTIETPSHYHQVLA
FT                   WTYASRYSRAQQELRKIRDSFREMNMM"
FT   gene            complement(321516..323777)
FT                   /gene="M1-419"
FT                   /locus_tag="PPSC2_01395"
FT                   /old_locus_tag="PPSC2_c0281"
FT   CDS_pept        complement(321516..323777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-419"
FT                   /locus_tag="PPSC2_01395"
FT                   /old_locus_tag="PPSC2_c0281"
FT                   /product="acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01395"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54266"
FT                   /db_xref="GOA:E3ECC3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECC3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368908.1"
FT                   /protein_id="ADO54266.2"
FT                   /translation="MILKAQAFDLHKVSIDSGPLYHAMELNTTYLLSLEPDRLLSRFRE
FT                   YAGLEPKAAHYEGWEARGISGHTLGHYLSGCALMFASTGDKRLLERVNYVIDELEICQN
FT                   SHGNGYISGIPRGKEIFEEVKAGDIRSQGFDLNGGWVPLYTMHKLFAGLRDAHLLAHHP
FT                   KALAMEIQLGDWLEDVFQGLSDEQVQQVLHCEFGGMNEVLTDLAEHSGEKRFLNLAERF
FT                   YHGEVLNDLADSRDTLAGRHANTQIPKIIGAARQFEVTGKPLYADLSRFFWDRVVHKHS
FT                   YVIGGNSYNEHFGEPGKLNDRLGEGTCETCNTYNMLKLTRHMFEWDAYAAYADYYERAM
FT                   FNHILASQQPVDGRVCYFVSLEMGGHKSFNSQYEDFTCCVGSGMESHSMYGTAIYFHTA
FT                   NTIYVNQYVPSTVTWDEMNIQLKQETLFPQNGRGTLHLISKEPKFFTIKLRCPHWAEQG
FT                   MKIKINGEEYAAEACPTSYIVIEREWKDGDTVEYDIPMTVRVEEMPDNPRRIAFMYGPL
FT                   VLAGDLGPVVQESNEERLLASVLIGSADSLTTKLIADGNETNTFHLNDLGYIRDLQLRP
FT                   FYQIYDRSYTVYWDLFSKEEWAATEAEYRTALAYQLELERLTVDVVQPAEMQPERDHAF
FT                   TGEHVGLGSIYNRKYRDTWSGGWFSFVMKVLPDKPVQLAVTYLKDSDRSHRDFDITADG
FT                   QNLGEGKLKSEEMNKFETFIYELPLSVTNEKNEVTIRFTAQPQGKVARVAGLRVIKSHL
FT                   "
FT   gene            323902..324795
FT                   /gene="yisR1"
FT                   /locus_tag="PPSC2_01400"
FT                   /old_locus_tag="PPSC2_c0282"
FT   CDS_pept        323902..324795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yisR1"
FT                   /locus_tag="PPSC2_01400"
FT                   /old_locus_tag="PPSC2_c0282"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54267"
FT                   /db_xref="GOA:E3ECC4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECC4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308292.1"
FT                   /protein_id="ADO54267.1"
FT                   /translation="MTYLKVNVDAPIQLISAGEFVSEVPWKHMSRSIENFELILGVQET
FT                   VYIREEEEYFEVGEGDILLLYPGRTHRGYRESLPGVKFYWFHFDVPATPNVLSSEEMKQ
FT                   ETSAMDGLVQRHGVIRDIYLPQSVQADNGDRIHIIVNQILHVANSHYLTYHSANYLFTS
FT                   LLIEISELALSRLISNPVHSQGNVSMNKIIEWTRIHAGEPLTVTDLAQKFNYNKDYISR
FT                   LFMQNTGMRPLEFIHSIRINKAKELISRTNMSIKQVAEEAGYTDEKYFMRLFKKRVHMT
FT                   PSQYRNAYHKTFMNNV"
FT   gene            324911..325849
FT                   /gene="ywqG"
FT                   /locus_tag="PPSC2_01405"
FT                   /old_locus_tag="PPSC2_c0283"
FT   CDS_pept        324911..325849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywqG"
FT                   /locus_tag="PPSC2_01405"
FT                   /old_locus_tag="PPSC2_c0283"
FT                   /product="ywqG"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01405"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54268"
FT                   /db_xref="InterPro:IPR015315"
FT                   /db_xref="InterPro:IPR035948"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECC5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425621.1"
FT                   /protein_id="ADO54268.1"
FT                   /translation="MLQSPLKEELTRILEEHSLDDELKEEIYQEAEATIQFQLEHEENY
FT                   ENVGNSRIAGYPDLPPTIEWPCNSDGEYYTFIAQINLSELPFSPFEGLPHQGILYFFLG
FT                   LDEPAYDIEHKIFYYNGDSSALQKTLPPAGRVEVSVEQRDFTAYAISFHPILTLPSEGE
FT                   LGDILLDQYEELYELLYEHSDTVWGQHQSFAGNTRRDAYLCRNGLKGLLFNWHKSEGQI
FT                   HQEAEQAMHRGSTEYAEHLRSEVLPQLQEYQANREKHDQASENWHVLLSVSSLNEVGMC
FT                   WWDAGYLEFFIDQRDLKNLDFSRTYVNLATS"
FT   gene            326087..326605
FT                   /gene="sigW1"
FT                   /locus_tag="PPSC2_01410"
FT                   /old_locus_tag="PPSC2_c0284"
FT   CDS_pept        326087..326605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigW1"
FT                   /locus_tag="PPSC2_01410"
FT                   /old_locus_tag="PPSC2_c0284"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54269"
FT                   /db_xref="GOA:E3ECC6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECC6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368911.1"
FT                   /protein_id="ADO54269.1"
FT                   /translation="MTDRELFELYKEQIYYFCYYLMQNQADAEDVCQEVFVKAILADRS
FT                   KVQDLKSWILRIASNECSNVLRRRKTGLMKEIRTFLLSRPHSFNPVEESLYHRETKTEL
FT                   HQLYNKLPDKIRMVVVLRYVNELTVPEISRVINIPEGTAKSRLNRGLKLLKKMVVSQVK
FT                   EMNSSESVF"
FT   gene            326589..328205
FT                   /gene="M1-423"
FT                   /locus_tag="PPSC2_01415"
FT                   /old_locus_tag="PPSC2_c0285"
FT   CDS_pept        326589..328205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-423"
FT                   /locus_tag="PPSC2_01415"
FT                   /old_locus_tag="PPSC2_c0285"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01415"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54270"
FT                   /db_xref="GOA:E3ECC7"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECC7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368912.1"
FT                   /protein_id="ADO54270.1"
FT                   /translation="MSRYFEKEQHIPQPEYDAMWVNIEQEATKRKATLQQSQEAPMHRT
FT                   KIVPASIVFSCFLLIAIPVFASVTINWDRIGGRSVTNAINSGIGQRYDLKVTDAGITMN
FT                   LNGVVTDGEKMKMLISLDPGTDPSSYIGFAIEKTMVTSNSNNKERAHGYLNYDPKSQKL
FT                   LGIYETVDTLKDRKKDYTLEAQNLIFYRNQDIPLKTNHQAGDTLVTGTKQYPNIYIESV
FT                   RQTNNKTVVRFRVAAAPSDLGRGNPHLVMKVGDKEIDAIPTILPSDSPELHIEQVFNMT
FT                   AQDWRKANLHFCYIEEAKRIEGTWKFEFEADGKKASEAIYSKKLHSSAEFQENTGATLD
FT                   QLIITPLDIEILVTERDSLKKGNVHYKTAQLVIGDKKINGGWNLKGAGPENYQHLYQFE
FT                   SSEWYKDWSDVPMKLILKDAVIQKRDTSKNWITLHKPKEEKQFAELNVDGYQIDFTYYT
FT                   EGKDVIVESKSVSPGFKGVNQTTMRINGKEVVPEIIAKGMVSTGVNVDRYKDIELDGKV
FT                   ELNPGLYKYSDPGRNIEVVLK"
FT   gene            complement(328378..331422)
FT                   /gene="lacZ1"
FT                   /locus_tag="PPSC2_01420"
FT                   /old_locus_tag="PPSC2_c0286"
FT   CDS_pept        complement(328378..331422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ1"
FT                   /locus_tag="PPSC2_01420"
FT                   /old_locus_tag="PPSC2_c0286"
FT                   /product="beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54271"
FT                   /db_xref="GOA:E3ECC8"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECC8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685818.1"
FT                   /protein_id="ADO54271.1"
FT                   /translation="MTIHTPSLDWLTDVTKFAVNRLPAYSDHKYYATLQEAEHQADMAW
FT                   RHSLNGSWKFNYATNPATRPVEFYAPDFEYGGWSDIQVPGHIQTQGFGQMQYANTMYPW
FT                   DGHSDVRPPHIPEDHNPVGSYIKRFVLPENMASDAQPVFISFQGVESAFYVWLNGQFVG
FT                   YSEDSFTPSDFELTPYLQAGENKLAVEVYQRSTGAWLEDQDFWRFSGIFRDVYLYTIPT
FT                   VHVRDLHAKADLDATYTQGLLELKLTLEQPATAHTTVDVKDAAGHIVACLKADFTDGIA
FT                   SLSATLEQVERWSAEKPYLYTLFIQIYDADGSLVEVIPQKVGFRKFEMVNKVMHLNGKR
FT                   IVFKGVNRHEFNARTGRAISREDMLWDIRTLKQNNMNAVRTSHYPNQTLWYELCDEYGI
FT                   YVIDEMNLETHGSWQKLGAVEPSWNIPANLPEWQDIVMDRAISMLERDKNHASILIWSC
FT                   GNESYAGEVLRNVANYFRSTDPSRLVHYEGVFHNRTYDDTSDMESRMYAKPADIEQYLN
FT                   DNPQKPYISCEYMHAMGNSVGGMHKYTELENKYELYQGGFIWDYIDQAVMKKDRYGREY
FT                   LAIGGDFDDRPTDYGFCTDGIVYADRKVSPKMQEVKFLYQNLKLIPDTQGVTIRNENLF
FT                   EGTGDYELVYSLLHEGQEIARNVSHVDVAAQTEAYIPLTFPSTDEKPGEYVIHTALVLK
FT                   EATLWAKAGHEVAFGQHIFIVEDPNPLKAPIAGALRVVHGDVNIGVHGTDFTIMFSKGA
FT                   GSLTSLRYAGREMIATPPAPLFWRATTDNDRGTALGFEAGGWFAASLTRKCVDIEVTEE
FT                   QTDRVTITFRYTLSIHADVQVTVTYTVLADGSLNVKSTYEGVSGLPTLPIFALSFKVPA
FT                   DYRHLDWYAMGPEENYIDRALGARLGVFRNEAADNVSGYVVPQESGNRTGVRRVDITDD
FT                   SQRGIRITAPATAPVECNISPYTAFELESAGHLYELPNVYYTVVTVAGKQMGVGGDDSW
FT                   GAPVHEEYQIPADQKLEFEFTVQRI"
FT   gene            complement(331474..332298)
FT                   /gene="araQ1"
FT                   /locus_tag="PPSC2_01425"
FT                   /old_locus_tag="PPSC2_c0287"
FT   CDS_pept        complement(331474..332298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araQ1"
FT                   /locus_tag="PPSC2_01425"
FT                   /old_locus_tag="PPSC2_c0287"
FT                   /product="lactose ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01425"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54272"
FT                   /db_xref="GOA:E3ECC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECC9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368914.1"
FT                   /protein_id="ADO54272.1"
FT                   /translation="MMKTKRAFTYAFLILVSFISIFPFLWMLSSSTNLSVDVTKGKLLP
FT                   GSHLMDNMHNLLEQVDIVTALSNSAKVSISTTLLAMLIASLAGYGFEIYRSKAKDVVFN
FT                   ILLMSMMIPFAAIMIPLYRMFGSISNVIPWIGIDTLSSVVIPTVTTAFLIFFFRQSTKM
FT                   FPKDLLEAGRMDGLSELGLFFRVYMPTMKTTYAAAAIITFMSSWNNYLWPLIVLQTPEN
FT                   QTIPLLISNLGSSYAPDYGVIMIAIVLSTLPTALVFFLMQKHFVAGMVGSVK"
FT   gene            complement(332295..333191)
FT                   /gene="lacF1"
FT                   /locus_tag="PPSC2_01430"
FT                   /old_locus_tag="PPSC2_c0288"
FT   CDS_pept        complement(332295..333191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacF1"
FT                   /locus_tag="PPSC2_01430"
FT                   /old_locus_tag="PPSC2_c0288"
FT                   /product="lactose ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54273"
FT                   /db_xref="GOA:E3ECD0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECD0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279253.1"
FT                   /protein_id="ADO54273.1"
FT                   /translation="MKTAAPKMTTTRLKAGMTGWLFISIAVIMIAAFYFYPMIQALILS
FT                   FKTGTGSNLSFNGIDNYKRLFTDKMFITAVKNTFIYLIFQVPLMVILALFISVLLNDKN
FT                   LKFKGFFRTAIFLPCITSLVAYSVVFKYLFSSDGLVNSLLLNLHVIGTPIQWITDPFWA
FT                   KVTIIIAITWRWTGYNMIFYLSGLQNIDSSIYEAARIDGASPIRQFFSITVPLLKPIIL
FT                   FTSITSTIGTLQLFDEIMNITKGGPGNATSSISQYIYNLSFKYSSDFGYAATVSYSIVI
FT                   MIIILSIIQFKVAGEKK"
FT   gene            complement(333293..334582)
FT                   /gene="lacE1"
FT                   /locus_tag="PPSC2_01435"
FT                   /old_locus_tag="PPSC2_c0289"
FT   CDS_pept        complement(333293..334582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacE1"
FT                   /locus_tag="PPSC2_01435"
FT                   /old_locus_tag="PPSC2_c0289"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01435"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54274"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECD1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368916.1"
FT                   /protein_id="ADO54274.1"
FT                   /translation="MKKMSFLLLIASLILLSACSSNSEKAATTTDSGKKEITVWAWDPN
FT                   FNIAALKLAKDRYVAKHPDVTVNIVEYAQNDIVQKMNAGLNSGSTKGLPNVVLIEDYRA
FT                   QNFLQAYPDSFHDMTNSIKASDFADYKIGPTSYNGKQYGVPFDSGVMGLYVRTDYLEQA
FT                   GYKVADLTNIDWDKFIEIGKAVKQKTGKDMLTQDPNDLGLIRGMIQTAGSWYLKEDGKT
FT                   PNLAGNPALKEALLTYKSLFDANIVKMNADWSQFLAAFNSGAVASVPTGNWITPSIKAE
FT                   ASQSGKWAVVPFPKLKNIPESVNASSLGGSSWYVLNSDGQDTAADFLKETFGSDPELYQ
FT                   DMLSKIGIVGSLNAASSGKAYDVEDAYFGGDKVYKKFADWTKQVPKVNYGLHTYAIEDI
FT                   MTVEIQNYLNGKDVDTVLKDAQGQAEAQLK"
FT   gene            complement(334871..336685)
FT                   /locus_tag="PPSC2_01440"
FT                   /old_locus_tag="PPSC2_c0290"
FT   CDS_pept        complement(334871..336685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_01440"
FT                   /old_locus_tag="PPSC2_c0290"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54275"
FT                   /db_xref="GOA:E3ECD2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECD2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425626.1"
FT                   /protein_id="ADO54275.1"
FT                   /translation="MKRYIHKIKYQGLFFKIFIVMVISITAVSLLTSLVTIRMSERLFA
FT                   ETFSITNAKVLSQIQSSFESFNDSIVNAVTHASENGTVKNYLTGGQSDSINSARIYFGM
FT                   AQQMKQIKSNVDAYDVGVAVTGMNGRSFYSDSSYWPVTAEQLKSSSITARSVARPAQLM
FT                   YQMDTELFHQQMNSTAQKPTPYIIASKVFMERTSGTMYGMIYIAIREPEFRRFYNNFTS
FT                   NGNDVLIMDKSGLIVSSNRQDLIGQRSSELLGYATKINEQGLNYINADVMNKESIVLSN
FT                   YIPSFDFYLVNMIDRQTAVGQIIDVKSVVWICIAIVLIALVIVFLISRRLIRSLTRLVK
FT                   QMSTIREKNFDNYIPVTGSYEVRQLSHAYNYMLDELNDYIRKLLETQKGQRNAELAALQ
FT                   RQINPHFLYNTLASIKMLVLKGNKETAAETINALISLLQNTISNVSETITIEQEMANMQ
FT                   NYVFINHVRYGQRVQVNYFVSPDCLEYHVPKLIIQPFIENSFFHAFNEKNAGHIYILVS
FT                   KTDDTLICEVVDDGDGMDLDGHTVQDGLPNPKSKRQLFTGIGIQNVHNRITLLYGEEYG
FT                   VTISSKKGEGTKVRMTLPLILKPVPPTP"
FT   gene            complement(336725..338290)
FT                   /locus_tag="PPSC2_01445"
FT                   /old_locus_tag="PPSC2_c0291"
FT   CDS_pept        complement(336725..338290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_01445"
FT                   /old_locus_tag="PPSC2_c0291"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01445"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54276"
FT                   /db_xref="GOA:E3ECD3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECD3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425627.1"
FT                   /protein_id="ADO54276.1"
FT                   /translation="MNELCNILIVDDEILVRQGIKHHLSWEQYGFRIVGEASNGKEALE
FT                   LIEALRPHIIITDIVMPIMDGEELTRIVRQNYPDIEVIVLSSYGEFNYVRSTFQQGVAD
FT                   YILKPKLDTDELLQVLQRTARKIPSIQYQEDAGNNRITIDHVIEKLTSGYSIDYDAELL
FT                   KQAFPYPRFALIGIEQSVQQDKGRSTTTSASDLFSKLTDRLASACEHMVLRQLPSDVYT
FT                   AVFLANLEPRELDAWMAAVREVAQETKQVEPQTGWAVSHLFDDFNQISNVYQDELPKLL
FT                   SYRFYFPETALLMEDELPQPVQVNSSFNLKQFTEEMKREHFDTAFQDLRSYVAAMSGNY
FT                   TSTAFEFKSLLGNIVFNITILLGNQGYDMKELDAAKYSYFKTINDAPHVHEAVRLLETF
FT                   LEEANRQILAKTQQGSSASMKKLLEYIEEHHAETLNLTTLGQYFHFNPSYLSSYFTAHH
FT                   TEGFSEYLNKIRVEKAAELLRSGTLPISDISSTVGYSDPSYFTKVFKKVKGYSPSQYRR
FT                   EHLH"
FT   gene            complement(338526..339161)
FT                   /gene="udk"
FT                   /locus_tag="PPSC2_01450"
FT                   /old_locus_tag="PPSC2_c0292"
FT   CDS_pept        complement(338526..339161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udk"
FT                   /locus_tag="PPSC2_01450"
FT                   /old_locus_tag="PPSC2_c0292"
FT                   /product="uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54277"
FT                   /db_xref="GOA:E3ECD4"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECD4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368919.1"
FT                   /protein_id="ADO54277.1"
FT                   /translation="MLIIGIAGGTGSGKSTVARAVVERLGSNKVTFISQDNYYKDHSHL
FT                   SYDERALVNYDHPFAFDNDLLIEHLQCLKKGQATQAPVYDFTVHARSTDETVELLPNHI
FT                   VMLEGLHVLSDEKLRSLLDIKVFVDTDPDVRILRRVLRDIEERGRTIHSIHDHYLTTVK
FT                   PMHEAFIEPSKKYADLILPEGGHNEVGIQLLSILTEKYLAGDRTWGTV"
FT   gene            complement(339237..339758)
FT                   /gene="M1-431"
FT                   /locus_tag="PPSC2_01455"
FT                   /old_locus_tag="PPSC2_c0293"
FT   CDS_pept        complement(339237..339758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-431"
FT                   /locus_tag="PPSC2_01455"
FT                   /old_locus_tag="PPSC2_c0293"
FT                   /product="M1-431"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54278"
FT                   /db_xref="InterPro:IPR012550"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECD5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368920.1"
FT                   /protein_id="ADO54278.1"
FT                   /translation="MSSYEYASKSELKEAIHTSYLRFDSEFQEIDESHKDTRIDEVDKT
FT                   PAEMIAYQLGWLHLVMSWDRDEQEGKTVIMPAPNYKWNRLGELYQSFYKTYSDHSLYEL
FT                   RNMLKLAEQTWLNWVDTLSHEELFTQGVHKWTGTNPNWPMARWIHINSVAPFKTFRAKI
FT                   RKWKKYNAQQ"
FT   gene            complement(339912..340871)
FT                   /gene="nmrA"
FT                   /locus_tag="PPSC2_01460"
FT                   /old_locus_tag="PPSC2_c0294"
FT   CDS_pept        complement(339912..340871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nmrA"
FT                   /locus_tag="PPSC2_01460"
FT                   /old_locus_tag="PPSC2_c0294"
FT                   /product="NmrA family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54279"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECD6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279106.1"
FT                   /protein_id="ADO54279.1"
FT                   /translation="MRYIITGVDGQLASRVAETVLEEVDGHNLTFTCMKKDRIPKARVQ
FT                   RWENAGVKIFEINYDDIPSMERAFKNGDRIYIVSGLEVGKRVQQHKNAIDTAIKAGISH
FT                   ITYSSFIGATDPKYAHVFVTPDHTATENYLKSTGIAYNAMRNNLYLENYLTMYPMLALM
FT                   SDNKWLSTAGEGRATLVHKDDCARAAAAALLGKGEDNKAYNIVGSESVSVRDLCNLIKE
FT                   ISCKDLEYIPVNPEQYYEYLKKLHIPKEITGDFSQSPVPFCGEDLMTTDASIQEGLLNV
FT                   ESNAIELLTGQKPKTAKDIVEKYKYIWEENIQNWRDMK"
FT   gene            340994..341875
FT                   /gene="lysR7"
FT                   /locus_tag="PPSC2_01465"
FT                   /old_locus_tag="PPSC2_c0295"
FT   CDS_pept        340994..341875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR7"
FT                   /locus_tag="PPSC2_01465"
FT                   /old_locus_tag="PPSC2_c0295"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01465"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54280"
FT                   /db_xref="GOA:E3ECD7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECD7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368922.1"
FT                   /protein_id="ADO54280.1"
FT                   /translation="MNIQQLKCFVSLAETLNFSTTANKLNLTQPAVSHNIKSLENELGI
FT                   VLVVRNKRTVNLTVAGNSFYEDIEGLLFRLDQSIKKAKRLSEKYDSTLIIGYTETVFEK
FT                   KVLPDIIKRFKEKYPQIQIQLKKSNLTREKDDLLNQKFDIIFTTEDNLGKDIDFCFYPV
FT                   LKGSYVCVLPQNHPLANERELTFEQLNHKSIILFNEHQSPPTLKSMHRKIIENCPESSF
FT                   TYGDTINTIHTMIKSDLGVSVLPNFVVVEDNEISFVPLSYTEEVIYGVACLRGEERLEV
FT                   KRWISTLKELLT"
FT   gene            342044..342283
FT                   /gene="insK1"
FT                   /locus_tag="PPSC2_01470"
FT                   /old_locus_tag="PPSC2_c0297"
FT   CDS_pept        342044..342283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insK1"
FT                   /locus_tag="PPSC2_01470"
FT                   /old_locus_tag="PPSC2_c0297"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54282"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECD9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368924.1"
FT                   /protein_id="ADO54282.1"
FT                   /translation="MGNSVGYPDLFNNGIVAWRLSQRNDLALVNETLDALSKDVNIEGV
FT                   ILHSDQGFQYTSKPFNRKLKSSESLEAIPGEETV"
FT   gene            complement(342547..343482)
FT                   /gene="ybfA1"
FT                   /locus_tag="PPSC2_01475"
FT                   /old_locus_tag="PPSC2_c0298"
FT   CDS_pept        complement(342547..343482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA1"
FT                   /locus_tag="PPSC2_01475"
FT                   /old_locus_tag="PPSC2_c0298"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54283"
FT                   /db_xref="GOA:E3ECE0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECE0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368925.1"
FT                   /protein_id="ADO54283.1"
FT                   /translation="MNSTYTSIVHSIRKFNRFYTNVLGLLEQYLLDSEFSLSEARVLYE
FT                   LNNIENCTSKKLIEALRMDSGYLSRMMKRFEAFNLTYKVRSAEDGRLYFLYLTDKGRET
FT                   LARLDALSDQQISQMVDKLQVHNQKKLVEGMEMIESALTDNPVSTEEKISIRSEIRAGD
FT                   IGYLIYLHGWIYAKECGYNHVFEGYVCKTFYEFLENYSPEKDRIWLAEANGIIIGAIAI
FT                   IGHTSEKAQLRWFILHPDFRGMGLGKRLLSQATQYCREKGYRQVYLETTEDQKHAIHMY
FT                   TQAGFRFKKEYRSSAWGVDHVELTYEWNLS"
FT   gene            complement(343749..344048)
FT                   /locus_tag="PPSC2_01480"
FT                   /old_locus_tag="PPSC2_c0299"
FT   CDS_pept        complement(343749..344048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_01480"
FT                   /old_locus_tag="PPSC2_c0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54284"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECE1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007429858.1"
FT                   /protein_id="ADO54284.1"
FT                   /translation="MTVNDVMKISSIDRSSLASDPVSFKAGIGLADRGLGKHLALELLK
FT                   RGAKVYTGAINPDSVVAATKVAKNVRSLRNNLLSKDRFSSFYLSVNNGLTYSDA"
FT   gene            complement(344176..344520)
FT                   /locus_tag="PPSC2_01485"
FT   CDS_pept        complement(344176..344520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_01485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01485"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZC78"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308308.1"
FT                   /protein_id="AKA44179.1"
FT                   /translation="MAIRPPQTLKSTGRKVPVTRYRNVSPTQTLRRFTVIWANNDGVPF
FT                   NTSGFFATLRRLDGTFVQAAGFDRFGTARFNRVRTPTNQPYILRTFRDDGVLFRVRSVP
FT                   AGVSSFVVIG"
FT   gene            complement(344633..347596)
FT                   /gene="ywqA"
FT                   /locus_tag="PPSC2_01490"
FT                   /old_locus_tag="PPSC2_c0301"
FT   CDS_pept        complement(344633..347596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywqA"
FT                   /locus_tag="PPSC2_01490"
FT                   /old_locus_tag="PPSC2_c0301"
FT                   /product="helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54286"
FT                   /db_xref="GOA:E3ECE3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECE3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368928.1"
FT                   /protein_id="ADO54286.1"
FT                   /translation="MSQYTETITVHIQLTTYGDALIYGDSSMNYSISGQMLKQRLFAWH
FT                   EASFYGTELEIQHVQDTDIIVLPSEQVIPFLAEQELLQHIEWIWDEANAPWLRLIPLLA
FT                   HCIETKAYVPNFTSFQAGKLQWKWDAEALENIQPAELALLDNLDENEREGLVAAFSAAV
FT                   FQRWYGTEAEAADLRREYPVLFAPNRQAAAGLDAQVWLIAIGWKADTAPFRPLLQLLEP
FT                   ELEDDEPSWKLKLVLQDKQDPALLVPVQLADDGYASGSWPDAWTVHVRERSGGWLERLT
FT                   AILPAGQRAGSRDGILSRPLSDEAAWQFLTTDSQRLLESGWQVLLPAWWEAATRKKPKL
FT                   RAKVRPGEGAGERSKGSSLFGLDSIVQFDWRVAIGDADLSESEFAELVARNERLVRFRG
FT                   QWIALDPALLAQIRRAMDGIDSAQGLSFQDILQLHLLGNTDEPEGDASGEQPEDPARFR
FT                   LEVELNAHLLKLISQLGRQSEWPALDVPDGLQAELRTYQRDGYAWLAFLRRFGLGACLA
FT                   DDMGLGKTVQFITYLLHLQEIAAETGVRSSSLLICPTSVLGNWQKELSRFAPSLRVMLH
FT                   YGSKREQGDLFREKVEQADVILTSFATATLDQELLQSMTWDSICLDEAQNIKNAQTKQS
FT                   TAVRSFPARHRIALTGTPIENRLSELWSIYDFINPGYLGSSRAFSNRFMNAIEKEHNEH
FT                   RTMDLQKLVQPFMLRRKKKDPAIQLDLPDKNEMKTYIHLTSEQGALYDQIVKELMERMQ
FT                   KLEGIERKGAILSALTQLKQLCDHPALLTKGALLDAAASGYSQPDLEAVISRSSKLERI
FT                   LAMVKELREEGERCLIFTQYIGMGQMLQQVLAQELQEPVLYLNGSTSKSARDRMIDQFQ
FT                   SHTLSPDEQPSVFILSLKAGGVGLNLTAANHVFHFDRWWNPAVENQATDRAYRMGQTKD
FT                   VQVHKFISLGTLEERIDEMLESKQQLSDQIITSTEGWITELSTDALKDLFTLRREWA"
FT   gene            complement(347593..349248)
FT                   /gene="ywqB"
FT                   /locus_tag="PPSC2_01495"
FT                   /old_locus_tag="PPSC2_c0302"
FT   CDS_pept        complement(347593..349248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywqB"
FT                   /locus_tag="PPSC2_01495"
FT                   /old_locus_tag="PPSC2_c0302"
FT                   /product="ywqB"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01495"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54287"
FT                   /db_xref="GOA:E3ECE4"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECE4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368929.1"
FT                   /protein_id="ADO54287.1"
FT                   /translation="MKPTYLMDDIQWQQLIQNVADHFNDVTIKRGFQYFKQGKVKEFAM
FT                   PDADHIAAVVDGNELYEVDLHLSAFAASRCTCPVRINCKHMIAVLLNYANEQERSVHAL
FT                   VNAHSAGFTRLAAKADTRTPTAFRSNLSLEHKETTRDALSKTASNIPDMPVSEWHDLFD
FT                   QCIALNHVHTQNSQYVQSALASIYAVKPQLSSGMQQLYGLHAHLRVLEKLVPQTPVTGY
FT                   PTHTYMGYYTQIAADELKEAIERDFESPLELTDEPMHEARMAETLAYLRRRMLTESRNG
FT                   TYFSDAYYQFWLYWVHPARQDSNIYTEELQHLHAAEEEHSARLARLPWMLAQSWMYVYQ
FT                   AQDHKAWELLQEAERAFPLKISSSQLLLFLHALRQAEDWVRLKNGLRHIGPLLHSHRDD
FT                   HLQDYMHDWKLVLQHLPEAEEDMWDTLKGMLPFAGGMYEEALLAHEKWRQWIDYQLSIR
FT                   SEPLSFRVSVLQPIEKNAPELLLPFYHQAVERYVLEKNRSSYKAAVKLLKRLFKLYKKM
FT                   KQETRWGLFFTTFTSRHSRLRALQEELRKGKLLS"
FT   gene            complement(349438..350556)
FT                   /gene="yndE9"
FT                   /locus_tag="PPSC2_01500"
FT   CDS_pept        complement(349438..350556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yndE9"
FT                   /locus_tag="PPSC2_01500"
FT                   /product="spore gernimation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01500"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44180"
FT                   /db_xref="GOA:A0A0D5ZBM2"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZBM2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425632.1"
FT                   /protein_id="AKA44180.1"
FT                   /translation="MSNIPSMKQEKISTLQALFTVTSTVYAVGIVSLPRTIAEKTQTPD
FT                   VWQGLLLATLLGIGVIFIHVKLCHRFPGKTFYEFNPVIAGKFIGFLINIAFIVFCTMIC
FT                   SLVCRMMAEFLKGLALERTPISMILLPFLLLIGYLTWGGLHAMVRLIELFFPLTFIVFL
FT                   LLIILNINHFNLDNLRPVFHKGWRPIFESLKVIPFSTMGFESILILTNVMTHPQKAWKA
FT                   GWIGYSIAMGLYILMVTMVIGCMSVEEVSRLQWPVVSFAQQIEFPGAFLERFEILFIIL
FT                   WTIKIFMTASNYYFYIVTGISQLTQKWNKYICYLPLIILFCLSMYPQNFIEIGNFDKII
FT                   GYVGIVVCAAVPSVLLVISMVFHRTEKTDGKQ"
FT   gene            complement(350557..351711)
FT                   /gene="yndF1"
FT                   /locus_tag="PPSC2_01505"
FT                   /old_locus_tag="PPSC2_c0304"
FT   CDS_pept        complement(350557..351711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yndF1"
FT                   /locus_tag="PPSC2_01505"
FT                   /old_locus_tag="PPSC2_c0304"
FT                   /product="spore gernimation protein GerA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01505"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54288"
FT                   /db_xref="GOA:E3ECE5"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECE5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368930.1"
FT                   /protein_id="ADO54288.1"
FT                   /translation="MISYGLLFRRTLWVQKCFAAWIACTLLTGCWDSREIDNLSIIQGV
FT                   AIDTDQQDMLELTYQHLIAQKSRKNMYRNVTTFNKDSIQSASREQAKQVSRAPLYSFIR
FT                   LILISDQAIQKRRIDQLLDTFTRSYKPSRKSLVMIVKDNAKDALNKMGKHQEIPSIDLE
FT                   ALAKNSNLNSKIPYRITLGEISTHISQGADFLIQCLETGGGNHFSGAALIRGKTKKFAY
FT                   WLDEEDVIGINWMLGKTKGSIIRTESSKSNQSMVFEVEDVHTKLIPHLNGQDLSFTVRI
FT                   KTDIKLNESTVNSEDFLKESFIQTAKQEAQDEIKQTVSQSLNTLQKEMRADVVGFGTKV
FT                   KVNYPAYWDRVKENWQDTFSQIPIDVKAKVQIERTGAYSKEEGE"
FT   gene            complement(351716..353194)
FT                   /gene="gerA"
FT                   /locus_tag="PPSC2_01510"
FT                   /old_locus_tag="PPSC2_c0305"
FT   CDS_pept        complement(351716..353194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerA"
FT                   /locus_tag="PPSC2_01510"
FT                   /old_locus_tag="PPSC2_c0305"
FT                   /product="spore gernimation protein GerA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54289"
FT                   /db_xref="GOA:E3ECE6"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECE6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685826.1"
FT                   /protein_id="ADO54289.1"
FT                   /translation="MARPLEAKLDYLEKTLGHLPDVVFKKMNVGQTGIHVIMIYLSGIA
FT                   DTSMINEQIVKPLILTGIRENHSPVNPDKIKEELIQQTAFTIDMTEGTDLETCVSKVLS
FT                   GYTCLLIEGTDDVFFASTGKFPSRSVEEPSTETLVRGPREGFIEDLESNLAMVRRHIKD
FT                   ISFRIDKITIGRRSSRKLAILYISDIANPELVQEVKRRVETIDVDDASDTGVIEQWIEE
FT                   HPWSPFPQIQASERSDKAITALMSGRVVIMLDGTPFVLIAPMTFWMLAQSPEDYYERFP
FT                   LGTFFRMLRLMALFIATFLPSLYVALISFHPGLIPPELVISIVASREGIPFPVFVEALI
FT                   MELALEILREASLRLPKGIGQVIGIVGGLVIGQAAVEAAVVSAFLIIVVGLTAIASFAS
FT                   PQYSGSIGIRLLRFPIMMIAGVFGLYGVILAFICLGVHMVQIKSFGVPYMSPLAPVRLR
FT                   DQQDTLVRVPYKYLRKRPMMLKTQDETHSNRKRK"
FT   gene            complement(353360..354025)
FT                   /gene="pgmB"
FT                   /locus_tag="PPSC2_01515"
FT                   /old_locus_tag="PPSC2_c0306"
FT   CDS_pept        complement(353360..354025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgmB"
FT                   /locus_tag="PPSC2_01515"
FT                   /old_locus_tag="PPSC2_c0306"
FT                   /product="beta-phosphoglucomutase"
FT                   /EC_number="5.4.2.6"
FT                   /note="catalyzes the interconversion of beta-D-glucose
FT                   6-phosphate to beta-D-glucose 1-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01515"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54290"
FT                   /db_xref="GOA:E3ECE7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECE7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599390.1"
FT                   /protein_id="ADO54290.2"
FT                   /translation="MKAVIFDLDGVITDTAEYHFQAWGSLAAALSIPFDREFNEQLKGI
FT                   SRTESLDKILARGNLSNTLSEEGKQELAIQKNTEYQRLISALTPSDVLPGIQALLKELR
FT                   EARVGIALASASKNAAFILDRLELAHYFDSVVDVTAIRHGKPDPEIFLAGAANLGVQPA
FT                   DCIGIEDAQAGIQAIKGAGMFAVGVGTPSQMQGADIVVATTAELSLSMLEEHFYEFKK"
FT   gene            complement(354050..356332)
FT                   /gene="yvdK"
FT                   /locus_tag="PPSC2_01520"
FT                   /old_locus_tag="PPSC2_c0307"
FT   CDS_pept        complement(354050..356332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvdK"
FT                   /locus_tag="PPSC2_01520"
FT                   /old_locus_tag="PPSC2_c0307"
FT                   /product="maltose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54291"
FT                   /db_xref="GOA:E3ECE8"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECE8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599391.1"
FT                   /protein_id="ADO54291.2"
FT                   /translation="MVYNRLFDVDSWKLTTHTLHSTHMRLQESLTSIGNGYMGMRGNFE
FT                   ETYSGDHHQGTYISGIWFPDKTKVGWWKNGYPEYFGKVINAMNFIGIRLIVNQEEVDLF
FT                   TAQISDFVQELDMKQGILRRACTVNDQIRITTERFLSITTRELCLIDYQVENISDQPLN
FT                   IELVPYLDGNTKNEDTNYDEVFWLEEAREVQEQFISLSTTTIDNPFGIPRFTVNATMGI
FT                   VTEGQYEQTTEEGFLYAARHYQYNVSPGDRIQLQKIVAVTTSRDMEKDALIPQGERIAV
FT                   EAVNKGYTSLKQDHIDAWARRWDKADVEIEGDTEAQQGIRFNIFQLFSTYYGEDARLNI
FT                   GPKGFTGEKYGGATYWDTEAYAVPMYLALADPEVTRNLLLYRHQHLEGAKHNATQQGLR
FT                   GALYPMVTFTGVECHNEWEITFEEIHRNGAIAYAIYNYTNYTGDLTYLHDYGIDVLVEI
FT                   SRFWADRVHFSKSRQQYMIHGVTGPNEYENNVNNNWYTNTLAAWVLKYTLSVLPQISTE
FT                   KSQRLAVTADERAHWQDIINNMYYPYDEERGVFVQHDTFMDKDLQPVSTLHPSNLPLNQ
FT                   KWSWDKILRSCFIKQADVLQGLYFFGDQFTLEEKARNFAFYEPMTVHESSLSPSIHAVL
FT                   AAELKMEDKAVEMYKRTARLDLDNYNNDTEDGLHITSMTGSWLAIVQGFAGMRTYNETL
FT                   SFSPFLPKDWNKYTFKINYRGRLLSILVQEGEVIITLLDGEPLTLELYGQPTHITSGQS
FT                   LMASSAS"
FT   gene            complement(356487..357494)
FT                   /gene="malR1"
FT                   /locus_tag="PPSC2_01525"
FT                   /old_locus_tag="PPSC2_c0309"
FT   CDS_pept        complement(356487..357494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malR1"
FT                   /locus_tag="PPSC2_01525"
FT                   /old_locus_tag="PPSC2_c0309"
FT                   /product="LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01525"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54293"
FT                   /db_xref="GOA:E3ECF0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECF0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368935.1"
FT                   /protein_id="ADO54293.1"
FT                   /translation="MAVTIKDVAKRAKVATSTVSRVIQDSPKISEATKARVRKEMKALG
FT                   YEPNYSAQSLANRVTQSIGIIMPESDVAIFQNPFFPESLRGISEWVNEHNYTLSIVTGK
FT                   TSDELLSRVKLMTRTGRVDGYIVLYSKQKDSIVEYLHKEKIPYTVIGKPQQFVSETTHV
FT                   DNDNYQAAKDVVTYLTGLNHERIAYVGGDQEHIVNLERLRGYQDALREAGLPLPKEYVV
FT                   REPFNLEDMRTLLQATPPPTAMIVSDDLVAMAVQKMLAQLGVSMPEQLSMVSFNNLMLA
FT                   ELMNPPLTSVDIDIFSLGYQAAKSLIEKIEDPKELTKHIIVPHRIVERKSSQTL"
FT   gene            357739..359403
FT                   /gene="ptsG1"
FT                   /locus_tag="PPSC2_01530"
FT                   /old_locus_tag="PPSC2_c0310"
FT   CDS_pept        357739..359403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsG1"
FT                   /locus_tag="PPSC2_01530"
FT                   /old_locus_tag="PPSC2_c0310"
FT                   /product="PTS system transporter subunit IICB"
FT                   /note="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system; catalyzes the phosphorylation of
FT                   incoming sugar substrates concomitant with their
FT                   translocation across the cell membrane; IIB is
FT                   phosphorylated by IIA and then transfers the phosphoryl
FT                   group to the sugar; IIC forms the translocation channel"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54294"
FT                   /db_xref="GOA:E3ECF1"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECF1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428236.1"
FT                   /protein_id="ADO54294.1"
FT                   /translation="MKKLLSFDFWQKLGKALLVVVAVMPAAGIMISLGKVVAMLAGDIH
FT                   FWVTVGGVMENLGWGIINNLHILFAVAIGGSWAKERAGGAFAALIAFVLINISTGTILG
FT                   VSSKMLTQEGATTHTLFGASIPVSGYFTSILGAPALNMGVFVGIISGFVGAVVFNKYYN
FT                   YRKLPDALAFFNGKRFVPFVVILWSVIVSLIMSAVWPFVQGGINQFGVWLATSGESAPF
FT                   IAPFVYGTLERLLIPFGLHHMLTVPINYTQLGGVYTVLTGSGAGSVVAGQDPLWLAWAS
FT                   DLSALRGTDPAAYNSLLGGVTPARFKVGQMIGGAGILMGLAVAMYRRVDKDKRGKYKSM
FT                   IFSAAAAVFLTGVTEPLEFMFMFVAPVLYVVYAILTGIAFGMADIIHLRLHSFGMIELL
FT                   TRLPLSINAGLVQDIINFVLTCVVFAVATYFIAYFMIGKFKMATPGRLGNYTDEEPQAT
FT                   SEAESTKADGLAAVSTNNQLAANIIKTLGGEQNIVEVDACMTRLRVTVKDTEAVGDEKT
FT                   WKALGALGLIKVDNGVQAVYGPKADVLKSDIQDILNR"
FT   gene            359409..360230
FT                   /gene="M1-449"
FT                   /locus_tag="PPSC2_01535"
FT                   /old_locus_tag="PPSC2_c0311"
FT   CDS_pept        359409..360230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-449"
FT                   /locus_tag="PPSC2_01535"
FT                   /old_locus_tag="PPSC2_c0311"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54295"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECF2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685829.1"
FT                   /protein_id="ADO54295.1"
FT                   /translation="MKLLTLNAHAWMEENQHDKLKQLAAFIDEQQFDVIALQEVNQSLE
FT                   ETPLTPDDLGAYYSADPEVVIKRDNYAYVLNGLLSDAYHWTWAPAHIGFAKYDEGLAIL
FT                   SKTPITATVNEYISSMQDYDNYRSRKIVGIQTVVDGVQAWFVSGHYNWWNDEESFRGLW
FT                   DRTTEVLDPLAPAPVFVMGDFNNAAEVRGEGYDYVMQSGWSDTYSNAAVRDAGHTVIKA
FT                   IAGWESNAEPLRIDYIFSSKAAQVQSSAVVLNGKTGPVVSDHFGVAVELEL"
FT   gene            complement(360256..361455)
FT                   /gene="norA1"
FT                   /locus_tag="PPSC2_01540"
FT                   /old_locus_tag="PPSC2_c0312"
FT   CDS_pept        complement(360256..361455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norA1"
FT                   /locus_tag="PPSC2_01540"
FT                   /old_locus_tag="PPSC2_c0312"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54296"
FT                   /db_xref="GOA:E3ECF3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECF3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368938.1"
FT                   /protein_id="ADO54296.1"
FT                   /translation="MVRNLYLNRNIACMIVISLIANMSGSMILPLFAIYVEQFGISTLG
FT                   MSILFSLFYVGRFLGGGMAGRIYEKIGAKRLGLGLLIAEIACMLLFPIATSFIILSILR
FT                   LLQGLVAIGLTVFVRVTVNHMSTAENRGTLNGYISSSEGAGMILGPLISGVIVSYFSLS
FT                   VPFYFVAIFACISFIAVSRMTFANSPLKPQQQHPPLQKPQRRIILTKQLLLYSTVHLLE
FT                   MSAFAIFLTYFSVYATYKLHWSPAEISLAFTIIGISTFVSAPFIGKISDMLKDRLLLCI
FT                   IGLLLIMMEIILFLWFTEPWIVYLGMFIGGIGGASYLDSFYSQLGDVIPEENRSSFIGN
FT                   VVSLSELGAIVSPIIAGALMDCFSINTPFYYNMILVLIAIVIQYTIRLKSKSVRKRPIA
FT                   "
FT   gene            complement(361646..362143)
FT                   /gene="ywlC1"
FT                   /locus_tag="PPSC2_01545"
FT                   /old_locus_tag="PPSC2_c0313"
FT   CDS_pept        complement(361646..362143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywlC1"
FT                   /locus_tag="PPSC2_01545"
FT                   /old_locus_tag="PPSC2_c0313"
FT                   /product="ywlC1"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01545"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54297"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECF4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279277.1"
FT                   /protein_id="ADO54297.1"
FT                   /translation="MSDANQLFAQALVKSLVGERGHIRMARALPDIDVELAGKKNAEMP
FT                   YSIYQLLKHMIYWQQFMLEHLEGRKPQLPGNVMESWPEETGPQSEEAWQAVINEFLQGV
FT                   DRAVQIAETAQLDELLAHFPGETKAGLLRNIASHNSYHLGEIVLLRRIYGAWPPPGGGF
FT                   PA"
FT   gene            362453..363952
FT                   /gene="yhjG"
FT                   /locus_tag="PPSC2_01550"
FT                   /old_locus_tag="PPSC2_c0314"
FT   CDS_pept        362453..363952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjG"
FT                   /locus_tag="PPSC2_01550"
FT                   /old_locus_tag="PPSC2_c0314"
FT                   /product="yhjG"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54298"
FT                   /db_xref="GOA:E3ECF5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECF5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368940.1"
FT                   /protein_id="ADO54298.1"
FT                   /translation="MDYEVIVVGGGPVGMWLAAELALARVSVCVIERLEEPIRQSRALT
FT                   LHPRTLEMFDMRGLKERFMKRGRPIRTGHFSMLNTRLDFSVLDSSSNYTLFIPQVITEQ
FT                   VIEEHALKLGVVVHRGMEVVSVREQEQGVEVVSVCASGAQANVSVMTAAYVVGADGAGS
FT                   IVRKQAGIAFPGTDTTLTAVLADVELANPPENGVHSEYSERGGVMIAPVSPDIYRVILT
FT                   TPRLINVPKDVPVTLEEVRTELRDLLGTDLGVTNPRWLSRFGNATRQAQTYRKGRILLA
FT                   GDAAHIHFPAGGQGMNVGLQEAANLGWKLAGVIRGWAPDTLLNSYHDERYPVNTQFLRN
FT                   TEVQTRLLDFTPAVLAHRQLHEEWFRHPEINRSMAEQISALDVCYPAAGNIPQHPLNGK
FT                   RFADFELQLPDGVTSYAYDLLHEGRFVLLHLAQDPKVSNEFRHISLSHISYVEAIAEEL
FT                   PVGWRGVHTVFIRPDGYIAWAISVEQTDIASVIKAGIVTLI"
FT   gene            364050..364532
FT                   /gene="yvmB1"
FT                   /locus_tag="PPSC2_01555"
FT                   /old_locus_tag="PPSC2_c0315"
FT   CDS_pept        364050..364532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvmB1"
FT                   /locus_tag="PPSC2_01555"
FT                   /old_locus_tag="PPSC2_c0315"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54299"
FT                   /db_xref="GOA:E3ECF6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECF6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368941.1"
FT                   /protein_id="ADO54299.1"
FT                   /translation="MEKATSVQHVYDLLIKMNHQLEQHQQRESMTFLEEIREHFDGMTS
FT                   LNMTDVHVMDCIGRHEPINVTTLAERMELSKGTISKVSTKLLKEGWIRRTQLNDNKKEI
FT                   YFRLTPLGKKLFLVHERLHAKVQHQLFQFLDRYSSEELHVLKRLLSDGVGFLEAME"
FT   gene            complement(364636..365565)
FT                   /gene="ycbB1"
FT                   /locus_tag="PPSC2_01560"
FT                   /old_locus_tag="PPSC2_c0316"
FT   CDS_pept        complement(364636..365565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbB1"
FT                   /locus_tag="PPSC2_01560"
FT                   /old_locus_tag="PPSC2_c0316"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54300"
FT                   /db_xref="GOA:E3ECF7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013972"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECF7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308322.1"
FT                   /protein_id="ADO54300.1"
FT                   /translation="MRFYIVDDDQGIRSMLADIIEDEGLGEVVGEAEDGSYVNSSLLEL
FT                   NRIDVLLIDLLMPLRDGIQTVRALGDQFSGKIIMISRIESKNMIGEAYSLGIEYYIAKP
FT                   LNRLEIIAVIQKVTERLRMQQSITDIQRTLQGLSMFTSNSPSATLEPTRNIVSSGQFLL
FT                   SEMGMIGEAGSVDLLDMLEYLEQYEEETGNLSPYLFPSLKDIFANIASKRLGDSASAIE
FT                   LSKEIKASEQRVRRAIFQTLSHIVSLGLTDYTHPKFENYASKFFDFTEIRKKMLELQNN
FT                   VEPSLSQARINTKKFVQVLYMEAKRLLH"
FT   gene            complement(365571..366875)
FT                   /gene="ycbA"
FT                   /locus_tag="PPSC2_01565"
FT                   /old_locus_tag="PPSC2_c0317"
FT   CDS_pept        complement(365571..366875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbA"
FT                   /locus_tag="PPSC2_01565"
FT                   /old_locus_tag="PPSC2_c0317"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01565"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54301"
FT                   /db_xref="GOA:E3ECF8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECF8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368943.1"
FT                   /protein_id="ADO54301.1"
FT                   /translation="MKLNTLLFLLMLIFVPLAGELNIHPFDNTFRLSFGTPVFFFFLLS
FT                   IRQIPPALSGVLVGIAVVAFRISLNHYLHPGSSFEALVTLHGPTFFYYMVYGLLFQVLN
FT                   INAEPYRALRVGLLSVGIEVAASVAELSVRRSIDGDFWDIMKISKVAFMAMIRSFFVLG
FT                   FYNMIRLNQSVQHEEAQRQQTERILLLVSDLYEESVQLGKTLSHAEQITRESYGLYREL
FT                   QQDESLKDREHYAKQALRISGQVHEIKKDSQRIFAGLSKLIDSESDVHYMTSQELGELI
FT                   VRTNSKYAQSLGKSIRFTLNFDPLLPKLHVYTVLTLINNLTSNSVEAMKDSGRIDVSIH
FT                   FLPGQEDIISFSVTDNGPGIPQRKREMIFTPGYTTKYDEGGQPSTGMGLFYVREVAESL
FT                   DGTLELLQNEDEHTDRSQTTFRVILPLRKLTEKGR"
FT   gene            367087..368340
FT                   /gene="gltT"
FT                   /locus_tag="PPSC2_01570"
FT                   /old_locus_tag="PPSC2_c0318"
FT   CDS_pept        367087..368340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltT"
FT                   /locus_tag="PPSC2_01570"
FT                   /old_locus_tag="PPSC2_c0318"
FT                   /product="glutamate:protein symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54302"
FT                   /db_xref="GOA:E3ECF9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECF9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425643.1"
FT                   /protein_id="ADO54302.1"
FT                   /translation="MKKINLTMQIFIGLALGIIVGALFYGNSGVEVYLKPIGDIFIRLI
FT                   KMIVVPIVISTLIIGVAGVGDMKKLGKLGGKSILYFEIVTTIAILFGLLVANLVRPGEG
FT                   VDMSHLAKSDIHSYVETAEKSGHNFIDTIVHIVPTNVIQALGEGDMLAIIFFSVLFGLG
FT                   VAAIGNKGKPVLNFFEGVADAMFWVTNQVMRLAPFGVFALIGTTVAKFGLASLWPLLKL
FT                   VLSVYGSMLLFIVIVFGIIAKLCGTRLWTMVKILKSELLLAYSTASSESVLPKIMEKME
FT                   KFGCPKGITSFVIPIGYSFNLDGSTLYQALAAIFIAQMYGIDMPITTQITLVLVLIISS
FT                   KGIAGVPGASFVVLLATLGAVNIPLEGLAFIAGIDRILDMARTVVNVLGNSLAAVVMSK
FT                   WEGQYDKEKGEEYVASIK"
FT   gene            368599..370110
FT                   /gene="tar3"
FT                   /locus_tag="PPSC2_01575"
FT                   /old_locus_tag="PPSC2_c0319"
FT   CDS_pept        368599..370110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tar3"
FT                   /locus_tag="PPSC2_01575"
FT                   /old_locus_tag="PPSC2_c0319"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01575"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54303"
FT                   /db_xref="GOA:E3ECG0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECG0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685836.1"
FT                   /protein_id="ADO54303.1"
FT                   /translation="MFLKKNESQSLAPLVEESRKLSQRIQQKDYAAAIQVPSASPEVQE
FT                   IANNVNQAIESMKNDAQHVDIRLKLVTKAIEIGLWDMEVIAGDPVNPNNTFTWSEEFRS
FT                   MLGYQSEKEFPNVLDSWSSRLHPEDYDRSLAELSDHLLDFTGKTPYDVQYRLKLKHGEY
FT                   RWFRATGTTIRDEKGVPLRIAGALLDVHDQKIKSEELQALVTRYDLINLVLVEAPYDVN
FT                   IIGGDIENPDNTFWWSPQFRETLGFKDEQDFPSKLSSWASILYPEDAEMAIKVLNDHLN
FT                   DYTGRTPYEMECRLVRKNGEHRWYYCSGKTLRDSKGVPIRIAGTIRDITVEKEKQAVAD
FT                   ELTLKIQHLSDSITEMVNGVNSVSNQAQELATAQEQSTEAANQAKVSAEETQNISNFIK
FT                   EIANQTNLLGLNAAIEASRAGEQGRGFAVVADEVRKLAIHSADATGNIETSLDEMKTLI
FT                   ERILHNIGNMSTLTQTQAALTQQVNASTDEINSMSKALLDFARTM"
FT   gene            370247..370609
FT                   /gene="ypaA"
FT                   /locus_tag="PPSC2_01580"
FT                   /old_locus_tag="PPSC2_c0320"
FT   CDS_pept        370247..370609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ypaA"
FT                   /locus_tag="PPSC2_01580"
FT                   /old_locus_tag="PPSC2_c0320"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54304"
FT                   /db_xref="GOA:E3ECG1"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECG1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279283.1"
FT                   /protein_id="ADO54304.1"
FT                   /translation="MSLLSSILVGIVALEHVYILVLEMFLWTTPRAIRTFGTSKELAGV
FT                   TKSLAANQGLYNGFLAAGLVWGLFYPDPVIGRQIQLFFVICVVVAAVYGALTANKSILL
FT                   KQGLPAILALISLLVF"
FT   gene            370802..371251
FT                   /gene="M1-460"
FT                   /locus_tag="PPSC2_01585"
FT                   /old_locus_tag="PPSC2_c0322"
FT   CDS_pept        370802..371251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-460"
FT                   /locus_tag="PPSC2_01585"
FT                   /old_locus_tag="PPSC2_c0322"
FT                   /product="M1-460"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01585"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54306"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECG3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368948.1"
FT                   /protein_id="ADO54306.1"
FT                   /translation="MTESTKRVRISQWDALMLESLRSLGWSHEELIHRAQQNELPTDGQ
FT                   FDYTELATGLASKEPEVFVNAVTDGYQIKYNTIRGIRSWIAVALGREPELSLEEGSEAV
FT                   TSELTQAEYDRLQQVLSLGWVIQEVRPATGDTAGMYRIVPAVQTN"
FT   gene            371527..372555
FT                   /gene="fhuB1"
FT                   /locus_tag="PPSC2_01590"
FT                   /old_locus_tag="PPSC2_c0324"
FT   CDS_pept        371527..372555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB1"
FT                   /locus_tag="PPSC2_01590"
FT                   /old_locus_tag="PPSC2_c0324"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54308"
FT                   /db_xref="GOA:E3ECG5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECG5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368950.1"
FT                   /protein_id="ADO54308.1"
FT                   /translation="MSEQEIHRSECGGGTIVAEPNAVSPRPQRIVLTLVAGLALLIFSF
FT                   FLSLITGIFPISYAELWEVLFSSNPDPILKEVVYQTRMPFALDMLLLGGCLAVSGTLLQ
FT                   LRTANGFASPTLTGLMPGAMTGLCVVLLLGLDIDSFGSMALCIAGAVFGGFIVFKLNRI
FT                   RFIRGRSAGIHLFMIGFIMDVALRSISGFIVLLGENQQEWAISVGGWGIREGSFTFWLA
FT                   LVTLLVAGSVSAFPKQLRPLYIPFAMVLTAATVWACGAIGYIGLIVPYFMRCMIGNRPR
FT                   LLILGSILWGGGLLMLAKVISARINEPVGLPLTPVLACVGIPFLVFMVRGEWKRSSLLE
FT                   KY"
FT   gene            372681..373238
FT                   /locus_tag="PPSC2_01595"
FT                   /old_locus_tag="PPSC2_c0325"
FT   CDS_pept        372681..373238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_01595"
FT                   /old_locus_tag="PPSC2_c0325"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54309"
FT                   /db_xref="GOA:E3ECG6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECG6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599394.1"
FT                   /protein_id="ADO54309.2"
FT                   /translation="MTSMTIVDPSVKPGLTAFQASAEDQAEVHELILKTARWLHSKGST
FT                   QWGKLLKGEDDHNLGGAIARGEVVIFRTSEDHRLAGAVILQQQPSAWDSRLWGLEETDS
FT                   EEGTSVYLHRLVVDRDNSGKGLGRELMQWIEQGIRFAGKDRIRLDCIAGNDKLSGFYKQ
FT                   CGYTYMGETNGYNTFEKMLIKS"
FT   gene            373509..374807
FT                   /gene="ugpB1"
FT                   /locus_tag="PPSC2_01600"
FT                   /old_locus_tag="PPSC2_c0326"
FT   CDS_pept        373509..374807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpB1"
FT                   /locus_tag="PPSC2_01600"
FT                   /old_locus_tag="PPSC2_c0326"
FT                   /product="sugar ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54310"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECG7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599395.1"
FT                   /protein_id="ADO54310.1"
FT                   /translation="MDNYMSWIKIGFFLSVLFLLAAACSTSPKIENTAGQKVRLTMQVW
FT                   GNPAEVKVYQRALDAFEKENPNIEVKLVPVPGDQYEQKLLTQLQGSRGPDVFYSYESTM
FT                   ARLIGAKQVQPLGEFLKSDASDVKAEHFPEGLWGPAKRDGEIYGVTPDSNPMVMYYNKK
FT                   VFKEAGVKTPQEYYDEGKWNWDAFEEVTSKLKAAGKQGYIAENWWAHWYSWVWSNGGRI
FT                   FDEQGKYVLDHNEKGKEAFAFMHDMVKKGNAVYLGSLPKGQGADAMFMSNQVGMLAAGR
FT                   WLEPLFSQNKSLDFDYIYWPSNTGKNEPVAIPVAYVAVNKNSPHVQEAMKLAAFYVSVK
FT                   GQEERLVEGGNAMGTLAAADESIMKKATIEHSGYLTEGRDKGHAYGSALAYDAQVPGLN
FT                   SDITETIDLMFLGKQDAATTIEKLNQIISKAVK"
FT   gene            374846..375718
FT                   /gene="M1-465"
FT                   /locus_tag="PPSC2_01605"
FT                   /old_locus_tag="PPSC2_c0327"
FT   CDS_pept        374846..375718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-465"
FT                   /locus_tag="PPSC2_01605"
FT                   /old_locus_tag="PPSC2_c0327"
FT                   /product="sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01605"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54311"
FT                   /db_xref="GOA:E3ECG8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECG8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368953.1"
FT                   /protein_id="ADO54311.1"
FT                   /translation="MQKKHQALWGYLFIGPQFLGLLCFSLLPLLYAFYLSFVNWDGFGV
FT                   PLFVGLDNFKGQLSDPDFWKALINTVYYMVLVIPVGIVLALLVAIVLNKVKGREIYRLF
FT                   FFMPVVTSSVSVGVIWMWILNGEFGILNHLLRAIGITGPMWLTDTHWVIPSIALLSIWL
FT                   GLGYNMVIFLAGLQGISKSYYEAAEIDGASKFQQLRYITLPLLSPTTFFVTIMMVISSF
FT                   QVFDQAFVMTNGGPAKASYTLVYHIYDQAFIDFTMGESAAAAMILFVIILIFTLLQFKM
FT                   QKRWVHYGD"
FT   gene            375708..376538
FT                   /locus_tag="PPSC2_01610"
FT                   /old_locus_tag="PPSC2_c0328"
FT   CDS_pept        375708..376538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_01610"
FT                   /old_locus_tag="PPSC2_c0328"
FT                   /product="sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54312"
FT                   /db_xref="GOA:E3ECG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECG9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308340.1"
FT                   /protein_id="ADO54312.1"
FT                   /translation="MEISCRGRMFLRHVLLAVGSLIMFFPFLWTILSSLKDISQIFVVP
FT                   PQWIPDPFVWSNYPASLEAMPFVQAYMNSFYITFIIVTATLISASMAAYAFAKIRFPGS
FT                   DILFILFLATMMVPKQVTMIPLYLVMDRIGWLDTHWSLIVPGALFNAFAVFLLRQFVMG
FT                   IPRDLEEAAVMDGAGYIRIYWSVILPLVRPALAAIGIFTFLGAWNSFLDPLIYLNTPEK
FT                   FTVPLLLNNFKGLYTADWSLMMAGTTISVVPVLIVYIIAQKQIIEGITLTGIKG"
FT   gene            complement(376549..377385)
FT                   /gene="yfiF1"
FT                   /locus_tag="PPSC2_01615"
FT                   /old_locus_tag="PPSC2_c0329"
FT   CDS_pept        complement(376549..377385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiF1"
FT                   /locus_tag="PPSC2_01615"
FT                   /old_locus_tag="PPSC2_c0329"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54313"
FT                   /db_xref="GOA:E3ECH0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECH0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685844.1"
FT                   /protein_id="ADO54313.1"
FT                   /translation="MIATPLFAIEQALRMVPFSMSADHVHQAHEIYYLLAGERYYYINQ
FT                   RVYALQKGDLIWISKHDFHRTSNKGSGSHERILINFDEAFVASSTSVTPSSDQSHLLLP
FT                   EKSFLLRPSAEEQRELEHLFQQMLDEYHQEHAYRHMYLQSLLLQLLIRIRRIQSAAPDT
FT                   IAPERSEQQQRVYSVIEYLHAHYAEKLSLEQLAGHFYISSTYLCRIFKQTTGFTLVEYL
FT                   QDVRVQQARAYLKETNWKVTAIAEKTGFDSIAHFGRVFKHFTGRTPLQYRKSHKKE"
FT   gene            377523..378809
FT                   /gene="yteT"
FT                   /locus_tag="PPSC2_01620"
FT                   /old_locus_tag="PPSC2_c0330"
FT   CDS_pept        377523..378809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yteT"
FT                   /locus_tag="PPSC2_01620"
FT                   /old_locus_tag="PPSC2_c0330"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54314"
FT                   /db_xref="GOA:E3ECH1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECH1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010348566.1"
FT                   /protein_id="ADO54314.1"
FT                   /translation="MAKIKYALVGTGGRAEFFYGEVVTVFKDTSELVAFCDVNQTRMDY
FT                   ANRLLQEKYEHHPIPTYKAHEFDRMIAETKPDIVIVTTIDRVHHHYIIRAMELGCDVIS
FT                   EKPMTVDEDKCQDILDAIDRTGRKLRVTFNYRYAPHNTKIREVIMDGTLGDILSVNFEW
FT                   LLNTQHGADYFRRWHRDKRNSGGLLVHKSTHHFDLMNFWLGSKPETVYAMGDLKFYGRE
FT                   NAEQRGVTEFYQRAYGSKAAENDPFALHLDRNEHLKNMYLDAEHEDGYVRDQSVFGDNI
FT                   SIEDTLSVMVKYQNKTVMNYSLNAYMPWEGFIIVFNGTKGRMEVRVSEQSYVNSGGSKA
FT                   DEGALKEKTITIYPHFAAPYEVEVEEGVGGHGGGDPVMLRDIFDKPAEDRFHRAASHID
FT                   GAWSILTGIAANRSMRTGQPVKVEQLVRL"
FT   gene            complement(378929..379765)
FT                   /gene="cah1"
FT                   /locus_tag="PPSC2_01625"
FT                   /old_locus_tag="PPSC2_c0331"
FT   CDS_pept        complement(378929..379765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah1"
FT                   /locus_tag="PPSC2_01625"
FT                   /old_locus_tag="PPSC2_c0331"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54315"
FT                   /db_xref="GOA:E3ECH2"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECH2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368957.1"
FT                   /protein_id="ADO54315.1"
FT                   /translation="MKKHWRGCLFSIFSIILALSVTGCTPSATSSTTSATSSSSANNVH
FT                   AVVQKSPHWSYEGDEGPEHWGELEKDFVACGNGQEQSPINIEHSHLEASHTQQPLQVHY
FT                   STTKVSILNNGHTVQVNAASPSNDIVVDGTKFTLKQFHFHHPSEHQIDGKNAEMELHFV
FT                   HQSDTGSTAVLGVLIQSGKENKAFNRIWSKLPKDISQEAVLDEDVNLAALLPKDLHSVR
FT                   YNGSLTTPPCTEHVNWTVLEQPIEMSADQIKQFAAIFPDNHRPVQQLGTRELKADK"
FT   gene            380007..381023
FT                   /gene_synonym="adhA"
FT                   /locus_tag="PPSC2_01630"
FT                   /old_locus_tag="PPSC2_c0332"
FT   CDS_pept        380007..381023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene_synonym="adhA"
FT                   /locus_tag="PPSC2_01630"
FT                   /old_locus_tag="PPSC2_c0332"
FT                   /product="ethanol-active dehydrogenase/acetaldehyde-active
FT                   reductase"
FT                   /note="similar to zinc-dependent eukaryotic ADH enzymes and
FT                   distinct from fermentative ADHs"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54316"
FT                   /db_xref="GOA:E3ECH3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECH3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010289901.1"
FT                   /protein_id="ADO54316.1"
FT                   /translation="MKAAIVTKDKKVSVEEKPLRSLKHGEALVQVEYCGVCHTDLHVKN
FT                   ADFGDVTGRVLGHEGIGKVIELGEGVTSLKVGDRVSIAWMFESCGHCEYCLTGRETLCR
FT                   EVKNAGYTVDGAMAEQCIVTADYAVKVPDNLDPAAASSVTCAGVTTYKAVKVSDIRPGQ
FT                   WIGIFGIGGLGNLAVQYAKNVFNAKVVAFDISDEKLELAKKIGADYIVNSMKEDPVARA
FT                   KELTNGAGLDATVVTAVAKTPFNQAIDVVKAGARVVAVGLPTDKMDLDIPRLVLDGIQV
FT                   IGSLVGTREDLKEAFQFAAEGKVVPLVQKRPLEDINEIFEEMEHGKIQGRMVIDFTK"
FT   gene            complement(381104..381469)
FT                   /gene="ytcD1"
FT                   /locus_tag="PPSC2_01635"
FT                   /old_locus_tag="PPSC2_c0333"
FT   CDS_pept        complement(381104..381469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytcD1"
FT                   /locus_tag="PPSC2_01635"
FT                   /old_locus_tag="PPSC2_c0333"
FT                   /product="HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01635"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54317"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECH4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368959.1"
FT                   /protein_id="ADO54317.1"
FT                   /translation="MGKKKYNISVEATLEVIGGKWKCVILCHLTHGKMRTSELKRMMPS
FT                   ITQKMLTQQLRELEEDGIVNRISYNQVPPKVEYELSEYGCSLKSILDSLCAWGERHIIK
FT                   EYGDKSAVLEDNILNKL"
FT   gene            381610..382806
FT                   /gene="ytbD"
FT                   /locus_tag="PPSC2_01640"
FT                   /old_locus_tag="PPSC2_c0334"
FT   CDS_pept        381610..382806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytbD"
FT                   /locus_tag="PPSC2_01640"
FT                   /old_locus_tag="PPSC2_c0334"
FT                   /product="MFS sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54318"
FT                   /db_xref="GOA:E3ECH6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECH6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685848.1"
FT                   /protein_id="ADO54318.1"
FT                   /translation="MSPESKRSIWPLLALAVSAFAIGTTEFISVGLLPLIAEDLHISVT
FT                   MSALTVTLYALGVTIGAPVLTSLTSSVPRKTLVLWIMIVFIAGNSLAAVSSGITLLLIA
FT                   RVISAFSHGVFMSIGSTIAADLVPDDRRASAISIMFSGLTVATVTGVPLGTYVGQQWGW
FT                   RAAFMAIVVVGVVALIANLILLPSTLRKGNKTPFSEQVKLVTNGRLLLAFIITALGYGG
FT                   TFVVFTYLSPLLHDITGFGQNTVTLILLLYGIAIAIGNVIGGKAANRRPLSALFYMFLI
FT                   QAVILFLLWFTVPFQTAGLITIFFMGLLAFMNVPGLQVYVVMLAERFAPKAVDVASAVN
FT                   IAAFNAGIAIGAYVGGMVTDSLGLMHTTWVGGVMVFVAVLLTAWSRMLEKRDTTALVG"
FT   gene            382838..383680
FT                   /gene="ytbE"
FT                   /locus_tag="PPSC2_01645"
FT                   /old_locus_tag="PPSC2_c0336"
FT   CDS_pept        382838..383680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytbE"
FT                   /locus_tag="PPSC2_01645"
FT                   /old_locus_tag="PPSC2_c0336"
FT                   /product="glyoxal reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01645"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54320"
FT                   /db_xref="GOA:E3ECH7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECH7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599397.1"
FT                   /protein_id="ADO54320.2"
FT                   /translation="MIQNLQSTTTLHNGVRMPWFGIGVFKVEEGSELVNAVKAAVKHGY
FT                   RSIDTAAIYANENSVGQAIQEALLENNLSREDLFVTSKVWNADLGYEETRAAYEASLDK
FT                   LGLDYLDLYLIHWPVQGKYKEAWRALESLYKEGRIKAIGVSNFQIHHLEDLMKDAEIKP
FT                   MVNQVEFHPQLTQAELLQFCQKNNIQMEAWSPLMQGQLLDHPVLQDIANKYGKSVAQVI
FT                   LRWDVQQGVVTIPKSTKAHRIVENADIFDFELTREDMDRIQSLNANLRVGPDPDNFDF"
FT   gene            383847..384869
FT                   /gene="scrR"
FT                   /locus_tag="PPSC2_01650"
FT                   /old_locus_tag="PPSC2_c0337"
FT   CDS_pept        383847..384869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrR"
FT                   /locus_tag="PPSC2_01650"
FT                   /old_locus_tag="PPSC2_c0337"
FT                   /product="LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54321"
FT                   /db_xref="GOA:E3ECH8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECH8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685850.1"
FT                   /protein_id="ADO54321.1"
FT                   /translation="MNKTIADIAQMAGVSKSTVSRFLNGGSVSLDTRRKIEKVVKATGY
FT                   VPNTFAQSLKAKRTNIIGTVVPRLDSFATSHTLMGIDEELRSQHYQMLISNTSQDVKRE
FT                   IEAIYEFARQKISGIILLAAQITDDHLTAIRDISIPVLLVGQQHEQIHSLIHDDYRAGY
FT                   DIGAYVLSQGHREIAYVGVTERDVAVGVQRKEGFRQAVHDALPAACYTDEAMRAAGYDI
FT                   RYYETGFKMSDARIAASAILDKFKPSLMVCATDNIALGVINAAYSRGITIPSDLSVTGF
FT                   GGYDITEVIHPALTTVQYPYMEAGRVAAQNIVRLVEHKTVEQVTVMDYSLIERESVDKR
FT                   "
FT   gene            385051..386526
FT                   /gene="scrB3"
FT                   /locus_tag="PPSC2_01655"
FT                   /old_locus_tag="PPSC2_c0338"
FT   CDS_pept        385051..386526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrB3"
FT                   /locus_tag="PPSC2_01655"
FT                   /old_locus_tag="PPSC2_c0338"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54322"
FT                   /db_xref="GOA:E3ECH9"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECH9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685851.1"
FT                   /protein_id="ADO54322.1"
FT                   /translation="MKMTKEQKYRLIEQAEPGEIASLQKKVEQCQWRQSFHIQPPTGLL
FT                   NDPNGFSYYQGEYHLFYQWFPLGTDHGMKYWYHLKSKDLVTWHSAGIGITPGDDFDSHG
FT                   AYSGSALEHEDKLYMMYTGNTRDENWIRHPYQCMAVMDESGRITKWEHPVIDHVPEGYT
FT                   DHFRDPKLWKDGDSFYCVIGAQRTNSTGCVVLYRSTDLHTWQFEGELNTGLESFGYMWE
FT                   CPDYFELNGAGVLVFSPQGLEPSGDENQNIYQSGYVIGKLLNTETRTLEHGAFHELDRG
FT                   FDFYAPQTMIDPQGRRIMVAWMGLPDIEYPTDPNGWAHCLTLPRELTLHEGKLLQRPIP
FT                   ELTTLRRNSEDRVADTLSSESKTYEGFKGTAYELICEVDLLDAKAFGIEFRASETEKTV
FT                   IKYNAVSRKLVLDRSQSGEPVAAEYGEVRQCAWDKDHIKLHLFVDTSSVEIFINDGEEV
FT                   FTSRIFPHPESDEIRFFADKGEALFQAVKWNFT"
FT   gene            386585..388012
FT                   /gene="scrA1"
FT                   /locus_tag="PPSC2_01660"
FT                   /old_locus_tag="PPSC2_c0339"
FT   CDS_pept        386585..388012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrA1"
FT                   /locus_tag="PPSC2_01660"
FT                   /old_locus_tag="PPSC2_c0339"
FT                   /product="PTS sugar transporter subunit IIA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54323"
FT                   /db_xref="GOA:E3ECI0"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECI0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368965.1"
FT                   /protein_id="ADO54323.2"
FT                   /translation="MNIMAENREIAKEVIEAIGGKENIASFAHCATRLRIMVHDKEKID
FT                   QKKVEEIDKVKGAFFNSGQYQIIFGTGTVNRIFEEVEKLGVTGSSKEEVKSQAKKEGNV
FT                   FQRSIRTFGDVFVPIIPVLVATGLFMGLRGLLTQPQILALLGMTPQDISPNFLLYTQVL
FT                   TDTAFAFLPALVAWSAFRVFGGSPVLGIVLGLMLVNPALPNAYSVADGSAHPLTMFGFI
FT                   PVVGYQGSVLPAFFVGLIGAKLERALRKRVPEALDLILTPFLTLLIMITLGLFAIGPVF
FT                   HSLEEWVLHGTIFVLDLPFGIAGIVIGFLHQIIVVTGVHHIFNFLEIQLLEKNGVNAFN
FT                   AIITCAMAAQGAACLAVGLKTKDSKLKALALPSSFSAFLGITEPAIFGVNLRYMKPFVM
FT                   GLIGGAVGGFIASVFHLAATGMAVTVIPGTLLYMNHQLPLYILANLAAMAVSFVLTWMF
FT                   GFSDKMLDKVKTAGSSK"
FT   gene            complement(388140..388928)
FT                   /gene="yisR3"
FT                   /locus_tag="PPSC2_01665"
FT                   /old_locus_tag="PPSC2_c0340"
FT   CDS_pept        complement(388140..388928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yisR3"
FT                   /locus_tag="PPSC2_01665"
FT                   /old_locus_tag="PPSC2_c0340"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54324"
FT                   /db_xref="GOA:E3ECI1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECI1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428280.1"
FT                   /protein_id="ADO54324.1"
FT                   /translation="MITLMDIRQDNGVDWYEKAGTNSSHDDLLFILVTFGKCVYWVNDC
FT                   KFILGKGEALLLPAHLNYYGKSIPTLFHTKYVIHCRKTCTNSTLPILNTNKPLLIKPGC
FT                   YDMLHERIKSMYYQWTEHPSYYTLMADCLLTEAMIYVNQEWDKGAISCDKERHVEHMKQ
FT                   YIQNHYREKVTKEELGDAIRKTPNYAATLLREVTRQTISEHVHTQRIKTAIYMLTESRL
FT                   TIREISEYVGYSDVSYFHRIFKRLTGCSPSEFLDERSSIV"
FT   gene            389107..390522
FT                   /gene="pykA1"
FT                   /locus_tag="PPSC2_01670"
FT                   /old_locus_tag="PPSC2_c0341"
FT   CDS_pept        389107..390522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA1"
FT                   /locus_tag="PPSC2_01670"
FT                   /old_locus_tag="PPSC2_c0341"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="catalyzes the formation of phosphoenolpyruvate from
FT                   pyruvate"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54325"
FT                   /db_xref="GOA:E3ECI2"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECI2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820210.1"
FT                   /protein_id="ADO54325.1"
FT                   /translation="MLKTKIICTMGPACDSIDLLKEMIQAGMTVARLNMAHGELEDHVK
FT                   RIENVRQAAKEMNTCIPVMMDIKGPEIRIGKLKEASVLLKPGSQLILTTEEILGDEHRI
FT                   SVNYPDMPKDIKTGDRILIDDGLVDLTVTSIEGTEMICNIVSGGILKPRKGVNLPGIHT
FT                   TLPGVTERDVKHIQFGVEQRIELIAASFVRKGDDIREIREILKGHHAEHVQIYSKIENA
FT                   EGMENLDDIIEASDGIMVARGDLGVEVPIQDVPVMQKEMIDKCNLVGKPVIVATHMLES
FT                   MQVNPRPTRAEVSDVFNAVMQGADVVMLSGESAAGKYPVESVRTMAAVAASAESQLDYQ
FT                   EQFDKRRARQSTNITEVISQGAVSSSLELDAKAIITSTASGFTARMVSKYRPKAPIIAV
FT                   TPNNTVFAKICLLSGVFPIKGDKVATTDEMFESSIRNALNAGYIQKGDTVVLSAGVPVA
FT                   EAGTTNLIRVYQA"
FT   gene            complement(390598..390996)
FT                   /gene="M1-479"
FT                   /locus_tag="PPSC2_01675"
FT                   /old_locus_tag="PPSC2_c0342"
FT   CDS_pept        complement(390598..390996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-479"
FT                   /locus_tag="PPSC2_01675"
FT                   /old_locus_tag="PPSC2_c0342"
FT                   /product="M1-479"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54326"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECI3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010348554.1"
FT                   /protein_id="ADO54326.1"
FT                   /translation="MNRKRMLVICTLLLALSIGQSSTWGSRTNAAALAPERALHVQDNE
FT                   ASKDDDLLKTLGISSDEQLYDALYNGQTLADIAQTHNQDAQAIVDLQVAQLTEQLDQRL
FT                   ANKSITLEQYQAHKAELTQVVAKSVFGL"
FT   gene            complement(391288..391629)
FT                   /gene="yhaH"
FT                   /locus_tag="PPSC2_01680"
FT                   /old_locus_tag="PPSC2_c0343"
FT   CDS_pept        complement(391288..391629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhaH"
FT                   /locus_tag="PPSC2_01680"
FT                   /old_locus_tag="PPSC2_c0343"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54327"
FT                   /db_xref="GOA:E3ECI4"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECI4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820212.1"
FT                   /protein_id="ADO54327.1"
FT                   /translation="MQWYLKVLQNYVGFQGRARRTEYWMFTLFNAIAGLVLYLLDFLLG
FT                   LPFVLSFIYGLAVLLPSLAVLFRRLHDTGKTGWWILIALVPFGSIVLLVFTCLDSQPGD
FT                   NKYGQNPKL"
FT   gene            392059..394494
FT                   /gene="yxiA1"
FT                   /locus_tag="PPSC2_01685"
FT                   /old_locus_tag="PPSC2_c0344"
FT   CDS_pept        392059..394494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxiA1"
FT                   /locus_tag="PPSC2_01685"
FT                   /old_locus_tag="PPSC2_c0344"
FT                   /product="glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54328"
FT                   /db_xref="GOA:E3ECI5"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR032291"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECI5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685857.1"
FT                   /protein_id="ADO54328.1"
FT                   /translation="MKQLFVRKVTAASLAGALLLPASLVGAESTLNSDTAGIQSVEQTS
FT                   LQAQGLENVLSQSKKAVSFKETSVHDPSILKVKDIFYIFGSHLAAAKSKDLMNWDTIAT
FT                   GVANGNALIPNVKEELKEALDWAQTDTLWAADVIQLADGKFYMYYNACKGDSPRSAMGL
FT                   AVADKIEGPYKNKGIFLKSGMWDQPSEDGTIYDATKHPNAVDPDTFYDKNGKLWMVYGS
FT                   YSGGIFIMQMDEKTGKPLPGQSYGKKLTGGNHARMEGPYIQYSPQTDYYYLFLSYGGLS
FT                   ADGGYNLRVARSKTPDGPFYDAEGNDMIKVKANPDKPLFDDASIEPYGVKLIGNYLIPR
FT                   EIGDPGTGLGTGYVSPGHNSAYYDPKTKKHFVIFHSRFPGRGEQFEVRVHEMFMNADGW
FT                   PVVAPYRYTGDEDSLKKLSEKDVIGQYSYVNHGKEISANIKQAVTVNLDRGGKLSGGVN
FT                   GTWKLGADNQLEITADGAKYKGVFLRHRDPDTGAKTLAFTALSSKGVAVWGSLKPDLKA
FT                   SKIVAAVQKDLSLGDTSNVFYDLTLPTQAAQDTTISWESSRPEIISVTGEVYRPEAGSQ
FT                   PAAVTLTATIKKDKATAKKSFTAIVPEQAQGPQLARYSWSEDQGTSVVDSTYNQLDGKT
FT                   YGGATWDKDGKLGGALSLNGKDGYVQLPNTVTDAKDFTFSAWVNWKGGAAWQRIFDFGN
FT                   GQARHMFLTPSQGSGVLQFTIHEGTDQSLLSKSSLPLNQWTHVAVTLEGNTGKLYVNGE
FT                   EVAVNDGITFNPNELLTNEAYLGKSRFVADAYFNGSLDEVQLYNKALTAEEIKALADL"
FT   misc_feature    394807..395133
FT                   /note="cspA"
FT   gene            394879..395079
FT                   /gene="cspD"
FT                   /locus_tag="PPSC2_01690"
FT                   /old_locus_tag="PPSC2_c0345"
FT   CDS_pept        394879..395079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="PPSC2_01690"
FT                   /old_locus_tag="PPSC2_c0345"
FT                   /product="cold-shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54329"
FT                   /db_xref="GOA:E3ECI6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECI6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019121223.1"
FT                   /protein_id="ADO54329.1"
FT                   /translation="MQTGTVKWFNAEKGFGFIEVEGGSDVFVHFSAIQGEGFKSLDEGQ
FT                   RVEFNVVEGNRGPQAENVVKL"
FT   gene            395211..395426
FT                   /locus_tag="PPSC2_01695"
FT                   /old_locus_tag="PPSC2_c0346"
FT   CDS_pept        395211..395426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_01695"
FT                   /old_locus_tag="PPSC2_c0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01695"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54330"
FT                   /db_xref="InterPro:IPR025916"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECI7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308357.1"
FT                   /protein_id="ADO54330.1"
FT                   /translation="MYNSRKKPMDEIPEEITTVWNCASDTCNGWMRDNFAFSVEPTCPI
FT                   CGSAMVKGEKKLAVLNNTSFNHTKQS"
FT   gene            complement(395509..396333)
FT                   /gene="yisY"
FT                   /locus_tag="PPSC2_01700"
FT                   /old_locus_tag="PPSC2_c0347"
FT   CDS_pept        complement(395509..396333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yisY"
FT                   /locus_tag="PPSC2_01700"
FT                   /old_locus_tag="PPSC2_c0347"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54331"
FT                   /db_xref="GOA:E3ECI8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECI8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368971.1"
FT                   /protein_id="ADO54331.1"
FT                   /translation="MGYYIEVERGVKLYVEDIGEGIPVLMVHGWPLDHRMYEYQVALLP
FT                   AYGYRCIQVDLRGFGKSDRPWHGYHYDRLADDLLAVIQALQLSHIRLIGFSMGGAIVTR
FT                   YMSRHRGWGVDQLILIGAATPRFTPTSDFPYGTPVAEVDKLIKQAYTDRPQLVTSFGEM
FT                   LFANPVSQSLRDWLRDQGFAASVHSMACTLYSLRDSDLRPDLPCIHVPTWILHGKLDRV
FT                   CPFPLAIQTQKGIAGSRLIPFERSGHSVFYEALPEFNSTLLSILSPSSLHPN"
FT   gene            396520..396852
FT                   /gene="M1-485"
FT                   /locus_tag="PPSC2_01705"
FT                   /old_locus_tag="PPSC2_c0348"
FT   CDS_pept        396520..396852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-485"
FT                   /locus_tag="PPSC2_01705"
FT                   /old_locus_tag="PPSC2_c0348"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01705"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54332"
FT                   /db_xref="GOA:E3ECI9"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECI9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308359.1"
FT                   /protein_id="ADO54332.1"
FT                   /translation="MTPSKTLKWITGGLELFFAIPVLGGLLVINSAYTVLFFMLIFHIV
FT                   TLVLSVTNKEAYYGSVLGIVTSVIGWIPFVGWLMHLISGIFLMITAAQQPRDQYRNRNP
FT                   YDDYRY"
FT   gene            complement(396903..397448)
FT                   /gene="yhfO"
FT                   /locus_tag="PPSC2_01710"
FT                   /old_locus_tag="PPSC2_c0349"
FT   CDS_pept        complement(396903..397448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhfO"
FT                   /locus_tag="PPSC2_01710"
FT                   /old_locus_tag="PPSC2_c0349"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54333"
FT                   /db_xref="GOA:E3ECJ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECJ0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368973.1"
FT                   /protein_id="ADO54333.1"
FT                   /translation="MKINKQEFNVEGVSYTIRSAMIQDAMNLSEIRVLIDGETENLDRE
FT                   KGEAFISTSGFEQLIKADTEHAKNLFLVAVVHDKVVGFSRCEGHLLRRFAHKVEFGVCV
FT                   LKDFWGYGIGTNLLKKSISWADSNGIQKMTLQVLETNNKAIALYKKHGFEIEGVLKNDK
FT                   ILSDGQYYNTILMGRIHN"
FT   gene            complement(397710..398282)
FT                   /gene="M1-488"
FT                   /locus_tag="PPSC2_01715"
FT                   /old_locus_tag="PPSC2_c0351"
FT   CDS_pept        complement(397710..398282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-488"
FT                   /locus_tag="PPSC2_01715"
FT                   /old_locus_tag="PPSC2_c0351"
FT                   /product="M1-488"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01715"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54335"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECJ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368975.1"
FT                   /protein_id="ADO54335.1"
FT                   /translation="MKSTKKAILAGTLALAFLGGGALYSTSAAHAASTTPDASTANKAQ
FT                   APKGNPGDANGPQIAGGNYAENKALLKLLKLSSSQLDTQLKAGKSLATIATAQGVSVNS
FT                   VIDVMVSDMKSKLATEKQNGKITASEYNQRVSNLKQMITDMVNGVKPSKPPVDGAKGET
FT                   GKAPAKTDAAAKAPAKTNTAKASAKQK"
FT   gene            398501..398914
FT                   /gene="yhcF"
FT                   /locus_tag="PPSC2_01720"
FT                   /old_locus_tag="PPSC2_c0352"
FT   CDS_pept        398501..398914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcF"
FT                   /locus_tag="PPSC2_01720"
FT                   /old_locus_tag="PPSC2_c0352"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54336"
FT                   /db_xref="GOA:E3ECJ3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECJ3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308362.1"
FT                   /protein_id="ADO54336.1"
FT                   /translation="MEEQRVGSFRFLIDFSQPLYEQILNQVRSSIAKGEIEMGSKMPSV
FT                   RDLAQELRMNPNTVMRAYQELERDGLTEKRRGLGTYVTSSSERIASFREQLAMTYIDQF
FT                   LGQMSSLGLSWEDVQQYIRNRQDGDHEEGGEKA"
FT   gene            398911..399624
FT                   /gene="potA1"
FT                   /locus_tag="PPSC2_01725"
FT                   /old_locus_tag="PPSC2_c0353"
FT   CDS_pept        398911..399624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA1"
FT                   /locus_tag="PPSC2_01725"
FT                   /old_locus_tag="PPSC2_c0353"
FT                   /product="multidrug ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01725"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54337"
FT                   /db_xref="GOA:E3ECJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECJ4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685862.1"
FT                   /protein_id="ADO54337.1"
FT                   /translation="MTESVVTAKKLIKQYGNKKALDQLDVVIPTGRIVGVLGPNGCGKS
FT                   SFFRAITGLIQPDGGELQVLGQQPGWETNRNISYLPDRARWYPNHTVQQTLEWGKSFLP
FT                   GFNIEDAYKLADHMDVELELKMAGLSRGQEARVLLILCLAREVPLMILDEPFVGIDVLS
FT                   REAIVAGIIDYLEDRQQSILISTHDIQEVEGLFDYTVMMDRGRVIWSGESDDLRAEHGS
FT                   LNQVFRNLYKREWKA"
FT   gene            399621..400388
FT                   /gene="M1-491"
FT                   /locus_tag="PPSC2_01730"
FT                   /old_locus_tag="PPSC2_c0354"
FT   CDS_pept        399621..400388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-491"
FT                   /locus_tag="PPSC2_01730"
FT                   /old_locus_tag="PPSC2_c0354"
FT                   /product="M1-491"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54338"
FT                   /db_xref="GOA:E3ECP4"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECP4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010348541.1"
FT                   /protein_id="ADO54338.1"
FT                   /translation="MNSSGLFKDLIRHEFRNKGSWRKQSRNRLPRSWRLVYFSLFLIAA
FT                   FAISLYFALHNQLELTRLWYVTLGLPYMIVFMGVGMLRREWENDTYGWWLTLPYPRMWL
FT                   ISAKWIAAILQTIVVILLLFVVGSLYALFISSTIQAYTFADAASFMIAGLNWFVMIIGF
FT                   TPLVIALGLLTASTKYSTLRPLSPILWILLMGGGSIFYWSGDQRIYEQFDRVQNGHWFP
FT                   FTWHFPVAVLISWVAAYALIRLNAYLLEKKLSI"
FT   gene            400428..400913
FT                   /gene="ccdC1"
FT                   /locus_tag="PPSC2_01735"
FT                   /old_locus_tag="PPSC2_c0355"
FT   CDS_pept        400428..400913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdC1"
FT                   /locus_tag="PPSC2_01735"
FT                   /old_locus_tag="PPSC2_c0355"
FT                   /product="cytochrome C biogenesis protein CcdC"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01735"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54339"
FT                   /db_xref="GOA:E3ECP5"
FT                   /db_xref="InterPro:IPR009916"
FT                   /db_xref="InterPro:IPR031306"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECP5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425683.1"
FT                   /protein_id="ADO54339.1"
FT                   /translation="MTTIFIYALMAVLVGLMIWLRTKRRRGPVKGNGFRILLPMFIAFP
FT                   AMMISVYQLMHIPGQTYALPAFWELLVAGLLGALFGYVVLLHTAYERRDDGLIYPKPNQ
FT                   YFKYIIIAIILIRVVLTQYLSSLGTTEISMLAITMALVYISIWRIGSFIKFRRTLSV"
FT   gene            401269..402486
FT                   /gene="M1-493"
FT                   /locus_tag="PPSC2_01740"
FT                   /old_locus_tag="PPSC2_c0356"
FT   CDS_pept        401269..402486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-493"
FT                   /locus_tag="PPSC2_01740"
FT                   /old_locus_tag="PPSC2_c0356"
FT                   /product="SnoaL polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54340"
FT                   /db_xref="GOA:E3ECP6"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECP6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368980.1"
FT                   /protein_id="ADO54340.1"
FT                   /translation="MKKHTVTAALAGLLVLSSAVPALAADVKPATGIQVWVDGKKEAYK
FT                   IAPIVRNKQVLIPLRQLATSLGIPLDAKHITFNTARQSTTIRYDQATVVLVSGSPEAQI
FT                   NGIKVPLSTSTILTKQGVTYVPVDVVKEAWGKQVIWDPASQTLQIGVSNKDKVVEILKS
FT                   FETGNTKAAEAWISKDQYIQHNPSFASGRDAFLQGISHSKGANVLVEVQRVIQDGNDVA
FT                   VHYKKSIAGKTSIGFDIFRFDSNGKIVEHWDNMQDSAPTNPSGHTMIDGTTQITDLNQT
FT                   ETNKTLIRKFVDDVLVGKNRAALESYYNGDQYIQHNPLFGDGVSSLKQALSAAGQGASI
FT                   GYDQVHMVLGEGNFVLVVSELKSPKGTSAAVYDLFRVENGKIAEHWDVVKEIPAKTEWK
FT                   NTNGKF"
FT   gene            402570..403247
FT                   /gene="M1-494"
FT                   /locus_tag="PPSC2_01745"
FT                   /old_locus_tag="PPSC2_c0357"
FT   CDS_pept        402570..403247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-494"
FT                   /locus_tag="PPSC2_01745"
FT                   /old_locus_tag="PPSC2_c0357"
FT                   /product="M1-494"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01745"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54341"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECP7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368981.1"
FT                   /protein_id="ADO54341.2"
FT                   /translation="MEGLKERVGCLHAHHSNIAYVERAFASYEVELVHFVEPGLMRRVS
FT                   SDPHFSADDASRKVEEQLSWMSQSDLDVILITCTNYIALAEKAQGAMSTPIVALDEPFF
FT                   HEMCDDLLPRTLVFTNPATVEGTMKRLYHTATLLGKPELSSLIEVKVVESAFELIMQGR
FT                   KDEYEELLIRSLHELRNADPSRELAVAQLSMVDAALQVELETGRTIGNPLRSLANLIKV
FT                   LLG"
FT   gene            complement(403341..404345)
FT                   /gene="purR1"
FT                   /locus_tag="PPSC2_01750"
FT                   /old_locus_tag="PPSC2_c0358"
FT   CDS_pept        complement(403341..404345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR1"
FT                   /locus_tag="PPSC2_01750"
FT                   /old_locus_tag="PPSC2_c0358"
FT                   /product="LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54342"
FT                   /db_xref="GOA:E3ECP8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECP8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368982.1"
FT                   /protein_id="ADO54342.1"
FT                   /translation="MVSIKDIAKQAGVSISTVSYALNGSDKVTEETCARILAIAKELNY
FT                   VPNAAARNLKKRQTKIIGVFLTDFRGDVYGDLLYGIKEILNRKGYDLIVCSGKQSHRML
FT                   PERMIDGAIVLDQTFDSQELLNYAERGHKIVVLDRELNHPNINQVLLDNKAGAALAIEH
FT                   LLELGHRKLYVVTGPEGSYDSWQRMQAVKQTIERSGVAEMIEIGGNFEKSGGEQAAEII
FT                   LQQQADPDSKPVAVFCLNDEMAVGFYNRMAQSELTIGKDVHIVGFDNIELAQYIQPRLT
FT                   TIDYSKRKWGAVAAEQVLKIIAGEDVEHERLYVTLVQRESAGAAFITQDQQNL"
FT   gene            complement(404512..407952)
FT                   /gene="chvB1"
FT                   /locus_tag="PPSC2_01755"
FT                   /old_locus_tag="PPSC2_c0359"
FT   CDS_pept        complement(404512..407952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvB1"
FT                   /locus_tag="PPSC2_01755"
FT                   /old_locus_tag="PPSC2_c0359"
FT                   /product="cellobiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01755"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54343"
FT                   /db_xref="GOA:E3ECP9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECP9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820224.1"
FT                   /protein_id="ADO54343.1"
FT                   /translation="MNTSLDQNILLRAGDLSFTFLSSGDVYKIAHGSTMINQLLTNSVD
FT                   GSLNNLYLRLYRPSGVSITPLLGVRSPGVIRQTDQQIIWEGFTAGVGYQVTFTLSRLGV
FT                   WFWDVTLQGDDVEADIVYGQDIGIADTAAVRSNEAYLSQYIDHTVYHDEQRGYTVCSRQ
FT                   NQPQSQAFPYIQQGSLTRTVGYSTDGFQFFGLSYKETNEPEALRRDSLANEVYQYEFAY
FT                   TALQSERVKLAGEARFTFYGLFQPSHPAAVTKLEYQDLVTKARDEVVGVLADASATIIP
FT                   ARIASDFQAERVATAQTIGEPLRTLDLTDAEVDQLFPKRQEEERDGDELLSFFTDSYEH
FT                   VVLKSKELRVERPHGHILMGGHYSGGKEETITTTSYMYGVFNSQLVIGNTNFNKMITNV
FT                   RNALNIPKTSGQRIYVGIQGKYRLLTMPSLFEIGFNYVRWYYKTADDTFIITNHTNADS
FT                   PEVRLHMRSASGKAYPFLITQQMCMHVNEYELPFHMEREGDDLLFRADSASLSAEAYPD
FT                   LLYRMHVAGASLQQVSDAQALLQGGASPDASLVVLELGDSSEWTCTVQGWLHGRSTGKD
FT                   RAHKELHASFEDERERYREYFAELMNGFHLTLGQQETSELFRVNAVAWWYTHNMLVHYS
FT                   VPHGLEQYGGAAWGTRDVCQGPVEYFSAVQKFDEVRSILLTVFSHQYEDSGNWPQWFMF
FT                   DNYTHVQQEESHGDIIVWPLKVLGDYLTATRDYSILGENVPYTHRHTFDYTKQTATLME
FT                   HALKEIEYIRENFLHDTYLSAYGDGDWDDTLQPANAQLKQYMASSWTVALTYQVVRNFA
FT                   AALEQAPADVVSEADKIAQDLHQMANGIRKDFNRYMLESGIIPGFVYMEEPGQPKLMLH
FT                   PSDTETGIHYRLLPMTRSMISQLLTPEQALAHEQLIREQFLCPDGVRLMNRPAQYDGGV
FT                   SSHFKRAEQAANFGREVGLQYVHAHIRFVEAMAKLGRKDDAWHSLKLINPVGIRATVPN
FT                   AEWRQSNAYFSSSDGKFNTRYEAQERFGELREGAVPVKGGWRIYSSGPGIYMNQLISNV
FT                   LGIRQSGEDLILDPVLPDDLDGLEFKFSFAGKPITFVYRMLQEHTSGEQGRTVLNGAPL
FT                   ESEPADDNRYRSGALRIKRETFEQALAEHDGVHCLEIIL"
FT   gene            complement(407966..410143)
FT                   /gene="bglX"
FT                   /locus_tag="PPSC2_01760"
FT                   /old_locus_tag="PPSC2_c0360"
FT   CDS_pept        complement(407966..410143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglX"
FT                   /locus_tag="PPSC2_01760"
FT                   /old_locus_tag="PPSC2_c0360"
FT                   /product="glycosyl hydrolase family 3"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54344"
FT                   /db_xref="GOA:E3ECQ0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECQ0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685868.1"
FT                   /protein_id="ADO54344.2"
FT                   /translation="MMEQHLNSYLQNMTLEEKVDQLLQLVGGFFEEAGTEGQITGPMAS
FT                   LGITEQTVHNVGSVLGLAGAQEAIRVQQAHLSKNRLGIPLLIMADIVHGFKTIFPIPLA
FT                   IGCSWDMELAEESATIAAREAAVSGVHVTFAPMVDLVRDPRWGRVMESTGEDPYLNSQF
FT                   ARAFVRGFQGKDLTNDTERVAACVKHFAAYGAGEGGRDYNTVDVSAWQLREYYLPSYKA
FT                   ALDEGCEMVMTSFNTVEGVAASGNKRLMRDLLRDEWGFDGVLISDWAAIKELIPHGIAE
FT                   DEREAAKKALLAGVDIEMMTSCYNGHLPELIRSGQLDEALVDEAVMRILKLKQKLGLFE
FT                   NPLRGADPEREREVVFCEAHRAVAKELAIKSCVLLKNDSVLPLNRNQRIALIGPFAESG
FT                   DILGSWSWSGSQEEAIRVVDGFHSKISSSLLTVAAGCSVDDITEEQYAEALHAASQAEV
FT                   IVLALGERSDMSGEAGSRSNIRLPQAQLELVKRLKTLNKPMVAVLFNGRPLDLHGVIEE
FT                   ADAVLEAWFPGGEGGAAIADLLYGDAEPTGRLTMSFPQSVGQVPVYYNHFNTGRPQLDP
FT                   NTTERYVSQYLDIPNEPLFPFGYGLSYTDVAYDSLQLSGDTLIPGQELTVRVQVTNTGT
FT                   RPVEETVQFYVRDISGDTVRPMKELKDFCKVLLAPGESQEVEFTVTEPQLRYHHADLSF
FT                   DSDSGEFAVFTGPNSRDTTEGRFRLVKETGK"
FT   gene            410645..411898
FT                   /gene="malE"
FT                   /locus_tag="PPSC2_01765"
FT                   /old_locus_tag="PPSC2_c0361"
FT   CDS_pept        410645..411898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malE"
FT                   /locus_tag="PPSC2_01765"
FT                   /old_locus_tag="PPSC2_c0361"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01765"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54345"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECQ1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425689.1"
FT                   /protein_id="ADO54345.2"
FT                   /translation="MMKRTLGIILASTLLLGGALAGCSSKDDSSGKDANGKTTITMWGM
FT                   GAEGKLLPEIVKDFEKENPDIHVDVQALPWDNAHDKLLTAVASKSGPDVVQLGTSWVPE
FT                   LASAGALTDITPYISKYPELEAKNFFEGAVGTAQFEGKPVAVPWYTETRVLFYRSDLLK
FT                   QVGYNEAPKTWEELSDAAQKLAARGKGKYGISFSAKEQSMGFMFALQNGSKLVDEQGNP
FT                   LFNQPPFVDAVKYVNTFFQNGSNAVDIGIDSVQGLQGEGIVPMFISGPFMIKEIKSKAP
FT                   ELEGKWNIAELPGKVNNLSVLGGANLSIMKFSKHPEESAKFLAYMSKPETQLKWMDLSS
FT                   NLPATTKSWEDAKLKSDPMLRTIRKQLDHSAALPQLAAWEEVSQQFIKSFERIYRGHAD
FT                   VQKEMDDFNQQAASIMKK"
FT   gene            411935..412819
FT                   /gene="lacF3"
FT                   /locus_tag="PPSC2_01770"
FT                   /old_locus_tag="PPSC2_c0362"
FT   CDS_pept        411935..412819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacF3"
FT                   /locus_tag="PPSC2_01770"
FT                   /old_locus_tag="PPSC2_c0362"
FT                   /product="sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54346"
FT                   /db_xref="GOA:E3ECQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECQ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279338.1"
FT                   /protein_id="ADO54346.1"
FT                   /translation="MKGSSQKLAPYLFIGPSIILLTLFSLLPILLALVISFTDMDLSGL
FT                   VNYESIRFIGLENYTNVLLDPSFLKSIGNTLFFVIIGVPLVLIFSLSIAILINMGKSRA
FT                   FKIFRVVFYLPSVTNVVAVAVVWSYLYNPTLGLFNYVLGLMNLGPVPWLTDPTVAKISL
FT                   IVLAVWRGIGLNMIIFIAAIKGIPGSYYEAAQLDGANTWQQIRYITLPQLRYAIFFVSI
FT                   TTMIGWLQFFEEPFVMTKGKPLDGTLTASLFIYNNGFQFSKFGYAAAGSFILFFAIIAV
FT                   TLIQFRLQNKAES"
FT   gene            412838..413692
FT                   /gene="lacG"
FT                   /locus_tag="PPSC2_01775"
FT                   /old_locus_tag="PPSC2_c0363"
FT   CDS_pept        412838..413692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacG"
FT                   /locus_tag="PPSC2_01775"
FT                   /old_locus_tag="PPSC2_c0363"
FT                   /product="sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54347"
FT                   /db_xref="GOA:E3ECQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECQ3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308375.1"
FT                   /protein_id="ADO54347.1"
FT                   /translation="MKTAVQQARANTRSGEKTFQWFVAILLTVGGLLMVLPFAWMILSS
FT                   FKTEGEVTKIPPTIWPEHFTLDNFKILFDSMAFGTYLTNTLIIVLASFFGLFLNAMAGY
FT                   GFAKFQFKGKGFLFYLVLATMMIPGQVTMIPVYLILNQMGLTNSMLGIVLPGLVGAFAI
FT                   FLFRQFMSDIPEELLEATRLDGAGEFRTFLQIVLPISTPIIAVQAILTFIGGWNSFLWP
FT                   LIIANDEKLYTLSVGLSLLKGQNESQFALQMAGSTFMVVPIMIIFIIFQKYIIENYTIS
FT                   GIK"
FT   gene            414065..414606
FT                   /pseudo
FT                   /locus_tag="PPSC2_01780"
FT                   /note="arylsulfatase regulator; disrupted"
FT   gene            414596..415474
FT                   /gene="pstB1"
FT                   /locus_tag="PPSC2_01785"
FT                   /old_locus_tag="PPSC2_c0366"
FT   CDS_pept        414596..415474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB1"
FT                   /locus_tag="PPSC2_01785"
FT                   /old_locus_tag="PPSC2_c0366"
FT                   /product="multidrug ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01785"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54350"
FT                   /db_xref="GOA:E3ECQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECQ6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425691.1"
FT                   /protein_id="ADO54350.1"
FT                   /translation="MTIDIQALSKSYGSHQVLNELHFHIDNGIFGLLGDNGAGKTTLMK
FT                   ILATLLRFDRGEVEIFGHSLKKEPDAIRSLLGYLPQYFDFFPNVTILESMNYFAALKGI
FT                   QGKHHIQEETSQRLIEVGLIDQVDKKIKQLSGGMKQRLGIAQAMLGQPKLLIVDEPTVG
FT                   LDPKERIAFRNLLQNYGEDRIILLSTHIVPDVSSTCDKLLVLKEGRCLYQGAIDDMIRT
FT                   VEGKVWLVDVGKRQLEQLSQQARITSIVRKEGRVQARLLCNYPPDCCTEVTPETANLED
FT                   AYLYISDPEES"
FT   gene            415479..416168
FT                   /gene="M1-503"
FT                   /locus_tag="PPSC2_01790"
FT                   /old_locus_tag="PPSC2_c0367"
FT   CDS_pept        415479..416168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-503"
FT                   /locus_tag="PPSC2_01790"
FT                   /old_locus_tag="PPSC2_c0367"
FT                   /product="M1-503"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54351"
FT                   /db_xref="GOA:E3ECQ7"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECQ7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425692.1"
FT                   /protein_id="ADO54351.1"
FT                   /translation="MGQVIRALVQFEVLLMKKSVVFFIALTFSCFLIPLFLYLGAGNKN
FT                   NTLWIFLHHGQMFFTILLMPLMYSVLYDGEKQKMISSVIMPKLPKGAQYFYCKSCVLWG
FT                   VVCLFQFVALAIFCVVQWTTHGKAPFLILLHLTVAGVATMGYSVQITVILNLLLRKQLY
FT                   VNIVMLVYLLISITINLPYISIWFNPDWIISNFFTQSFAFGRVFLFLLMWVLMKVSNHL
FT                   WMARVQE"
FT   gene            416165..417310
FT                   /gene="M1-504"
FT                   /locus_tag="PPSC2_01795"
FT                   /old_locus_tag="PPSC2_c0368"
FT   CDS_pept        416165..417310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-504"
FT                   /locus_tag="PPSC2_01795"
FT                   /old_locus_tag="PPSC2_c0368"
FT                   /product="M1-504"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01795"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54352"
FT                   /db_xref="GOA:E3ECQ8"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECQ8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368992.1"
FT                   /protein_id="ADO54352.1"
FT                   /translation="MNGIIVRFWLQLLLRREQAVTLLVSFSVVLLFNLIMNEGIAITYS
FT                   VNLLFVAFFSLQIASIHNRNHTEPYIYISVFPNYRLIAYQLYVSLILSFPLLLMMVGLL
FT                   WKSFADVSLWNLVIIVFFSSVFSSMLGLFLGQVVKHYGLAFTFLIAFYLPIGLVSWSFN
FT                   EKLRYISPVVNIFNPYMINWRNLFGLLGCSLLFYGLGTLLSSRRGGGKKSIIPWISTVL
FT                   ACSILMGVWGYERLFNENVQTSSFQKITVGQTQVEYKGISSYQARQFATLFETLYQVAK
FT                   KKETHPIHYTLEITRIHSMSSFEPKIIVQNHNKLQINIYSNKLLEFNFGMDWASKWIDY
FT                   ILPQLTHLSNEQVDAFKRLKNEIILEVREKNPENIYTIQGD"
FT   gene            417365..419219
FT                   /pseudo
FT                   /locus_tag="PPSC2_01800"
FT                   /note="ABC transporter permease; disrupted"
FT   gene            419639..420421
FT                   /gene="M1-506"
FT                   /locus_tag="PPSC2_01805"
FT                   /old_locus_tag="PPSC2_c0370"
FT   CDS_pept        419639..420421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-506"
FT                   /locus_tag="PPSC2_01805"
FT                   /old_locus_tag="PPSC2_c0370"
FT                   /product="muscle M-line assembly protein unc-89
FT                   Uncoordinated protein 89"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01805"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54354"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECR0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368994.1"
FT                   /protein_id="ADO54354.1"
FT                   /translation="MNVSFTSSHQSSFHTTDNNRLELRHPLSPQAERKSIGKPQNKIIK
FT                   QLIEQKQNLMERRSDYISNALKRGLGSEAVKAEMEKIDKQIQQIDENIQKQSIEEQKKA
FT                   FGMDEESKKEAQEDKKEQYTHKTAEEQKQSLMTYTMHSIVSANNQLKNSKITKRAQITL
FT                   ESEAKGWENTNPSRSTTLREKAEGLNGKIMEIASNINECIRKAVNEEATIIDRDESKDE
FT                   KESSIEVGRVWTEQEINAYVDSAKDEAKNAGVKINIAV"
FT   gene            420669..422183
FT                   /gene="abfA"
FT                   /locus_tag="PPSC2_01810"
FT                   /old_locus_tag="PPSC2_c0371"
FT   CDS_pept        420669..422183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abfA"
FT                   /locus_tag="PPSC2_01810"
FT                   /old_locus_tag="PPSC2_c0371"
FT                   /product="alpha-N-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54355"
FT                   /db_xref="GOA:E3ECR1"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECR1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685877.1"
FT                   /protein_id="ADO54355.1"
FT                   /translation="MAAAVKAKMIVDKSFRIAEVDKRIYGSFVEHLGRAVYGGIYEPTH
FT                   STSDESGFRNDVKELVKELDVPIIRYPGGNFVSGYNWEDGVGPVASRPRQLELAWRTVE
FT                   PNEVGTNEFFKWAKDVGSEVMMAVNLGTRGIDAARNLVEYCNHPGGSYWSDLRRSHGIE
FT                   QPHKIKTWCLGNEMDGPWQIGHKTAEEYGRLAVESAKAMRLIDPDIELVSCGSSSSTMP
FT                   TFPEWEATTLDHTYEVADYISLHQYYGNHDNDTANYLARSMDMDHFIHTVISTCDYIKA
FT                   KKRSKKKMMLSFDEWNVWYHSNDADKKIDPWSVAPPQLEDIYNFEDALLVGSMLITFLR
FT                   HADRVKMACLAQLVNVIAPIMTENNGKAWKQTIFYPYLHASRYGRGVSLMPVVDSEKYD
FT                   SKDFTDIPYLDSAVVYDEEGDALTVFAVNRHLSESLELTVDVRSFEGYRIVEHTVLEHD
FT                   DLKATNSPAGEKVTPHNGGNAKLEDGIVKAHLGKASWNVIRLAKSH"
FT   gene            422599..424494
FT                   /gene="htpG1"
FT                   /locus_tag="PPSC2_01815"
FT                   /old_locus_tag="PPSC2_c0372"
FT   CDS_pept        422599..424494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG1"
FT                   /locus_tag="PPSC2_01815"
FT                   /old_locus_tag="PPSC2_c0372"
FT                   /product="molecular chaperone Hsp90"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01815"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54356"
FT                   /db_xref="GOA:E3ECR2"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECR2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599403.1"
FT                   /protein_id="ADO54356.1"
FT                   /translation="MSQTDEYRFQVNLGGMIDILANHLYSSPRVFIREILQNATDAITA
FT                   RKELRKTEAESRSLKEDNTLEDTVSESNDYEGKVIVELSGAGDQQVLMIQDNGIGLSEE
FT                   DIHRFLSIIGQSSKKGADLLTSETSFIGRFGIGLLSCFMVSDEIVVLTRSVKEGISMEW
FT                   RGKPDGTYTIRRLETELPIGTQIYLRCKPGSEFYYEPAQVKDSLFYYGALLPYPVLLSV
FT                   DGETKQVNLPSTSWMQDPEQLRSRRGEVLDLGYRLMGERFSDFIPLRTASGRTGGIAFI
FT                   LPRSVNLNSKRLHRVYLKHMLVSDKAENVLPEWAFFIKSLIWTDELQPTASREYFYENE
FT                   QLDAVRSELGTCIREELLRMAEYEPDRLQHWIRLHELSMKALAVEDDEFLRIMHRWFSF
FT                   ESTFGRRELSELIREAGGRPLHYTATVDEYRQITHVAAAQSMLVINGGYIYDSEILDKL
FT                   HWIDATLQTERLSPEDVSLSFTGLTQEEHTKYYDVLRVMDAALQPMRCRAELKRFEPAS
FT                   LPVLYTISQDALTLRSMEHTVEETTSLFSNVLDSLKAGVQQNAGYSTLYFNLSNPVVAR
FT                   IFEATDTQMITAATEMMYVNALMMGHYPMNRSELGLMNRSVLHFINWGLGNGQNT"
FT   gene            424519..425580
FT                   /gene="M1-509"
FT                   /locus_tag="PPSC2_01820"
FT                   /old_locus_tag="PPSC2_c0373"
FT   CDS_pept        424519..425580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-509"
FT                   /locus_tag="PPSC2_01820"
FT                   /old_locus_tag="PPSC2_c0373"
FT                   /product="M1-509"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54357"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECR3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820230.1"
FT                   /protein_id="ADO54357.1"
FT                   /translation="MEETIYEMMEQAQDMPGGAAKLAILEEAVRLADTSGLKELAYEIR
FT                   GEIVDCAIFNGYPLKSLIAFSWQLGQFDQNPEEYDPVELLWNYKWILGKVCSFPNISKT
FT                   QIEDLVEDMRRRYAEYGYNERPYYYYKFRIAMDMGELDEARRYLDMFRVIEPDSMSDCE
FT                   ACEQSQMVRFYYLTGEDEQALAVAKPILSGRMRCAEVPHVTLSQVLLPLYRQGEVDQAK
FT                   EQYRKGYRLVRDDRDFLKTIAEHIEYLTVANPIEGIGVVERHLHIALDYESGLEQMYFY
FT                   AAMVGLLQKLDTSRKLRLIRMPASFEWGKQERTLEEIIAYFRPLAESAAAEFDRRNGNA
FT                   FYSKWIGKIVQPA"
FT   gene            425671..426417
FT                   /gene="yqiK"
FT                   /locus_tag="PPSC2_01825"
FT                   /old_locus_tag="PPSC2_c0374"
FT   CDS_pept        425671..426417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiK"
FT                   /locus_tag="PPSC2_01825"
FT                   /old_locus_tag="PPSC2_c0374"
FT                   /product="yqiK"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54358"
FT                   /db_xref="GOA:E3ECR4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECR4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820231.1"
FT                   /protein_id="ADO54358.1"
FT                   /translation="MTMTQKVINFAHRGASGVCPENTMAAFRHALELGATGIETDVQRT
FT                   QDGHLVLIHDESLERTTGCPLDVRDITLEELNKLDAGSWFDEKFRGERVPMLGELLELA
FT                   QSSDTIINLELKNSIHLYPGMEEEVIAAVKRFGLEKRVILSSFNHESLALCAQIAPEIK
FT                   TGALYIEIMVRPSEYATQFGATALHAYKQVVTPEAVSEALALGVVYHPWTVNEPEEMER
FT                   LLEAGVNGIITDYPDRLAHILAVHSS"
FT   gene            complement(426583..427410)
FT                   /gene="ubiE9"
FT                   /locus_tag="PPSC2_01830"
FT                   /old_locus_tag="PPSC2_c0375"
FT   CDS_pept        complement(426583..427410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE9"
FT                   /locus_tag="PPSC2_01830"
FT                   /old_locus_tag="PPSC2_c0375"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54359"
FT                   /db_xref="GOA:E3ECR5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECR5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013368999.1"
FT                   /protein_id="ADO54359.1"
FT                   /translation="MIPEGNLQSNVDRFNGFADNYDQHRPEAPSLVVEIISRYLDRNVA
FT                   LVADIGCGTGLSTFIWKDTARRIVGIEPNPDMRGIAQRKLERAGTTMTGTISFESGFSN
FT                   NLPFEDGTVDVITCSQSFHWMDPESTLQEAGRVLAQGGVFAAFDCDWPPVLQWQIEQAY
FT                   TELITKADTVLEQEAPVEQQAHKWSKDQHLANLHHSGQFRYIREIVFHNREQCDAARYT
FT                   GLALSQGGIQSLFKLGNRTLDDDIARFVKLVENHFEGRTLDILFSYRMRIGIK"
FT   gene            complement(427553..428434)
FT                   /gene="yngB"
FT                   /locus_tag="PPSC2_01835"
FT                   /old_locus_tag="PPSC2_c0376"
FT   CDS_pept        complement(427553..428434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yngB"
FT                   /locus_tag="PPSC2_01835"
FT                   /old_locus_tag="PPSC2_c0376"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01835"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54360"
FT                   /db_xref="GOA:E3ECR6"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECR6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308391.1"
FT                   /protein_id="ADO54360.1"
FT                   /translation="MRKITKAVIPAAGLGTRFLPATKALPKEMLPIVDKPAIQYIVEEA
FT                   IKSGIESIIIVTGRNKKAIEDHFDKSVELEQVLESKGKYDLLREVQSIGGKAVIHYIRQ
FT                   KEPLGLGHAVRCARQFIGDEPFAVLLGDDIMNSSTPAIRQMMDVYEATGKQVVGVRTVE
FT                   EQDVSKYGIIGSTHQNGLIHEVGGLVEKPSPADAPSRQAVIGRYVLEPSIFSILENMST
FT                   GAGGEYQLTDALHQVALQNQLLALELEGTRYDIGDKAGYLEAVLHMGMQREDLRPMLDS
FT                   MMREWALASMIK"
FT   gene            complement(428431..428853)
FT                   /gene="yngA"
FT                   /locus_tag="PPSC2_01840"
FT                   /old_locus_tag="PPSC2_c0377"
FT   CDS_pept        complement(428431..428853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yngA"
FT                   /locus_tag="PPSC2_01840"
FT                   /old_locus_tag="PPSC2_c0377"
FT                   /product="sugar translocase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54361"
FT                   /db_xref="GOA:E3ECR7"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECR7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369001.1"
FT                   /protein_id="ADO54361.2"
FT                   /translation="MKSRMAQLLPMIRFGIVGLVNTGVDYIIFMLLAWTGVPVVVAQII
FT                   SYSCGTANSYILNSKWTFSKQQANNTSKGQLLKFIVINLIVLGITSLLLQVLHTETKLP
FT                   LALGKLIATAAGMIINYIGSRYWVFGSPSRKESESL"
FT   gene            complement(428856..429947)
FT                   /gene="ykcC"
FT                   /locus_tag="PPSC2_01845"
FT                   /old_locus_tag="PPSC2_c0378"
FT   CDS_pept        complement(428856..429947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykcC"
FT                   /locus_tag="PPSC2_01845"
FT                   /old_locus_tag="PPSC2_c0378"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01845"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54362"
FT                   /db_xref="GOA:E3ECR8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECR8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369002.1"
FT                   /protein_id="ADO54362.1"
FT                   /translation="MSEPIRYSIVIPMYNEEAVITETYRRLKQVMGSMGEPYELIFVND
FT                   GSSDRSVQLIKEFSLRDDTIVLIDFSRNFGHQLAITAGMDYAVGEAVVVIDADLQDPPE
FT                   LIVEMANKWKEGYEVVYAKRLKRNGETRFKKWSASLFYRVLKASTDINIPVDTGDFRLM
FT                   DRKVIDELKRLPENNRFVRGLVSWIGFKQTAVEYERDERLAGETKYPLKRMIKLSLDGI
FT                   TSFSIKPLKLAGYIGALLSMSGFLYLMYVLFLNFFTDSYVMKGWSSMISISLIFDGVIL
FT                   IILGIMGEYIGRIYDETKARPLYIVRERLGGQYDNGPTHAMKVPEQRESLYMKGARDSL
FT                   ISGGRTVRDNSAVYTGPKSGRGA"
FT   gene            complement(429965..432319)
FT                   /gene="arnT"
FT                   /locus_tag="PPSC2_01850"
FT                   /old_locus_tag="PPSC2_c0379"
FT   CDS_pept        complement(429965..432319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arnT"
FT                   /locus_tag="PPSC2_01850"
FT                   /old_locus_tag="PPSC2_c0379"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54363"
FT                   /db_xref="GOA:E3ECR9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECR9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599405.1"
FT                   /protein_id="ADO54363.2"
FT                   /translation="MNMIKKWFKTRADIPLIIIMLISTFLNGYNIWQDKYVNTYYTTAV
FT                   ASMLQSFHNFFFASLDSAGSVTVDKPPVVFWIQTLSAYIFGLHGWSVILPQALAQVGSV
FT                   LLVYLLVKPSFGTLAARLAAFAMATTPIAVAVSRTNNIDAMLVFTLLLATWLLFRGLKN
FT                   SKTGLILAAFAVVGIAFNEKMLQAYMIVPALGLFYLLASKYNWKRKAITLAGSAVVLLI
FT                   VSLSWAVVVDSTPADERPYMGSSGTNSVLNLAFGYNGLSRLTGDQGTGGNRGGQRSEQN
FT                   NNAATNSNITNTDQIQTTTSSNSTTTTDDSGANYMTADGPGAGGQMPPGGFGGNGQGVP
FT                   GGDGQGGPGGGPGGNSGGGMFGTGEKGPLRLFQSSLSGQASWLLPFAIIASIGLLASIR
FT                   RRNITQKHKEVIFWLAWLIPVAAFFSVAGFFHHYYLIMLAPPIAALFGAGFVELWQQYR
FT                   ERSNWLSWLLPVAVLATSVFSWFILQNYNDTIGSGWSIAVLILGIIGTALLVVARMKSE
FT                   KFTRYAIIASVLAMFIGPVYWALTPIVYGGNSMIPQAGPTQFGDGGGGMPGRNDGNRGA
FT                   SFNGQQAEGTQMNNQTQNAENSNSVGNTSSTQTSTDTEQKASTRTRGMGGPNGSQSLDQ
FT                   KTLSYLQKNNTGETYLFAASNYSTAAPYLVEAGQKVIIMNGFVSSDPVYTVDKIKALVE
FT                   SGQVKYFMISGGGGGPDGGNSEVTAWIKEHGKVIPTDEWKTTTTAETSTAVKATNSGND
FT                   TTNTNATVQDGQGGFGGDERGGSGTLYEITL"
FT   gene            432555..433241
FT                   /gene="phoP1"
FT                   /locus_tag="PPSC2_01855"
FT                   /old_locus_tag="PPSC2_c0380"
FT   CDS_pept        432555..433241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoP1"
FT                   /locus_tag="PPSC2_01855"
FT                   /old_locus_tag="PPSC2_c0380"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01855"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54364"
FT                   /db_xref="GOA:E3ECS0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECS0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425704.1"
FT                   /protein_id="ADO54364.2"
FT                   /translation="MNPIHGVKIMLADDEPHILQFLELGLINEGYEVRTAENGSDALDL
FT                   AREFRPHVAVLDVMMPEMNGFEVCQSLKETEDNIAVIMLTAKDDVDDRVKGLKLGADDY
FT                   IVKPFSFNELLARIEARLRNQFPDLLGEVVHGPFQVDDRRKEIRYQSQVLELSPTEYEL
FT                   LKFLVLNHGIVLSKSRILDRVWGYDFGGEDNIVEVYIRSLREKLKDKEHRVIRTLRGVG
FT                   YRVDLL"
FT   gene            433238..434734
FT                   /gene="phoR3"
FT                   /locus_tag="PPSC2_01860"
FT                   /old_locus_tag="PPSC2_c0381"
FT   CDS_pept        433238..434734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR3"
FT                   /locus_tag="PPSC2_01860"
FT                   /old_locus_tag="PPSC2_c0381"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54365"
FT                   /db_xref="GOA:E3ECS1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECS1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599407.1"
FT                   /protein_id="ADO54365.1"
FT                   /translation="MKAGRKKRRKYVLRSLRSQLLARTLLILALLLVLIGFLQYFLMKD
FT                   FLYRSRADAMNTQLNSIPVDLLIKDSQENSGDGIAAPQDDTNRRGNRPGPFLFWPDMSL
FT                   ASIGIDGTFQSLSNENGLKPPRLTTQQYQAMQQSKRMRHGYQLITDAQGKEQLVVFRPL
FT                   GPPDRSSGLLQMGVSTNSMQEQLINQLRTFILLSLIALAIGLALMLPVLRRTLVPLSRM
FT                   VEAVKRIDAGNLDERFDAEQGQYEVDRLAVSFNGMLERLEHSFAAERELQMQMRRFIAD
FT                   ASHELRTPLTSIHGFLEVLLRGAASNPKQLQSALESMYGESKRMNKLVSDLLLLAKLDR
FT                   TPELKLEDISLDALLLEMKPQLLMLAGTRKVFFDMTAGVRVLAEGDKIKQVVLNLFHNA
FT                   VQHTDMEQGVIHVNLSAGKKLADIQIRDNGPGMGKEQLERIFERFYRGDESRTRSSGGA
FT                   GLGLAITKSIVEAHGGSITAESTLGTGSIFKVTLPLAGTV"
FT   gene            complement(434818..439104)
FT                   /gene="vpr"
FT                   /locus_tag="PPSC2_01865"
FT                   /old_locus_tag="PPSC2_c0382"
FT   CDS_pept        complement(434818..439104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vpr"
FT                   /locus_tag="PPSC2_01865"
FT                   /old_locus_tag="PPSC2_c0382"
FT                   /product="serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01865"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54366"
FT                   /db_xref="GOA:E3ECS2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034213"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECS2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369006.1"
FT                   /protein_id="ADO54366.1"
FT                   /translation="MKKPIILQKIPVVSLALALTVSLSLPSFSSAATADLQINSFLKAQ
FT                   EALTIEAAPAFISPELSTDSSRQVRVIVQLDGEPLAVDKYAARSSAKAFTAQSEQKAES
FT                   AIATEQTTFVDQAAEHGISLQVNYQYNTVLNGLEVTVPANKIPELAKLPGVKSIHENKT
FT                   YYSIPVQDPPTLTANEATYDNAPLDQIGVPEAWAKGLNGEGIKVGVIDTGIDYEHPDLK
FT                   EAYKGGYDSFEQDNDPYEEPFLEKENDPYGTGFSGTTHGTHVSGTIAGKAANKSSDIVQ
FT                   KGIAYKSDLYVYKVLGRNTKTGRSSGSSAQVIDGIERAVKDGMNVINLSLGSDSEKDPN
FT                   SPDAIAINNAVLSGVVAVIANGNAAQQGPYFYSMGSPATSQLAISVGAATSPSHSYSNK
FT                   ASVNLVTYGDDEKPITVTSDTYYNFNMMGWQTFHEDFSSILGTEPLELVYANLGYPDDF
FT                   TSKDVKGKVVVVSRGVLGFVDKIANAQLNGAKAIIIFNGQAKSSDSTQANLSEAIPGYD
FT                   GYINSNQGDNVDYIPTFDMTGKEGRALARQIIESQNHKQKFFITFGEEYRRTDNPGNTM
FT                   AGFSSRGPNGDELLSIKPDVSAPGVGIMSTYPAFAKFYPDASYEQAYKRSNGTSMASPH
FT                   VAGLAVLLKQQHPNWTPFDIRAALANTSVTLFNEDKTQYDVYSQGAGLVNIANAIQTPA
FT                   LLETVEKITILDKNFNRQEVVNYNPSASFGLLRPGSDAKQIQLQLKNLSANPVQYEASY
FT                   VLHDNVTSDPTKPIATPDVSNISVQLQGIGANGAISAEPGKSQPFFLSVQPSANAATGV
FT                   YEGEVILKSAGQPTLHLPFVVHVGKENPTTGFGLQDLSFTNPIIYPNRTGAQRTTDLTF
FT                   RLTTDKTNQIALYVYGLDDKLIGLIDGIATTKEQGANARLKQGAYSFKGINGSYVEFDD
FT                   NGKPVLDANGQPVIQHLKDGVYKLEVSSPELNEKGEVERNTDGPKLFTATKSIRVDNSA
FT                   PSGGSSGGGGGGGGGRSNTTPSAATNTSTPVATSAPSLQSVVKQGQAVKAVPTAVALNN
FT                   NVQSLTVADADLQAAVATAGSSPTAIVLSATSQAGQTTKASLTSSQLATLGKAAAGSSL
FT                   VVSNTGSSLALPVSVLKNAPEGAGIEVVISSQAEASGTFTSKLKGSNVIGTPVGFEANV
FT                   ITGGKSQPLKVAPGQFISRSFTVPGQIDPNTAGVLYTANGNVYPVPSVFTKQVDGSTVV
FT                   KVSRPGFSTYAAATRPVSFEDISSSYAQSEIQSLANKLLINGTTDTKFSPKQNVTRAEF
FT                   AVLVTRALGLTPGTAAPFSDIPAGSWYAGDVAAAYGAGLITGRNNDKFDPQANISRQEI
FT                   AVVLGKAVDLLQIKTAADGPARTPYHDTSSFAGYAKDSIEKVSAAGIINGATIKGSSYF
FT                   QPNAPTTREASAKVLHVLLQKAALIN"
FT   gene            439470..440402
FT                   /gene="ppaC"
FT                   /locus_tag="PPSC2_01870"
FT                   /old_locus_tag="PPSC2_c0383"
FT   CDS_pept        439470..440402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppaC"
FT                   /locus_tag="PPSC2_01870"
FT                   /old_locus_tag="PPSC2_c0383"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="catalyzes the hydrolysis of pyrophosphate to
FT                   phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54367"
FT                   /db_xref="GOA:E3ECS3"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECS3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016820240.1"
FT                   /protein_id="ADO54367.2"
FT                   /translation="MAKTLIFGHKNPDTDTICSAIAYADLKTKLGADVEPVRLGEVNGE
FT                   TQYALDYFKVSAPRLVEQVATETDSVILVDHNERQQSATDIDKVRVTEVIDHHRIANFE
FT                   TSQPLYFRAEPVGCTATILNKLYKENGVAIPKEIAGLMLSAIISDSLLFKSPTCTDQDV
FT                   AAARELAEIAGVDADRYGFDLLKAGADLSGHTIEQLVSLDAKEFQMNGRKVEIAQVNAV
FT                   DVNDVLSRQADLEAALAQTIAAKNLDLFLFVVTDIVNSDSIGIALGSQAQAVEKAYNVQ
FT                   LDDNKAVLKGVVSRKSQIVPVLTEAFNSL"
FT   gene            complement(440465..441388)
FT                   /gene="estA1"
FT                   /locus_tag="PPSC2_01875"
FT                   /old_locus_tag="PPSC2_c0384"
FT   CDS_pept        complement(440465..441388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estA1"
FT                   /locus_tag="PPSC2_01875"
FT                   /old_locus_tag="PPSC2_c0384"
FT                   /product="esterase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54368"
FT                   /db_xref="GOA:E3ECS4"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECS4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369008.1"
FT                   /protein_id="ADO54368.2"
FT                   /translation="MVRRLRQTLFVKLARRSAGRMITASDFKPSHSPKVHRTGKMIPTS
FT                   VGDSRVIVYEPSLRSADPLPVFVNFHGSGFIMGSAEMDDPWCPVIAERANCVVVNVDYR
FT                   LAPEHKFPIPLQESYDVTQWVYKHPNVLNIDPQRIAVGGHSAGGNLAAALCLMARDRKE
FT                   FPIVYQVLDYPSLDIATDPKLKPQFEKAIPPRVAKIFNESYLRSPDEARNPLASPIYAE
FT                   SLHDLPPALIITAELDSLADEAELYAKRLIEADVPVMYKKYMGAAHAFTHSGDLAVAES
FT                   AWHLMSDQLKLAFEFRIEDVLEDLRK"
FT   gene            complement(441385..441924)
FT                   /gene="papX1"
FT                   /locus_tag="PPSC2_01880"
FT                   /old_locus_tag="PPSC2_c0385"
FT   CDS_pept        complement(441385..441924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="papX1"
FT                   /locus_tag="PPSC2_01880"
FT                   /old_locus_tag="PPSC2_c0385"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54369"
FT                   /db_xref="GOA:E3ECS5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECS5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369009.1"
FT                   /protein_id="ADO54369.1"
FT                   /translation="MFFFLDSEIRQLAYNLFPGGNKPIGVLVDLFSITYEIRKNMEKRS
FT                   REFGLSYGQYIALCVLSAQRDEMSSPSALAEKMGVSRAAISSMVISLEQEGFINKYDDP
FT                   NDKRGVFVSLNDKGRSKIQQMDPFFIGLASRLMSDFTEAELCQFQTYLSRVRDAFEDVK
FT                   GSRLTTPSALREEEDK"
FT   gene            complement(442036..442986)
FT                   /gene="lig"
FT                   /locus_tag="PPSC2_01885"
FT                   /old_locus_tag="PPSC2_c0386"
FT   CDS_pept        complement(442036..442986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="PPSC2_01885"
FT                   /old_locus_tag="PPSC2_c0386"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54370"
FT                   /db_xref="GOA:E3ECS6"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECS6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369010.1"
FT                   /protein_id="ADO54370.2"
FT                   /translation="MKPVIPFEPELSEKVPVDVGLWRYEIKWDGTRILTYHDQGSTRLF
FT                   NRKQHERTLLYPELAHFSSYCRADSVILDGEMIALGADGKPSFHEIMRRDLIRRTDRIQ
FT                   AAYTAVPATYMLFDIVYLNGEWVHRKPLQERLELLHQIIIPNERIQLAPAHPDGQALFQ
FT                   VMCSQGMEGIVCKKLDSPYTLGGQDRRWVKVKNYGDIIAVIGGYTLNGGVINAVLLGQY
FT                   DRQGMLRYIGHVGTGKLTRGDWRQLTERLLPHTISERPFINKPDRHQDAFWVKPMFTAK
FT                   IQYSEWRWQEGRTLRQPSIQALVDQGIEQCIGPWK"
FT   gene            443192..443467
FT                   /gene="yjdJ"
FT                   /locus_tag="PPSC2_01890"
FT                   /old_locus_tag="PPSC2_c0387"
FT   CDS_pept        443192..443467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjdJ"
FT                   /locus_tag="PPSC2_01890"
FT                   /old_locus_tag="PPSC2_c0387"
FT                   /product="GNAT family acetyltraansferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54371"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECS7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279389.1"
FT                   /protein_id="ADO54371.1"
FT                   /translation="MRQIREEDHAVVMVDDGQVVAEVGYKSVDDHSLVIDHTFVSEQLR
FT                   GQKIGKELIDKVVAMAREQHKKVIPACSYALALFKRHQEYSDVWQQ"
FT   gene            443758..444321
FT                   /gene="M1-525"
FT                   /locus_tag="PPSC2_01895"
FT                   /old_locus_tag="PPSC2_c0388"
FT   CDS_pept        443758..444321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-525"
FT                   /locus_tag="PPSC2_01895"
FT                   /old_locus_tag="PPSC2_c0388"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01895"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54372"
FT                   /db_xref="GOA:E3ECS8"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECS8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369012.1"
FT                   /protein_id="ADO54372.2"
FT                   /translation="MNKASEDKQYVPTSNRNFTALIITVSIIANVIILLLFFSPIGYQG
FT                   SVSFDLTIFPRLNAIFNSFTFIFLVAALVAIFKKNIKVHKTFILLAFASTVLFLFSYLT
FT                   FHYISPETAKYGGVGILRPIYFTLLISHSILAAIIVPLALFTVVWGWTMQVAKHRKIAR
FT                   WTMPIWLYVSLTGVLVYVFMAPYY"
FT   gene            444506..445780
FT                   /gene="srrA1"
FT                   /locus_tag="PPSC2_01900"
FT                   /old_locus_tag="PPSC2_c0389"
FT   CDS_pept        444506..445780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srrA1"
FT                   /locus_tag="PPSC2_01900"
FT                   /old_locus_tag="PPSC2_c0389"
FT                   /product="sugar ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54373"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECS9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428331.1"
FT                   /protein_id="ADO54373.1"
FT                   /translation="MTKKAKGRLRLLVSMLALVVLLSGCGGGGSKPEKVDGGKVTLQFW
FT                   TIALQPTFTPYFNRVIADYEQKNPNVKIDWKDYPYDAVTNKLLTSIASNSSPDVVNLNT
FT                   EFASQMGSKGAVVDMNEHLSPEEKAAYFEGIYNSTVINGKAYALPWYTGTEVLYMNTKL
FT                   VKAAGLDPAHPPKTRGELSEWGRQINRKIGKAGYAQQLVSKLFAVDGIPILNKEKTAAA
FT                   FNTPDAVTMIDNLKKQMEDGVVLKEDADFSQQVKYYASEQVAFELAGPTFINFIKTAAP
FT                   DVYKNTIAVPVPTGKADVRLSNSMDLVVPTKSAHIDEAVKFAVFLTNAESQTAFSKEAN
FT                   TLPSTKESIKDSYFTQSDQSLEAQAKVVSAQSLDKATDYMVGVPNAKDVNSAIARALQN
FT                   ILLNGRDTKETLTALEQEVNDILKQ"
FT   gene            445845..446726
FT                   /gene="lacF5"
FT                   /locus_tag="PPSC2_01905"
FT                   /old_locus_tag="PPSC2_c0390"
FT   CDS_pept        445845..446726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacF5"
FT                   /locus_tag="PPSC2_01905"
FT                   /old_locus_tag="PPSC2_c0390"
FT                   /product="lactose ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01905"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54374"
FT                   /db_xref="GOA:E3ECT0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECT0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010348502.1"
FT                   /protein_id="ADO54374.1"
FT                   /translation="MIKWLRSESFTAWAFMTPGLLLLAVFVFWPIIYSIPLALTDYSVI
FT                   SDTHFVGLDNFEAAFKDRNFLISIWNSLLYVLIVPFLQLFSILMAVLVNSRIPGIKIFR
FT                   TTYYIPVVTSMVAVALIWSWLLGNNSVVNYLLIQAGLISKDIHWLSDSNLALYVLMFIT
FT                   MWKGLGYYMMLYLAGLQNIPHDLYEAARVDGASRWRLIIHITLPLLKPYVLFCTLISLM
FT                   AAIRVFDEVYVLTKGGPGTATLTSSLYIFQKGMEQFNFGYASALGLIVGAMIAVLSIIV
FT                   FRFNRKGGVNPY"
FT   gene            446726..447616
FT                   /gene="yurM1"
FT                   /locus_tag="PPSC2_01910"
FT                   /old_locus_tag="PPSC2_c0391"
FT   CDS_pept        446726..447616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yurM1"
FT                   /locus_tag="PPSC2_01910"
FT                   /old_locus_tag="PPSC2_c0391"
FT                   /product="sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54375"
FT                   /db_xref="GOA:E3ECT1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECT1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685888.1"
FT                   /protein_id="ADO54375.2"
FT                   /translation="MNLQNDKMLHSSLPKKESSRIMRSLGRVLRMTIMYLLLVLLALFL
FT                   MGPFLWLLSVSLMPGRNIFSTPPAIFPTFIDFDNYVQVWQFMDFPKYMLNTVIITVLGV
FT                   VLNVILASLTGYPLAVFRFKGKNVVFTLLIATMIIPSYTAFIVHYLTIQGLHLGNTYMG
FT                   VVLPGAVSVFNIFLMRQTFIHIPADVRDSGKMDGASEFRIWWQLVLPLVKPALAVISLL
FT                   EAMSFWNSFLWPIVILNDTELYPLAAALTYLNGQFAYNFGWIAAGTMISVLPIIILFLF
FT                   TQRYYMEGLAGAVKG"
FT   gene            447667..449493
FT                   /gene="hyl"
FT                   /locus_tag="PPSC2_01915"
FT                   /old_locus_tag="PPSC2_c0392"
FT   CDS_pept        447667..449493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyl"
FT                   /locus_tag="PPSC2_01915"
FT                   /old_locus_tag="PPSC2_c0392"
FT                   /product="hyaluronidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01915"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54376"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECT2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425711.1"
FT                   /protein_id="ADO54376.1"
FT                   /translation="MELSRGMRPNSGVGLTPQEIQYYFRDVYDSGDKLVISEPNLICEL
FT                   SSRFAMNQEYEGALDPEGPIRLIAPPGPGVPTETRGSVQLVLEYDRTLTADGYRLDIQK
FT                   EGRIEIHASNKRGLKYGMDALHLLLQVEQERCTLPVISIRDEPSFPVRGIIEGFYGKPW
FT                   SFADRLDAVHFMAAHRMNTFMYAPKDDPYHRELWREPYPEETFAQIRELKEACERHEVD
FT                   FHYCISPGNDLSFGSDEDFLKLTEKLAAMMAIGVRHFSILMDDIDYVLKGENRHLLGRS
FT                   GHAHVFLTNKVHTWLAERLPEFTLTVCPSEYWSYWDTEYKKDFRERLHPEIKVFWTGYF
FT                   VFAPQISRQHAADNHAFYRHDLWLWDNVPVNDCDHDRLFLDPLRGRYSGLPDCGHTGMV
FT                   ANPMNQWECSKVTLITMSHYMWNSERYMPELSWEWAVRELVGEHTDELMFFCRQNKNSR
FT                   LGGSTYEDVDLALQMRDIPALDIYFERLLYVVSVLQNISADDPAAGFVAQAAPWLERAK
FT                   LDVSLWQVLRQAALGSERQNDVQSLGNLMQSEATDGQEPPPLTDEVVDELRRSITACLE
FT                   AEARLGSNPAIRAAVQWGYVDQDEQGKHRLIL"
FT   gene            449589..451130
FT                   /gene="M1-530"
FT                   /locus_tag="PPSC2_01920"
FT                   /old_locus_tag="PPSC2_c0393"
FT   CDS_pept        449589..451130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-530"
FT                   /locus_tag="PPSC2_01920"
FT                   /old_locus_tag="PPSC2_c0393"
FT                   /product="M1-530"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54377"
FT                   /db_xref="InterPro:IPR025394"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECT3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425712.1"
FT                   /protein_id="ADO54377.1"
FT                   /translation="MVKPNTRLLFVPLDERPCNYQFPYLLAQGTDLEMERPPLEWMGQK
FT                   KTPGDTTRLWAWLEERAASADGAIIAMDTLLYGGIVPSRLHGMSSEQVRNRANRLRRLK
FT                   QLYPQLTLYAFQLIMRCPQYSLADEEPDYYADWGREIFRKGFIEHRQELAIATAEELLE
FT                   LADIDERLPIEILDDYLGRRRVNLEANQVALELVAEGVIDFMIIPQDDSAPYGYTAKDQ
FT                   QRLRSRISELGLDLKVYMYPGADEVGCTLLARWVNQTNHVVPLVYPRLSALQGAFVVPL
FT                   FEDRYFYETLKYQIIAAGGLIASSAAEADLILLANTPGDTMAEASSQQHAMAGYDVHRN
FT                   LVELVEYGAHMQHHTNKNIAIADVAYANGADLKLLRLLRQKGLLFKLAGYAGWNTSSNT
FT                   LGTVIAQSMLYVRYGPTEEHLDFLGLRYAEDACYCAVVRTAMNNGIVEQMGFNKFMLDG
FT                   SRGSVAAVIRGRLEQALDEYVNGPEGRVEITDCYMPWNRTFEVGLTVRHYAEGRE"
FT   gene            451136..451855
FT                   /gene="nanE"
FT                   /locus_tag="PPSC2_01925"
FT                   /old_locus_tag="PPSC2_c0394"
FT   CDS_pept        451136..451855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanE"
FT                   /locus_tag="PPSC2_01925"
FT                   /old_locus_tag="PPSC2_c0394"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01925"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54378"
FT                   /db_xref="GOA:E3ECT4"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECT4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369018.1"
FT                   /protein_id="ADO54378.1"
FT                   /translation="MGMEGVLSKVRHGLIVSCQALPGEPLHGADSMVKMARAAQEGGAV
FT                   AIRANGASDVRAIKQAIPLPVIGLIKRDYNDSDIYITPTLREMEELVEAGADIIALDAT
FT                   LRPRPAGCKLKHLIDYAHEHGVASMADISTLEEALHAASLGIGCVSTTLSGYTPYSTQI
FT                   EGPDLELVRRASELVPVPVIAEGRIHDPAQVEEAFRLGAHAVVVGSAITRPQLITQRFA
FT                   DAARKAVKCIYGDERPN"
FT   gene            451833..452672
FT                   /gene="rpiR1"
FT                   /locus_tag="PPSC2_01930"
FT                   /old_locus_tag="PPSC2_c0395"
FT   CDS_pept        451833..452672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiR1"
FT                   /locus_tag="PPSC2_01930"
FT                   /old_locus_tag="PPSC2_c0395"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54379"
FT                   /db_xref="GOA:E3ECT5"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECT5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425714.1"
FT                   /protein_id="ADO54379.1"
FT                   /translation="MEMNDRINTYYPSLTKSEQKVALCVLECPADIIYFSVTELADFAG
FT                   TGETTVMRFCRKIGFKGYQDFRLSLAQNQTYRKTDMSEENIDPDNEHDITRTVYHNMLD
FT                   ILHSSMGLLDRSELSRAIACLDQAGYVQFFGVGASGISAQDAKNRFLRIGRRAEAVADG
FT                   HIQSMMAVSMSPGDVAIGISVSGSTLDTNDMLHKAKQNGATVIAITNYAKSPITSIADI
FT                   VLLTAGKEAPIEGGSIGAKISQLFVIDLICEGLARKHTSHTKQMKEKTARAVIERSY"
FT   gene            452789..453730
FT                   /gene="glcK3"
FT                   /locus_tag="PPSC2_01935"
FT                   /old_locus_tag="PPSC2_c0396"
FT   CDS_pept        452789..453730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcK3"
FT                   /locus_tag="PPSC2_01935"
FT                   /old_locus_tag="PPSC2_c0396"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01935"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54380"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECT6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599409.1"
FT                   /protein_id="ADO54380.2"
FT                   /translation="MVVAVALNKVIGIDIGGTSVKAAIVARDGSVLDEIRMDTDASRGR
FT                   DWVLSRVSDSVFGLMCSFGDTSVSTPVGIGALGIATAGRVNVESGEVVYATDNLPGWQG
FT                   TSLVRWAREKLALRAVADNDANAALLGEAWQGAGKGKQRLAMLTLGTGVGGAYMENGLL
FT                   CRGAHWSGGDWGHSILFPGGHPCNCGKKGCAEQYVSGSALLRRGSECTGKLYCSGNEIV
FT                   EEAAHGNLKTIQALDDYTADLAVLLANISVTLDPELIIVGGGVADAGDVWWPLLEKHLD
FT                   RLGVQTEVSRAMLGNRAGFIGAARLAFEMTES"
FT   gene            453754..455364
FT                   /gene="M1-534"
FT                   /locus_tag="PPSC2_01940"
FT                   /old_locus_tag="PPSC2_c0397"
FT   CDS_pept        453754..455364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-534"
FT                   /locus_tag="PPSC2_01940"
FT                   /old_locus_tag="PPSC2_c0397"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54381"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECT7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017425716.1"
FT                   /protein_id="ADO54381.1"
FT                   /translation="MTQKRLDADIVVIGGGLGGTSAALAAAKAGMRVIMTEETDWLGGQ
FT                   LTSQAVPPDEHRWIEQFGCTATYREFRNRVRDYYRQNYPLTEEAYNDPILNPGNGWVSR
FT                   LAHEPRVALQVLEDMLAPYLNTGRVRVYYHTVPIAAQTDGDSITSVTVRTSYNPDHKSG
FT                   LRVLHGTFYLDATECGDLLPMAGVEHTSGAESRAATGEPHALEYANPLDMQSITHVAAV
FT                   DYIPQESFIIERPQQYDFWRNYIPSFSRFPILSWFATDADDTSKLKQFTLFPNDQGIVS
FT                   LWDYRRIVDPSIWSEPLNDGEVTLLNWAQNDYYLGPLIGVTAQEQARHREGARELTRSL
FT                   IYWLQTEAPRLDGGFGYPGIRPRGDFLGTSDGLAKTAYIRESRRIKAKYTISEFDVSRE
FT                   LRGKEGPKRYSDSVGVGSYHLDLHPTTVSQRTFYIPNYPYEIPLGSLIPVRVRNLLPAC
FT                   KNIGMTQIANGCYRLHPTEWNIGESSGSLAAYCVSNGVYPIEVSRSEEHLGRFQNVLLR
FT                   QGVELHWPVEVFEPEGVTS"
FT   gene            455757..457315
FT                   /locus_tag="PPSC2_01945"
FT                   /old_locus_tag="PPSC2_r010"
FT   rRNA            455757..457315
FT                   /locus_tag="PPSC2_01945"
FT                   /old_locus_tag="PPSC2_r010"
FT                   /product="16S ribosomal RNA"
FT   gene            457523..460453
FT                   /locus_tag="PPSC2_01950"
FT                   /old_locus_tag="PPSC2_r011"
FT   rRNA            457523..460453
FT                   /locus_tag="PPSC2_01950"
FT                   /old_locus_tag="PPSC2_r011"
FT                   /product="23S ribosomal RNA"
FT   gene            460530..460646
FT                   /locus_tag="PPSC2_01955"
FT                   /old_locus_tag="PPSC2_r012"
FT   rRNA            460530..460646
FT                   /locus_tag="PPSC2_01955"
FT                   /old_locus_tag="PPSC2_r012"
FT                   /product="5S ribosomal RNA"
FT   gene            460681..460757
FT                   /locus_tag="PPSC2_01960"
FT                   /old_locus_tag="PPSC2_ct013"
FT   tRNA            460681..460757
FT                   /locus_tag="PPSC2_01960"
FT                   /old_locus_tag="PPSC2_ct013"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:460715..460717,aa:Ile,seq:gat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            460780..460855
FT                   /locus_tag="PPSC2_01965"
FT                   /old_locus_tag="PPSC2_ct014"
FT   tRNA            460780..460855
FT                   /locus_tag="PPSC2_01965"
FT                   /old_locus_tag="PPSC2_ct014"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:460813..460815,aa:Ala,seq:tgc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            460860..460935
FT                   /locus_tag="PPSC2_01970"
FT                   /old_locus_tag="PPSC2_ct015"
FT   tRNA            460860..460935
FT                   /locus_tag="PPSC2_01970"
FT                   /old_locus_tag="PPSC2_ct015"
FT                   /product="tRNA-Asn"
FT                   /anticodon="(pos:460893..460895,aa:Asn,seq:gtt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            460970..461043
FT                   /locus_tag="PPSC2_01975"
FT                   /old_locus_tag="PPSC2_ct016"
FT   tRNA            460970..461043
FT                   /locus_tag="PPSC2_01975"
FT                   /old_locus_tag="PPSC2_ct016"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:461004..461006,aa:Met,seq:cat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            461047..461138
FT                   /locus_tag="PPSC2_01980"
FT                   /old_locus_tag="PPSC2_ct017"
FT   tRNA            461047..461138
FT                   /locus_tag="PPSC2_01980"
FT                   /old_locus_tag="PPSC2_ct017"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:461082..461084,aa:Ser,seq:gct)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            461170..461241
FT                   /locus_tag="PPSC2_01985"
FT                   /old_locus_tag="PPSC2_ct018"
FT   tRNA            461170..461241
FT                   /locus_tag="PPSC2_01985"
FT                   /old_locus_tag="PPSC2_ct018"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:461203..461205,aa:Glu,seq:ttc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            461248..461323
FT                   /locus_tag="PPSC2_01990"
FT                   /old_locus_tag="PPSC2_ct019"
FT   tRNA            461248..461323
FT                   /locus_tag="PPSC2_01990"
FT                   /old_locus_tag="PPSC2_ct019"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:461281..461283,aa:Val,seq:tac)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            461334..461407
FT                   /locus_tag="PPSC2_01995"
FT                   /old_locus_tag="PPSC2_ct020"
FT   tRNA            461334..461407
FT                   /locus_tag="PPSC2_01995"
FT                   /old_locus_tag="PPSC2_ct020"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:461368..461370,aa:Met,seq:cat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            461433..461509
FT                   /locus_tag="PPSC2_02000"
FT                   /old_locus_tag="PPSC2_ct021"
FT   tRNA            461433..461509
FT                   /locus_tag="PPSC2_02000"
FT                   /old_locus_tag="PPSC2_ct021"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:461467..461469,aa:Asp,seq:gtc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            461560..461635
FT                   /locus_tag="PPSC2_02005"
FT                   /old_locus_tag="PPSC2_ct022"
FT   tRNA            461560..461635
FT                   /locus_tag="PPSC2_02005"
FT                   /old_locus_tag="PPSC2_ct022"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:461593..461595,aa:Phe,seq:gaa)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            461658..461733
FT                   /locus_tag="PPSC2_02010"
FT                   /old_locus_tag="PPSC2_ct023"
FT   tRNA            461658..461733
FT                   /locus_tag="PPSC2_02010"
FT                   /old_locus_tag="PPSC2_ct023"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:461691..461693,aa:Thr,seq:tgt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            461739..461824
FT                   /locus_tag="PPSC2_02015"
FT                   /old_locus_tag="PPSC2_ct024"
FT   tRNA            461739..461824
FT                   /locus_tag="PPSC2_02015"
FT                   /old_locus_tag="PPSC2_ct024"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:461773..461775,aa:Tyr,seq:gta)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            461841..461913
FT                   /locus_tag="PPSC2_02020"
FT                   /old_locus_tag="PPSC2_ct025"
FT   tRNA            461841..461913
FT                   /locus_tag="PPSC2_02020"
FT                   /old_locus_tag="PPSC2_ct025"
FT                   /product="tRNA-His"
FT                   /anticodon="(pos:461874..461876,aa:His,seq:gtg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            461932..462006
FT                   /locus_tag="PPSC2_02025"
FT                   /old_locus_tag="PPSC2_ct026"
FT   tRNA            461932..462006
FT                   /locus_tag="PPSC2_02025"
FT                   /old_locus_tag="PPSC2_ct026"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:461964..461966,aa:Gln,seq:ttg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            462011..462086
FT                   /locus_tag="PPSC2_02030"
FT                   /old_locus_tag="PPSC2_ct027"
FT   tRNA            462011..462086
FT                   /locus_tag="PPSC2_02030"
FT                   /old_locus_tag="PPSC2_ct027"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:462044..462046,aa:Lys,seq:ttt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            462102..462189
FT                   /locus_tag="PPSC2_02035"
FT                   /old_locus_tag="PPSC2_ct028"
FT   tRNA            462102..462189
FT                   /locus_tag="PPSC2_02035"
FT                   /old_locus_tag="PPSC2_ct028"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:462136..462138,aa:Leu,seq:cag)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            462196..462270
FT                   /locus_tag="PPSC2_02040"
FT                   /old_locus_tag="PPSC2_ct029"
FT   tRNA            462196..462270
FT                   /locus_tag="PPSC2_02040"
FT                   /old_locus_tag="PPSC2_ct029"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:462228..462230,aa:Gly,seq:gcc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            462281..462351
FT                   /locus_tag="PPSC2_02045"
FT                   /old_locus_tag="PPSC2_ct030"
FT   tRNA            462281..462351
FT                   /locus_tag="PPSC2_02045"
FT                   /old_locus_tag="PPSC2_ct030"
FT                   /product="tRNA-Cys"
FT                   /anticodon="(pos:462313..462315,aa:Cys,seq:gca)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            462378..462454
FT                   /locus_tag="PPSC2_02050"
FT                   /old_locus_tag="PPSC2_ct031"
FT   tRNA            462378..462454
FT                   /locus_tag="PPSC2_02050"
FT                   /old_locus_tag="PPSC2_ct031"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:462412..462414,aa:Arg,seq:acg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            462477..462550
FT                   /locus_tag="PPSC2_02055"
FT                   /old_locus_tag="PPSC2_ct032"
FT   tRNA            462477..462550
FT                   /locus_tag="PPSC2_02055"
FT                   /old_locus_tag="PPSC2_ct032"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:462511..462513,aa:Pro,seq:tgg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            462560..462630
FT                   /locus_tag="PPSC2_02060"
FT                   /old_locus_tag="PPSC2_ct033"
FT   tRNA            462560..462630
FT                   /locus_tag="PPSC2_02060"
FT                   /old_locus_tag="PPSC2_ct033"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:462592..462594,aa:Gly,seq:tcc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(462835..463938)
FT                   /gene="M1-535"
FT                   /locus_tag="PPSC2_02065"
FT                   /old_locus_tag="PPSC2_c0398"
FT   CDS_pept        complement(462835..463938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-535"
FT                   /locus_tag="PPSC2_02065"
FT                   /old_locus_tag="PPSC2_c0398"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02065"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54382"
FT                   /db_xref="GOA:E3ECT8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECT8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017428695.1"
FT                   /protein_id="ADO54382.1"
FT                   /translation="MNEPSNPLLQPAFGESTDKLLNDLEIHIPDSPFLHVLRSSLHQLS
FT                   NLKFALDTSSIVALTDHRGIIQYVNDKFCEISQYSREELIGQDHRLINSGYHTRAFMKN
FT                   LWTTIRSGEVWQGEIRNRAKDNSYYWVNTTIVPFMDEEGKPYQYLAIRNEVTKLKKVEA
FT                   ELQTMMTQVMQIQEEERKRFSRELHDGIGQSLFSLIIQLDSQLAEQPSATLENLRTQVT
FT                   DIIKDVRGLAWELRPSVLDDLGVVPALRTYIENFCSHYGIEVHFQCTLRKRLDIRKEIA
FT                   IYRIVQEALTNVAKYADVAEAYVDVEDQDEIIKVTIRDEGMGFSGESKGEGVGLFSMEE
FT                   RARGVGGFMSMTSAPNQGTSIQLTIPV"
FT   gene            complement(463931..464584)
FT                   /gene="nreC1"
FT                   /locus_tag="PPSC2_02070"
FT                   /old_locus_tag="PPSC2_c0399"
FT   CDS_pept        complement(463931..464584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nreC1"
FT                   /locus_tag="PPSC2_02070"
FT                   /old_locus_tag="PPSC2_c0399"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54383"
FT                   /db_xref="GOA:E3ECT9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECT9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818376.1"
FT                   /protein_id="ADO54383.1"
FT                   /translation="MIRILVVDDHVVVRSGLMALLDGKNGIKVVGDAADGDEAIRKAVE
FT                   LQPDVVLMDFSMPPGKDGLTATTELKKQLPDTEVLILTMHDDEEYLFRAIQAGASGYIL
FT                   KSAPHEELLAAIQSVAEGSAYLYPNATKRLMSEYLDKIKQEGIAGPYESLSEREKEILS
FT                   WVAKGYANKEIAEHLVISVKTVESHKSNLMEKLNLKTRPELVKFALKKGLLHYE"
FT   gene            complement(464728..465177)
FT                   /gene="nreA1"
FT                   /locus_tag="PPSC2_02075"
FT                   /old_locus_tag="PPSC2_c0400"
FT   CDS_pept        complement(464728..465177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nreA1"
FT                   /locus_tag="PPSC2_02075"
FT                   /old_locus_tag="PPSC2_c0400"
FT                   /product="NreA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02075"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54384"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECU0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308415.1"
FT                   /protein_id="ADO54384.1"
FT                   /translation="MLQITDEMRNELNQLRDHVHGDLTALAFMSRSGGKLHWYYASGSR
FT                   NNRYRLISFKVGHGIAGMAVRLGRTVTVSALISGSIRLRQECALMLAEQLHSAVAIPFS
FT                   STGDLPNGVLLVGNREVRTFTESDVAKATQVAHRLGQLCALPLTP"
FT   gene            465476..466216
FT                   /gene="fnr1"
FT                   /locus_tag="PPSC2_02080"
FT                   /old_locus_tag="PPSC2_c0401"
FT   CDS_pept        465476..466216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnr1"
FT                   /locus_tag="PPSC2_02080"
FT                   /old_locus_tag="PPSC2_c0401"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54385"
FT                   /db_xref="GOA:E3ECU1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECU1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599410.1"
FT                   /protein_id="ADO54385.1"
FT                   /translation="MQATCMERFRDETQRTGIQLFLTEEHFELLKDIMSWKKVKAGVML
FT                   FREGDDAEQLYYIHSGHVKLRKSTEDGKELILTIQHQGDLIGEFSGIDGEEYSCTAETA
FT                   DVCELGVVLVKDLESLLSKNGEMALQFIQWMAMKQRIMQSRFRDLLLYGKTGALASTLI
FT                   RASNTCGVAVKDGILLNMKLSHSELGEMIGATRESVNRMLSSLKEQGTLDTRDGKIVIH
FT                   DLKVLRAMCCCPSYGQCAHEICRL"
FT   gene            466741..468299
FT                   /locus_tag="PPSC2_02085"
FT                   /old_locus_tag="PPSC2_r013"
FT   rRNA            466741..468299
FT                   /locus_tag="PPSC2_02085"
FT                   /old_locus_tag="PPSC2_r013"
FT                   /product="16S ribosomal RNA"
FT   gene            468507..471434
FT                   /locus_tag="PPSC2_02090"
FT                   /old_locus_tag="PPSC2_r014"
FT   rRNA            468507..471434
FT                   /locus_tag="PPSC2_02090"
FT                   /old_locus_tag="PPSC2_r014"
FT                   /product="23S ribosomal RNA"
FT   gene            471511..471627
FT                   /locus_tag="PPSC2_02095"
FT                   /old_locus_tag="PPSC2_r015"
FT   rRNA            471511..471627
FT                   /locus_tag="PPSC2_02095"
FT                   /old_locus_tag="PPSC2_r015"
FT                   /product="5S ribosomal RNA"
FT   gene            472257..473588
FT                   /gene="yurO1"
FT                   /locus_tag="PPSC2_02100"
FT                   /old_locus_tag="PPSC2_c0403"
FT   CDS_pept        472257..473588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yurO1"
FT                   /locus_tag="PPSC2_02100"
FT                   /old_locus_tag="PPSC2_c0403"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54387"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECU3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685895.1"
FT                   /protein_id="ADO54387.1"
FT                   /translation="MSRIKMKAFAVVAAGALALTLAACNNGQSAGPGNSGEKGGGNVTK
FT                   DVTITFQNINPDPSTPSYKMIKQIVSQYEQDHPHVKIELDSLNTDQQKLKLKTQAAAKE
FT                   VPDITIVNPAAQMKPFVDAGLLAPLNDVADKEGLKDTFQDGLLNYYSFDDKLYAFPDGN
FT                   NIEVVFYNKELFEQAGIQKLPTTFDELITTVKTLKAKGITPIAIGEKDSWTGSLLFMNI
FT                   LLRTNEGPNFLNDVLDGKKTFNDPAFVEAVDAFQELVQAGAFPDGATSIDYNAGGNIFK
FT                   TRKAAMYIMGTWETGSIDASPVAGKVGAFQFPTVNGKGNVNEYVIAPGSAFAVSANSEH
FT                   LQETKDFLHYFITEMPKIQFDLKNAIGSGQKMKGDLKEAGYSELAISLNELFKNVKGGD
FT                   LAFDNTMNPAIAQAHLSSIQNLFVQQEDSAQVAKEHQNTFEANK"
FT   gene            473722..474612
FT                   /gene="lacF7"
FT                   /locus_tag="PPSC2_02105"
FT                   /old_locus_tag="PPSC2_c0404"
FT   CDS_pept        473722..474612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacF7"
FT                   /locus_tag="PPSC2_02105"
FT                   /old_locus_tag="PPSC2_c0404"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02105"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54388"
FT                   /db_xref="GOA:E3ECU4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECU4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308418.1"
FT                   /protein_id="ADO54388.1"
FT                   /translation="MNVLKVPARTIAVFVLPCLLLYTCMVFVPILVSVYCGLLDWNGIA
FT                   EAKFVGLANFKRIFTADPVFWPSVKRTMMFAVFSMLEIPLCLLLAILLNRYVRKANTLV
FT                   TMYFLPVILSVVIIGQLWKTIYNPASMGGMLNGILMAVGLESWTRSWLTEPQIAMYALY
FT                   FVSLWQYFGYHLLIQFTGVQNIPNELYEAAKIDGAEGFKADRYITLPLIVPIFKISIVL
FT                   AFIGSLQSFDLIWVMTGGGPAHATDTVSTYMYNMSFLSMKYGYGSALASFLVVICLSFT
FT                   IVINFVFKRIENKVS"
FT   gene            474627..475451
FT                   /gene="yurM3"
FT                   /locus_tag="PPSC2_02110"
FT                   /old_locus_tag="PPSC2_c0405"
FT   CDS_pept        474627..475451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yurM3"
FT                   /locus_tag="PPSC2_02110"
FT                   /old_locus_tag="PPSC2_c0405"
FT                   /product="sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54389"
FT                   /db_xref="GOA:E3ECU5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECU5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599411.1"
FT                   /protein_id="ADO54389.1"
FT                   /translation="MNALKKTGVFSLLAVLVVTQLYPLFWLLTYSLKTNEEILSSSFFA
FT                   LPQVPQWHNYQEAYESGSYLRYLGNSVLVTGVTMMFVIVLSSMTAYAITRFRWRFGAVV
FT                   LTLFLVGMMIPMQATLLPLMVMFKNVHILNTYFSLILPYIAFQTPIAVFILSGFMRSIP
FT                   HEIEESAYIDGASIYRIFRSVILPISIPPIMTVCILTFINIWNEYIMAATFISSEKLKT
FT                   LPFGVYTFVSQYSVNYGNIGAFLVMGALPVIIIYFALSEKITKGMVAGAVKG"
FT   gene            475482..477278
FT                   /locus_tag="PPSC2_02115"
FT                   /old_locus_tag="PPSC2_c0406"
FT   CDS_pept        475482..477278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_02115"
FT                   /old_locus_tag="PPSC2_c0406"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02115"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54390"
FT                   /db_xref="GOA:E3ECU6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3ECU6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308420.1"
FT                   /protein_id="ADO54390.1"
FT                   /translation="MMRRFQSIQYRLFVLFLLSMSSIVLAVSLLFYNRTTVQFHDKISE
FT                   LARKNVSQTAGLFELLLDSYNSLSKSISNNMDLVRLLTTDHSDLPAVNYINERTITNIL
FT                   GAIYYSREDLIGIHVITDTGKVYNYGNYMNVIDTHYEHTEWYREIRRSAGKIAWLGVYP
FT                   HSVIDQVETRPVFAFGRQLYDLDEHKPIGIVLFEAEPRSVLSALHNLRLSTNSQVYLLG
FT                   HENRIVSATSSDPPPDLRNLQEQVPEEDVIVDRNNEKVVIASKLPFADWSVISVTPSED
FT                   LNVELAQNQRYLFIVAPILIMVSALIASIVSRSISHPLKRVIGEMKRVETGNFRHTVNI
FT                   ESYEEINQLATSFNHMVRQIAELIELVRISSVSEKNAELHALQTQVNPHFLYNTLDMIY
FT                   WMLDEKGQDQLGEVVLSLSHMFRYSSHWEEGADVSLREEVEQVGHYLTIIQARLEGRVS
FT                   VDVNIEEQWLDIRLPKMTLQPLIENAVKHGLEPLHADTGGKLLVRAEEYGGVLSLHIID
FT                   NGVGMEYERWEVVQVALAEPGKQAGSGQAGGIGLQNLNLRLRHMFGEEYGLRISSTPGA
FT                   GTTVTVSVPLPQKEEKHEYSDS"
FT   gene            477259..478443
FT                   /locus_tag="PPSC2_02120"
FT                   /old_locus_tag="PPSC2_c0407"
FT   CDS_pept        477259..478443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_02120"
FT                   /old_locus_tag="PPSC2_c0407"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54391"
FT                   /db_xref="GOA:E3ED34"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED34"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010347832.1"
FT                   /protein_id="ADO54391.1"
FT                   /translation="MNILIADDENMIRQGIRRTIGQALPTCGIHLAASTEEAAGILAEH
FT                   PVDIVLTDILMPGMDGLEFMRISKRKHPHLQWVVISAHSDFQYAQRAVKLGAKDYLLKP
FT                   IGKKKLLECIEMLAAEALVASQQANEGRLLKSNMVYLREAVFQRYALGLDTGKLDIQPF
FT                   VENYPEFHLFMVRMEPDHKQTHLEHFMIENVLSELIEAGGSGFVVSLDRHSLLGIARLR
FT                   DEAEAARLEMLLESHLKRYVRVPLQITRSGVHHNFSSIPEEVARLRRTPEEIAAAAADT
FT                   GECLRKGMHTVDVALQYIRAHFTEELSLEKVASIVFLNPVYFSQLFKQKTGQGYKDYVI
FT                   SLRMEEAKRLLNDPHLRLADISERIGYQDMRHFTQVFRRKCGMTPTEYRHQGVK"
FT   gene            complement(478516..479421)
FT                   /gene="yclA"
FT                   /locus_tag="PPSC2_02125"
FT                   /old_locus_tag="PPSC2_c0408"
FT   CDS_pept        complement(478516..479421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclA"
FT                   /locus_tag="PPSC2_02125"
FT                   /old_locus_tag="PPSC2_c0408"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02125"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54392"
FT                   /db_xref="GOA:E3ED35"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED35"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369032.1"
FT                   /protein_id="ADO54392.1"
FT                   /translation="MDLKHLHYFCVIVEEGQITKAARTLNMAQPPLSQQLKNMEDELGV
FT                   KLIYREGKKWEVTEAGYTLYTRAKRLLAEMEDTCREIGEFENRVTGTLAIGTSSACMSL
FT                   ITEQLSHFHQVYPEVYVKIGHGDTHHLEELLHQNKVDLALLLLPVDNKSYHTIELEGVS
FT                   FVAVLPCEWADRHPSGEITLQEAASYDLLLGRRTEGHGLYETVIRKFQEHHLIPRVVLD
FT                   CPEISTILSLVSTGMGITIIPDAGLAQEYGDRFRTLSIKEPFPFTQPAVVWRKDRYLSN
FT                   AARKFVELLQAGDTKKTVPE"
FT   gene            479583..480173
FT                   /gene="yclB"
FT                   /locus_tag="PPSC2_02130"
FT                   /old_locus_tag="PPSC2_c0409"
FT   CDS_pept        479583..480173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclB"
FT                   /locus_tag="PPSC2_02130"
FT                   /old_locus_tag="PPSC2_c0409"
FT                   /product="phenolic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54393"
FT                   /db_xref="GOA:E3ED36"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR032901"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED36"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428426.1"
FT                   /protein_id="ADO54393.1"
FT                   /translation="MKKIIVGISGATGSIFGIRILQQLREAGVQSHLVLSPWAIANIPY
FT                   ETGYTVKEVEAMADAVYSYKDQAARISSGSFRVDGMVVAPCSMKTLASIRIGMADNLLT
FT                   RSADVILKERKKLLLMTRETPLSSIHLENMLELSRMGVMILPPMPAFYNHPASIEELVD
FT                   HIVFRALDQFGIVTTAAKRWDGMKQNDSRLHQN"
FT   gene            480202..481620
FT                   /gene="yclC"
FT                   /locus_tag="PPSC2_02135"
FT                   /old_locus_tag="PPSC2_c0410"
FT   CDS_pept        480202..481620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclC"
FT                   /locus_tag="PPSC2_02135"
FT                   /old_locus_tag="PPSC2_c0410"
FT                   /product="phenolic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02135"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54394"
FT                   /db_xref="GOA:E3ED37"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032902"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED37"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427169.1"
FT                   /protein_id="ADO54394.2"
FT                   /translation="MAYKDFRDFLHTLEKEGQLLTISDEVKPEPDLAAANRALNNLGDK
FT                   TPALFFNNIYGYTDARIAMNVMGSWPNHALMMRMPKNTPLKEQFFEFARRYEQFPVPVK
FT                   REDAAPFHEVEITENINLFDILPLFRLNQGDGGFYLDKAILISRDLDDPDTYGKQNVGL
FT                   YRMQVKGKNRLGIQPVPQHDIAIHIRQAEERGENLKVAIALGCEPVITTAASTPLLYDQ
FT                   SEYEMAGAIQGEPYRVVKAKDADLDLPWGAEVILEGEVLAGEREYEGPFGEFTGHYSGG
FT                   RAMPVIQINRVYHRKQPIFEHLYIGMPWTETDYMIGVNTSVPLFQQLKDAFPNEIVAVN
FT                   AMYTHGLVAIISTKTRYGGFAKAVGIRALTTPHGLGYCKLVIVVDEEVDPFNLPQVMWA
FT                   LSTKLHPKHDAVIVPGLSILPLDPGSDPAGMTHKMILDATTPVAPDIRGHYSQPLDSPL
FT                   GVAEWEKKLSQMLR"
FT   gene            481662..481886
FT                   /locus_tag="PPSC2_02140"
FT   CDS_pept        481662..481886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_02140"
FT                   /product="phenolic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02140"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZC84"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818874.1"
FT                   /protein_id="AKA44181.1"
FT                   /translation="MHICPRCESNRSEVVSHSPVKGAWEVLLCPVCLFTWRTSEPDSIT
FT                   DPAKYKSAFKVNPQDIPDAAHVPPIPERI"
FT   gene            481958..482419
FT                   /gene="yclD"
FT                   /locus_tag="PPSC2_02145"
FT                   /old_locus_tag="PPSC2_c0412"
FT   CDS_pept        481958..482419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclD"
FT                   /locus_tag="PPSC2_02145"
FT                   /old_locus_tag="PPSC2_c0412"
FT                   /product="yclD"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02145"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54396"
FT                   /db_xref="GOA:E3ED39"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED39"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369036.1"
FT                   /protein_id="ADO54396.1"
FT                   /translation="MQTPRIGKELFTLLNGKELEHKQQEAMMLLTVTEDQWPHIAMISV
FT                   GEVVALDEGNLRLALWPGTTTTGNMIRTGKATLAVFTGGKAHYVRLSLKHLPALPGAKH
FT                   VRERFAAHVFAAREDSAQYADILTGVTIRLKEPESVIHRWKETVAELLV"
FT   gene            482583..483743
FT                   /gene="M1-550"
FT                   /locus_tag="PPSC2_02150"
FT                   /old_locus_tag="PPSC2_c0413"
FT   CDS_pept        482583..483743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-550"
FT                   /locus_tag="PPSC2_02150"
FT                   /old_locus_tag="PPSC2_c0413"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54397"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED40"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369037.1"
FT                   /protein_id="ADO54397.1"
FT                   /translation="MSRFDKVDQLLQRFLANGPAGCGCAIAQNGQVLYEGYHGYADVET
FT                   RKPITEDTVYRLFSMTKVVVCAAALMLYERGQFLLNEPLCEYLPEFRNAHVFKTAPNGY
FT                   TYVDKAEKPILIKHIFNMSIGLPYASESSETGKAMQKAIAGLKEKQGKYDLRTEIKALS
FT                   EVPLAFEPGTRWLYGYGHDLVAGLIEVISGKSLGQFLKDEIFDPLGMNNTGYRYRGDIE
FT                   SRMASMYQRTDSGKLEKIEGFLDEYHQPDAIYEGGGAGLYSTVKDYLTFSQMMSNGGTV
FT                   NGVNLLGRKTIDLMRTNHLNTAQLSDFTNSYHTGYGYGLGVRTLMDKAAGHANSSIGEF
FT                   GWSGMAGTWVSIDPSEQFSVVYMHQLDPNMEEYHHLRIRAAAYSCL"
FT   gene            483883..486219
FT                   /gene="ligA1"
FT                   /locus_tag="PPSC2_02155"
FT                   /old_locus_tag="PPSC2_c0414"
FT   CDS_pept        483883..486219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA1"
FT                   /locus_tag="PPSC2_02155"
FT                   /old_locus_tag="PPSC2_c0414"
FT                   /product="cadherin"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02155"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54398"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED41"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369038.1"
FT                   /protein_id="ADO54398.1"
FT                   /translation="MKNRWSGFLALVILISSFTSYAGFASAAEAVLSKIVLSSNEVTLQ
FT                   QGDTAALTATAVYSDGTTSNVTVSTDWKSDNTSIATVYNGTVSAKAEGEATVIATYKEK
FT                   VQSVQVHVTKKVKALTSNVQSLNLRSSGTGQINLTATYSDNTTAQVSGDATWTSDNQKV
FT                   ATVVNGLVTAQGAGSANIKAVYGQQTVTIAVQVEQVKRLDASTSEVSLLLKDTEKVKLT
FT                   ATFPDGSTQDVTESAEWSSSNTAVADVLKGTITGYSTGKATITGKYGTMSATIAVDVDQ
FT                   TNKLKASETNIFLRLDESKKIQVSAVYPDGTVTDITDKAAWTSSDEKIATVNKGTIMAI
FT                   GAGSATVTAKYGDKTVSIKTDIETSRFLDLSEDKLSLNAKESKKLKLTATYVTGTEEDI
FT                   TSKAEWKSSNEDIAFVSVGEVTGYKTGEATITASYGGKTATATVSVNVPGDLSLSSKTA
FT                   TIDINEDYIATLTATYADGRKEDVTQDAEWASSAEDIASVSKGTITGKAAGKAVITATY
FT                   NGKKLTINVQVGLVDRLETDSRVIALGAQETKQLKVTGVKSGGTKTDVTKDATWTTSNV
FT                   KVVEVSEGLIKANASGKATITASYGKQTITFTVEVDVAQKIEADAIALSLKSGDQKTIA
FT                   IVVKSSDGKEKDVTTQAEWKTSNYRVATVKKGQVTAISYGKANIQAKFGGKVISVPVDV
FT                   DTLKYLQTDEVALTLKAGQLAKVTATATYKDESEKDVSKPAVWSSSRIIVATVKDGNIK
FT                   AQGKGKAVITVKYAGKMTKVQVTVQ"
FT   gene            complement(486331..487230)
FT                   /gene="sdhA1"
FT                   /locus_tag="PPSC2_02160"
FT                   /old_locus_tag="PPSC2_c0415"
FT   CDS_pept        complement(486331..487230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA1"
FT                   /locus_tag="PPSC2_02160"
FT                   /old_locus_tag="PPSC2_c0415"
FT                   /product="serine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54399"
FT                   /db_xref="GOA:E3ED42"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED42"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369039.1"
FT                   /protein_id="ADO54399.1"
FT                   /translation="MRFSHLHEISAICAEESTTIGRLMIQEQVQETNTTEEEIFRQMSD
FT                   YYEVMKEAVHRGQTQDTVSRSGLTGGDGKRLAEYLRTGETCSGDASALAMAYALSVSEV
FT                   NASMGRIVATPTAGSCGVIPGVFISAQERFGWDDEHMVHGLFAAGAIGYVIANNSFISG
FT                   AEGGCQAEIGSAIGMAAGAMVELRGGTPEQAVHAVGLALKNTLGLICDPVAGLVEIPCI
FT                   VRNGLGAVTALAAADMALAGVRSAIPSDEVIDVMLEVGSAMPSKHRETAKGGLAQTPTG
FT                   KRLTESLTRNTSVKKDKP"
FT   gene            complement(487220..487909)
FT                   /gene="sdhB1"
FT                   /locus_tag="PPSC2_02165"
FT                   /old_locus_tag="PPSC2_c0416"
FT   CDS_pept        complement(487220..487909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB1"
FT                   /locus_tag="PPSC2_02165"
FT                   /old_locus_tag="PPSC2_c0416"
FT                   /product="serine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02165"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54400"
FT                   /db_xref="GOA:E3ED43"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED43"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308430.1"
FT                   /protein_id="ADO54400.1"
FT                   /translation="MRFKDVFSIIGPAMTGPSSSHTAGAVRLARVARHWLGTQPDRARM
FT                   TLYGSFADTYKGHGTDLALIAGLLNYDTDDHRIPDAEQWAEQAGMAVEFAVSGLPAPHP
FT                   NTVRFELWKGEDQRTLLGSSIGGGSIHVQQLNEFRVNLTGELSTLVLLHSDKPGTLGAV
FT                   TSALGAADINIAYMHVDRKGRDGEALTAIETDSLPTAELIAKLQSLPHMYEIKMINLKK
FT                   GAESDAI"
FT   misc_binding    complement(488032..488125)
FT                   /bound_moiety="glycine"
FT                   /note="glycine riboswitch"
FT   misc_binding    complement(488126..488235)
FT                   /bound_moiety="glycine"
FT                   /note="glycine riboswitch"
FT   gene            488450..490054
FT                   /gene="M1-554"
FT                   /locus_tag="PPSC2_02170"
FT                   /old_locus_tag="PPSC2_c0418"
FT   CDS_pept        488450..490054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-554"
FT                   /locus_tag="PPSC2_02170"
FT                   /old_locus_tag="PPSC2_c0418"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54402"
FT                   /db_xref="GOA:E3ED45"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR039975"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED45"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369042.1"
FT                   /protein_id="ADO54402.1"
FT                   /translation="MVKGLRFTGSRLKGVLHLAAIVSLLIGIFVPFGQVKAEGALTVAE
FT                   ALQRQGSGGTVTVEGYIVGHATGSKTANFSSPFANDFNVLIADQANERSTSNLLDVQLT
FT                   SAYRGQFGLTGHPELIGNKIRVTGTLGAYNNFGGVKSPSAVELVNGSEPGEPGEPGEPN
FT                   PGNPGQPGTTLPDGKGKKVLFDNTHAQTAGAADWVIEGAFSDFANGLRNVGFTVDQLNR
FT                   PIPFTYGEQAITYDKLRQYDVFIIGEANVAFKASEQAALLQYVNNGGSVFFISDHYNAD
FT                   RNKNRWDSSEVMNGYRRGAYTNPAKGMTTEEAASPAMQGLTSSDWLATNFGVRFRYNAL
FT                   GDVNATDIVAADQSFGITKGVRSIAMHAGSTLAIIDPTKAKGIAYIPTGTNKWGNAVDQ
FT                   GVYNGGGRAEGPYAAISKVGQGKAAFIGDSSPVEDATPKYAREENGQSKKTYDGFKEVD
FT                   DATFLVQTVQWLAWKQDYTKLSDVAGLTLDQPTKLLPFEEPAASTEPQPEPWSAPAAGY
FT                   KWYDPKTFKSGSYGAAS"
FT   gene            490383..491414
FT                   /gene="oppD1"
FT                   /locus_tag="PPSC2_02175"
FT                   /old_locus_tag="PPSC2_c0419"
FT   CDS_pept        490383..491414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD1"
FT                   /locus_tag="PPSC2_02175"
FT                   /old_locus_tag="PPSC2_c0419"
FT                   /product="peptide ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02175"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54403"
FT                   /db_xref="GOA:E3ED46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED46"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369043.1"
FT                   /protein_id="ADO54403.1"
FT                   /translation="MNIKPVLEIKGLSVSFRIKDQYHPAVDHLDLTVNPNEVLAVVGES
FT                   GCGKSALALSIPQLHDMERTRVEGKVLFKGTDLIRLSSGQMNKIRGAGIGMIFQDPLTA
FT                   LNPLMCIGKQIEENLDYHTSLSTKQKRERVLELLESVDIPNPVRVYEQYPHELSGGMRQ
FT                   RVMIAIAIACRPSLIIADEPTTALDVTIQSQILDLLKQLQQETGSGIILITHDLGVVAE
FT                   VADRVVVMYAGEIVESADVFELFRHPQHPYTRSLLASMPGSHTKGEPLHVIGGIVPSLQ
FT                   DIPRNSCRFASRIPWIQQRMHEDHPRLSEISPGHWVRCTCYQHFHFEDETKGEAAHGTT
FT                   RDK"
FT   gene            491392..492318
FT                   /gene="oppF1"
FT                   /locus_tag="PPSC2_02180"
FT                   /old_locus_tag="PPSC2_c0420"
FT   CDS_pept        491392..492318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF1"
FT                   /locus_tag="PPSC2_02180"
FT                   /old_locus_tag="PPSC2_c0420"
FT                   /product="peptide ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54404"
FT                   /db_xref="GOA:E3ED47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED47"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685909.1"
FT                   /protein_id="ADO54404.1"
FT                   /translation="MALLEINDLKVHYPVRGGFFQRVVDQVKAVDGVSISIEAGQTYGL
FT                   VGESGCGKTTTGRTIIGLNKLTSGQILFNGKDLTALSRNNRHPLRRDIQMIFQDPYSSL
FT                   NPRKRVLDVIAEPLRNFERLSNEEERRKVQMLLEKVGLNADAAYKYPHEFSGGQRQRIG
FT                   IARALTLNPKLIIADEPVSALDVSVQAQVLNFMKDVQREFKLTYLFISHDLGIIRHMCD
FT                   QIGIMYRGRLVEQGSEQDIYECPQHLYTQRLIATIPSIDPAKRLENAQKRQKLLSSYKS
FT                   ELPKHLDASGKPFALKSVSSSHQVALP"
FT   gene            492332..493300
FT                   /gene="oppB1"
FT                   /locus_tag="PPSC2_02185"
FT                   /old_locus_tag="PPSC2_c0421"
FT   CDS_pept        492332..493300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB1"
FT                   /locus_tag="PPSC2_02185"
FT                   /old_locus_tag="PPSC2_c0421"
FT                   /product="peptide ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02185"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54405"
FT                   /db_xref="GOA:E3ED48"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED48"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427175.1"
FT                   /protein_id="ADO54405.1"
FT                   /translation="MWKFTMRRLLVMIPQLFALSVLIFFLAKAMPGDALTGLITSTPNL
FT                   NPAALEEQRQRLGLNDPVWVQYGNWLVQLAHGDLGKSYVHKISVTDLIGSRLGNTFFLG
FT                   VVILVLTYLIAIPLGVLSGRYQHSLLDKTVVGYTYLSFATPLFILALLLLYVFGFRLGW
FT                   FPTSGSVDVGVEPGTWSYYVNKSYHLILPAVTGALLSTTATIQYLRNEVIDTRLKDFVK
FT                   TARSKGVPEGKIYSRHIFKNSLLPIAAFLGYDLTGVIAGNVFLESIFGYPGLGQLFLQS
FT                   ITQRDFSVVNALVMISGFLALLGTLLSDVILSKVDPRIRIE"
FT   gene            493329..494237
FT                   /gene="oppC1"
FT                   /locus_tag="PPSC2_02190"
FT                   /old_locus_tag="PPSC2_c0422"
FT   CDS_pept        493329..494237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC1"
FT                   /locus_tag="PPSC2_02190"
FT                   /old_locus_tag="PPSC2_c0422"
FT                   /product="peptide ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54406"
FT                   /db_xref="GOA:E3ED49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED49"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369046.1"
FT                   /protein_id="ADO54406.1"
FT                   /translation="MVSMQVEEVFSPEIIRKSPSSWSVLRRELVRDKMALISIGFVALF
FT                   LIFIYASVLFVNQDVVTTVDLGAIREAPGSVHWLGTDRAGRDIFGQLVIGARNSFTIGF
FT                   TITLLSAAIGLTLGLLAGFYGGLVDNIIMRIIDFILVLPFLMLVIVFVSIVPKSGIGSF
FT                   IFIMTAFLWIGKARLIRAKVLSERELDYVQASKTLGTPNWKIIWLGVLPNLSSVVIVNL
FT                   TLSLAGNIGIETGLSYLGFGLPESTPSLGTLVSYANDPDVLQNNWWMWLPASLLILVLM
FT                   LAINFIGQALKRATDAKQRLG"
FT   gene            494281..496101
FT                   /gene="oppA1"
FT                   /locus_tag="PPSC2_02195"
FT                   /old_locus_tag="PPSC2_c0423"
FT   CDS_pept        494281..496101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA1"
FT                   /locus_tag="PPSC2_02195"
FT                   /old_locus_tag="PPSC2_c0423"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02195"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54407"
FT                   /db_xref="GOA:E3ED50"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED50"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818863.1"
FT                   /protein_id="ADO54407.1"
FT                   /translation="MVKRWKKGILPVLSAILVLSLAACSGSPSASNGAKSSDGTGGSGA
FT                   DSKQVNATALAKAVKNDNPPIKGGIINYALVSDTPFEGILNPVFYDGNPDFEVFQFFYP
FT                   SLFSIDSNLNIDDKGAATISFSADNKAVTVKIDPKLNWTDGNPVTAEDYAFSYEVIGHK
FT                   DYEGPRYDSFMTNIVGMEDYHAGKAKTISGIKVLNEKEVTIHFKEPNPSVKSGLWSTPL
FT                   EKKVFRNIPVKDMAGSDPVRKNPIGYGPFKIKSMVTGESVEFVKNEDYFRGAPKLDGLH
FT                   LKVVNPNVITEALKSGEIDWASYPTTRYNEASNPKNVQFLGQEELSYSYVGFKLGKFDQ
FT                   AKSLNIMDPNAKLANKSLRQALGYALNNEQVGKQLYHGLRTPATSLIPPAFKGYHDVNA
FT                   KGIAYDPDKAKKLLDEAGYVDTNGDGYREDPKGKELVLHYAAMSGDATAESLAKFYLQN
FT                   WKDVGLHVELVDGRLLEFNSFYDRVQKDDPGIDIFGGAWSTGTDVNPSGLYGRGASFNY
FT                   SRFTSEENDKLLQEGVSVKAFDDNYRKDIYNQWQAYMSEEAPIVPTLFRYSLEAVNNRV
FT                   ANYDITRGKEYDADAFANITLTAEKAEVAQ"
FT   gene            496314..497102
FT                   /gene="M1-560"
FT                   /locus_tag="PPSC2_02200"
FT                   /old_locus_tag="PPSC2_c0424"
FT   CDS_pept        496314..497102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-560"
FT                   /locus_tag="PPSC2_02200"
FT                   /old_locus_tag="PPSC2_c0424"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54408"
FT                   /db_xref="GOA:E3ED51"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED51"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369048.1"
FT                   /protein_id="ADO54408.1"
FT                   /translation="MQIKALEEELGMTLFDRAGKKIKMTDAGKLLLQHSAHALKDLQQA
FT                   KASIEELRTEQRGSLRIGIALPELEESLQEMFAHFHRSFPKISLHICPSFDVTEQLLDN
FT                   RVDVGITLHSGTDERLVQLPLRTENYCLIVPVNHAFSNRSSLMLDELRHVPWAMQPECH
FT                   PGRKLIEKCFLDRGYPFATVLETNSIPSILRWVQEGLAVTLQTKSLAAELDRSLFCTVP
FT                   ILRGVPQGQLELIYRSDRYQGEAVKRLIEKIQTVLTECSN"
FT   gene            complement(497130..497780)
FT                   /gene="glnP1"
FT                   /locus_tag="PPSC2_02205"
FT                   /old_locus_tag="PPSC2_c0425"
FT   CDS_pept        complement(497130..497780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP1"
FT                   /locus_tag="PPSC2_02205"
FT                   /old_locus_tag="PPSC2_c0425"
FT                   /product="glutamine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02205"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54409"
FT                   /db_xref="GOA:E3ED52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED52"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279421.1"
FT                   /protein_id="ADO54409.1"
FT                   /translation="MDFGGLFAWPNVRFILEGFLLTLEVAIYSIIFSFALGIVFGILRY
FT                   TRIPVLSQVAAFIIDLIRNLPLLLIIFFIGMVLPSIGLSISLKWAAITGLSIFEGAMIA
FT                   EIVRSGLNSVHKGQLEAARSSGLSYSQTLWHIILPQALRRMVPPIVSQFISLFKDTSLA
FT                   VIISLPELTHNIQIVGGQNQSFVIPALLFAAFLYFAVNYSMSLIARRLEVRTH"
FT   gene            complement(497795..498454)
FT                   /gene="glnP3"
FT                   /locus_tag="PPSC2_02210"
FT                   /old_locus_tag="PPSC2_c0426"
FT   CDS_pept        complement(497795..498454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP3"
FT                   /locus_tag="PPSC2_02210"
FT                   /old_locus_tag="PPSC2_c0426"
FT                   /product="glutamine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54410"
FT                   /db_xref="GOA:E3ED53"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED53"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279422.1"
FT                   /protein_id="ADO54410.1"
FT                   /translation="MLTFDINVLFDHGDRFREGLLHTVQASVIALIGSFILGAIIAIFR
FT                   IAPFKWLNWIGTVYVEVIRNIPLLIVVLFFYLGLPTLGIPLDGFVSGTLGLTVYTASFI
FT                   AEAIRAGIQSVPKGQFEASRSSGLNYNQTMISIILPQAIKIVLPAIGNQFINLVKNSSV
FT                   LAIVAGLDLMYYSDLINSDTFLPITVYAITALLYLVLTVPLSFLVLYMERRLSKTS"
FT   gene            complement(498526..499356)
FT                   /gene="glnH"
FT                   /locus_tag="PPSC2_02215"
FT                   /old_locus_tag="PPSC2_c0427"
FT   CDS_pept        complement(498526..499356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="PPSC2_02215"
FT                   /old_locus_tag="PPSC2_c0427"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02215"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54411"
FT                   /db_xref="GOA:E3ED54"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED54"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279423.1"
FT                   /protein_id="ADO54411.1"
FT                   /translation="MRKRFQWSTLVLVALTCLLVLAGCGGKQEAATSGNEAAASNGLEA
FT                   IKQRGKLVVGVKYDTKLFGLKDPASGKVEGFDIDIAKAVAKHIFGDETKLELKEVTSKT
FT                   RITLLQNGDIDAIIATMTISDERKKQVDFSDVYFNAGQSLLVKKGSPITGLESLTPDTK
FT                   VLAVKGSTSAKNIREKAPKATILEFENYQDAFNALKAGKGQALTTDNSILLGMQQQDPN
FT                   YTLVGGNFTEEPYGIAVKKGQTELLQAINDTIKELKSNGEYDKLHEQWLGVKPE"
FT   gene            complement(499402..500139)
FT                   /gene="glnQ1"
FT                   /locus_tag="PPSC2_02220"
FT                   /old_locus_tag="PPSC2_c0428"
FT   CDS_pept        complement(499402..500139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ1"
FT                   /locus_tag="PPSC2_02220"
FT                   /old_locus_tag="PPSC2_c0428"
FT                   /product="amino acid ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54412"
FT                   /db_xref="GOA:E3ED55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED55"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010347817.1"
FT                   /protein_id="ADO54412.2"
FT                   /translation="MSSLIQFRNVNKHYGHFHVLKDINLQIKEGEVVVIIGPSGSGKST
FT                   LLRCINRLETISDGELIVNDVPVHDKKIDINAFRRNIGMVFQHFNLYPHKKVIENIVLA
FT                   PMKVLGIPKEEAIQTALTYLKRVGIEEKAQSYPAQLSGGQQQRVAIARGLAMNPKIMLF
FT                   DEPTSALDPETIGEVLDVMRSLAHQGITMVIVTHEMGFAREVADRVIFMDKGQILEDSQ
FT                   PAEFFQNPGEERARLFLSRLIHH"
FT   gene            500469..500933
FT                   /gene="glnQ1"
FT                   /locus_tag="PPSC2_02225"
FT                   /old_locus_tag="PPSC2_c0429"
FT   CDS_pept        500469..500933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ1"
FT                   /locus_tag="PPSC2_02225"
FT                   /old_locus_tag="PPSC2_c0429"
FT                   /product="cupin"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02225"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54413"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED57"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369054.1"
FT                   /protein_id="ADO54413.1"
FT                   /translation="MTKAISPLVTALGMEPHPEGGWYKEMWKANFQIPKPVLPDVYSGP
FT                   RFAASSTYFLLHPGEFSEWHVVHSDELWLYHSGSPIELKLGGSGEEPGEETVIIVGADV
FT                   EAGQHPQALVPGTVWQTARPLGDEPVLVTCVVAPGFHFDDFKLIAKGKVE"
FT   gene            complement(501014..501715)
FT                   /gene="M1-566"
FT                   /locus_tag="PPSC2_02230"
FT                   /old_locus_tag="PPSC2_c0431"
FT   CDS_pept        complement(501014..501715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-566"
FT                   /locus_tag="PPSC2_02230"
FT                   /old_locus_tag="PPSC2_c0431"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54415"
FT                   /db_xref="GOA:E3ED58"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED58"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599412.1"
FT                   /protein_id="ADO54415.2"
FT                   /translation="MSISLTALLLIGLTLALWIYTLIFLHSVMMERNLLRKLAYQDPVT
FT                   GLFNRNALELFWKRSNGKEGFAIMYLDLDGFKAINDTYGHQIGDKLLRRVSDHLLQVTN
FT                   SHQKAFRIGGDEFLLIMKDYDADQVTVLAELLLQKISVPYNIQGINLQVTGSIGITMHP
FT                   SPKKPLPSLLKEADIAMYQAKGMGRNRYAVYQRIRQRPNVRSYGTARVIKFAAGFRKKT
FT                   KIQGIQQMATL"
FT   gene            complement(501767..502417)
FT                   /gene="srtA"
FT                   /locus_tag="PPSC2_02235"
FT                   /old_locus_tag="PPSC2_c0432"
FT   CDS_pept        complement(501767..502417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srtA"
FT                   /locus_tag="PPSC2_02235"
FT                   /old_locus_tag="PPSC2_c0432"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02235"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54416"
FT                   /db_xref="GOA:E3ED59"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042000"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED59"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369056.1"
FT                   /protein_id="ADO54416.1"
FT                   /translation="MRKLAYVSIILGIIIMLFPTANEWLEDQKQKELLQEAESLSNTDT
FT                   STLTPEMMKGYTDLSNWLTNTAAADGPQLSQATPPSSASEQAPIATIQIDRIGLELPVL
FT                   EGATQQHMRYAAVHMSETATLGQVGNAAIAAHRSRTTGRLFNRLNEVKIGDQILIHTRG
FT                   EKYVYKVYNISVVTPSNVSVLKSIKKQKLLTLITCDPLVNPTHRLIVHARQLT"
FT   gene            complement(502525..506136)
FT                   /gene="M1-568"
FT                   /locus_tag="PPSC2_02240"
FT                   /old_locus_tag="PPSC2_c0433"
FT   CDS_pept        complement(502525..506136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-568"
FT                   /locus_tag="PPSC2_02240"
FT                   /old_locus_tag="PPSC2_c0433"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54417"
FT                   /db_xref="GOA:E3ED60"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED60"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369057.1"
FT                   /protein_id="ADO54417.1"
FT                   /translation="MRKKWNAATVALLLFLQCLFSTTQAYAQNPDSTLPVTPGADPVQS
FT                   VTNDVYPMPSEPINIPPAVPAPAPEPTAGSTSEVRATQESILTKLTLTDSTGSVIDAVY
FT                   NPDSRIDIGSAIHLGYEWELPNHTYKAGDTFTFQLPEQFQIYTDIMSPLTNTDGEVGHF
FT                   TVDRQGKVVMTFNDYVESHSNVSGKLEIKTEFSTQIEKGSTQVIIAIPIKGGEQTAIVN
FT                   IKPAAGPTMEKQGKFDGKDQIHWTVDVNKHLDPIKHAVVTDPTPQGLELVKDSIRVNHL
FT                   QINVNGTTVLGDTVSADKYTVETDPVVPGFIIRFNEESINSAYRIQYSTNITSEDTRFS
FT                   NTATFSGDDVKDTSATATVTVQRGDFLSKKVEKYDPVTQTISWAIKYNFANKKIPAAKA
FT                   ALSDRFNNSQQLIIDSLKVYKGDTQDELPASQYSVTPVIDDHGTNGFNLLFNTDIEAPY
FT                   TIRYQTKAIDRVVKNSKIKNSVTSDGVTKETTTELKSIIITKGYKEPNYNTKTIPWVIS
FT                   INADKYTMDQIVIDDAFPNGSLALLPNTLKIQSADGKTTLTSPTDYELIPLTLDYKKGF
FT                   TIRFHKKIQDTYTINYTTTFNNEWKIDKTKPDFWNKASITWLYNGTTQTAEAEARLWPD
FT                   NMTQQNGAKSGSYNASSKQITWDIKANYNRKTLNYAEIRDTLLQGQKLVPNSVKVYDMT
FT                   LLGWWNGVQKGAEVPSSQYTLVLPSAANNNELRIQFNQSINSPYWVTFQTTLEGELIDK
FT                   EINNNALLMDGKNVDSEWAAKVTVPHGGEYVTKSGAQNGNKIDWNIHINEGQSHVSNAK
FT                   IVDTPSNNQILIEDSFHLYSTKVSANGEAVRDTELVKDQDYKLKITTTAQGQQSFELAF
FT                   AKAISSGYILQYQSFLQAEDKAKVSNKVNFEGDRLTTEIRETSKEITVRTSSGSGSGGG
FT                   VTGSLEITKVDEDDHNKVLSGARFALYDKNQKRAPLVQTTNLDGKIVFSSLSYDDYILE
FT                   ELTAPEGYKITAPKTEIKIDTTIKQSSGIKQIVITNKKDTPVDPGPGTPTDPGTPTNPG
FT                   TPTDPGTPTSPGSGKKHDKDPEITEPPATPVTPVTTEEPKIIEDEDVPLGVPVIEQPPV
FT                   EPEAQPSAEPGVQPETPEADPHQEPSPPVKIEEDPVPKGVIRLPAEKPENPSDPGHTPK
FT                   VDTLPKTGENSPAPFYVSGMFLILLGAYLGYRRTHKK"
FT   gene            complement(506496..507461)
FT                   /gene="yebA1"
FT                   /locus_tag="PPSC2_02245"
FT                   /old_locus_tag="PPSC2_c0434"
FT   CDS_pept        complement(506496..507461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebA1"
FT                   /locus_tag="PPSC2_02245"
FT                   /old_locus_tag="PPSC2_c0434"
FT                   /product="transglutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02245"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54418"
FT                   /db_xref="GOA:E3ED61"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED61"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369058.1"
FT                   /protein_id="ADO54418.1"
FT                   /translation="MMAASYRLKWLFVVLIFPENFIRNGKPVERQGRKAIGPSIDDGSL
FT                   ATERKFFMGKMILSTLLLFFMLSAILLNSTIYAADSVAWLDQNNVNHGTVSVRYPVKPN
FT                   VKTKILVTKDAQKYSYNLTPGKSEEVFPLQMGNGNYNISILEQLSGNQYKVIGQDTIEL
FT                   KLNDSKAVYLNSVQNINWSSTNQAIQKARELTQGATTDREKLQKIYDYVISHIKYDSNQ
FT                   AFALTTDYLPQIDHTLSSQKDICYGYASLMAAMLRSVDVPTKLVMGKSSYVDTYHAWNE
FT                   VYIDNQWVVVDTTVDAALYMGKQKFQMVKDPSKYIKTKQY"
FT   gene            complement(507626..508501)
FT                   /gene="araC1"
FT                   /locus_tag="PPSC2_02250"
FT                   /old_locus_tag="PPSC2_c0435"
FT   CDS_pept        complement(507626..508501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC1"
FT                   /locus_tag="PPSC2_02250"
FT                   /old_locus_tag="PPSC2_c0435"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54419"
FT                   /db_xref="GOA:E3ED62"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED62"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369059.1"
FT                   /protein_id="ADO54419.1"
FT                   /translation="MTTNQKNAQYVWSEDPVAIICTPSAFAKKSLFYIQEIGYFKTDAY
FT                   VMERQKLTSFLLLFTLSGRGELQYRGKDYILKPHDMLFINCEEYVQYKTSCQKTWEFIS
FT                   VNLYGNLIDHFYEQFDKHNKPVISLQDSSAVLDKLRTLLHVQPERSLSSELLSSRIIVD
FT                   LLTIILQHPYTNPNANSDGTAEVRKVKQYLDQSYCERITLDSLAEMFGLNKFNLAKNFK
FT                   KQIGFSPIEYLINVRITAAQSWLKTSDVAIVDIAQYVGIPNTSHFINLFKEHIGETPHS
FT                   YRKKWGNRIK"
FT   gene            509085..510341
FT                   /gene="yjiN"
FT                   /locus_tag="PPSC2_02255"
FT                   /old_locus_tag="PPSC2_c0436"
FT   CDS_pept        509085..510341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjiN"
FT                   /locus_tag="PPSC2_02255"
FT                   /old_locus_tag="PPSC2_c0436"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02255"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54420"
FT                   /db_xref="GOA:E3ED63"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED63"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369060.1"
FT                   /protein_id="ADO54420.1"
FT                   /translation="MGKTKNTKTAAAWSLVMMGAGFAATLPFQQFGWARLLAGSFEAGL
FT                   VGGLADWFAVTALFRHPLGIPIPHTALLPKNRGKLTDALVNTVENNLLHKESIASKIAE
FT                   IRLAELVLKSVEKGIRTPEAVTFIDVLAKQLVRSIPLAELAPAIATGVKRQATEFDIGP
FT                   LLEVLARQAGERKYDQRALDYALEQTESWLLRSDTGVTLGTLGMQAVSGLQVSGLMQFA
FT                   LNAFLGYLNEERMGEMIRHFLLDRVAELRDEGHPRRQAVLDGFNTQLIHLAAKDTVSEG
FT                   LNHWKNTFIDSWEGDAAISDKLEELRRNLLDYMEDASYVTAYIVPLLDQMLSDLWRNTE
FT                   LLDKINSWIVAGVTGVVEANHSQIGNLVRENVNRMDDASLIALMEDKLGQDLQWIRING
FT                   ALTGFLIGIVLTGVRMLLE"
FT   gene            510488..513550
FT                   /gene="M1-573"
FT                   /locus_tag="PPSC2_02260"
FT                   /old_locus_tag="PPSC2_c0437"
FT   CDS_pept        510488..513550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-573"
FT                   /locus_tag="PPSC2_02260"
FT                   /old_locus_tag="PPSC2_c0437"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54421"
FT                   /db_xref="GOA:E3ED64"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED64"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369061.1"
FT                   /protein_id="ADO54421.1"
FT                   /translation="MNKRNFFLITLSFLIVIIGLRLLWFDYYHNQDYPRAKAGILDLRG
FT                   LNLQEIKTLPLNGEWEFYPGTLSSPAELKSLLMQKQRQTIQVPGLWSESVSPVDHKAYG
FT                   VGTYRLLILSDRSEDTLYGLRIGKISTASNIFVNGRLISHSGQVSSKVEQHIGTTVPFS
FT                   AMFDANRQAIEIVIQVSNFDFSASGGIMKPIIFGSADAVNSRTNFTIAMQIMVCIILLL
FT                   HGLYIVVIFFMNPQKKALLYFAGIVICTVLSILTDDDKLLLDWFPINLGLSLKITTLSY
FT                   IGIGMCVLKLAQSLLVRSRIIQIVFIGHCCFAILVLLAPASSLYAFLMVLIALPAITLC
FT                   ATVPSLAFLRTFRGQKEAVFLLLASISIASSMLWGIFKTNDLPYYPWDIVLAFVAFASY
FT                   WFKRFFNTNAELRRLSDRLQRADQVKNEFLANTSHELRNPLHGMINIAQTVLENQGSAL
FT                   DEPNRRNMQLLVTVGRRMSLLLNDLLDVTRLREKDIILEKRSLKPKAVASGVLDMLQFM
FT                   TDGKPLNMVVNIPADFPNVLADENRVIQILFNLLHNAVKHTAEGTISVHAHIQGEMASI
FT                   QVRDTGVGIDEETQKRIFHPYEQGNSHLTVIGDGLGLGLSISKQLVELHGGSLSVSSEL
FT                   GQGSTFSFTLPLDPSPTPDESRDNEQVCMDEEAGTDFIALQNEAVMQVAAGSARSAILA
FT                   VDDDPVNLRVLEGILASESEPYELVTVTSAQDALHRLDHREWDLIIADVMMPQMSGYEL
FT                   TRRVREYFSISELPVLLLTARSQQEDLYTGFLAGANDYIMKPVDSMELKSRVRALTDVK
FT                   KSARERLWMEAAWLQAQIKPHFLFNTLNTIASLSHVDHTRMVNLIEEFGKYLRSSFNPQ
FT                   NLDRVVSLEYELALLKSYLYIEKERFGNRLDIVWEVDEQISLLLPPLSIQPLAENAIRH
FT                   GIMNRIHGGTLCIRIQQREDGTEIAIIDDGVGMSQEELDRLLSHHQEQDSGIGLRNTNR
FT                   RLKQVYGKGLSISSLPNQGTTVSFHVPQVQR"
FT   gene            complement(513659..514810)
FT                   /gene="M1-574"
FT                   /locus_tag="PPSC2_02265"
FT                   /old_locus_tag="PPSC2_c0438"
FT   CDS_pept        complement(513659..514810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-574"
FT                   /locus_tag="PPSC2_02265"
FT                   /old_locus_tag="PPSC2_c0438"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02265"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54422"
FT                   /db_xref="GOA:E3ED65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED65"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369062.1"
FT                   /protein_id="ADO54422.1"
FT                   /translation="MERSEILTRIVIVDDEELALDYMKRLLGELQGIHIAGAFTNPFVA
FT                   KDYILLDDIDIAFLDVRLPGISGIELAHQILEHKPHIQIVFVTAYDKYAIQAFELNALD
FT                   YLLKPVTTERLIKTMNRILKRDDQAASMPENQPSVLQLQVFQYVVFTLPDQQPTVIQWR
FT                   TKKTQELFLYLLQNHDQWVRKSALIELLWPEYEEDKAYSLLYTAAYYIRKTIAPYHSFL
FT                   EISNTNGGYILHTQNVLLDTERWESLLASAPQMNKESIPYYVKMMELYKGDYLQEYDFW
FT                   WVESERQRLHKMWLSVSLKMAEWYRGNSQPEEAISIYEGICSRHPQEEEAYWGLMKTYA
FT                   EMYKNSLVIKWYDLLSSVLWEELHEKPNEQITNWFKEWQMAHA"
FT   gene            complement(515011..515685)
FT                   /gene="frp"
FT                   /locus_tag="PPSC2_02270"
FT                   /old_locus_tag="PPSC2_c0439"
FT   CDS_pept        complement(515011..515685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frp"
FT                   /locus_tag="PPSC2_02270"
FT                   /old_locus_tag="PPSC2_c0439"
FT                   /product="NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54423"
FT                   /db_xref="GOA:E3ED66"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED66"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685920.1"
FT                   /protein_id="ADO54423.1"
FT                   /translation="MSNTSAKKQEILDAFLFRHATKEFAPDRIIPEEDFQFILETGRLS
FT                   PSSVGFEPWQFVVVQNQALREKLAAVSSGGQKQLPAASHVVLILARKDVRYDSPYVEHM
FT                   YKEVKGMSDEDFASLPGRYKIFQGENQRLLENERTLFDWASKQTYIALGNMMTAAAQIG
FT                   IDSCPIEGFNYDQVHAILEEEGLLENGLLDISVIAAFGYRAHEPKREKSRQPLEKVTRW
FT                   VL"
FT   gene            515872..516255
FT                   /gene="ydeP1"
FT                   /locus_tag="PPSC2_02275"
FT                   /old_locus_tag="PPSC2_c0440"
FT   CDS_pept        515872..516255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeP1"
FT                   /locus_tag="PPSC2_02275"
FT                   /old_locus_tag="PPSC2_c0440"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02275"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54424"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED67"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369064.1"
FT                   /protein_id="ADO54424.1"
FT                   /translation="MAQEMEHTVSVNFGCPVAKTVGVIGGKWKGVILYHLTTGPRRYNE
FT                   IRRTLPNITQRMLTLQLRELERDGIVHREIYNENPPRVEYSLTPLGDTLRPLLDFMRDW
FT                   GIFYGEQGCEPVETISKSGKHFC"
FT   gene            complement(516352..517599)
FT                   /gene="ydhD1"
FT                   /locus_tag="PPSC2_02280"
FT                   /old_locus_tag="PPSC2_c0441"
FT   CDS_pept        complement(516352..517599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhD1"
FT                   /locus_tag="PPSC2_02280"
FT                   /old_locus_tag="PPSC2_c0441"
FT                   /product="glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54425"
FT                   /db_xref="GOA:E3ED68"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED68"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685922.1"
FT                   /protein_id="ADO54425.1"
FT                   /translation="MKIVNKALLSSVIFLSTAAGIYSPLAQAEAGKVSIMLDGYPLPFP
FT                   VQPAMMNGTTMVPFRAISEALGITVKWDQANQSITATKAQGNATKQVVLKMGSRNATVD
FT                   GQTVQLTAAPQTVRGSTMIPLGFFGQQFGATVNWNQGTRTVSITSPREAMYTVGFYALS
FT                   SFDQKSKIPNFNAVAFGWSRIDTNGQFTTTGKEYKWPQAAGAVTPESILQEADSQGTSP
FT                   YLMVYSVDGNHELTKILENAQLQEQTISQIVSTATDKQFKGITLDLEGLGWSGDKAKAR
FT                   SDYNAFIKKLSAKAHQAGLKLTVVLHPLNSSYTGYDYKTLGNLADDLIIMAYDYGQKST
FT                   PEPLDKVDEAIKLALKETSRDKLILGISMGSEKDSTVNAKIGLAKRYDLKGIAIWRLGI
FT                   IGETAWAKMNESIEFK"
FT   gene            complement(517791..518540)
FT                   /gene="ycnI"
FT                   /locus_tag="PPSC2_02285"
FT                   /old_locus_tag="PPSC2_c0442"
FT   CDS_pept        complement(517791..518540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnI"
FT                   /locus_tag="PPSC2_02285"
FT                   /old_locus_tag="PPSC2_c0442"
FT                   /product="nuclear export factor gle1"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02285"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54426"
FT                   /db_xref="GOA:E3ED69"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED69"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369066.1"
FT                   /protein_id="ADO54426.1"
FT                   /translation="MNITIQTAKSRFSRLTTSIGLIAAGALLFAGMASAHVTVKPSVSQ
FT                   PNAWETYTLKVPVEKNIPTTKVALKVPKEVVFKQYEPVPDWKVATEKDSSGKITTVTWT
FT                   SEKDGIQAGQYQRFSFVAQNADQNTAAAWDAFQYYSDGSIVEWTGDEGSNNPHSITKIT
FT                   ADATPETSAPAADSGHDSAGTAEGHASTDTAKDNSSAAPTSDNAAEATPAASAPASSAA
FT                   QTTALVLSIIAVVLGAAAVGIALKRRK"
FT   gene            complement(518571..520289)
FT                   /gene="copD"
FT                   /locus_tag="PPSC2_02290"
FT                   /old_locus_tag="PPSC2_c0443"
FT   CDS_pept        complement(518571..520289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copD"
FT                   /locus_tag="PPSC2_02290"
FT                   /old_locus_tag="PPSC2_c0443"
FT                   /product="copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54427"
FT                   /db_xref="GOA:E3ED70"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED70"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369067.1"
FT                   /protein_id="ADO54427.1"
FT                   /translation="MLYLSRPARAACLLLLCLPLLLLFPHSSWAHAFVVESSPTENQVL
FT                   DKSPSQVTITFNEDLQSAFMSIKVTDETGKRVDTGKAQLNPKHPSTMEIQLIPGMKNGI
FT                   YTITWRALSADGHPVNGVIPFQVGSGSNAYTDQATPSESSGTSRIDLIAVRWLLYIGLS
FT                   LLFGAICFRLFLLPSINRDKNRSEQKMLNQQPSDTLPRWTKLLWSGYGITSAAILISLP
FT                   LQASWDAGVSIREGFSLPILGEALQFTGAGKIWFIQMILVLLLSVTLIYAIDPSISNRQ
FT                   RRVWGYSSVLLTLSLMLSKAFVGHPAAATHPAPAIVADFVHLAASAFWIGSLTVMVVCL
FT                   PVAGSELPVFKQAALRQIALRRFAGWGIAMVAALLATGIYGAVLYLPAPFMLLNTSYGL
FT                   VLLGKAALLLVMLVFAASQFRSARQAAASKRAAGGLRVELSVGLLVMLLAAVLTHMSPG
FT                   QAPAVPFEETRTTGEYSVTLAVSPNAVGSNEFKVSVQDSKGTAVSGIQQVTLTLTPADP
FT                   DQDQQEFVLPVKQQQPFRSQELITSEGTWAVKVHALTASLDAVDAEFTLHVGGKK"
FT   gene            complement(520545..522395)
FT                   /gene="M1-580"
FT                   /locus_tag="PPSC2_02295"
FT                   /old_locus_tag="PPSC2_c0444"
FT   CDS_pept        complement(520545..522395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-580"
FT                   /locus_tag="PPSC2_02295"
FT                   /old_locus_tag="PPSC2_c0444"
FT                   /product="HD family phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02295"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54428"
FT                   /db_xref="GOA:E3ED71"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED71"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369068.1"
FT                   /protein_id="ADO54428.1"
FT                   /translation="MMSILKKLQERVTTTGIYVFFMCMVGLIVLLYTNHWSFLHYSTTE
FT                   WVTIYSLLGAVLILEHFTFQLPPASNKQSMDSSVYLACIFVHGTEIAILILLFNVIIAA
FT                   FRHTELSWWKHAVNFSIYALSIFVSSTVFELSGGTQGALNEDHFTSYLLALICYFTVNT
FT                   ITLGIYFYIAYKGSFNELKQAFLAESLLVYLCTLILSLVLTTLIYYNGILGLLLFLGLS
FT                   MLLSHAFKQMFTMYREIEEKANTDRRTGLYNHSYFENTLEAELNISRSQNTPLSLALID
FT                   IDDFKKYNDHFGHLKGDQLLGFLGEFLKRETFGTHITVSRYGGEEFTLLMPDHTAEQAY
FT                   EKVNAIRKRLNDSRYEGVEIFPHGCLSFSAGIAQSRIDIYDKSQLVDLADKALYYAKKQ
FT                   GKNIVHTHGSLNEVEREVDLGQDIRDLEQQLNLFLYKDINTFKHSKRVFRYAADMSDVL
FT                   QLGPKDKRRFLLGALIHDIGKLEIPWNILNKKEKLSSEEWRMVQAHVMWGKRIVEANER
FT                   FIDLVPFVELHHERYDGGGYPFGFKGEQIPRLCRMLTIIDSFDAMTTERPYQPTKTFEE
FT                   AIEELRTCSGSQFDPELTAIFIQYIQHKQPAFTQSIEVGF"
FT   gene            complement(522679..523272)
FT                   /gene="M1-582"
FT                   /locus_tag="PPSC2_02300"
FT                   /old_locus_tag="PPSC2_c0445"
FT   CDS_pept        complement(522679..523272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-582"
FT                   /locus_tag="PPSC2_02300"
FT                   /old_locus_tag="PPSC2_c0445"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54429"
FT                   /db_xref="GOA:E3ED72"
FT                   /db_xref="InterPro:IPR035168"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED72"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427192.1"
FT                   /protein_id="ADO54429.1"
FT                   /translation="MVYDGVLLGLIVGLFRGGWRQGLIRFSHIRLIAGWMFPLLLLVQF
FT                   IIFYAQEKWAWLAAMNGYLFMGVYVVGLIFLWLNRHHKGFKLILIGVLLNFIVMAVNGG
FT                   RMPVSLSASEVLGPYYTDMLKSGSVISKHYMMDASTRLSLLGDIIPLSKPYPRTQVISI
FT                   GDVVMNFGMFLFIQNVMVVKRNKDNQQETNPRHA"
FT   gene            523475..524704
FT                   /gene="tcaB"
FT                   /locus_tag="PPSC2_02305"
FT                   /old_locus_tag="PPSC2_c0446"
FT   CDS_pept        523475..524704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcaB"
FT                   /locus_tag="PPSC2_02305"
FT                   /old_locus_tag="PPSC2_c0446"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02305"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54430"
FT                   /db_xref="GOA:E3ED73"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED73"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427193.1"
FT                   /protein_id="ADO54430.1"
FT                   /translation="MNRLSNTVMVAADMTKSRILWIAFVLGALSAFGPLSIDMYLPSLP
FT                   TLADNLHTTTSLAQLSLTACLLGLAVGQIVAGPLSDVRGRRGPLVISLILYAAASLLCV
FT                   FAPNIGVLIALRFIQGLTGSAGIVISRAVARDLYSGKELTRFFSLLMLVNGVAPIAAPV
FT                   LGGVILNFVSWRGVFMVLCVVGVAMLIAVVLGLPETLPTNRRSSGGLKQTLGTLGHLFA
FT                   DRRFMGYALSQALITGAMFAYIAGSPFVLQDIFGVSPQTYSIIFAVNGLGIVLFSQLTG
FT                   RLVGRFSERQLLLSGLVIAAVAGISLLTVAFTGGQLLAVLIPMFFVVSCVGIVSTTTTS
FT                   LAMQSQQRSAGSASAMLGLLPLLLGSIASPLVGLGSGTTPVPMAVVIAIAELGALLSFI
FT                   VLAKEARAKA"
FT   gene            525080..525646
FT                   /gene="M1-584"
FT                   /locus_tag="PPSC2_02310"
FT                   /old_locus_tag="PPSC2_c0447"
FT   CDS_pept        525080..525646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-584"
FT                   /locus_tag="PPSC2_02310"
FT                   /old_locus_tag="PPSC2_c0447"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="Bacteria have multiple sigma factors which are
FT                   active under specific conditions; the sigma factor binds
FT                   with the catalytic core of RNA polymerase to produce the
FT                   holoenzyme and directs bacterial core RNA polymerase to
FT                   specific promoter elements to initiate transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54431"
FT                   /db_xref="GOA:E3ED74"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED74"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369071.1"
FT                   /protein_id="ADO54431.2"
FT                   /translation="MTMLVAETLAGSREAYKELYDYTIHTVYKSVHFLLEEKADVDDVV
FT                   QEIYIQVYKSLETFDTNRSFQPWLMGIVMRQIRAYRRKRWMRMRITSKAESLEHHAAFD
FT                   FSEEIVDKVANHVLLQAVQQLSFKLKQVIVLHYLHEYSQEEIANILDIPLGTVKSRIHA
FT                   ALQKLRSKERQGHFLIGKVEKIHEA"
FT   gene            525636..526379
FT                   /gene="M1-585"
FT                   /locus_tag="PPSC2_02315"
FT                   /old_locus_tag="PPSC2_c0448"
FT   CDS_pept        525636..526379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-585"
FT                   /locus_tag="PPSC2_02315"
FT                   /old_locus_tag="PPSC2_c0448"
FT                   /product="ecf-type sigma factor negative effector"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02315"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54432"
FT                   /db_xref="GOA:E3ED75"
FT                   /db_xref="InterPro:IPR022019"
FT                   /db_xref="InterPro:IPR038267"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED75"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369072.1"
FT                   /protein_id="ADO54432.1"
FT                   /translation="MKLEQELRKVMQHEDNHLSPPIELKENIMIQIERIKGKGSKPMKK
FT                   YIVTTILVAALLIPTGAFAAYSYLTDTLYGSQEKLIEMGGTAQEYTRVESKLQQAQGRL
FT                   SKEEFSVFMELLKELGAYNLKITDKNGMLHKERLSVDEQREYNRITAELEPYFDKLNQE
FT                   EFQTHKSIDLQDELDYAKKALSKDEFVKFRVLFTEFYKYVPRITGENGVLYPDRLPERE
FT                   REDYEEHLRLLQPYFDQFNSLEKKR"
FT   gene            526499..526849
FT                   /gene="csoR"
FT                   /locus_tag="PPSC2_02320"
FT                   /old_locus_tag="PPSC2_c0449"
FT   CDS_pept        526499..526849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csoR"
FT                   /locus_tag="PPSC2_02320"
FT                   /old_locus_tag="PPSC2_c0449"
FT                   /product="CsoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54433"
FT                   /db_xref="GOA:E3ED76"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED76"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427194.1"
FT                   /protein_id="ADO54433.1"
FT                   /translation="MAEEQPVSHTEVHGAHCGTDGEKTVRKSHHSAEFKNSLVSRLNRI
FT                   EGQVRGIKGLIEKDTYCDDVLNQIAAVQSALNGVGKLLLEGHMKSCVIERMQAGEQEVI
FT                   DELLVTVKKLIR"
FT   gene            526905..527105
FT                   /gene="yvgY"
FT                   /locus_tag="PPSC2_02325"
FT                   /old_locus_tag="PPSC2_c0450"
FT   CDS_pept        526905..527105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvgY"
FT                   /locus_tag="PPSC2_02325"
FT                   /old_locus_tag="PPSC2_c0450"
FT                   /product="copper resistance protein CopZ"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02325"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54434"
FT                   /db_xref="GOA:E3ED77"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED77"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428461.1"
FT                   /protein_id="ADO54434.1"
FT                   /translation="MAQVTLNVEGMSCNHCVKAVEGALEKVGATGKVSLETKQVNVEYD
FT                   ESKLSVEALKTAIEDQGYDVV"
FT   gene            527223..529679
FT                   /gene="copA"
FT                   /locus_tag="PPSC2_02330"
FT                   /old_locus_tag="PPSC2_c0451"
FT   CDS_pept        527223..529679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="PPSC2_02330"
FT                   /old_locus_tag="PPSC2_c0451"
FT                   /product="ATPase P"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54435"
FT                   /db_xref="GOA:E3ED78"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED78"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685928.1"
FT                   /protein_id="ADO54435.1"
FT                   /translation="MENRATDGDKHTTLHITGMSCAACASRIEKGLNRIDGVAQANVNL
FT                   ALEQASISYDPKQVEIPEFRDKIASLGFGTVSEEANLNVTGMTCAACAARIEKGLNRIP
FT                   GVTGASVNLAMETAHVEYAAGSTTVSDLVSKIEQLGYGAIPQSAEDNIADVRSKDIQRK
FT                   KWKWMISAVLSLPLLWAMVAHFSFTSWIYVPELFLNPWFQLVLTTPIQFIIGWQFYVGA
FT                   YKALRNGSSNMDVLVALGTSAAYFYSLYLTLRPSDAMEGMAGMPVTTMPELYYETSAVL
FT                   ITLILVGKWFEAVAKGRSSEAIKSLMNLQATTARVVRDGQELDLPIEQVRVKDIFIVRP
FT                   GEKIPVDGVVVDGRSAVDESMLSGESLPVEKGEGSPVTGATLNKNGVLRIQAERVGGDT
FT                   ALARIIKVVEDAQNSKAPIQRIADQISGIFVPIVVAVAVITFLVWFFLVTPSDFAGSLE
FT                   KMIAVLVIACPCALGLATPTSIMAGSGRAAEYGILFKGGEHLEMTRSVNAVILDKTGTV
FT                   TNGKPELTDVIVRASSLAETDLLRLLGAAEKSSEHPLAEAIVKGIADRGIELVGPTDFE
FT                   NIPGYGVKASVEGKQVLVGTRRLMSREGITMDDSTEQQMNELEGAGKTAMLVAVDGSYA
FT                   GLVAVADTIKETSREAIARLRAMNIEVIMITGDNERTAKAVAAEAGIERVLAEVLPEGK
FT                   AEEVKRLQDQGKIVAMVGDGINDAPALATAHIGMAMGTGTDVAMEAADITLMRGNLNSI
FT                   PDAIEMSRRTMTNIRQNLFWALGYNVIGIPIAALGFLAPWLAGAAMAFSSVSVVLNALR
FT                   LQRVKL"
FT   gene            529967..530710
FT                   /gene="nfrA"
FT                   /locus_tag="PPSC2_02335"
FT                   /old_locus_tag="PPSC2_c0452"
FT   CDS_pept        529967..530710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrA"
FT                   /locus_tag="PPSC2_02335"
FT                   /old_locus_tag="PPSC2_c0452"
FT                   /product="NADPH-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02335"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54436"
FT                   /db_xref="GOA:E3ED79"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED79"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428465.1"
FT                   /protein_id="ADO54436.1"
FT                   /translation="MNDTISLLMNHRSVRKFKSDPITDEQLAAIVAAGQMASSSSNVQA
FT                   YTVIAVTEPSLKTKLAELAGGQAYVEQCPTFLVWCADLYRLKQVTIHHQPGQPSYEGSV
FT                   ENYTVATIDAALAAQNAAVAAESLGLGIVYIGGIRTKIAEVSELLGLPELVYPVFGMCI
FT                   GVPDQETGLRPRLPLSGVLHMNGYDKNQTMKAVEVYDHTSAEYLKERTGGQRSTPWSEQ
FT                   MATRLTEPARLQLKPFLEQKGFLKQ"
FT   gene            complement(530889..531734)
FT                   /gene="M1-591"
FT                   /locus_tag="PPSC2_02340"
FT                   /old_locus_tag="PPSC2_c0453"
FT   CDS_pept        complement(530889..531734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-591"
FT                   /locus_tag="PPSC2_02340"
FT                   /old_locus_tag="PPSC2_c0453"
FT                   /product="DNAase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54437"
FT                   /db_xref="GOA:E3ED80"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED80"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369077.1"
FT                   /protein_id="ADO54437.1"
FT                   /translation="MNDWNMHSALRSNAAATVPLIDAHIHVDSYPPEQQELLLASLADN
FT                   HVEAIIAVSMHLASSQANLRLAERWPRLVRPAFGFHPEQALPAHTELDLLFDWMDEHVQ
FT                   QMIAVGEVGLPYYNRIEASRSGEPFELAPYIALLERFIQFASKHSKPIVLHAVYEDADI
FT                   ACDLLERHDVTQAHFHWFKGSAATTKRMARNGYYVSFTPDLLYEEEIRSLARQYPSDQV
FT                   MAETDGPWPFEGPFTGQQTHPRMTTEVIRAYSKLTHQDEAAVRQLFYDNTRRFYSLSDS
FT                   "
FT   gene            complement(531727..532680)
FT                   /gene="M1-592"
FT                   /locus_tag="PPSC2_02345"
FT                   /old_locus_tag="PPSC2_c0454"
FT   CDS_pept        complement(531727..532680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-592"
FT                   /locus_tag="PPSC2_02345"
FT                   /old_locus_tag="PPSC2_c0454"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02345"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54438"
FT                   /db_xref="GOA:E3ED81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED81"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427198.1"
FT                   /protein_id="ADO54438.2"
FT                   /translation="MSLHPTDLTSPPVADEQQQAGELQVMTPAPPALELDGISLVFRKR
FT                   RSSLPVLQDVSLTVKPGEFVSLIGPSGSGKSTLFHIIGGLLKPQQGRIRMHGRDMTGER
FT                   GHISYMPQQPALFPWRTTLDNILLGQENAPRKDAAAGSRYGSERERRKEALQWLEQVGL
FT                   GKFAKAYPHTLSGGMQQRAAFLRALLSPQELMLLDEPFSALDALTRADMQQWLLRMWEK
FT                   NRRSVLFITHSIEEALLLSDRIYVLSARPASVMHVVDVPFPRPRREEITLDPRFMEWKR
FT                   TMTGWMREEKHKLDGDMDAAESIRKYTSDDRVNHYE"
FT   gene            complement(532726..533502)
FT                   /gene="ytlD1"
FT                   /locus_tag="PPSC2_02350"
FT                   /old_locus_tag="PPSC2_c0455"
FT   CDS_pept        complement(532726..533502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytlD1"
FT                   /locus_tag="PPSC2_02350"
FT                   /old_locus_tag="PPSC2_c0455"
FT                   /product="nitrate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54439"
FT                   /db_xref="GOA:E3ED82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED82"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685931.1"
FT                   /protein_id="ADO54439.1"
FT                   /translation="MNPKGKNVSWWKSVWPPLVAVLFFLAAWQGAVNYLHIESWLLPAP
FT                   SLIVQEGMAQSALLGTHTWATVRLTLAGFAIGTATGLLIAIVLHTIPFLKSALYPLLIL
FT                   SQNIPIIALGPLLMVWFGFGVLPKLMVITLVCFFPVAVAAMDGLTRTDRMMMNYMRMSG
FT                   ASRRAIFLKLELPHSLPQVFSGVKIAATYSVMGAIIAEWIGASEGIGYYMLLQKSAYRT
FT                   DLIFAAIGIIVALSLLMFVVILLLEKWLVRWKPDQE"
FT   gene            complement(533499..533792)
FT                   /gene="M1-594"
FT                   /locus_tag="PPSC2_02355"
FT                   /old_locus_tag="PPSC2_c0456"
FT   CDS_pept        complement(533499..533792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-594"
FT                   /locus_tag="PPSC2_02355"
FT                   /old_locus_tag="PPSC2_c0456"
FT                   /product="M1-594"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02355"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54440"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED83"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019913979.1"
FT                   /protein_id="ADO54440.1"
FT                   /translation="MANTLLSIQVIPKTPNNEDSYPYVDKAIEVIQRSGVKHQVNPLDT
FT                   TMEGELDELLKVVKDMHEALTEAGSPSVISQIKIAHNPQGISMNKLTEKYRP"
FT   gene            complement(534308..535351)
FT                   /gene="M1-596"
FT                   /locus_tag="PPSC2_02360"
FT                   /old_locus_tag="PPSC2_c0458"
FT   CDS_pept        complement(534308..535351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-596"
FT                   /locus_tag="PPSC2_02360"
FT                   /old_locus_tag="PPSC2_c0458"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54442"
FT                   /db_xref="GOA:E3ED85"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED85"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308464.1"
FT                   /protein_id="ADO54442.1"
FT                   /translation="MKRMKMLSLGLISLWLMALTLTACGGNPPTSQKEAPAADTSTSTS
FT                   AKGLKDVKVVLDWTPNTNHTGLYVAKDKGFYEKAGLNVQIVQPGSGGADQMVASNAAPF
FT                   GISYQEGVTQARIQGVPLVSIAAVIQHNTSGFAAPVDRGIKSPKDFEGKSYGGWGSPVE
FT                   EAVMKSIMDSDQGDVSKVKIVNMGNADYFTAVKRDIDFAWIFYAWTGIEAKLRGEPLDM
FT                   LYVKDYSKNLDYYTPVIVSNEQTIKNDPELVKAFMDATAQGYEYTIAHPEEAADILSKA
FT                   VPELDKKLVLASQKWLSPRYQDDAPQWGVQKAEIWKNYSDWMYERKLLSKPLEVDKAFT
FT                   NDFLPKR"
FT   gene            535928..536362
FT                   /gene="ydaG"
FT                   /locus_tag="PPSC2_02365"
FT                   /old_locus_tag="PPSC2_c0460"
FT   CDS_pept        535928..536362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaG"
FT                   /locus_tag="PPSC2_02365"
FT                   /old_locus_tag="PPSC2_c0460"
FT                   /product="general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02365"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54444"
FT                   /db_xref="GOA:E3ED87"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED87"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818833.1"
FT                   /protein_id="ADO54444.1"
FT                   /translation="MGKTDTLDRSQLEQAIVKALDNNKFCSLGTVEGGKPKVRYMALFN
FT                   DGMNIHLATDRKTHKVEELKDNPNAYLLLGYEVGGTKEVLEVEATVQVTADEGLRKQVW
FT                   NDSLKKWFSGPDDPDYVVLDVNPTRIEYVGQQTERQVWTK"
FT   gene            536580..538682
FT                   /gene="cpdB1"
FT                   /locus_tag="PPSC2_02370"
FT                   /old_locus_tag="PPSC2_c0461"
FT   CDS_pept        536580..538682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpdB1"
FT                   /locus_tag="PPSC2_02370"
FT                   /old_locus_tag="PPSC2_c0461"
FT                   /product="2', 3'-cyclic nucleotide 2'-phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54445"
FT                   /db_xref="GOA:E3ED88"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED88"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818832.1"
FT                   /protein_id="ADO54445.1"
FT                   /translation="MLFRKNWFKGFTAVVVACSLLVFSAAPSWAASDSRYSATVNLRIM
FT                   ETTDIHGALMNYDYYSDKETNEYGLIRTAGLIQQARSETRNSMLFDNGDLLQGNPLGDY
FT                   MARNKTFEKEGGVHPVYKMMNLMGYDAATVGNHEFNYGLDFLDKSLKGADFPYVNANVY
FT                   VDNEGQATKNYFTPYQILDKKVTDEKGEEHTLRVGVIGLVTPQIMQWDEANLKDKVVTK
FT                   DIVETAKKFIPQMKTEGADIIVVLAHTGYEDVPQTPMMENAVKYLSQVDGINAILFGHA
FT                   HKSFPGPDFKDMKGVDLDKGTINDVPAVEASSWGKDLGIIDLSLEKRNREWHVINSQSQ
FT                   VRPVVSTTNQAVKFTPEFKLVDAIKGEHQGTLDYIRQPVGTTTAPITSYFALVQDDPSI
FT                   QIVTNAQKWYVQNHLKGTEYENLPVLSAGAPFKAGGRNGAEYYTNIPEGTIAIKNVSDL
FT                   YVYPNTVHAVEVTGAEIQEWLEWSAGQFNRIDPSKTEEQSLINKDFPTYNFDVIDGVNY
FT                   QIDVTQPARYDAKGTIIDSSAHRIKDLQYNGKAIDPAQKFIVATNNYRASSSKLANPDG
FT                   KRIVMAAPDESRQVVVDYIRTNGTINPSADGNWSIAPFGQAKVTFESSPDAKDVLAGNQ
FT                   QISYLSSAADGFAKYSLKADAKPSAATTSVKEAAAPAKATAKPAVKTTKPAAAKPAKTT
FT                   KPKASK"
FT   gene            538959..540020
FT                   /gene="M1-600"
FT                   /locus_tag="PPSC2_02375"
FT                   /old_locus_tag="PPSC2_c0462"
FT   CDS_pept        538959..540020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-600"
FT                   /locus_tag="PPSC2_02375"
FT                   /old_locus_tag="PPSC2_c0462"
FT                   /product="signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02375"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54446"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED89"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369086.1"
FT                   /protein_id="ADO54446.1"
FT                   /translation="MTCSNCSIILPIKDQGLLKIRHSRVSLTPALEGLGMLSEQMKQEH
FT                   WCEGNIVFRYDSRSQLEHLVNGLARLPQECLSRMQVVVTGLQHVEGFEEWLLFGQLQAR
FT                   LQHPDLVSIINNQNFTSHMQPIVDYKLNIIGFEFLLRSSQPDKSFQPFRLFEVAREAGL
FT                   HAHLDRSARISAIEKSATCLPVGIKRFINFLPSTIYNPAYCLNHTFETIERLSMNTEDF
FT                   VFEVVETEEIDDLNFLHQIFEQYRTRGVSVALDDVGAGYSTTELMNCLQPDYVKIDRSI
FT                   IDGCHHNSDQKRQITGIVESAFRFGGQVLAEGVEQMEDFEFCRNAGVSLAQGYLFGKPE
FT                   PTPPSNFILSRVV"
FT   gene            complement(540170..541261)
FT                   /gene="M1-601"
FT                   /locus_tag="PPSC2_02380"
FT                   /old_locus_tag="PPSC2_c0463"
FT   CDS_pept        complement(540170..541261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-601"
FT                   /locus_tag="PPSC2_02380"
FT                   /old_locus_tag="PPSC2_c0463"
FT                   /product="M1-601"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54447"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED90"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427203.1"
FT                   /protein_id="ADO54447.1"
FT                   /translation="MNLRPKEPKDLIVESAVIPPNIHVDVESATEGGTRRLMLSDNPET
FT                   LTHVTVPTEQATLWHDVVRTTTRTVKHRIFGWHYNKIGSPVKLGITIENKSTARLEVRH
FT                   IERALEIVPEDGNWIIDVGQSIAKSCLAGTMKRLKPVDRHKFGRGTALLEEFELPEGSL
FT                   AGFIYDLTVEYAEGHGTLDYVIRTVVSKDTQTDLREIHKDALPPVPPPQAHPRGVWSFS
FT                   ETNARMPEYVVGQSANYRACATKKLNGETPADLLFTGERSELGPALDNRGQFGTIYNAT
FT                   IPIVNHSSEVRTVRIYANPRGGAFAGSVRVDGHVYGIPLLQDNTKVCRLTDIRIPPGQS
FT                   SYSLSFMVAGSATTPLGLYVITL"
FT   gene            541532..543232
FT                   /gene="malL"
FT                   /locus_tag="PPSC2_02385"
FT                   /old_locus_tag="PPSC2_c0464"
FT   CDS_pept        541532..543232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malL"
FT                   /locus_tag="PPSC2_02385"
FT                   /old_locus_tag="PPSC2_c0464"
FT                   /product="oligo-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02385"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54448"
FT                   /db_xref="GOA:E3ED91"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED91"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818829.1"
FT                   /protein_id="ADO54448.1"
FT                   /translation="MPKKIWWKEAVVYQIYPISFQDSDGDGKGDLRGILSRLDYLSELG
FT                   IDVIWICPIYKSPNHDNGYDISDYYAIMDEFGTMEDFDELLHQAHERGIKIMMDLVLNH
FT                   TSDEHPWFTESRSSKDNPKRDYYIWRTGKNGGYPNNWESYFSGSVWKYDKLTDEYYMHL
FT                   YSEHQPDLNWENEEMVGELYRMVEWWLKKGVDGFRFDAIAHIVKAEGLPDAHNPDKQTL
FT                   VRAYQLFSNLEQVHVLLRMLNEKVLERYPLMTVGETSGLGPEQALDYVGDQRHELNMVF
FT                   QFEHMFIDAQGLGTEKWKYKSWTLVELKKIMSSWQTVLHQEGWNANYLNNHDQPRALSR
FT                   FANDGQYRVESAKMLATFTHMLEGTPYIYQGEEIGMTNIAFPSIDDYRDVETLNYYEQQ
FT                   RKLGEPEEQIMAAIWRKSRDNARTPMQWNAGPAAGFTDGEPWMKINDNYTHINAEAERN
FT                   DPNSIFHYYRKLIALRKQHEVIVYGEYKLLLPLDTELYVFSRMLGQECLLVILNFFDRD
FT                   PVFHWPDGEKFPAAKAELLLSNYEPVKGENLHALKLRPYEARVYKLTLK"
FT   gene            complement(543544..544341)
FT                   /gene="M1-604"
FT                   /locus_tag="PPSC2_02390"
FT                   /old_locus_tag="PPSC2_c0466"
FT   CDS_pept        complement(543544..544341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-604"
FT                   /locus_tag="PPSC2_02390"
FT                   /old_locus_tag="PPSC2_c0466"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54450"
FT                   /db_xref="GOA:E3ED93"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED93"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369090.1"
FT                   /protein_id="ADO54450.1"
FT                   /translation="MKQIFTLWLCIALMGMSTVMGESASATQAVDGQPYHFGFKKSKGG
FT                   ELPSIAQEGFMHLIERQGGIFLGDTTKKELFLTFDNGYENGYTPKVLDVLKAKKVPAAF
FT                   FVTGHFVKDQPDLMRRMASEGHIIGNHSWSHPDMSTISSAEIRSELDRVRTASAELTGQ
FT                   KEMKYVRPPRGIFNEKALASCREAGYTSVFWSVAYKDWDTNIQRGTDYAYRQVMQQLHP
FT                   GAVILLHSVSKDNTEALGSIIDEARKQGYEFKSLDDLKVKHYH"
FT   gene            544613..545635
FT                   /gene="metN5"
FT                   /locus_tag="PPSC2_02395"
FT                   /old_locus_tag="PPSC2_c0467"
FT   CDS_pept        544613..545635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN5"
FT                   /locus_tag="PPSC2_02395"
FT                   /old_locus_tag="PPSC2_c0467"
FT                   /product="methionine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02395"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54451"
FT                   /db_xref="GOA:E3ED94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED94"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308478.1"
FT                   /protein_id="ADO54451.1"
FT                   /translation="MIELRNVSKTYVRKGLSIQALKNINITVDKGDIFGFIGFSGAGKS
FT                   TLIRLVNRLEKVTTGEVLVEGESLNAYSTSGLRKVRKKIGMIFQHFNLLESKTVFENIA
FT                   IPLVLLKRNKREIERRVTELLAFTGLSDKANSYPSELSGGQKQRVGIARALASNPSILL
FT                   CDEATSALDPQTTQSILDLLRKINKEYKITILIITHEMSVIQRICNKVAVMEKGEIIEQ
FT                   GDVLEVFGQPKHPTTQSFVRTVIHDEVPDSVLQTFEQQESQRIYKLEFIGQAASDPVVH
FT                   ELIRKHDIHVNILFANMTEIQETTIGYMTLQLRGEQQAVQQAVDFIKSKGVHIQEVESL
FT                   "
FT   gene            545632..546297
FT                   /gene="metI"
FT                   /locus_tag="PPSC2_02400"
FT                   /old_locus_tag="PPSC2_c0468"
FT   CDS_pept        545632..546297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="PPSC2_02400"
FT                   /old_locus_tag="PPSC2_c0468"
FT                   /product="methionine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54452"
FT                   /db_xref="GOA:E3ED95"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED95"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818825.1"
FT                   /protein_id="ADO54452.1"
FT                   /translation="MMITGTTITWDQLWEALYESVLMVSISLFIGALIGIPIGILLVVT
FT                   RLGGILENKWLYGILNPIINIVRSLPFIILLIAIIPLTRLIVHTSIGTSAAIVPLIIYI
FT                   APYIGRLVENSLLEVNPGILEAADAMGATPFQVIRYFLLPEAFSSLILSLTTAAIGLIG
FT                   ATAMAGAVGGGGIGDLAIAYGYQRFDTLVMLITVIILVVFVQGVQSLGNLLSRKARRG"
FT   gene            complement(546433..547413)
FT                   /gene="yajO"
FT                   /locus_tag="PPSC2_02405"
FT                   /old_locus_tag="PPSC2_c0469"
FT   CDS_pept        complement(546433..547413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="PPSC2_02405"
FT                   /old_locus_tag="PPSC2_c0469"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02405"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54453"
FT                   /db_xref="GOA:E3ED96"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED96"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369093.1"
FT                   /protein_id="ADO54453.1"
FT                   /translation="MDYVKLGNTGLDVSRLCLGCMGFGVAERWIHPWILDEERSRPVIK
FT                   KALELGINFFDTANVYSDGTSEEIVGRALKDYANRDEIVLATKVHFRMHQGPNGAGLSR
FT                   KAIMSEIDKSLKRLGTDYVDLYQIHRWDYNTPIEETMEALHDVVKAGKARYIGASAMYA
FT                   WQFLKALHVAENNGWTRFVSMQNHLNLLYREEEREMLPLCKEEKIGVIPYSPLAGGRLT
FT                   RDTQETTHRSETDQVSKSKYDATADSDRLIVDQVATIAEKRGVPRVQIALAWLLQKAPV
FT                   TAPIIGATKTSHLEDAVAALSITLTPEEIASLEELYVPHPVIGAL"
FT   gene            547686..551210
FT                   /gene="ebh"
FT                   /locus_tag="PPSC2_02410"
FT                   /old_locus_tag="PPSC2_c0470"
FT   CDS_pept        547686..551210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ebh"
FT                   /locus_tag="PPSC2_02410"
FT                   /old_locus_tag="PPSC2_c0470"
FT                   /product="ebh"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54454"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED97"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369094.1"
FT                   /protein_id="ADO54454.1"
FT                   /translation="MLKLVNRNKWIASAMVLGIASGSIVSLPWMGGAQTAYAATADTQS
FT                   ETGFVTQARTLGLMTGGNQGDFMAQKNLTRAEAAKILCSLFQLEVNNQPQTSFMDVSSD
FT                   AWGAPYIEAVRAAGYMTGNGELFRPGDAITKEELIVSLVRAMDLQDAGTTDAQQNAVQV
FT                   ARNYGLLSEDASATDLKNPLNRESSAEVFVSLLDHPVGEVKSEGNTVRIGNIPYQLEGS
FT                   LQGLFGENNKAVLKGAKIDLNRNLRTLTGVNKLEINADGGVFDGKGVSFDGRLIVNGSV
FT                   TLKNMSSTGVLEIKGSGNQSVSAILENTTWSGVELGSKDAKLTATGTTKIDNLTLKNDA
FT                   SIMTEGNAAISRVSLQQGLGKLLVSGSIGLLDASQYVGVPFITLAKGAAINQLNLPEQK
FT                   QPRDVIINYDAVKEAIGLVNGTKNSSSAGSVITDTDSKDKKKHDSDIISVDRSQLETEV
FT                   HAAKELLERAGEGGTDQALYPAAAKESLSIAINQAMLVLNNTAATQAEVDQALSTLKQD
FT                   VSVYTASVTEPVIGTQELTRLIQLASTILEQNRMVGDEFPPLWDDSLSQAIRFGNNVLE
FT                   GNAPQNIVDREVESLGRVIKVYKASVKLRDVYLHFLDVTDRVENLKTDKARYKSIVREG
FT                   SKVYLNPLSTTEQLDEWKQKIEGATESFLALQAADFSVLKNTLQEAQVIYDQSGSQNAE
FT                   LDNLIQEYTEKMHTAMTQQDVLNLNMELSQRLTEFTAPVPATTREKLQQLVQDIQLKLL
FT                   SDPVARNYLNTEMQLLDQQTVQAHFALIMPFTPEEQLVISYNQLSQAKGTYIEKYNEKR
FT                   LQLRDKVIEMQTSINGILLQNSGTLSAEAQQALSSASEHASTFLGLSSFELQDVVPVYE
FT                   ELQQVQNQYTAPIAVDTMLLNLNINLANNEVQTFGRHYTDQDNEELQGQINLANLVLNN
FT                   PNSTQLQVDQANTDLITAFANYQSKWIVTDLDINELKNIANNLLTVNGTDPTTVYFHRV
FT                   VDAFNRLDQYLPMPELKKNYMNLEDAIQEYKDFIDSQQQSSGTGSGDSSGGTTPLSDSD
FT                   GTGSGDSSGGATSPSDSDGTGTGDSSGGTTPPSDSDGTGSSDSSGGTTPPSDSNGTGSG
FT                   DSSGGATSPSDNSGTGSGDISGGATPPSDNSGTGSSDSSGEATPPSVSSGDDSGSIPGG
FT                   SIDDVIIP"
FT   gene            551374..554514
FT                   /gene="ywpD"
FT                   /locus_tag="PPSC2_02415"
FT                   /old_locus_tag="PPSC2_c0471"
FT   CDS_pept        551374..554514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywpD"
FT                   /locus_tag="PPSC2_02415"
FT                   /old_locus_tag="PPSC2_c0471"
FT                   /product="lysis regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02415"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54455"
FT                   /db_xref="GOA:E3ED98"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED98"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369095.1"
FT                   /protein_id="ADO54455.1"
FT                   /translation="MKKQGVLFFIILLLAVALPVYPLVSGVLSGNSHWKAHNGVIDLRN
FT                   WDPDKEGAVQLGGEWEFYPNQLFQPSSFQETRYQDWGNRQNSSKLGLGTGSSAKIVDVP
FT                   GKWNQWMPGGQATGYGTYHVRVLLPEKVENLYGIHMQNIRNSSRVWINGAEVGASGIPS
FT                   VSADKGKQGNAPFVGFAAVDGHSADITVHVANYSYSSGGIIYPLLFGDYASITHSREVA
FT                   MAEDTVLVAGFFIPTVFFIMLYFLRRKEKALLYLACFCIAALFYILTHGEKLLVWGMPD
FT                   LPYEWILKIQSFSSTLFYYFLIRYVHLTTQIVMNRIVLLLYNIVTALMLGMGLLLPTLV
FT                   LSSFETFILLFGVVSVGYVLLILIRGLLQRTDDAALLVISIMSILMIVVTSFVYVLGWG
FT                   DVRGVTAYEMLIFVLAQTLLLAKRFVHSFMEVENLSRRLLTLDGLKDEFLANTSHELRT
FT                   PLHGIINIAQSMLDRYGAQFNEPQKHNLALIVNVGRRLSYLINDILDFSNLKNGRLALN
FT                   RRPVNVQTAVNSVLEVLGHNVGKKKLQFVKEWPNSLPKVDADEDRLNQILYNLLGNAMK
FT                   FTEEGEIVISAKVRNREMEISVKDTGPGIAPDHLSHIFEPFNRGANAEDKGYSGTGLGL
FT                   GITRRLVELHGGYIRVESRLGKGSTFYFTLPLAETGTSAHEVQKDVLSEVILKPGVTSN
FT                   QGVNPLEEDGLEQVRNVPYRVLAVDDDGVNLRVLEELLYATGCSVVAVDHAEEALQLLN
FT                   GRARFDLVITDWMMPEMSGIELCRRIREGYSLSELPVLLLTARDLPGDIHAGFMAGAND
FT                   FLRKPVDAEELKARVRTLLNMRNSAEEAVRSEMAFLQAQIKPHFLYNALNVIVSTVAVD
FT                   PDKAAELLMELSQYLRGSFDFQNRENTVPLCKELELVESYVALEKARFEERLQVTIEVG
FT                   RNIRSLIPPLSIQPIVENAIRHGVMQRATGGTVRVIVQEDGADFVVSVTDDGVGIPPER
FT                   LQQLLSEEHVSSSVGLRNIHRRLIHMYGEGLRIESNPMQGTTVSFRVPETILSHPTE"
FT   gene            554673..555824
FT                   /gene="lytT"
FT                   /locus_tag="PPSC2_02420"
FT                   /old_locus_tag="PPSC2_c0472"
FT   CDS_pept        554673..555824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytT"
FT                   /locus_tag="PPSC2_02420"
FT                   /old_locus_tag="PPSC2_c0472"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54456"
FT                   /db_xref="GOA:E3ED99"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3ED99"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685943.1"
FT                   /protein_id="ADO54456.1"
FT                   /translation="MKAILIDDERSALTYLERLLEADGRLTVMGKYTSAQAGLDHLAAE
FT                   RVDIVFIDIGMPEMNGLEAAEWIQQLDSHIHIVFVTAYSEYAIEAFELQALDYLLKPVH
FT                   ARRLNKTLDRIVATLADSRPSSSVVAAEQLPKVRCFQKLEIPEDGQGAVGAKPFKWRTL
FT                   KSQELFSFLLHHEGEWVSKEQLLDALWPEYHLDKAVVHLHTSIYQIRKALKERMQDTKL
FT                   EYNLDRYRLNRNGWVTDVELFERGISEWAASGNGGTPRIESLLALYRGNYLEEHDYPWA
FT                   YAKREKLRNMYLACASELAKEELRSGRARQSIQRLLSLQQREPYSDDICGLLLTAYAQL
FT                   GEYTAAQKHYESFVSLLEDELGIEPHQVTHQLYVQLKTQTLPA"
FT   gene            complement(555968..557284)
FT                   /gene="rpoN"
FT                   /locus_tag="PPSC2_02425"
FT                   /old_locus_tag="PPSC2_c0473"
FT   CDS_pept        complement(555968..557284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="PPSC2_02425"
FT                   /old_locus_tag="PPSC2_c0473"
FT                   /product="DNA-directed RNA polymerase subunit sigma"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02425"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54457"
FT                   /db_xref="GOA:E3EDA0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDA0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599419.1"
FT                   /protein_id="ADO54457.1"
FT                   /translation="MRYGLQQEQTFRLAMTPELRQAITILQYSSVDLMSYLHEQANENP
FT                   IIDLAEIDMSIERINTEEEYSPRKNDNPVDLLDFVSNPADNLYRHLKAQLGMVSGLSRL
FT                   QQMIGMFLIGNLNEKGYLELDVNIVAGILDVPTDEVENILALIQGFEPAGIAARSLEEC
FT                   LLLQLRYAGNDDVYLEEIVRHHMVNLSCNRIQKIADALGIDIHMVQQITDQIRKLNPCP
FT                   GAAFAPYERQHHIADISVEKFKNDYIVTVNDITVPRVGINPFYQSMLRKPAMEEEKRFL
FT                   REKMNTALWLIHSLEQRRLTLMRVAQAIVDRQRDFFEHGVYHLKSMTQKEIAEITGLHE
FT                   STISRAVSNKYMQTPRGLFELKYFFTSALGSKDGDATSSESAKMRIKQIIDGEEKQKPF
FT                   SDQAITELMAKEGLELSRRTVAKYREELGYLSSARRKVY"
FT   gene            557539..560331
FT                   /gene="levR"
FT                   /locus_tag="PPSC2_02430"
FT                   /old_locus_tag="PPSC2_c0474"
FT   CDS_pept        557539..560331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="levR"
FT                   /locus_tag="PPSC2_02430"
FT                   /old_locus_tag="PPSC2_c0474"
FT                   /product="PTS sugar transporter subunit IIA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54458"
FT                   /db_xref="GOA:E3EDA1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDA1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369098.1"
FT                   /protein_id="ADO54458.1"
FT                   /translation="MKRIDEILEYIANGTKKLSVEALQDGSGITAAEIADQHNMLRNNV
FT                   SKELNSLLRADLIIKIKGRPVKFLHKQVIEETFRVQLKEKQIQVNSIHEILLPGEQVDP
FT                   FHALIGFMGSMRNQVEQGKAAILYPPKGLHTLIVGQTGVGKTMFARLMYNYGKYMKRFS
FT                   EQAPFIVFNCADYYNNPQLLLSHIFGHVKGAFTGADREKEGLVEKADGGILFLDEIHRL
FT                   PPEGQEMIFYFMDTNSYNKLGESERKREANVLLIGATTEDPGSSMLKTFIRRIPITINI
FT                   PSLQERTVEERFLILKHLFANEAHRVNKPIRVELETVKALIGSVTYGNIGQLKSNIQLV
FT                   CAKGFLNSIHENKEEIELDFKILPGNIKEGLFNMGKNRKEIAEMEMVNSSLYITPEGSK
FT                   GMDEADASELPFNLYKLIEDKIGMLKEEGLDDSFINKFITTDVNIHIKSFYNRFYNIKG
FT                   GRERILKIVGRNILEFAEQVQEMAQKELNRNYSDRFVYAFSLHLSAFLKRIREKKYVSK
FT                   QIYDPMNDQDEEYRLALIIKDLIESKFEVNVPDAETTYVAILLKSVEEEHQGNVGIIVA
FT                   AHGNSTASSVVSVVDSLLGSSNICAVDMPLDVSPREILEVIVDKVKDIDNGRGVLLLVD
FT                   MGSLLNLEATIMERVGIKVKTIDMVSTPLVLEAVRKASIFDMNIEEIYQSLKDFRGYNT
FT                   GNAGVKAEKTSNKVIVTVCSSGKGAAAKLKEFVEKVVYDLTEEKIVVVPAKVRELDKVV
FT                   KDLRAKHTLLAVIGVKRPSELNVPFIPLEKLIEASGEQALRELLLNNQLPVMHEHGSVV
FT                   VRDLCEDTLKEFMTYLNPHKILGILMKFIEQLEQELEADFHYAKKVQLAVHTAHALERM
FT                   VIGEGLVYQEDVSLLDQRLIDVVNRSCNIFASSINIKLTNDEKYYICEILSEVYNCIPK
FT                   "
FT   gene            560531..560950
FT                   /gene="manX1"
FT                   /locus_tag="PPSC2_02435"
FT                   /old_locus_tag="PPSC2_c0475"
FT   CDS_pept        560531..560950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manX1"
FT                   /locus_tag="PPSC2_02435"
FT                   /old_locus_tag="PPSC2_c0475"
FT                   /product="PTS mannose transporter subunit IID"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54459"
FT                   /db_xref="GOA:E3EDA2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDA2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369099.1"
FT                   /protein_id="ADO54459.1"
FT                   /translation="MIGVIVGTHGKFSEEILRSTEMIFGHLENVVGVTFEPGESVNGLV
FT                   EKYKAALETIDWTDGLIFLVDLFGGSPYNAASRIVARYEKMDIVTGVNLPMIVDLLTNR
FT                   GLENVENLSDLAIRAGQDSMKSFRVIRDIQTEEEL"
FT   gene            560953..561441
FT                   /gene="manX3"
FT                   /locus_tag="PPSC2_02440"
FT                   /old_locus_tag="PPSC2_c0476"
FT   CDS_pept        560953..561441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manX3"
FT                   /locus_tag="PPSC2_02440"
FT                   /old_locus_tag="PPSC2_c0476"
FT                   /product="PTS friuctose transporter subunit IIB"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54460"
FT                   /db_xref="GOA:E3EDA3"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR018455"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDA3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428387.1"
FT                   /protein_id="ADO54460.1"
FT                   /translation="MEISFVRIDDRLIHGQVATVWVKETKCNKIIAVSNEVAADTLRKT
FT                   LLLQVAPPGIKAYVVTIAKAIEAYNNPKYNDFKTLFLFTNPTDVLRVVEGGVPFTSVNV
FT                   GGMCFKEGKTQITGAVSVDKQDVEAFYKLHEKGIELEIRKVASDPKINLINKLQNVQF"
FT   gene            561473..562243
FT                   /gene="sorA"
FT                   /locus_tag="PPSC2_02445"
FT                   /old_locus_tag="PPSC2_c0477"
FT   CDS_pept        561473..562243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sorA"
FT                   /locus_tag="PPSC2_02445"
FT                   /old_locus_tag="PPSC2_c0477"
FT                   /product="PTS mannose transporter subunit IIC"
FT                   /note="catalyzes the phosphorylation of incoming sugar
FT                   substrates concomitant with their translocation across the
FT                   cell membrane; the IIC domain forms the PTS system
FT                   translocation channel and contains the specific
FT                   substrate-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02445"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54461"
FT                   /db_xref="GOA:E3EDA4"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDA4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428388.1"
FT                   /protein_id="ADO54461.1"
FT                   /translation="MSVFEIVMVTLVAAICGMGSVLDEGQTHRPIVACTLIGLVLGDLK
FT                   TGIILGGTLELLALGWMNVGASMAPDAALASVVSTILVIVGHQSIGAGIAVAIPIAAGG
FT                   QVLTIFVRTITVFFQHLADKYAESSNFKGIELCHFIALLLQGLRVALPAVLVAIAAETG
FT                   LVTTLLDAIPEVITKGLQIAGGFIVVVGYAMVINMMAAKYLMPFFFLGFVIAAFTSINL
FT                   VGFGIMGAVLALLYIQLNPKYSQRKDQVGEIEEL"
FT   gene            562273..563097
FT                   /gene="manZ"
FT                   /locus_tag="PPSC2_02450"
FT                   /old_locus_tag="PPSC2_c0478"
FT   CDS_pept        562273..563097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manZ"
FT                   /locus_tag="PPSC2_02450"
FT                   /old_locus_tag="PPSC2_c0478"
FT                   /product="PTS mannose transporter subunit IID"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54462"
FT                   /db_xref="GOA:E3EDA5"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDA5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428389.1"
FT                   /protein_id="ADO54462.1"
FT                   /translation="MEEKKLTKSDLNKMFFRSWFLLGSFNFERMQSIGFCVTLIPAIKR
FT                   LYSKKEDQKEALKRHLEFFNTQPFISAPIMGVTAAMEEQKANGQPIDNATISGVKVGLM
FT                   GPLAGVGDPIFWGTLRPVLAALGASIALSGSVIGPVLFFLLFNVIRLATKWYGLKYGYQ
FT                   KGTEIVSDMSGNRLQKLTESASILGLFVMGALVSKWTTLNIPLEVSRYTRSDGVEVVTT
FT                   IQMILDQLIPGLLPLLLTFLCMRLLKKKVNAIALIFALFAIGIIGYALGVLA"
FT   gene            complement(563828..565630)
FT                   /gene="nplT"
FT                   /locus_tag="PPSC2_02455"
FT                   /old_locus_tag="PPSC2_c0479"
FT   CDS_pept        complement(563828..565630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nplT"
FT                   /locus_tag="PPSC2_02455"
FT                   /old_locus_tag="PPSC2_c0479"
FT                   /product="cyclomaltodextrinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02455"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54463"
FT                   /db_xref="GOA:E3EDA6"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDA6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369103.1"
FT                   /protein_id="ADO54463.1"
FT                   /translation="MLLEAIYHHPKRNWAFGYDDETIILRLRAKKNDLNSVHVLTVDKY
FT                   DWDRTRQLISMSKFATDGRFDYYECTVKPTHRRLKYGFLLEDDEERIWMNEDDFTTEEP
FT                   QNADSLFQYPFLNPIDILKPPAWVKDAVFYQIFPERFANGDPSISPEGAEDWGGTPQRD
FT                   NFFGGDLQGILDHLDHLNELGINAIYMTPVFKATTNHKYDTEDYMEVDPHFGDKKILKK
FT                   LVEACHDRGIRVLLDAVFNHSGRTFKPFVDVLKKGEASPYKDWFHVHSFPLEVVDGTPT
FT                   YDTFGLEPMMPKLNTEHPEVKEYLLNVAKHWIEEVGIDGWRLDVADEVDHAFWREFRTT
FT                   VKQANPEAYILGEMWNESSEWLQGDQFDATMNYPFTYAVNDFFVKKVTDAQSFAFAIGR
FT                   QLARYPQQASEVAFNLLDSHDTPRLLTLCGGDKRLMRLAALFQFTYMGAPCIFYGDEIG
FT                   LDGDADPGCRQCMEWDTDKQDHELFNFYRELIALRKAHPVLRDQGSITFLEAQPEGASL
FT                   AYERRSDEEVLLVLLNRSDEDHTFELSIPEQEWQLVFGESRWSVGAKGLHAELLPYGYA
FT                   VLKATPVRSVNSAKEVDDKMQSKA"
FT   gene            565781..566455
FT                   /gene="rcaC"
FT                   /locus_tag="PPSC2_02460"
FT                   /old_locus_tag="PPSC2_c0480"
FT   CDS_pept        565781..566455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcaC"
FT                   /locus_tag="PPSC2_02460"
FT                   /old_locus_tag="PPSC2_c0480"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54464"
FT                   /db_xref="GOA:E3EDA7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDA7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428482.1"
FT                   /protein_id="ADO54464.1"
FT                   /translation="MKTNVLYIEDDQDIGAWTHQYLEERKYAVTWLRSGDGAVEAARTC
FT                   QLVILDVMLPGLDGFTIGKRLKKEYPELPILMLSARTSIDDKLQGLDFADDYVTKPFHP
FT                   DELIARMEILLRRSGSVSEESLQLGHLSVFPPDNRIVNRDTGEEITLTGKQYHIFAYLL
FT                   RHLGQIMTKEQMYEAVWGDPYIDGDKTLMVHIRHLREKLEIDPATPRIIETIRGVGYRV
FT                   KA"
FT   gene            566455..567885
FT                   /gene="ybdK"
FT                   /locus_tag="PPSC2_02465"
FT                   /old_locus_tag="PPSC2_c0481"
FT   CDS_pept        566455..567885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="PPSC2_02465"
FT                   /old_locus_tag="PPSC2_c0481"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02465"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54465"
FT                   /db_xref="GOA:E3EDA8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDA8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017427210.1"
FT                   /protein_id="ADO54465.1"
FT                   /translation="MNGMRKRWTGLHLNSRPGQGGRFRNSLLFRYLVIIVFAMVLLPIV
FT                   LPVTTLIYSILLNLQTDIKPTNPYYPSTTHTENSWHREAIALKGANPEQVSAHLRKIQQ
FT                   NMFPDSQIFWVDTAGLTRLELPTQPNIPKQWSAAQAIAFMKQASYDGPFTVVAFIGGGK
FT                   DDVNQGYMVLKVPRSFFEQSSTDNGMLMYYLLFILLVLGAFIFVSLLFFGGIRRRLLQL
FT                   QAAMSQRGEDGLPILVATGRPDEIGKLEEAFNRMVEQLAESRGRERQEEELRKRLVADL
FT                   SHDIRTPLTVVRSHLYTLDAENLSSRGKQSITLMENKLKDLGSLIDNLLTYNLLSSGKY
FT                   TMNNEPRDILRLVRECAASWYPVWEKEGFEVDIDLPEHSMVWNVDEQGFRRLLDNLFQN
FT                   VVRHAASGRYIGIQVQKVNGREALVIADKGPGMERQSSEKGAGIGLAITELLAREMNLE
FT                   REICSSSAGTRICFLNKT"
FT   gene            567945..568862
FT                   /gene="bcrA1"
FT                   /locus_tag="PPSC2_02470"
FT                   /old_locus_tag="PPSC2_c0482"
FT   CDS_pept        567945..568862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcrA1"
FT                   /locus_tag="PPSC2_02470"
FT                   /old_locus_tag="PPSC2_c0482"
FT                   /product="bacitracin ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54466"
FT                   /db_xref="GOA:E3EDA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDA9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599420.1"
FT                   /protein_id="ADO54466.1"
FT                   /translation="MNESIIETNSLSKIYKGRAAVNQLDLKIARGDIYGFLGPNGAGKT
FT                   TTIRMLLGLIRPTRGTIRIFGKDIRRHRLDILRKVGSLVEYPSYYGHLNAVENLEAIRR
FT                   ILNVPKENIAEVLEVVRLTKHAKRPVKGYSLGMKQRLGIAAALLGNPEVLILDEPTNGL
FT                   DPEGIQEMRELIQAMPKQRGITVLVSSHLLSEVEHMANTVGIIREGQLVFQNTIHNLRQ
FT                   ESAGGIRIVVSEPEAAQLIAREQGYHSVKDGSALDFDNMNDAAVALLVRRLVENTHAVY
FT                   RVEERRKSLEDMFMQVVGKGGGSL"
FT   gene            568859..569575
FT                   /gene="bcrB1"
FT                   /locus_tag="PPSC2_02475"
FT                   /old_locus_tag="PPSC2_c0483"
FT   CDS_pept        568859..569575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcrB1"
FT                   /locus_tag="PPSC2_02475"
FT                   /old_locus_tag="PPSC2_c0483"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02475"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54467"
FT                   /db_xref="GOA:E3EDB0"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDB0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685947.1"
FT                   /protein_id="ADO54467.1"
FT                   /translation="MMLRALTADLLKARRKGIWFLVFLGPLGLVAMQGLNFGLRYDYLI
FT                   PRYKGRLWESLMDNIALFVPLALVLGATMVASMLANVEHTSNSWKQLLALPISKFSVYM
FT                   AKLTLAIGMLCVSCLLLTVGTWTLGMLLGFGGEPAPIGELLRLGFWPLGGTLPILVLLL
FT                   WLTVTFHNQALPVTLGITLGIGSLFASQLSEWFPLAWPQFAWVAPQAWVFASIGCATGI
FT                   ILSLLTAAHFSRKDVA"
FT   gene            569575..570303
FT                   /gene="mrsE1"
FT                   /locus_tag="PPSC2_02480"
FT                   /old_locus_tag="PPSC2_c0484"
FT   CDS_pept        569575..570303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrsE1"
FT                   /locus_tag="PPSC2_02480"
FT                   /old_locus_tag="PPSC2_c0484"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54468"
FT                   /db_xref="GOA:E3EDB1"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDB1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369108.1"
FT                   /protein_id="ADO54468.1"
FT                   /translation="MFGGYVRLLSVERLKMAKSPVWLLALVSPAIAVLVGLLANPGGNW
FT                   LLLLAAMLTIHAMLFLPMLTAVFGSLVCRFEHGGGGWKQLMSLPLSRTGLYAAKLTIIM
FT                   AMVGLTQLLFGGALLGVGAVQGMNGPIPWTVIAQSLLAGWVACLPLAALQLMVSFLWSS
FT                   FAAPLALNFVFTVPNMLIANSQTYAPYYPWVQPLLAMMPSGGDDFGAFMVPTDTLLMVV
FT                   LGSFVLFALAGLTIFRYKEI"
FT   gene            complement(570408..571364)
FT                   /gene="ldh1"
FT                   /locus_tag="PPSC2_02485"
FT                   /old_locus_tag="PPSC2_c0485"
FT   CDS_pept        complement(570408..571364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh1"
FT                   /locus_tag="PPSC2_02485"
FT                   /old_locus_tag="PPSC2_c0485"
FT                   /product="lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="Converts (S)-lactate and NAD(+) to pyruvate and
FT                   NADH"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02485"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54469"
FT                   /db_xref="GOA:E3EDB2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDB2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369109.1"
FT                   /protein_id="ADO54469.1"
FT                   /translation="MKGKARKVAIVGAGMVGSSCAYSMVNQSICDEIMMIDRTYDRALA
FT                   HALDLSHCMDFTSTRTKVRAGTYADCTDMDVVIITAGSNPKPGQDRLSVLDDAVHITRE
FT                   IVTAIMEGGFDGIFVIAANPVDIVTYLVQSISGLPRNKVIGTGTSIDSSRLKTLLSEVF
FT                   SIDPRSVQGYALGEHGESQFVAWSHVTIGGKPLLHILRQHKERFRHVDLDDIARKTRDA
FT                   GWEIFTRKGATYFGIANALAYITRSILNDDGKIIAISAVLDDEYGHTDVCTGVPAIIGS
FT                   RGIQEIIELELNPEEQAKFDASCRLISENIRAISDLV"
FT   gene            571903..572718
FT                   /gene="M1-624"
FT                   /locus_tag="PPSC2_02490"
FT                   /old_locus_tag="PPSC2_c0486"
FT   CDS_pept        571903..572718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-624"
FT                   /locus_tag="PPSC2_02490"
FT                   /old_locus_tag="PPSC2_c0486"
FT                   /product="M1-624"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54470"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDB3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369110.1"
FT                   /protein_id="ADO54470.1"
FT                   /translation="MEESKSTTEAAKQLGIGASTLRKYAAALEEQGYVFQRSANQSRMF
FT                   SAGDVDCLKVMRRALREQHMTMEQSVQVVLERITAPFQLEDEEFRLPPISDAESLTATW
FT                   QEIMAAAENREETVVQEQAAATVELTELEDEMSVQELSEEPMQPQEQLQTLTSAIEYRL
FT                   EQAPVSVQTQESVEPQELAQMQDMVQTALSEMRSRLEELEAEHSRLVEKNVSLSNQLED
FT                   HKRWMKERVEEERDRQLITNLRTYQGRQRKTRSSLLSWLGLTPRSRREA"
FT   gene            572864..573691
FT                   /gene="ybdM"
FT                   /locus_tag="PPSC2_02495"
FT                   /old_locus_tag="PPSC2_c0487"
FT   CDS_pept        572864..573691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="PPSC2_02495"
FT                   /old_locus_tag="PPSC2_c0487"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02495"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54471"
FT                   /db_xref="GOA:E3EDZ1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDZ1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369111.1"
FT                   /protein_id="ADO54471.1"
FT                   /translation="MFAWLRNIYESWMDYPKQPGDLLSGRYCVRSLLGMGSYGLTYLCL
FT                   DRHSGQEVAVKLPRPSKRAQAVQLLQREAHIMRQMEHPYIPKLLENDIHSDEMYMVMEY
FT                   VSGMTLEELIFEQERSFTEQECIVYILELMERVLHVHERGYIHRDIRIPNVIHREGMPY
FT                   LIDFGLALAVGERQEDVFTEAMLEKRAPERQDVAFYSDLYDIGHFMLFMLYSSYEPQPD
FT                   QPPGSWQEELVLSQPVRHILERLFQIRPRYENSRQFMQELEEALLLLEVNPEW"
FT   gene            complement(574373..575920)
FT                   /gene="gntK1"
FT                   /locus_tag="PPSC2_02500"
FT                   /old_locus_tag="PPSC2_c0490"
FT   CDS_pept        complement(574373..575920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntK1"
FT                   /locus_tag="PPSC2_02500"
FT                   /old_locus_tag="PPSC2_c0490"
FT                   /product="gluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54474"
FT                   /db_xref="GOA:E3EDZ4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006002"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDZ4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369114.1"
FT                   /protein_id="ADO54474.1"
FT                   /translation="MTETRYMIGVDIGTTSTKAVLFEENGNIAAQHHVGYPLHTPEPDA
FT                   AEQDPEDIFKAVVATVQEVMTQSGVPAEHVLFVSFSSAMHSVLAVDKNGKPLTASITWA
FT                   DNRSAKWAEALKHKYNGHDIYLRTGTPIHPMSPLTKLMWITRDLPDVAAQTYKFISIKE
FT                   YVFARLFHQYVVDHSIASATGLMNLKQLDWDEEALTIAGVTKEQLSELVPTTHVLKGLD
FT                   AAYAHDMGLLETTPFVIGASDGVLSNLGVNAIKPGVVAVTIGTSGAIRTVVDKPLTDAK
FT                   GRFFCYALTEKLWVIGGPVNNGGIVFRWIRDEFAASEVETAKRLGIDPYHVLTQIAEQV
FT                   RPGSDGLLFLPYLSGERAPLWDPNARGSFFGLSLRHKKEHMIRAALEGVLFNLYTVMLA
FT                   MEEVIDRPSVIHATGGFARSELWRQLMADIFDQEVIIPESLESSCLGAAILGLYALGRI
FT                   DSLDAVSGMIGTTHQHKPAAEHVDIYRDLLPIYIRISRKFEEEFKDIAEFQAKSLQF"
FT   gene            complement(576160..576855)
FT                   /gene="gntR3"
FT                   /locus_tag="PPSC2_02505"
FT                   /old_locus_tag="PPSC2_c0492"
FT   CDS_pept        complement(576160..576855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR3"
FT                   /locus_tag="PPSC2_02505"
FT                   /old_locus_tag="PPSC2_c0492"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54476"
FT                   /db_xref="GOA:E3EDZ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDZ6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016818810.1"
FT                   /protein_id="ADO54476.1"
FT                   /translation="MKYPTTWLQGASLGERIACELRLQIIRGMQTPGTVLSENQIATDF
FT                   GTSRSPVREAMKVLSGEGLIRLERMGAVVIGMTPGDMEELFDVRMLIEHFVVQRYVHRD
FT                   NTILVTTLNQMIDKMEVALKHRDIAEFSLQDFNFHEALVLEAGHTRILHTWNGMRQLIL
FT                   TVMLAATEQRFASNIEESQVTIRKHRTFANALNQANAQELSRLIDEHYRDTRNAVNDSV
FT                   LSSYRKTLS"
FT   gene            577048..577794
FT                   /gene="map1"
FT                   /locus_tag="PPSC2_02510"
FT                   /old_locus_tag="PPSC2_c0493"
FT   CDS_pept        577048..577794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map1"
FT                   /locus_tag="PPSC2_02510"
FT                   /old_locus_tag="PPSC2_c0493"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="'catalyzes the removal of N-terminal amino acids
FT                   from peptides and arylamides; generally Co(II) however
FT                   activity has been shown for some methionine aminopeptidases
FT                   with Zn, Fe, or Mn'"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54477"
FT                   /db_xref="GOA:E3EDZ7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDZ7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428495.1"
FT                   /protein_id="ADO54477.1"
FT                   /translation="MIIIKTKEQIENMKKAGEILAACHREIAKMIKPGITTLEIDAFAE
FT                   SFMKKHGATPEQKGYNGYQFATCGSPNDVICHGFPNKTPLKDGDIVTIDMVVNLNGWLA
FT                   DSAWSYAVGNVSEQAQKLLDVTKESLYKGIEQAVVGNRIGDISHAIQTYAEAEGFSVVR
FT                   EFIGHGIGEEMHEQPQVPHYGPPHRGPRLKEGMVITIEPMLNTGTYRSKIDADGWTART
FT                   LDGGLSAQYEHTLAITADGPIILTQQ"
FT   gene            578911..580469
FT                   /locus_tag="PPSC2_02515"
FT                   /old_locus_tag="PPSC2_r016"
FT   rRNA            578911..580469
FT                   /locus_tag="PPSC2_02515"
FT                   /old_locus_tag="PPSC2_r016"
FT                   /product="16S ribosomal RNA"
FT   gene            580677..583607
FT                   /locus_tag="PPSC2_02520"
FT                   /old_locus_tag="PPSC2_r017"
FT   rRNA            580677..583607
FT                   /locus_tag="PPSC2_02520"
FT                   /old_locus_tag="PPSC2_r017"
FT                   /product="23S ribosomal RNA"
FT   gene            583684..583800
FT                   /locus_tag="PPSC2_02525"
FT                   /old_locus_tag="PPSC2_r018"
FT   rRNA            583684..583800
FT                   /locus_tag="PPSC2_02525"
FT                   /old_locus_tag="PPSC2_r018"
FT                   /product="5S ribosomal RNA"
FT   gene            583883..583958
FT                   /locus_tag="PPSC2_02530"
FT                   /old_locus_tag="PPSC2_ct034"
FT   tRNA            583883..583958
FT                   /locus_tag="PPSC2_02530"
FT                   /old_locus_tag="PPSC2_ct034"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:583916..583918,aa:Ala,seq:tgc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            583963..584038
FT                   /locus_tag="PPSC2_02535"
FT                   /old_locus_tag="PPSC2_ct035"
FT   tRNA            583963..584038
FT                   /locus_tag="PPSC2_02535"
FT                   /old_locus_tag="PPSC2_ct035"
FT                   /product="tRNA-Asn"
FT                   /anticodon="(pos:583996..583998,aa:Asn,seq:gtt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            584042..584133
FT                   /locus_tag="PPSC2_02540"
FT                   /old_locus_tag="PPSC2_ct036"
FT   tRNA            584042..584133
FT                   /locus_tag="PPSC2_02540"
FT                   /old_locus_tag="PPSC2_ct036"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:584077..584079,aa:Ser,seq:gga)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            584153..584224
FT                   /locus_tag="PPSC2_02545"
FT                   /old_locus_tag="PPSC2_ct037"
FT   tRNA            584153..584224
FT                   /locus_tag="PPSC2_02545"
FT                   /old_locus_tag="PPSC2_ct037"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:584186..584188,aa:Glu,seq:ttc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            584234..584309
FT                   /locus_tag="PPSC2_02550"
FT                   /old_locus_tag="PPSC2_ct038"
FT   tRNA            584234..584309
FT                   /locus_tag="PPSC2_02550"
FT                   /old_locus_tag="PPSC2_ct038"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:584267..584269,aa:Val,seq:tac)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            584339..584412
FT                   /locus_tag="PPSC2_02555"
FT                   /old_locus_tag="PPSC2_ct039"
FT   tRNA            584339..584412
FT                   /locus_tag="PPSC2_02555"
FT                   /old_locus_tag="PPSC2_ct039"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:584373..584375,aa:Met,seq:cat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            584438..584514
FT                   /locus_tag="PPSC2_02560"
FT                   /old_locus_tag="PPSC2_ct040"
FT   tRNA            584438..584514
FT                   /locus_tag="PPSC2_02560"
FT                   /old_locus_tag="PPSC2_ct040"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:584472..584474,aa:Asp,seq:gtc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            584528..584603
FT                   /locus_tag="PPSC2_02565"
FT                   /old_locus_tag="PPSC2_ct041"
FT   tRNA            584528..584603
FT                   /locus_tag="PPSC2_02565"
FT                   /old_locus_tag="PPSC2_ct041"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:584561..584563,aa:Thr,seq:tgt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            584608..584693
FT                   /locus_tag="PPSC2_02570"
FT                   /old_locus_tag="PPSC2_ct042"
FT   tRNA            584608..584693
FT                   /locus_tag="PPSC2_02570"
FT                   /old_locus_tag="PPSC2_ct042"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:584642..584644,aa:Tyr,seq:gta)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            584796..584870
FT                   /locus_tag="PPSC2_02575"
FT                   /old_locus_tag="PPSC2_ct043"
FT   tRNA            584796..584870
FT                   /locus_tag="PPSC2_02575"
FT                   /old_locus_tag="PPSC2_ct043"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:584828..584830,aa:Gln,seq:ttg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            584875..584950
FT                   /locus_tag="PPSC2_02580"
FT                   /old_locus_tag="PPSC2_ct044"
FT   tRNA            584875..584950
FT                   /locus_tag="PPSC2_02580"
FT                   /old_locus_tag="PPSC2_ct044"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:584908..584910,aa:Lys,seq:ttt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            584963..585043
FT                   /locus_tag="PPSC2_02585"
FT                   /old_locus_tag="PPSC2_ct045"
FT   tRNA            584963..585043
FT                   /locus_tag="PPSC2_02585"
FT                   /old_locus_tag="PPSC2_ct045"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:584997..584999,aa:Leu,seq:tag)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            585054..585128
FT                   /locus_tag="PPSC2_02590"
FT                   /old_locus_tag="PPSC2_ct046"
FT   tRNA            585054..585128
FT                   /locus_tag="PPSC2_02590"
FT                   /old_locus_tag="PPSC2_ct046"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:585086..585088,aa:Gly,seq:gcc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            585134..585210
FT                   /locus_tag="PPSC2_02595"
FT                   /old_locus_tag="PPSC2_ct047"
FT   tRNA            585134..585210
FT                   /locus_tag="PPSC2_02595"
FT                   /old_locus_tag="PPSC2_ct047"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:585168..585170,aa:Arg,seq:acg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            585223..585302
FT                   /locus_tag="PPSC2_02600"
FT                   /old_locus_tag="PPSC2_ct048"
FT   tRNA            585223..585302
FT                   /locus_tag="PPSC2_02600"
FT                   /old_locus_tag="PPSC2_ct048"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:585257..585259,aa:Leu,seq:caa)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            585310..585386
FT                   /locus_tag="PPSC2_02605"
FT                   /old_locus_tag="PPSC2_ct049"
FT   tRNA            585310..585386
FT                   /locus_tag="PPSC2_02605"
FT                   /old_locus_tag="PPSC2_ct049"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:585344..585346,aa:Pro,seq:tgg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            585394..585464
FT                   /locus_tag="PPSC2_02610"
FT                   /old_locus_tag="PPSC2_ct050"
FT   tRNA            585394..585464
FT                   /locus_tag="PPSC2_02610"
FT                   /old_locus_tag="PPSC2_ct050"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:585426..585428,aa:Gly,seq:tcc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            586598..587560
FT                   /gene="ydhT1"
FT                   /locus_tag="PPSC2_02615"
FT                   /old_locus_tag="PPSC2_c0494"
FT   CDS_pept        586598..587560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhT1"
FT                   /locus_tag="PPSC2_02615"
FT                   /old_locus_tag="PPSC2_c0494"
FT                   /product="glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02615"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54478"
FT                   /db_xref="GOA:E3EDZ8"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDZ8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369118.1"
FT                   /protein_id="ADO54478.1"
FT                   /translation="MNSFKKTKSLISALTGAALLFSLPITAGAESNINYTGMFLGYDGS
FT                   VNTSPVWTYNPDIVSYDLLNWNQGGTDAASITSNSASVIQDLGKIVTVSTHMPNPQGGN
FT                   VNAPMSDSDFNILANTDISSINSSSPAWLQNYKAQVDNVVTGLQKFNSSPVYYRPFHEM
FT                   NGGWFWWGNKNTTDYKNLYINLYNYIVTTNGMSNVNFVYAPNKGANAAAYYPGSSYVTW
FT                   IGIDAYSDDPSNDNEIKVAYNDIKGLGKTYGFCEIGPAVGGDHVDRNNNQLKEFDYSLW
FT                   NNALNEVYTGASFFITWDGAYAPQNNTNGSVLFTKESSQ"
FT   gene            complement(587791..588288)
FT                   /gene="ccdC3"
FT                   /locus_tag="PPSC2_02620"
FT                   /old_locus_tag="PPSC2_c0495"
FT   CDS_pept        complement(587791..588288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdC3"
FT                   /locus_tag="PPSC2_02620"
FT                   /old_locus_tag="PPSC2_c0495"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54479"
FT                   /db_xref="GOA:E3EDZ9"
FT                   /db_xref="InterPro:IPR009916"
FT                   /db_xref="InterPro:IPR031306"
FT                   /db_xref="UniProtKB/TrEMBL:E3EDZ9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369119.1"
FT                   /protein_id="ADO54479.1"
FT                   /translation="MFHISTPLLQYGATFGMILIAISAIFIRMKTGHRPINAKKIIIPP
FT                   LGMSTGFMMFVVPEVRVPWLWALGAFLIGWFIFSYPLIRSTKFELQEGLVFVQRSRTFF
FT                   FILISLLIVRLLLHEFIQHYITIPQTAGLFFILAFGTLLHWRLRMYFQYRQFIPEETEV
FT                   RI"
FT   gene            complement(588453..588929)
FT                   /gene="dsbB"
FT                   /locus_tag="PPSC2_02625"
FT                   /old_locus_tag="PPSC2_c0496"
FT   CDS_pept        complement(588453..588929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="PPSC2_02625"
FT                   /old_locus_tag="PPSC2_c0496"
FT                   /product="disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02625"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54480"
FT                   /db_xref="GOA:E3EE00"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE00"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369120.1"
FT                   /protein_id="ADO54480.1"
FT                   /translation="MIGSFKKTDIALFAAWVVACVATLGSLYLSEILGYEPCKLCWFQR
FT                   ILMYPLTLLLGIAYFRGDTKIRIYVMPLAVIGGAISAYHFIIQRIHAAAKAATQTSTAC
FT                   GRVSCEQDYLNWLDFITIPFLALIAFILIIAAMVYIMRQEKKSAAGEVQAQELA"
FT   gene            589160..589786
FT                   /gene="yodC"
FT                   /locus_tag="PPSC2_02630"
FT                   /old_locus_tag="PPSC2_c0497"
FT   CDS_pept        589160..589786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yodC"
FT                   /locus_tag="PPSC2_02630"
FT                   /old_locus_tag="PPSC2_c0497"
FT                   /product="NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54481"
FT                   /db_xref="GOA:E3EE01"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE01"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428498.1"
FT                   /protein_id="ADO54481.1"
FT                   /translation="MSSSRKNETLSVISERHAVKSYVKDFKMPEEDLEAILTAAVEAPS
FT                   AWNLQHWKFLVIESEADKQKLLPIAYNQGQVAESSVTIAVLGDLEANRNAVIYDQAVEA
FT                   GALPAEIRDALVGQINGAYQNPQVARDAAILNSALAAQNIMLAAKSLGYDTCAMGGFIP
FT                   AQLIEQFNIPARYLPTMLISVGKAQVPARPSGRFPLSDVVVKGSF"
FT   gene            complement(589892..592534)
FT                   /gene="mprF"
FT                   /locus_tag="PPSC2_02635"
FT                   /old_locus_tag="PPSC2_c0498"
FT   CDS_pept        complement(589892..592534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mprF"
FT                   /locus_tag="PPSC2_02635"
FT                   /old_locus_tag="PPSC2_c0498"
FT                   /product="lysyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02635"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54482"
FT                   /db_xref="GOA:E3EE02"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE02"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369122.1"
FT                   /protein_id="ADO54482.1"
FT                   /translation="MNSNHKPFQSFKIVQYMMTIYRQRLTRILLPLAVLAFIIWEAGRE
FT                   LKDFNLARMLHELRRMDATFLIEIGLFSLVAVAAMSAYDYVIRHHFKLQVKPGTTFRYA
FT                   WISNTFNNVFGFAGFTGAGLRTVLYKKSGVPLGVITSAVVFLSPVVITGLSLLAWGAIV
FT                   HLYPVQPVLDAHPWLHWALWGMALYLPLFLIMQRSKRYATWFNKGEGQLSWFTISASIG
FT                   ASLLEWLLAGLTFAWIGSHLLHELPLHAVFGIYVIAAIAGLISLAPGGVGAFDIIALLG
FT                   LQMAGANSDRALAVLLVFRVFYYIIPWLIGLVLAALEMIPRNERLSQLAETGWDYSLNA
FT                   WQKVWGWPGQFRFLADLGVWALGKLVLISGVVLLLSAATPGLLYRLRFAEHLLSLPVMR
FT                   LSHEISVIIGIMLVVLSHGISLRIRRALRLTLILLLTGAIFTFTKGLDFEEAFFLLFVA
FT                   LMLWISRSRFYRVSAPLNRHNILIWGGLSLLVTGAYFMIGAGSNTPFMRHIHAKVHLDF
FT                   FMNRSDYGVTAVFSLILAWVFLTVYFFLRPQRSISNLPDAQELVKLKEFLERQGGNLVS
FT                   HMLFLGDKYLYWTKDEQVVLPYARSRDKLIVLGDPLGPKERVSEAIQEFQRFADRYALT
FT                   AVFYQASPEYLSIYHENGYRFFKLGEEALVPLESFTLTGKSNQALRSAKNRFDREGYSF
FT                   EMVQPPLEASLIEEMRHISDIWLDGRKEKGYSLGWFKESYLQLAPIALLRDSEGKVIAF
FT                   ATMAPAYDHGQTVSIDLMRHLPDTPNGTMDYLFTRVIEWAKESGYTTFNLGMAPLSQVG
FT                   QSEKALREEKLARLVFQYGGHFYGFQGLRRFKDKFKPQWEPRYLAYPASVFLPILTLEL
FT                   VYLVSKRSD"
FT   gene            592746..593507
FT                   /gene="cysA1"
FT                   /locus_tag="PPSC2_02640"
FT                   /old_locus_tag="PPSC2_c0499"
FT   CDS_pept        592746..593507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA1"
FT                   /locus_tag="PPSC2_02640"
FT                   /old_locus_tag="PPSC2_c0499"
FT                   /product="ATPase AAA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54483"
FT                   /db_xref="GOA:E3EE03"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE03"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685961.1"
FT                   /protein_id="ADO54483.1"
FT                   /translation="MSIWDRNLFIRRLELLWPPDADRSQYPFNLKALQQWNELKFHPSV
FT                   TYIVGENGVGKSTLMEAIAVAWGFNPEGGTKNFNFSTQATHSSLHEHIRLVRGVEKPRD
FT                   GFFFRAESYYNVATHIDELDREGGGRPIRDSYGGKSLHEQSHGESFFAAFVHRFGGQGL
FT                   YILDEPEAALSPLRQMAMLARIHELVQQGSQFIISTHSPILMSYPDSVLYHLTHEGIDT
FT                   RTLEETDHFIITKQFLNNKERLLQELFEDSP"
FT   gene            593555..594073
FT                   /gene="M1-637"
FT                   /locus_tag="PPSC2_02645"
FT                   /old_locus_tag="PPSC2_c0500"
FT   CDS_pept        593555..594073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-637"
FT                   /locus_tag="PPSC2_02645"
FT                   /old_locus_tag="PPSC2_c0500"
FT                   /product="M1-637"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02645"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54484"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE04"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685962.1"
FT                   /protein_id="ADO54484.1"
FT                   /translation="MSSNLDVVIQRISAFKVAALTARAPFAELGDEVRRQWQQVQQNVP
FT                   ENHSGRLNADMGYVLTPQWTVVEENGSTAVKVGVKVSSWNEVPDSLERIEVPEGEYAVT
FT                   RFQGDRERLNTIYDDLFAWLDCNGYERNTTEGVYWIESNRLKPVNPFDIPSAEIQKFDY
FT                   DIAIAIVQK"
FT   gene            594220..595422
FT                   /gene="blt1"
FT                   /locus_tag="PPSC2_02650"
FT                   /old_locus_tag="PPSC2_c0501"
FT   CDS_pept        594220..595422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blt1"
FT                   /locus_tag="PPSC2_02650"
FT                   /old_locus_tag="PPSC2_c0501"
FT                   /product="multidrug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54485"
FT                   /db_xref="GOA:E3EE05"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE05"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308507.1"
FT                   /protein_id="ADO54485.1"
FT                   /translation="MSDSQQLKMGPLVILMINMFIAMLGIGLIIPILPKFMGSLGGSGE
FT                   TGGYLVAVFGLTQFIFSPLAGEWSDKYGRKKMIIIGLVIMTVSSVLFAIGHSLTMLYIS
FT                   RLLGGAGAAFMIPPMMAYIADITTVHNRGRGMGLLGAAMSLGFVIGPGVGGLLADISLR
FT                   TPLYVSAAVSGLAALISLILLPETLSLEKQLKFRNVKVKRDNVIKQFALSFRKPYFMLL
FT                   IMIFTLTFGLTHFETMFPFFVTGKFHYNERDIAIIITVGALVGTIIQAVVISPMLNRFG
FT                   EKGVIIGSFLFSAISLVLMLLSGNFYYVLGVSLIFFTATSLLRPAINTALSKMAGDEQG
FT                   VAAGMNNAYMSIGNILGPALAGTLFEVHINLPYIFGAVILMLSLGLAVKWKSRDTQSTA
FT                   V"
FT   gene            595647..596699
FT                   /gene="ykgB1"
FT                   /locus_tag="PPSC2_02655"
FT                   /old_locus_tag="PPSC2_c0502"
FT   CDS_pept        595647..596699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgB1"
FT                   /locus_tag="PPSC2_02655"
FT                   /old_locus_tag="PPSC2_c0502"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02655"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54486"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE06"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369126.1"
FT                   /protein_id="ADO54486.1"
FT                   /translation="MKERNEQLFYIGTYASREERGIYIGSLHTDNGDLRMVGGVEGIER
FT                   PSFLALHPNGAKLYAASETDQGELYTYQVNNQTGELHPLDRKGTEGAHTCYVSVTTDGR
FT                   YVLASNYSGGNAVVFPATVAGGLGDMSGQVQHTGSGIRQDRQDTPHPHSIIPDPSGQYA
FT                   MVCDLGLDQIIGYRLTEDGKLVTHRETDLPPGSGPRHLVFHPSGRYAFVANELNNTVTV
FT                   FGYNERNGKLTLLQSLSTLPEGIIDVENTAADIRITPCGRFLYVSNRGHDSIVLYHVDL
FT                   DSGKLKTIEWVETFGSTARNFNILSGYLLVANQEGNNVVSFAIHGDDGRLTRTGYVLEV
FT                   PSPVCIEPVR"
FT   gene            complement(596820..597776)
FT                   /gene="M1-640"
FT                   /locus_tag="PPSC2_02660"
FT                   /old_locus_tag="PPSC2_c0503"
FT   CDS_pept        complement(596820..597776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-640"
FT                   /locus_tag="PPSC2_02660"
FT                   /old_locus_tag="PPSC2_c0503"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54487"
FT                   /db_xref="GOA:E3EE07"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016943"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE07"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369127.1"
FT                   /protein_id="ADO54487.1"
FT                   /translation="MQLDISEKSLPVYEALASEVRLNMIVLLAEKPMNIRELAEALGLS
FT                   SAIMTMHVKKLERASIISTKMLPGRGGVQKVCSLATDKIEIAMPRYQQDVRQFHQTEIS
FT                   VGHFTDFEIQATCGLATVEKIIGEFDEPRSFLDPERFNSKILWFSQGYMDYKVPNFLLS
FT                   SQKAEELEISMELSSEAPFTNDNWPSDITFFLNDVNLGTWTSPGDFGDNRGKYTPSWWP
FT                   DFINQYGLLKRLRVTSEGTFMDGKQISDVTLSDVLIDQKQWKFRIAILDDAQHVGGVTL
FT                   FGTGFGNYNQDILFRLYYKPAENHTKTATVEAGDSSK"
FT   gene            complement(598052..599020)
FT                   /gene="M1-641"
FT                   /locus_tag="PPSC2_02665"
FT                   /old_locus_tag="PPSC2_c0504"
FT   CDS_pept        complement(598052..599020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-641"
FT                   /locus_tag="PPSC2_02665"
FT                   /old_locus_tag="PPSC2_c0504"
FT                   /product="M1-641"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54488"
FT                   /db_xref="GOA:E3EE08"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE08"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017428079.1"
FT                   /protein_id="ADO54488.1"
FT                   /translation="MSPTDFAALVAYISPGLIAFLLALSLLVWLYVHSAAQLRNSRQQR
FT                   LEELQESLRIYGRLAGYLQTATQNAINNSEKQQHQHGLIHALQEAKAAPYLTPHLQEQV
FT                   QASLRECDPFRRELLLKSLEREMNKLIEERRLVLLESHAPGWGTALWKLLRPAAGPLTL
FT                   AGIVWLTSRLVVELMTYSHVDVSLPDTTQSVSWLIGYAWIRFVSGLIALLYVYRLMTLR
FT                   RQNDLDVTASHFPTSLLCMVIAVVALFQWLGPEASPYILAAQLVLFLIGFRLTRGRSRS
FT                   DRPYVGHPSLMKADASQHQELHATDKDTTADSSLADEHMRS"
FT   gene            599224..599637
FT                   /gene="M1-642"
FT                   /locus_tag="PPSC2_02670"
FT                   /old_locus_tag="PPSC2_c0505"
FT   CDS_pept        599224..599637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-642"
FT                   /locus_tag="PPSC2_02670"
FT                   /old_locus_tag="PPSC2_c0505"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54489"
FT                   /db_xref="GOA:E3EE09"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE09"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369129.1"
FT                   /protein_id="ADO54489.2"
FT                   /translation="MLRVDYAIPAVEEYQALRKEAGLSQITEEAAAKGLPNSLFAVTLR
FT                   LGQELIGMGRVSGDGGVFFLVTDIAVKPSHQGKGYGRKLMEEIMEYLKREVPAGSFATL
FT                   IADKPADRLYAQFGFQLVSPRSEGMYWRQPGEL"
FT   gene            599723..600355
FT                   /gene="M1-643"
FT                   /locus_tag="PPSC2_02675"
FT                   /old_locus_tag="PPSC2_c0506"
FT   CDS_pept        599723..600355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-643"
FT                   /locus_tag="PPSC2_02675"
FT                   /old_locus_tag="PPSC2_c0506"
FT                   /product="3-beta hydroxysteroid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02675"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54490"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE10"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010347740.1"
FT                   /protein_id="ADO54490.1"
FT                   /translation="MKVIIFGATGTIGKALVKEAIKRKYEVTAAVRDPQRVTEQNEYLT
FT                   VVQADILNPNSVTEVAKGHDAIISAYGPKFGAEEELLEATRSLLEGTRRSGAERILVVG
FT                   GAGSLKTENGERLMDTAEFPEEVKPLAAAHADALELYRAADVDWTYCSPAGIIEPGKRT
FT                   GQFRIGLDHLVVDELGHSRISVEDYAVALIDELVEGEFVNSRFTVGY"
FT   gene            600389..602029
FT                   /gene="yjeF"
FT                   /locus_tag="PPSC2_02680"
FT                   /old_locus_tag="PPSC2_c0507"
FT   CDS_pept        600389..602029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeF"
FT                   /locus_tag="PPSC2_02680"
FT                   /old_locus_tag="PPSC2_c0507"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54491"
FT                   /db_xref="GOA:E3EE11"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE11"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369131.1"
FT                   /protein_id="ADO54491.1"
FT                   /translation="MYMVTAEQMRQLDRYTIDKLGIPALTLMENAGRAVADEVLKLCAE
FT                   RRGKSGGINEVTHTGAGDVPEHGSVIRTDSSSRGRYDVCERAHWYILVGKGNNGGDGLV
FT                   AARHLTDAGLRVTVVYAEPPETLRGEVAAQRDIIAALDIPVILYGWDNLELHGASGIVD
FT                   ALLGTGTQGPPREPYASLIREANASGAPIVSVDVPSGLDADTGALHEPCIHARVTVCLA
FT                   YLKCGLAQYPGAGNAGDVVVRYIGIPPSLAREHGVQLQLLTSATLRDALDVDVSRSRVP
FT                   DGHKGTYGHVLVAAGSLRMSGAGLLAARAALRIGSGLVTWAVPEALLPRVIGAAPELML
FT                   AAAATGGDGEWNADSAAELLQLAQARDVLAVGPGLGRFAGDTGWLRRLWEEYSGPLVLD
FT                   ADALNILASAELDAWKSRDAAVVLTPHPGEMARLLGIPTAEVQRDRISHAREYARTRGV
FT                   TLVLKGARTVIACPDGNAYVNTTGHAGMATGGAGDVLTGIIAGLLAQGLNASQAAAFGV
FT                   YLHGAAGETAARQRQHPASVVAGDIIEAL"
FT   gene            complement(602013..602507)
FT                   /gene="M1-645"
FT                   /locus_tag="PPSC2_02685"
FT                   /old_locus_tag="PPSC2_c0508"
FT   CDS_pept        complement(602013..602507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-645"
FT                   /locus_tag="PPSC2_02685"
FT                   /old_locus_tag="PPSC2_c0508"
FT                   /product="M1-645"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02685"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54492"
FT                   /db_xref="GOA:E3EE12"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE12"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016819446.1"
FT                   /protein_id="ADO54492.1"
FT                   /translation="MRQPWNEFNSKMPWRMELGCYALNKLACGGLVFGLLWVYCYLTEE
FT                   ITGLPVSIAGNSGELTAQLWAYGFALPAALAADALRDLLPWLRKPEQFTLYLAVGSSVF
FT                   LLLGSLMSPAGTGISWSNGIAGAGITLLYYGGRHWLNREYGVQIMLAFLLPLLLWIIGL
FT                   Q"
FT   gene            602678..603514
FT                   /gene="phnX"
FT                   /locus_tag="PPSC2_02690"
FT                   /old_locus_tag="PPSC2_c0509"
FT   CDS_pept        602678..603514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnX"
FT                   /locus_tag="PPSC2_02690"
FT                   /old_locus_tag="PPSC2_c0509"
FT                   /product="phosphonoacetaldehyde hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54493"
FT                   /db_xref="GOA:E3EE13"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE13"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369133.1"
FT                   /protein_id="ADO54493.1"
FT                   /translation="MIQAVIFNLESTLLDPGGRGLIQGMCDIFRWKGIQVTEEQVSHGR
FT                   GLPIRDHIANVLGLSEVRRKWLECFGAHPGRMDIEHIYLELVPVLRSLIQGAETATGID
FT                   RALQELQDRRIQSGATASCPMEMLSHVFTPAQSPYTLDCMVAPCEVSQGRPYPWMIYEI
FT                   AHRLQVFPLSDIVKVGDTAADMQEGRNAGVWTIGVLNHNESALTPDHTTSCETDDRVSE
FT                   ERRRQSIYGLKRAGAHIVMNSVADLPRILREIEMLQHTGGYPSYMKPMKTAAAPPS"
FT   gene            complement(603742..605496)
FT                   /gene="tse"
FT                   /locus_tag="PPSC2_02695"
FT                   /old_locus_tag="PPSC2_c0510"
FT   CDS_pept        complement(603742..605496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tse"
FT                   /locus_tag="PPSC2_02695"
FT                   /old_locus_tag="PPSC2_c0510"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02695"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54494"
FT                   /db_xref="GOA:E3EE14"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE14"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016819448.1"
FT                   /protein_id="ADO54494.1"
FT                   /translation="MKSKVKKRMGLQSKLYFILLIPLVVIGVMILWTTKLSIQNASLST
FT                   MQLNNEALAVNTAKLLDKSAVKSLNTNPSEQSSEYKELRNELNTLRLQSGVLYMYMYNR
FT                   VGDEWKLTVDGAAWDDKDYSPFGSPVSFTRKETADRLKQGETVTTDITTDPDWGTMFSS
FT                   FTPIKDTDGTIIGYLGIDRSLASVTEVYEKTLPEAYRLVIPVVSIILIISIAAMVLVTR
FT                   RILRQVRFIKNTLEQVADGNLTVTSQQVTYDQLGEISGLTNRMVEAMSNMIVDIQSSSS
FT                   TLQQASENIVVTTEGTLHQTEELSRTLQQIADVSTNQADQTLESVQQSDRLGQTLDEVG
FT                   SHVHQFTDTARHLNKVRNQVASEHEQLLEKGRESALRIKQMQRMSHALTEKSREAANIG
FT                   QQVQGIVKQTQILSFNASIEASRAGEAGKGFSVVAHEMGQLAQQSAMSIREIDQILSSF
FT                   VEQIEQMGDQFDQNINTVNEQEKQIALCLQSVDKVTQVSEEVQELAAHLAQLTTEMHEV
FT                   RHSVDQHLNHTASAAQQTAGMTEDVSASAQKQALAVKELSAVARNLTTLSNNLQRHADQ
FT                   FRVKSSDQ"
FT   gene            complement(605668..606699)
FT                   /gene="nrdB"
FT                   /locus_tag="PPSC2_02700"
FT                   /old_locus_tag="PPSC2_c0511"
FT   CDS_pept        complement(605668..606699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="PPSC2_02700"
FT                   /old_locus_tag="PPSC2_c0511"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54495"
FT                   /db_xref="GOA:E3EE15"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE15"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308516.1"
FT                   /protein_id="ADO54495.1"
FT                   /translation="MQLQKIFNTEAPNRSTRIIEGENSGILNWNDIRMPHMYKLYKVLL
FT                   LNHWIPDEIPMSKDASQFPMLDAEEQRTFKINIGLLAVLDSMQTMFVGDVKRYFTDSSL
FT                   EAISAIIGQQEVVHNQSYSYVLSSLVSEQEQKEIFEYWKNDPVLLERNTFISAIYQEFR
FT                   DEQNPQTFFQAMVADLILEGIFFYSTFAFFYNLARDQKMMATSQMISYIQRDENQHCYF
FT                   FAEVFKQLLADFPELNTKENMDYVYRMINRAVELETNWAHYTLKEVRGIDLNELSDYIK
FT                   YMANMRLRLLGMDKAYEGVDINSMPWIKPFSDEALNATKTDFFEAKSRNYGKVGDDNGF
FT                   DDL"
FT   gene            complement(606720..609053)
FT                   /gene="nrdA"
FT                   /locus_tag="PPSC2_02705"
FT                   /old_locus_tag="PPSC2_c0512"
FT   CDS_pept        complement(606720..609053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="PPSC2_02705"
FT                   /old_locus_tag="PPSC2_c0512"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /EC_number="1.17.4.1"
FT                   /note="Catalyzes the rate-limiting step in dNTP synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02705"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54496"
FT                   /db_xref="GOA:E3EE16"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE16"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369136.1"
FT                   /protein_id="ADO54496.2"
FT                   /translation="MPQLVTKPNNRQLAFDEIRISVYADRVLSGLDKLDKDRLIRGVTS
FT                   KLRRDEVTGDEISNAFAMAALELVSKEEPDWKFAAARALLTSLYKKAATHRRYKSYADE
FT                   PYGAFYPLITDLVQKGIYRQELLDCYTKEQIDELGDSILPQNDLLFDYIGLLTLSERYL
FT                   ANDFDGRVMELPQERYMIIAMYLMHQEPADKRMELVKEAYWAMSNMYMTAATPTMSNAG
FT                   KKVAGQLSSCFIDTVDDSLEGIFDSNTDVARLSKMGGGIGVYLGKVRARGSDIRGHKNT
FT                   SSGVIPWIRQLNNTAVSVDQLGTRKGAIAVYLDVFHKDILAFLDLKLNNGDERMRAHDV
FT                   FHGVCLPDLFMERVEARGEWNLFCPHEVKKVMGWKDDKGRPLGLEDFYDEAFGSGSFRE
FT                   KYEEASKHPILSRITVPAIDIMKRLMKSQLETGTPYMFYRDTVNRANPNRAHGMVYSSN
FT                   LCTEIMQNQSATVVEKEELVTKDGQTRIVISKIPGDFVVCNLNSIHLARAVPAGVLDRL
FT                   VPIQVRMLDNVIDINNIEVLQAQYTNSQYRAVGLGTFGLHHLLALEGIRWESDEAVTYN
FT                   DHLYEKINYLAVKSSMELAKEKGRYAKFEGSDWATGHYFTSRGYTDGTREGKFVTTSEW
FT                   SELAEEVQQNGVRNAWLFAIAPNGSTSIIAGSTASIDPLYELLSYEEKTTYKIANPAPD
FT                   LNEKTIWYYKTAFLLDQHASINMASARQRHIDQGQSFNLYVRPDIKATEFLELHIHAWK
FT                   SGMKSTYYVRSRALTIEECESCAS"
FT   gene            609577..609924
FT                   /gene="dglA"
FT                   /locus_tag="PPSC2_02710"
FT                   /old_locus_tag="PPSC2_c0513"
FT   CDS_pept        609577..609924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dglA"
FT                   /locus_tag="PPSC2_02710"
FT                   /old_locus_tag="PPSC2_c0513"
FT                   /product="dglA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54497"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE17"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369137.1"
FT                   /protein_id="ADO54497.1"
FT                   /translation="MAIAEVTVIPIGTGSTSLSDYVAQMQKVLKTQKGITYELTSMSTI
FT                   IEGSLDDVFTAIAALHEAPFLAGAKRVSTSVKIDDRRDKPSSSRQKLRSVADKLSGATA
FT                   GNVTELNPNPS"
FT   gene            609998..610069
FT                   /locus_tag="PPSC2_02715"
FT                   /old_locus_tag="PPSC2_ct051"
FT   tRNA            609998..610069
FT                   /locus_tag="PPSC2_02715"
FT                   /old_locus_tag="PPSC2_ct051"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:610030..610032,aa:Thr,seq:cgt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(611683..612030)
FT                   /gene="ykvN"
FT                   /locus_tag="PPSC2_02720"
FT                   /old_locus_tag="PPSC2_c0517"
FT   CDS_pept        complement(611683..612030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykvN"
FT                   /locus_tag="PPSC2_02720"
FT                   /old_locus_tag="PPSC2_c0517"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54501"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE21"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685981.1"
FT                   /protein_id="ADO54501.2"
FT                   /translation="MKTFFCELEVTLEVIGGKWKGLVLYYLIKGPKRTGELKRLVHNIS
FT                   QKMLIQTLRELETDGLIRRKMYNQVPPKVEYSTTELGQSLEPILRSLCDWGGNYAEQSF
FT                   APGEIEILYLD"
FT   gene            complement(612190..612936)
FT                   /gene="ykvO"
FT                   /locus_tag="PPSC2_02725"
FT                   /old_locus_tag="PPSC2_c0518"
FT   CDS_pept        complement(612190..612936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykvO"
FT                   /locus_tag="PPSC2_02725"
FT                   /old_locus_tag="PPSC2_c0518"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02725"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54502"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE22"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369142.1"
FT                   /protein_id="ADO54502.1"
FT                   /translation="MGKFDGKVAVVTGGTSGIGLASAQQFVKEGAYVFITGRRQRELDE
FT                   AVKQIGKNVTGVRGDISKSEDLDILFETVKREKGHLDILFANAGLGSFLPLGEITEAQY
FT                   YKTFDVNVKGTIFTVQKALALFPNKRGSIILTGSTAGSTGMPAFSIYGASKAAIRQLVR
FT                   SWILDMRGTEIRINILSPGTIVTPAYDELFGSELDHLLEQAKNDIPLGRVGQVEEISNA
FT                   VMFLASNESSYMNGVELFVDGGVAQV"
FT   gene            complement(613112..613594)
FT                   /gene="yfnB"
FT                   /locus_tag="PPSC2_02730"
FT                   /old_locus_tag="PPSC2_c0519"
FT   CDS_pept        complement(613112..613594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfnB"
FT                   /locus_tag="PPSC2_02730"
FT                   /old_locus_tag="PPSC2_c0519"
FT                   /product="haloacid dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54503"
FT                   /db_xref="GOA:E3EE23"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE23"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369143.1"
FT                   /protein_id="ADO54503.1"
FT                   /translation="MEPSFTMLRMGEIVVGLEWGGLYRELLGDGNQLLMEGAMDVCHRL
FT                   SKTHRMFVITNGITHTQIKRLKQSGLYKFFEDIFDSQSIGYQKPKEEFFNYVISHISEF
FT                   NRKDALVIGDSLNTDIKGGLQSGIDTCWVNRTGQISPAEIKSTYTISNLMELTSIC"
FT   gene            complement(614556..615653)
FT                   /gene="gerKB"
FT                   /locus_tag="PPSC2_02735"
FT                   /old_locus_tag="PPSC2_c0521"
FT   CDS_pept        complement(614556..615653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="PPSC2_02735"
FT                   /old_locus_tag="PPSC2_c0521"
FT                   /product="spore gernimation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02735"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54505"
FT                   /db_xref="GOA:E3EE25"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE25"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369145.1"
FT                   /protein_id="ADO54505.1"
FT                   /translation="MRETVTRVSGLAIAFSLFQVGSTTLFLLGAKAKQDAWLAMLIGAL
FT                   AGFVLLIMYLYMHKLDPHRDLYELLCHYWGKWVGSLGGLLFISYFAYEASRNARDMGEL
FT                   GALTLLNRTPTEVITFIALIACADVAWFGPRVWFLLCHIFFLLLFFGYSTLLLLTPFTG
FT                   LIHFEFLFPVLENGLTPVVKAAIPEIMSFPFGQTILFLVLFKLVTDKRKLKRSIVIVYW
FT                   ITAVFLILMNELTILVLGPEWAASSTYPLFEVTQLIQLPKIFERADVLFSMILFIGIGV
FT                   KTTGFMFGAVIGLQTITPLRYKPALLLLSIIIYGLTFLSPRLTEFLWFGLNVALIQIWP
FT                   IFQIALPVLLFLTMLIRKKKRRAYS"
FT   gene            complement(615683..616909)
FT                   /gene="gerKC"
FT                   /locus_tag="PPSC2_02740"
FT                   /old_locus_tag="PPSC2_c0522"
FT   CDS_pept        complement(615683..616909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="PPSC2_02740"
FT                   /old_locus_tag="PPSC2_c0522"
FT                   /product="spore gernimation protein GerC"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54506"
FT                   /db_xref="GOA:E3EE26"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE26"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369146.1"
FT                   /protein_id="ADO54506.1"
FT                   /translation="MSQLGRFIWVLVILFILPGCWNRVELNELWVTAATGVDMMDDGQW
FT                   MVSYQIIVPSALASGTGGGTGGSSQPASHVFSVKSKTYNQALSYSNLKTSRRIYVAHNR
FT                   VVYIGKRAAEKGMDRLIDFYLRNTEAREMVNMIVTDGLASDLIKKLLPPEKLQGAAMAE
FT                   LVNKESDMISLFPKVRVYEFVLSMNSDSKSIGVPVAELIGERDYQDEKEAESLDVFKKT
FT                   STPLKLALTKLAVFQKGKLKGFLNKKESLGVSYLSQKVSNTEVSFPCGEQSNREMYSSL
FT                   LVNSADVKLTPRKTNSHYTMQVGVKINGTLSETTCTKDISKTKTIHDLEEEIAKEVTST
FT                   INEGWARLQELGVDATGFADRIHRRFPKEWKTVKKDWEQEFKRIELDIQVDARIKRPGL
FT                   LQKRIGSQT"
FT   gene            complement(616922..618538)
FT                   /gene="gerKA1"
FT                   /locus_tag="PPSC2_02745"
FT                   /old_locus_tag="PPSC2_c0523"
FT   CDS_pept        complement(616922..618538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA1"
FT                   /locus_tag="PPSC2_02745"
FT                   /old_locus_tag="PPSC2_c0523"
FT                   /product="spore gernimation protein KA"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02745"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54507"
FT                   /db_xref="GOA:E3EE27"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE27"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017428060.1"
FT                   /protein_id="ADO54507.1"
FT                   /translation="MVDKLKKWLFKQPSRSNSGTSPEPVNDEKSTELSEKLSVTLKDNI
FT                   ILLKQEIGHSTDFILRCLNDKQGNPVLAVGFLQGLIDQQILTTLLEELTAGIRNGDLSD
FT                   RNVESWLMDRIPIGGITCLKNEKALIDAVLYGQVVLLVEGSTKAFAASMGGGAKRAVEE
FT                   PTSQTVIRGPKEGFTEDISTNIALLRRRIKSTELHFDSRIIGSYTQTKVSVAYVRGIAD
FT                   PEVVKEISKRLDSINTDSILESGYIEEFIQDGVWTPFPTMVNTERPDTVAGSLLEGQVA
FT                   ILVDGTPFVLIAPVTFFRFISSSEDYYQRYDLASFLRIVRMASFFLALLLPAFFIATTT
FT                   FHQEMLPTTMLITLAAQRENTPLPALLEAMIMELTFEVIREAGVRMPRAVGPAISIVGA
FT                   LVLGQAAVQAGLVSAAMVIVVSFTAICNFVLPAFNMAGSVRLLRFVLMLMAGLLGLYGV
FT                   LSVLVPILVRLVSVNSFGVPYMMPLAPFYKSNMKDLFVRVPRWKMKKRPVMIGDSNPVK
FT                   QATEQESFAEQAGEHGRDPMA"
FT   gene            complement(618800..619699)
FT                   /gene="yqhC"
FT                   /locus_tag="PPSC2_02750"
FT                   /old_locus_tag="PPSC2_c0524"
FT   CDS_pept        complement(618800..619699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqhC"
FT                   /locus_tag="PPSC2_02750"
FT                   /old_locus_tag="PPSC2_c0524"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54508"
FT                   /db_xref="GOA:E3EE28"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE28"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369148.1"
FT                   /protein_id="ADO54508.1"
FT                   /translation="MNQLITELAKQIARHTPKDGLHQTAIPELCFRRASAESKPTHTLN
FT                   MPSLYIIAQGSKTVTFVGESLMCDSSSYMVASVHLPVIGKITHASPQLPYLSLQLTLSP
FT                   DVIIDISKKSSSQKKGVTGRGILVNPSTSFLLDAILRLVNLLDSPTDIEILAPLYIREI
FT                   FYRVLEGEQGALLRQFAVIGSYAQGISNAIHVINRDYSEQLVIEELAKKVNMNPTTFHK
FT                   HFKRVTGMSPLQYQKIIRLQSARRLMLTEGYDAATAGFQVGYESPSQFNREYARLFGRP
FT                   PMRDISHLRDIELPSQLI"
FT   gene            619863..620624
FT                   /gene="sdr3"
FT                   /locus_tag="PPSC2_02755"
FT                   /old_locus_tag="PPSC2_c0525"
FT   CDS_pept        619863..620624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdr3"
FT                   /locus_tag="PPSC2_02755"
FT                   /old_locus_tag="PPSC2_c0525"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02755"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54509"
FT                   /db_xref="GOA:E3EE29"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE29"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017428055.1"
FT                   /protein_id="ADO54509.1"
FT                   /translation="MRLIQNATLSGIKDKVVVITGASSGIGEATTLLLAEHGAKVVLGA
FT                   RRPERLEALAARIAEVGGEVVYASTDVRRREDVTKLIHLACERFGTIDVLVNNAGVMPI
FT                   SPLDDLRVEDWEDMIDVNIKGVLYGIAAALPVFRKLGSGHFVNIASTAGHKTVPHQSVY
FT                   SATKFAVRAISEGLRQEAGDKVRVTIISPGLVRTNFAEGVTNLEVRARLEESRDQFALP
FT                   PEAIARAIAYAIEQPVDVDVNEIVIRPTSQV"
FT   gene            620909..621736
FT                   /gene="frlC1"
FT                   /locus_tag="PPSC2_02760"
FT                   /old_locus_tag="PPSC2_c0526"
FT   CDS_pept        620909..621736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frlC1"
FT                   /locus_tag="PPSC2_02760"
FT                   /old_locus_tag="PPSC2_c0526"
FT                   /product="endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54510"
FT                   /db_xref="GOA:E3EE30"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE30"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369150.1"
FT                   /protein_id="ADO54510.1"
FT                   /translation="MKIAGMNITYRYFPFEHFLDQVAELGIEHIELWAGEPHLYVYRNV
FT                   LGNLRHVRQQLKSRDMKVVCYTTEQCVYPFNIAASDLQLRQKSIDYFIDNLYAALELET
FT                   DMMLVTSGIGDFAVPQLESWKYASDSIYQISRVAEKEGMTLALEPLTRFESNLIIDAKG
FT                   IKRMLEEIRSPSLKGMIDTVAMQLANETPEDYFSLLPEMVHFHLIDGDGSSDAHLALDD
FT                   GVLNWREYLTSLQSHNYEGACTLEIMGFNYYQNPQEALRESVRKIRGMQFLSP"
FT   gene            621753..623099
FT                   /gene="frlA"
FT                   /locus_tag="PPSC2_02765"
FT                   /old_locus_tag="PPSC2_c0527"
FT   CDS_pept        621753..623099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frlA"
FT                   /locus_tag="PPSC2_02765"
FT                   /old_locus_tag="PPSC2_c0527"
FT                   /product="fructoselysine transporter"
FT                   /note="inner membrane protein possibly involved in
FT                   fructoselysine transport; member of the flr operon"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02765"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54511"
FT                   /db_xref="GOA:E3EE31"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE31"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369151.1"
FT                   /protein_id="ADO54511.1"
FT                   /translation="MSNDSLKRKLGFWSALAIAVGTTIGSGIFVSSGDVAKAAGMPSIS
FT                   ILAWIIGGVIAIPQVMVLAELATAYPQNGSGYVYLNKAGWRPLAFLYGWATFWALDPPS
FT                   ISIMALAIVAYLASFFPFFVGIAGKLLGVAIILIITSIHYRSVKAGGSFQVIITAVKII
FT                   PFLIVIVLGLMYMNFDNFAYTPAAGATSSSLIGGVSATTWAYTGMAAICFMAGEFKNPG
FT                   KVLPRALIISVLIVLGLYTLLAVCVTGLMPFDKLMGSSSAVSDAVKYIPGLSGMASSFV
FT                   AVTAIIVILGSLSSCIMFQPRLEYAMAKDGLFFQRFAKVHPKFETPSFSIIAQVTLACI
FT                   LVFFSNLTELLGYFTLIQLVINILDFAAVYKCRKREDYNPIYRMPMWRVTTVLAILGAG
FT                   WLAWGTFTWAPVQGMIAAAIVIATGLPVYYYWEKKYGSKSSHDSSNIVI"
FT   gene            623261..624274
FT                   /gene="agaS"
FT                   /locus_tag="PPSC2_02770"
FT                   /old_locus_tag="PPSC2_c0528"
FT   CDS_pept        623261..624274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="PPSC2_02770"
FT                   /old_locus_tag="PPSC2_c0528"
FT                   /product="sugar isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54512"
FT                   /db_xref="GOA:E3EE32"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR024713"
FT                   /db_xref="InterPro:IPR035488"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE32"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009671289.1"
FT                   /protein_id="ADO54512.1"
FT                   /translation="MLNFDEQLFLKLVEQEGLAFRGQIEEIVDGIAKKGYSNIFLIGAG
FT                   GTIAMMYPYEYILKSNSTIDVHAAIAAEFMVMNNRHFSKDSVCIFTSVSGTTQETVAAA
FT                   EFCKERGATTIALVAERDTPLTKIVDHCITTGSEKHSFDTFFMLLYMVVFRFMYNNNEF
FT                   PQYEQFTKEVALLPRAILDAVKTFDPKAEAFAKEHKDTDYHMMVGSGNLWGNTYSYAMC
FT                   ILEEMQWIHAKSIHAAEFFHGTLELVVEDTSVILLKGEDETRPLMDRVERFAEKITKKL
FT                   TIIDTKDFALEGISEEFRKHFAVSINWSVLSRISAYLERERNHPLTLRRYYRQMEY"
FT   gene            624370..625152
FT                   /gene="yhfQ"
FT                   /locus_tag="PPSC2_02775"
FT                   /old_locus_tag="PPSC2_c0529"
FT   CDS_pept        624370..625152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhfQ"
FT                   /locus_tag="PPSC2_02775"
FT                   /old_locus_tag="PPSC2_c0529"
FT                   /product="fructoselysine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02775"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54513"
FT                   /db_xref="GOA:E3EE33"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE33"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369153.1"
FT                   /protein_id="ADO54513.2"
FT                   /translation="MRIITIGDNCMDVYQASGKAYPGGNPVNVAVYLTEMGAETAYLGW
FT                   VGTDIYGEIMIQAIQDKGVDTSRISKKDGKTAVTYVEMVENDRRFGDYDEGVMAQFFLT
FT                   AEELDFAGHYQLVHSGIWGHADAYFPLFKEKGLITSFDFSDQLQDDRVLTLTPYVDYPF
FT                   FSYTQDDDYIRQLLVEVKQRGAQIAVATLGENGSLAYDGEQFFPHGVGKVNVVDTMGAG
FT                   DSFIAGFIYGRLKGFSTENCLELGAITAGKTIGYFGAW"
FT   gene            625216..625944
FT                   /gene="frlR1"
FT                   /locus_tag="PPSC2_02780"
FT                   /old_locus_tag="PPSC2_c0530"
FT   CDS_pept        625216..625944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frlR1"
FT                   /locus_tag="PPSC2_02780"
FT                   /old_locus_tag="PPSC2_c0530"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54514"
FT                   /db_xref="GOA:E3EE34"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE34"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_009671286.1"
FT                   /protein_id="ADO54514.1"
FT                   /translation="MNLNPSTPQPLYMQIRQMLKNDIQDGRYKPDEQIPTEAELCDTYS
FT                   VSRITIRKAIEELVREGTLTRIPRRGTFVASNKFHNELLSVSGFSEFSHQLGMIPNSRI
FT                   LRSEVIPASEEVAVHLLIEEGSPVLELERLMYVDDRPLFYDIAHYSLTRFPDLEKKIAM
FT                   KESTYKILSEDYNTEIVSNDKIIDVIGATKDYAKLLECDIGANLFRILKIAFDANDEPV
FT                   HLSTFMCETNRVNLTVHRAK"
FT   gene            626258..626914
FT                   /gene="M1-670"
FT                   /locus_tag="PPSC2_02785"
FT                   /old_locus_tag="PPSC2_c0531"
FT   CDS_pept        626258..626914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-670"
FT                   /locus_tag="PPSC2_02785"
FT                   /old_locus_tag="PPSC2_c0531"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02785"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54515"
FT                   /db_xref="GOA:E3EE35"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE35"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019685997.1"
FT                   /protein_id="ADO54515.2"
FT                   /translation="MNMKNKWLLALSLTLTFVFSMTPVVVSQAKAGEEKGFTCLSPKMV
FT                   QLKGDMQKVWIDHTIWTRSYIVSAISNRPDQKDVLDRLLRNQQDIGNVIKPYYGEAAGN
FT                   KLADLLREHILIAGKIVAAAKAGNQADMKKLDADWHANADDIAKFLSEANPNWQFKTLQ
FT                   DMLYTHLQLITEIVLNCLKGDWKADIAATDKNEIHMIHLADILTEGIAKQFPEKF"
FT   gene            627382..628197
FT                   /gene="M1-671"
FT                   /locus_tag="PPSC2_02790"
FT                   /old_locus_tag="PPSC2_c0532"
FT   CDS_pept        627382..628197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-671"
FT                   /locus_tag="PPSC2_02790"
FT                   /old_locus_tag="PPSC2_c0532"
FT                   /product="M1-671"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02790"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54516"
FT                   /db_xref="InterPro:IPR021328"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE36"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308531.1"
FT                   /protein_id="ADO54516.1"
FT                   /translation="MDAFVARSLDEIRFWSRIMKEHSFFLGLGFRAEDTQLKTEANRFY
FT                   SIFEDIEKRSYEFKTDTDPYTIREFNTEVQNAATNIWAFKRMVLGLILQCKLPGQTNFP
FT                   LLVDHVSREANYFRNRLGELNSGTLEPLPDAIIDENVFFLKIMADHAKFIGHLLDPSER
FT                   KLVEQAREFSNDFDTLMFQAIDLSYMRPQSQTVPLLSQFVDENRISVKSLRDFKKTARD
FT                   LIDECRIKSIIHPLLADHVFREAERFLFILDMFDQSLSGVKVNKNEIMH"
FT   gene            complement(628437..628985)
FT                   /gene="yjcK3"
FT                   /locus_tag="PPSC2_02795"
FT                   /old_locus_tag="PPSC2_c0534"
FT   CDS_pept        complement(628437..628985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcK3"
FT                   /locus_tag="PPSC2_02795"
FT                   /old_locus_tag="PPSC2_c0534"
FT                   /product="alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02795"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54518"
FT                   /db_xref="GOA:E3EE37"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE37"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019686002.1"
FT                   /protein_id="ADO54518.2"
FT                   /translation="MQMSEQQVYVRFPEEVDVTELTAMYRRNREFFDKFSPNHQEEHYT
FT                   EEHQLQTIIKSKADMMEDRKYSFVVCHKEDDRIIGSIGLSFVVRGPLQSCMIGYSLDQA
FT                   YNGKGYMTEAVKQVVRYAFDELKFHRIVGEASPRNPGSIRVLEKAGFHKEGISRSNVKI
FT                   NGKWEDHQVLAIINPSEDI"
FT   gene            629339..629938
FT                   /gene="M1-673"
FT                   /locus_tag="PPSC2_02800"
FT                   /old_locus_tag="PPSC2_c0535"
FT   CDS_pept        629339..629938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-673"
FT                   /locus_tag="PPSC2_02800"
FT                   /old_locus_tag="PPSC2_c0535"
FT                   /product="DeoR faimly transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02800"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54519"
FT                   /db_xref="GOA:E3EE39"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE39"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369159.1"
FT                   /protein_id="ADO54519.1"
FT                   /translation="MISIDKKSDTLIVVLHEIYGINQHIQNFCSLLSGQGYDVICPNLI
FT                   GKETPFDYSQEEAAYAHFMGSVGFERASYHIESVLLSIRARYKKIFIVGFSIGATIAWL
FT                   CSKEKYADGIVGYYGSRIRNYLEITPHCPTLLFFPQEEKSFNVDELISTLDNYNIRVHK
FT                   FNGQHGFSDPYSTRYHVHSAQQSFNEMVELFRKVDQ"
FT   gene            629997..631166
FT                   /gene="M1-674"
FT                   /locus_tag="PPSC2_02805"
FT                   /old_locus_tag="PPSC2_c0536"
FT   CDS_pept        629997..631166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-674"
FT                   /locus_tag="PPSC2_02805"
FT                   /old_locus_tag="PPSC2_c0536"
FT                   /product="M1-674"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02805"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54520"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE40"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369160.1"
FT                   /protein_id="ADO54520.1"
FT                   /translation="MMCRLVIGIYIIDYDEKEMHVAVATFYQAFKLKSRIWRTMLKRNG
FT                   VTGIGVGYADPNRPAKGAAIVLYTLRNLSAVSQTKLQAVTQNISRASAVPIRILGVGSF
FT                   KREAATPTQTNPRQRWRPVPGAVSVGTTVPTTAGGTGGLIVIKNNTLFILSNAHVLVPT
FT                   NTSQFHNTIQPSPADGGRTADQIGRAFQFVPLTTTGVNFQDSAIAIANSNSLLNPRYLI
FT                   NQSGGLITVPGHLLSYRLGMTFKRMAKTNGFARGVVEAIGVEQRVRGDSGIKTFRDQTV
FT                   IRFTQGRTGPGDSGSVWLNDSNDRLNNYAAAVHFAGSTDGTRSVSFPIERAMRTYGTLV
FT                   AIPAAAGGYKAGVAKGKAPKNNYAYVRPLTRKQRSLSPVITSNTEQEKH"
FT   gene            complement(631178..631867)
FT                   /gene="ydfF"
FT                   /locus_tag="PPSC2_02810"
FT                   /old_locus_tag="PPSC2_c0537"
FT   CDS_pept        complement(631178..631867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfF"
FT                   /locus_tag="PPSC2_02810"
FT                   /old_locus_tag="PPSC2_c0537"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02810"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54521"
FT                   /db_xref="GOA:E3EE41"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE41"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369161.1"
FT                   /protein_id="ADO54521.1"
FT                   /translation="MSTKSNVAMIASLVSEPSRAAILTALLDGRFHTASELAHMAGIKP
FT                   QTASFHLAKMTEAQVVTVEKQGRHRYYGIQDPEVAQVMESLLSIAPPVPIKSFKQASEN
FT                   EAIRLARTCYDHVAGHLGVQIMSFFIQRGILSEDQDGLHITQQGEIFFADFQIDLKNTR
FT                   QKRRSFSHKCLDWSERRHHLAGALGSALLDRLFELHWVEHLPTTRAIRITAEGKRGFKE
FT                   VFSIEIG"
FT   gene            631966..632604
FT                   /gene="ydfE"
FT                   /locus_tag="PPSC2_02815"
FT                   /old_locus_tag="PPSC2_c0538"
FT   CDS_pept        631966..632604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfE"
FT                   /locus_tag="PPSC2_02815"
FT                   /old_locus_tag="PPSC2_c0538"
FT                   /product="ydfE"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02815"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54522"
FT                   /db_xref="GOA:E3EE42"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE42"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019686006.1"
FT                   /protein_id="ADO54522.1"
FT                   /translation="MDPMNQINQMNYSPSIKTITPSILYYGTPVILLNTLNEDGTTNIS
FT                   PISSSWALGDCVVLGIGTGGKALENMERHSECVINVPGPSMWENVERLAPFTGKNPVPV
FT                   EKEKHGFTYQKDKYEISGLTAIDSNRVKPARIRECPIQIEAKVKEARIPDHSPYFAIVE
FT                   TQAIQVHVHQDIILGENHIDPAKWSPLIYNFRHYFGLGEHLGKTFRSET"
FT   gene            632758..634050
FT                   /gene="cysD"
FT                   /locus_tag="PPSC2_02820"
FT                   /old_locus_tag="PPSC2_c0539"
FT   CDS_pept        632758..634050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="PPSC2_02820"
FT                   /old_locus_tag="PPSC2_c0539"
FT                   /product="O-acetylhomoserine aminocarboxypropyltransferase"
FT                   /EC_number="2.5.1.49"
FT                   /note="catalyzes the formation of L-methionine and acetate
FT                   from O-acetyl-L-homoserine and methanethiol"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54523"
FT                   /db_xref="GOA:E3EE43"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE43"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428545.1"
FT                   /protein_id="ADO54523.1"
FT                   /translation="MSEERKLSFETLAVHAGQEIDPTTFSRAVPLYQTTSYGFRDAEHA
FT                   ADLFSLKEFGNIYTRLMNPTTDVFEQRIAALEGGAGALATASGMAAISFSILNIAGAGD
FT                   EIVSASSLYGGTYNLFSTTLPKLGIKVHFVDSDDPENFRHAITDKTKAIFAETIGNPQG
FT                   NVLDVEAVSAIAHEYGIPLIVDNTFPSPYLLRPIEYGADIVVHSATKFIGGHGTSIGGV
FT                   IVDSGKFDWKASGRFPGLTGPDPSYHGVVYTEAVGPIAYIIKARVQLLRDLGAAISPFN
FT                   SWLLLQGLETLHLRLERHSQNALKVAQYLESHKDVEWVSYAGLPSHPSYELAQKYLPKG
FT                   QGAILTFGIKGGSQAGSKLIANVKLFSHLANVGDSKSLIIHPASTTHQQLNAEEQVAAG
FT                   VKPELLRLSVGTEAIDDILYDLEQAITASQQ"
FT   gene            634247..635911
FT                   /gene="ndh1"
FT                   /locus_tag="PPSC2_02825"
FT                   /old_locus_tag="PPSC2_c0540"
FT   CDS_pept        634247..635911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh1"
FT                   /locus_tag="PPSC2_02825"
FT                   /old_locus_tag="PPSC2_c0540"
FT                   /product="CoA-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02825"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54524"
FT                   /db_xref="GOA:E3EE44"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE44"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369164.1"
FT                   /protein_id="ADO54524.1"
FT                   /translation="MGRKIIIIGGVAGGASAAARLRRWSEEDEIILFERGEHVSFANCG
FT                   LPYYIGGTIQAREKLFLQTPQGIRDRFNIDVRVQKEVIQIDREHKLVHYRDMITGETDE
FT                   QPYDIVVLSPGAKPMIPDIPGLHEATNVFTLRNIHDTDLIKAYVDERHPKHATVIGAGF
FT                   VGLEMAENLRERGLAVTIMDKGQQLLNPLDPEMAKLVEQHVKLNGVEVRLEEGVAAFEE
FT                   QGTQLRLTSGEMLQTDLVILAIGVVPENELAKQCGLELGFRGAIQVNAQLQTSDPSIYA
FT                   VGDAIQVKDRNHGFATMVSLAWGANRQGRLAADHINGQAISYDGALGTSVIKTFALTAA
FT                   STGNNEKTLQRLAVPYQAIHIHPGSHAGYYPGASPISMKLLFHPETGMIYGAQAVGADG
FT                   ADKRIDVIATAIRGHLNVRELADIELAYAPPYSSAKDPVNMAGYVASNIMDGLVQTIQW
FT                   HEVDDFHRNGGLVIDVRDAVELQGGTIPGSMHIPLVEIRERMSEIPRDLEIAVSCQVGL
FT                   RGYLAARILTQSGYRVRNVDGGYKTYSVMAKRDHLLK"
FT   gene            complement(635896..636264)
FT                   /gene="phnB5"
FT                   /locus_tag="PPSC2_02830"
FT                   /old_locus_tag="PPSC2_c0541"
FT   CDS_pept        complement(635896..636264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnB5"
FT                   /locus_tag="PPSC2_02830"
FT                   /old_locus_tag="PPSC2_c0541"
FT                   /product="glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54525"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE45"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428547.1"
FT                   /protein_id="ADO54525.1"
FT                   /translation="MRSASPFVIVNDVQQSIDYYQSVLGGKIKVLNKQEGKLLHAELHL
FT                   GSSHIHFSDSYGKPLKAQHVQIILDCESEDELKQAYYSLSEKGTITVELQDTFFGALHG
FT                   EVTDHLNQIGWVMNYFKR"
FT   gene            636407..636739
FT                   /gene="M1-680"
FT                   /locus_tag="PPSC2_02835"
FT                   /old_locus_tag="PPSC2_c0542"
FT   CDS_pept        636407..636739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-680"
FT                   /locus_tag="PPSC2_02835"
FT                   /old_locus_tag="PPSC2_c0542"
FT                   /product="M1-680"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02835"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54526"
FT                   /db_xref="GOA:E3EE46"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE46"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369166.1"
FT                   /protein_id="ADO54526.1"
FT                   /translation="MMDRKEVEQVGTSAIWEAVIYWVILVISALCVIAVSGSRKTASTI
FT                   ILAPIVLFCTIFMMQGSVFTAMKHPTMGANVGLGMAFLTTWVVSGILFAVALVIAFIKY
FT                   SKRNKA"
FT   gene            637301..637609
FT                   /gene="M1-682"
FT                   /locus_tag="PPSC2_02840"
FT                   /old_locus_tag="PPSC2_c0544"
FT   CDS_pept        637301..637609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-682"
FT                   /locus_tag="PPSC2_02840"
FT                   /old_locus_tag="PPSC2_c0544"
FT                   /product="M1-682"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54528"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EE48"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599427.1"
FT                   /protein_id="ADO54528.1"
FT                   /translation="MLPDLERKLLRILYNYFAQHRHMPTMAELSAKTGRRDSEITAALR
FT                   HMEQERYITWENNTGTQHIVLLEGWERPSTYKPAQVEAGRPTTQTIQSGSTEYWTNY"
FT   gene            638329..638784
FT                   /gene="slyA1"
FT                   /locus_tag="PPSC2_02845"
FT                   /old_locus_tag="PPSC2_c0546"
FT   CDS_pept        638329..638784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyA1"
FT                   /locus_tag="PPSC2_02845"
FT                   /old_locus_tag="PPSC2_c0546"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02845"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54530"
FT                   /db_xref="GOA:E3EF10"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF10"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016819479.1"
FT                   /protein_id="ADO54530.2"
FT                   /translation="MTASRKDKKTSQNNSPSVCTCINLRRASMAVTGLYDQYLAPSGLN
FT                   ISQFSLLKHLTVLGPVSVSELALEMRLDRTTLVRNLKALEQSGYVEDTSAEGSRNRCLT
FT                   LTESGKALYNDAAELWEEAQLFLQESLGSADLQILTTLLSKIEKLRL"
FT   gene            638938..639816
FT                   /gene="M1-685"
FT                   /locus_tag="PPSC2_02850"
FT                   /old_locus_tag="PPSC2_c0547"
FT   CDS_pept        638938..639816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-685"
FT                   /locus_tag="PPSC2_02850"
FT                   /old_locus_tag="PPSC2_c0547"
FT                   /product="(Fe-S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54531"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF11"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369171.1"
FT                   /protein_id="ADO54531.1"
FT                   /translation="MVTPVPDMKELIAAEMKAYVSEDKGNFCEELQSPYYEEPIIQFAE
FT                   ANDPLFEQYKTVVGSDHATPQEAFERTFGTGSFGGGTVVSVVLPISETIRKANRAQKAR
FT                   ASREWALLRTFGDEYFVRSARQHLAGYLIGLGYRAVAPLDTDWYSIHGAVGGPVSNWSE
FT                   RHIAYAAGLGTFSINDGFITEKGIAIRLLSVVTDLQVPPDVRVSSNLSHTGNCLLCSKG
FT                   ICGVCITRCPVQAISKEGGHDKIACMKFVYGEESRKWAVLNGGEAKSGAGCGLCQTKVP
FT                   CESRNPMRTAR"
FT   gene            639938..641440
FT                   /gene="rpfG"
FT                   /locus_tag="PPSC2_02855"
FT                   /old_locus_tag="PPSC2_c0548"
FT   CDS_pept        639938..641440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpfG"
FT                   /locus_tag="PPSC2_02855"
FT                   /old_locus_tag="PPSC2_c0548"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02855"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54532"
FT                   /db_xref="GOA:E3EF12"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF12"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017428038.1"
FT                   /protein_id="ADO54532.2"
FT                   /translation="MPIYKRFIQHVILNYIIGSFIAVLLVCMIFVFSTLNVAHYELLGL
FT                   VKIVAFSSVIMIVCETIVFRMHLRPVHRFFQGNQETLKDVEAVYIRVHHLPNLSVLRIV
FT                   GPHLLGFSIPAAVIALWMIHTGQLTFPFYYVGIACIGACLVASMHALVEFFLTMRAIKP
FT                   LLEEIRDRTYQQYGLSLSLRGRVLLSLRHKFQLSATLIGAFPLFLFCLATQIRLERLEA
FT                   TDSGSYWAWAGTILIFGVAFAYLGGRLLTREIEQPIHHLLEKMNEVKEGRLNSNASDLY
FT                   SDEFAELVEGFNMMIEGLKEREEKNGQLLDSYFATLAAALDARDAYTAGHSLRVAEYSV
FT                   LIGRKGGLSETDLDLLRKTALLHDIGKIGVADAVLFKDGKLTDEEFDQIKMHPVMGESI
FT                   LRQVEPAYAMAPYLPGVRSHHERYDGKGYPDQLSGEDIPLFGRIIAVADAYDAMTSDRP
FT                   YRKGMKEEKAVMILEEGKGTQWDPYFAELFVKEWRRNKGILS"
FT   gene            641615..643060
FT                   /gene="phY1"
FT                   /locus_tag="PPSC2_02860"
FT                   /old_locus_tag="PPSC2_c0549"
FT   CDS_pept        641615..643060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phY1"
FT                   /locus_tag="PPSC2_02860"
FT                   /old_locus_tag="PPSC2_c0549"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54533"
FT                   /db_xref="GOA:E3EF13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF13"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016819482.1"
FT                   /protein_id="ADO54533.1"
FT                   /translation="MQFSMMFLMNLGMLIAVAYVANVIYKYGLSRTSTRFKYVSSVLLV
FT                   VFGGWVSSCFGFNFNETVIFDLRFVPLIIAALVYPRSYTLIIIGVAIGLTRFTFGLNMA
FT                   AWVGFLNMSILGVLCAGLNYWMRRSTWRLIIKASVTILAVNIVNTLNIAFLGVIPWRYY
FT                   VAEVVPLTLPIGVILSFLFALILRDFQMEQQRNYQIQQANELLSEQRDKLQKAKVILEE
FT                   RAKQLMMASQYKSDFMATMSHELRTPLNSIINLAQIINEQGKELDEDELYQYSDLIYAS
FT                   GHDLLQLINDILDLSKVEAGHMEIVSEPVSVREIAQGMMMHFEVTAKDKNLEFNLKVHE
FT                   HIPDEIRSDSKRVQQILRNLLSNAFKFTHKGRVLLEISTQHLDRKGQEGDWVVFAVKDT
FT                   GIGISKLQQHVIFEAFQQANGSINRKYGGTGLGLSISRDFSRLLGGFIRLESEEGKGST
FT                   FSLYLPMCPSDSKEADEQPFKLT"
FT   gene            643098..643817
FT                   /gene="M1-688"
FT                   /locus_tag="PPSC2_02865"
FT                   /old_locus_tag="PPSC2_c0550"
FT   CDS_pept        643098..643817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-688"
FT                   /locus_tag="PPSC2_02865"
FT                   /old_locus_tag="PPSC2_c0550"
FT                   /product="nucleoside-diphosphate sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02865"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54534"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF14"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017428036.1"
FT                   /protein_id="ADO54534.1"
FT                   /translation="MERKAVVVGGTGLVGGYVVRELLVQKEYTRVMVMGRRPLDIKHPK
FT                   LEQALIDWKQPQKSAFALEGVDDVFCCLGTTMKKAGSKERFRQVDLDYPVLTAQLGKEA
FT                   GAVQMLAVSAMGADPDSRVFYNRTKGEAEEALAAIGLPALHLFRPSLILGARPERRFGE
FT                   AAATVVMKALDGLMTGRLASYRAIPASFIARAMVRIALAQASGVHIYPNDIIRVIGAEL
FT                   TSDDEEPGTGTTPDDNV"
FT   gene            complement(643896..645161)
FT                   /gene="M1-689"
FT                   /locus_tag="PPSC2_02870"
FT                   /old_locus_tag="PPSC2_c0551"
FT   CDS_pept        complement(643896..645161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-689"
FT                   /locus_tag="PPSC2_02870"
FT                   /old_locus_tag="PPSC2_c0551"
FT                   /product="M1-689"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54535"
FT                   /db_xref="GOA:E3EF15"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="InterPro:IPR040680"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF15"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369175.1"
FT                   /protein_id="ADO54535.1"
FT                   /translation="MNPSGFENQDQELDEKLQLEKENLEAKMVVIPDLVRQRLDAFYAQ
FT                   MESDPELLPNRPSSHLSVKRFFRGTAITAASAALIGVMIIGSAFVSPTMAESLKQVPLV
FT                   DSVFKLAGDLGLQTADQKGLATSVNLSVTHSGITLKVPQIIFDGTRLVVALEKSGGDSP
FT                   HEPLYPTTNTQGQEEDMVEKIDLFINGTSVNSNSSAFNHMYGRPGKDNNSMLIAYMRDP
FT                   ASGKSALPDQFELEVYAKLKGVPEPFRIQTTVHKTKINNKILQPQMSKSNPYLAFTVEK
FT                   LEITPITTKITTSFKMLTDIAHMPDEYTVEREHNNMKNGHTIQYTKRELDILDYAVFDE
FT                   QGRELQLLSGSGVPHTQERDSKMITLFTPFVDTPQKIIFKPYILPTQPGGSALLDANGN
FT                   WPRHYMDELEITIDVPPNTNHP"
FT   gene            complement(645158..645685)
FT                   /gene="sigW3"
FT                   /locus_tag="PPSC2_02875"
FT                   /old_locus_tag="PPSC2_c0552"
FT   CDS_pept        complement(645158..645685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigW3"
FT                   /locus_tag="PPSC2_02875"
FT                   /old_locus_tag="PPSC2_c0552"
FT                   /product="RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02875"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54536"
FT                   /db_xref="GOA:E3EF16"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF16"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599431.1"
FT                   /protein_id="ADO54536.2"
FT                   /translation="MNLETILHQARNGDRKAFVALMKHMESDMYGMARSILRSNEDCAD
FT                   AMQEAMLKAYKSLGELREPRYFKTWLLRILINECHLIIRKQKRVVPVAEFIKEPSTSGG
FT                   YEKIELREAIDHLEESMRTVISLHYLRDMPIREISELLDLSEGAVKTRLHRARRTLMDL
FT                   LQNRGERKVTFQ"
FT   gene            645958..646338
FT                   /gene="yhaR"
FT                   /locus_tag="PPSC2_02880"
FT                   /old_locus_tag="PPSC2_c0554"
FT   CDS_pept        645958..646338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhaR"
FT                   /locus_tag="PPSC2_02880"
FT                   /old_locus_tag="PPSC2_c0554"
FT                   /product="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54538"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF18"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308546.1"
FT                   /protein_id="ADO54538.1"
FT                   /translation="MKKTIATEKAPGAIGPYSQAVEAGGFIYTSGQLGLNPATGEFGKD
FT                   VQEQARLSLSNVQAILEAAGSNMNQVVKATVFLKDMNDFVSVNEVYSSFFEQPYPARSA
FT                   VEVARLPKDALVEIEVIALKGE"
FT   gene            646464..647528
FT                   /gene="murG1"
FT                   /locus_tag="PPSC2_02885"
FT                   /old_locus_tag="PPSC2_c0555"
FT   CDS_pept        646464..647528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG1"
FT                   /locus_tag="PPSC2_02885"
FT                   /old_locus_tag="PPSC2_c0555"
FT                   /product="UDP-diphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="UDP-N-acetylglucosamine--N-acetylmuramyl-
FT                   (pentapeptide) pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase; involved in cell wall
FT                   formation; inner membrane-associated; last step of
FT                   peptidoglycan synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02885"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54539"
FT                   /db_xref="GOA:E3EF19"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF19"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014599432.1"
FT                   /protein_id="ADO54539.2"
FT                   /translation="MNKKIMFTGGGSSGHVAVNLALIPHLLEQHWSVQYIGSEQGIERN
FT                   LISGLEDVCYFSVATGKLRRYFDWNNVKDPFKVLKGISQAYRIIKKEKPDIIFSKGGFV
FT                   SVPVVLAGWLNRVPVIIHESDLTPGLANKISSMFATEICTTFPETTEYFRSKNTRYIGA
FT                   VVRDELKEGKAAKGLAYCGFTRNKPIMLIMGGSLGSKKINELVWLNLEALLAHFQIVHI
FT                   CGKDQVNNSIRTNGYQQFDYINDELADVMAMADMVVSRAGSNSIFEFLTLRKPMLLIPL
FT                   SKAVSRGDQILNARSFKARGLCEFLEEEDLESERFVDIILRLYEKRSDYIRNMEKINTD
FT                   QSASKLLDLIKVYA"
FT   gene            complement(647622..648377)
FT                   /gene="M1-693"
FT                   /locus_tag="PPSC2_02890"
FT                   /old_locus_tag="PPSC2_c0556"
FT   CDS_pept        complement(647622..648377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-693"
FT                   /locus_tag="PPSC2_02890"
FT                   /old_locus_tag="PPSC2_c0556"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54540"
FT                   /db_xref="GOA:E3EF20"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF20"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014279544.1"
FT                   /protein_id="ADO54540.1"
FT                   /translation="MSRSHPYKWWNIIAFIAVVLVNILASTLPIGGRSTAAVSNMYPTL
FT                   ITPAGYAFSIWSVIYVLLACFAMYQATSTGQAKTSVQSIGIFFILSCLFNIIWIFLWQY
FT                   VYVELCVIVIILYLLSLFVVYTRTRTPQPTRGEMWFVKLPFSLNLGWVSVATLINIAVA
FT                   LEKNEWSGWGLSDTIWAIIILFIGTVLAILVSFPSRDSIYPLVFVWAYVAIAIEHPNNE
FT                   NVRLAAWILSAIILVYALWLFFARNRDRD"
FT   gene            648674..649624
FT                   /gene="yocS"
FT                   /locus_tag="PPSC2_02895"
FT                   /old_locus_tag="PPSC2_c0557"
FT   CDS_pept        648674..649624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yocS"
FT                   /locus_tag="PPSC2_02895"
FT                   /old_locus_tag="PPSC2_c0557"
FT                   /product="sodium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02895"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54541"
FT                   /db_xref="GOA:E3EF21"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF21"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369180.1"
FT                   /protein_id="ADO54541.1"
FT                   /translation="MRGLEKAGKFVGGTFSIWVLLFACLGFFFPTAFTGLKGYIQLFLG
FT                   IVMFGMGLTLSAADFREVFRRPVDVAIGVVGHYLIMPFLAFVLALVLQLPPDIAVGVIL
FT                   VGCCPSGTASNVMTLLSKGDVALGVSIASVSTLIAPLATPAMISLLAGRWMNIDAKSLI
FT                   MDILIVVIVPIVLGVIVKSLFRKQAEASVKALPLISTLAIVLIVAIVVAGSKGKILETG
FT                   PIIFAVVILHNGIGFLLGYWFAKLFGMNLSKRKAVTLETGMQNSGLGAALAAAHFNPIA
FT                   AVPSAIFSVWHNISGSLLATWFSRREEKDSIAGGK"
FT   gene            649880..651004
FT                   /gene="yqiG"
FT                   /locus_tag="PPSC2_02900"
FT                   /old_locus_tag="PPSC2_c0558"
FT   CDS_pept        649880..651004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiG"
FT                   /locus_tag="PPSC2_02900"
FT                   /old_locus_tag="PPSC2_c0558"
FT                   /product="NADH-dependent flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54542"
FT                   /db_xref="GOA:E3EF22"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF22"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369181.1"
FT                   /protein_id="ADO54542.1"
FT                   /translation="MNPKYNPLFEAFTLPSGVTLKNRITMAPMTNFASHENGEVSDEEL
FT                   AYYRERSGGVGAVITACVYVTPDGKGFVNEFSADKDEMIPSLRRLADTIHQEGAKAILQ
FT                   IYHGGRLCPPDQIPDGQPISASAVAEEKEGAPVPREMTSDDIHRVIRAYGEATRRAIEA
FT                   GYDGVELHGANGYLVQQFFSPHSNIRTDEWGGSLEERLTFPLAVVHEVKKVIAEHAKRP
FT                   FIFGYRLSPEEGHTPGITLDDTMVLVDRLADEGLDYLHISVNHFFGGSFRDRSDERSRT
FT                   VLIHEKVGNRVPVMGVGSLNTPDEALAALETGVPLVSLGRPLLMEPQWVQKVQNGTEDT
FT                   IRTTLSKQAQQELVIPDYLWGALTTIPGWMPVTD"
FT   gene            651114..651701
FT                   /gene="yjcK5"
FT                   /locus_tag="PPSC2_02905"
FT                   /old_locus_tag="PPSC2_c0559"
FT   CDS_pept        651114..651701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcK5"
FT                   /locus_tag="PPSC2_02905"
FT                   /old_locus_tag="PPSC2_c0559"
FT                   /product="alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02905"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54543"
FT                   /db_xref="GOA:E3EF23"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF23"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369182.1"
FT                   /protein_id="ADO54543.1"
FT                   /translation="MFYETNGVISMRSTHPGLQIRLLQVSDAEHLLEIRRENFDFFKPY
FT                   EPERPEIYFTLEEQARLISNGLEAAQAGQGYTFGLFLVENNKLIGRMELSGVARGPFQN
FT                   ANLGYFVDPAYHGQGYATSAVKDIVRYALNELELHRIQAGVMPRNTPSHRVMEKAGFRR
FT                   EGLALNYLKINGVWEDHVLYAMTAEDLQNGAF"
FT   gene            complement(651631..653283)
FT                   /gene="ntrC"
FT                   /locus_tag="PPSC2_02910"
FT                   /old_locus_tag="PPSC2_c0560"
FT   CDS_pept        complement(651631..653283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="PPSC2_02910"
FT                   /old_locus_tag="PPSC2_c0560"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54544"
FT                   /db_xref="GOA:E3EF24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF24"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369183.1"
FT                   /protein_id="ADO54544.1"
FT                   /translation="MKVLIVDDEKHVRHAIRMLVHWEAYGVTEVIEAESGDQAIEVITA
FT                   LSPPVVLTDMRMPGRDGVALMEWIQANSPATRVVVVSGYDDFELVRQAIRRGGMDYILK
FT                   PVDPVEINEALSKATQAWRTAEQDRNRQTMQAMEVNRMRPHYADKLLTELISGTSLSIT
FT                   PLREELRLPPAIQVCNAAVMSTTQLDADILDKYKTRRALLGFSLMNICNEFLGTSQTGV
FT                   AFRHLERTDEIILLYWGEPARWPVLLQDIHAGIRTALRCYMHIGIGSFGTFPVGAATAY
FT                   QEARQALWKRDVLQATNWMHESSPARQTVRLPQLSEMEEELRLSALSCNASRVSMAVSS
FT                   WMEAVAVLPSVTAEQLAGWNQELDWMLARWLNDRPGDTEGEELTDESNSIPALPVDNRG
FT                   MLSLPLWKKQIENRLLAAGQALTPSHSPNNPTIRDIARYLDANYDEDISLQDIASRFYL
FT                   SREYISRKFKQEYGVNLSDYLCQIRMGKAKLLLLNDKLRLHHIAGMVGYQDEKYFGKVF
FT                   KKLEGVTPGEFRRRHSANPQPSSHITHDLPTHH"
FT   gene            complement(653291..655105)
FT                   /locus_tag="PPSC2_02915"
FT                   /old_locus_tag="PPSC2_c0561"
FT   CDS_pept        complement(653291..655105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_02915"
FT                   /old_locus_tag="PPSC2_c0561"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02915"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54545"
FT                   /db_xref="GOA:E3EF25"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF25"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428560.1"
FT                   /protein_id="ADO54545.1"
FT                   /translation="MKFHSIRSRLIWFLLIAVTLPLLLSMTMTFILTKQSLREQATQEN
FT                   ERLIFQGITNLDNYLQGLNRASIGVYNDPHFLRNLAKIPDDYRAVAEIYTTLQTMMNAS
FT                   SGIDQVYLHSFEAGQSTLITSTVPLREFRLEPFTGSIHYGPSGLFMQPSHIKHLYGFSA
FT                   VSYAEQNTKRQVFTLHRAIRNIPSSETLGVLAIDVDLEPLRSICRQLYDADTEELFLID
FT                   RNGTIVYSGKESFIGTHWKESGLLKRISKEDEHGVIEDDTALHVYGKLDANLSGWTLVK
FT                   KIPHRTLYLRATQLTQINAVITGAALLLVIVATLWISIKITEPIKRLTRYINQIQSGQL
FT                   DVDIRAMSNDEIGVLSRRFRQMMDTINNLILREYKLELANKTHQLKALQAQINPHFLYN
FT                   TLQSIGTLALQHEVPRIYSLLSSLAKMLRYNMRDHTVVTLKEEAEHVKQYLDLQKERFG
FT                   EQLEVTYQWDDEVLNDRVPKMILQPLVENYFKHGADPRLGPGKIHITACRIREGIVRIE
FT                   VENNGASIPPTELEQLQQMLKRPLKAHEESDTSEQNSIGLRNVLLRIQLHSEDGSNTLC
FT                   VDNILPHGVRFTLEIRTEPHTENHIKGE"
FT   gene            655313..656194
FT                   /gene="amyD1"
FT                   /locus_tag="PPSC2_02920"
FT                   /old_locus_tag="PPSC2_c0562"
FT   CDS_pept        655313..656194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyD1"
FT                   /locus_tag="PPSC2_02920"
FT                   /old_locus_tag="PPSC2_c0562"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54546"
FT                   /db_xref="GOA:E3EF26"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF26"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369185.1"
FT                   /protein_id="ADO54546.1"
FT                   /translation="MNRAKSSQWLQQWIFVGPSTLFFVIIIVIPFMLGMYYSFTEWNGV
FT                   ANQAKWVGLDNFSHILFNDDKFGTAFWFTVRFTVIGVVAANIFGFLLAYFLTKPLKTKN
FT                   VLRTIFFMPNVIGGLLLGFIWQFIFVKGFAAIGESTGLSFFNLSWLGDEITAFWGIVIV
FT                   FIWQTAGYLMVIYISSLTNVPRDMLEAAEIDGASRMQILRSIILPLIMPAITVCLFLAI
FT                   SWSFKMFDLNLSLTKGGPFGSTESVALNIYNEAFVNNRYGLGTAKALIFFIIVALVTSL
FT                   QVRLTKSREVES"
FT   gene            656195..657031
FT                   /gene="amyC1"
FT                   /locus_tag="PPSC2_02925"
FT                   /old_locus_tag="PPSC2_c0563"
FT   CDS_pept        656195..657031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyC1"
FT                   /locus_tag="PPSC2_02925"
FT                   /old_locus_tag="PPSC2_c0563"
FT                   /product="sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02925"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54547"
FT                   /db_xref="GOA:E3EF27"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF27"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369186.1"
FT                   /protein_id="ADO54547.1"
FT                   /translation="METNNRYRVGTWATELVMILVALVFLVPFYFLFVNSVKSFGDLLT
FT                   DSAAWPQTFVWSNYARAWSITRFPEALWNSLVVTVVSNLLLVLISSMAAYRMVRRPTRY
FT                   NRVLFSLFVAAMVIPFQSVMIPLVKVVSTLDLMNSISGLVICYLGFGAPMSIFLFHGFV
FT                   KGVPVEVEEAATVDGCTPYGVFFRIVYPLMLPMMVTVIILNTLWIWNDYLLPSLVLQKA
FT                   ELRTIPIATYAFFGQYTKQWDLALPALVLGILPVIAFFLAMQKYIIQGIMAGSVKG"
FT   gene            657119..658414
FT                   /gene="msmE1"
FT                   /locus_tag="PPSC2_02930"
FT                   /old_locus_tag="PPSC2_c0564"
FT   CDS_pept        657119..658414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msmE1"
FT                   /locus_tag="PPSC2_02930"
FT                   /old_locus_tag="PPSC2_c0564"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54548"
FT                   /db_xref="GOA:E3EF28"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF28"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308556.1"
FT                   /protein_id="ADO54548.1"
FT                   /translation="MKTHTFKKKAQAMILLFAAFALVLAGCNSSGGQNAGNEEVKEKTI
FT                   HIFQFKVEIAEALNRMKAEYEATHPGIKLDIQTVGGGSDYGAALKAKFASGEQPDIFNV
FT                   GGYRELDTWLEYLEDLSDQPWVGDVVDVAKEPMTKDGKLYGQPMNLEGYGFIYNKDLFK
FT                   KAGITEPPKTLSELEAAAQKLQAAGITPFSNGYQEFWVLGNHLLNVAFANQPDPSAFVK
FT                   GLNDGTAKIPGNAVFAEWIKLLDLTLKYGNSKPLTTDYNTQVTNFATGKAAMMQQGNWT
FT                   QVQIDGINPKLNLGILPMPIGEDATAGDKLFVGVANNWVVNKNSSVKAEAKEFLNWIVT
FT                   SEQGKKYITKEFKFIPAFKSIKGEEADMGQLGAEVVKYSQENKLLGWFFSRYPEGAQQE
FT                   FGSQMQAYVAGKSDAGKLFEDFQRTWDNLKTK"
FT   gene            complement(658498..659037)
FT                   /gene="ywjB"
FT                   /locus_tag="PPSC2_02935"
FT                   /old_locus_tag="PPSC2_c0565"
FT   CDS_pept        complement(658498..659037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywjB"
FT                   /locus_tag="PPSC2_02935"
FT                   /old_locus_tag="PPSC2_c0565"
FT                   /product="deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02935"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54549"
FT                   /db_xref="GOA:E3EF29"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF29"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369188.1"
FT                   /protein_id="ADO54549.1"
FT                   /translation="MKDLKSNEVVLYIAMSLDGYIAMPDGAVDWLYDVKGDGGDNGYAE
FT                   FYDTVSTVLMGRLTYEEVLKLSDDFPYAGKPCYVLTRSLTEQQQAPHVTFTDEALSELV
FT                   PRLQKQSEGLVWLVGGGQLVQAFMQAGLLEKAIIAIIPKVLGQGIPLFPEGTLPSTFQL
FT                   QEIERRGDIVLLHYHL"
FT   gene            659141..660073
FT                   /gene="yobV3"
FT                   /locus_tag="PPSC2_02940"
FT                   /old_locus_tag="PPSC2_c0566"
FT   CDS_pept        659141..660073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yobV3"
FT                   /locus_tag="PPSC2_02940"
FT                   /old_locus_tag="PPSC2_c0566"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54550"
FT                   /db_xref="GOA:E3EF30"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF30"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369189.1"
FT                   /protein_id="ADO54550.1"
FT                   /translation="MNERRIALMRILDSRKKYTARELAERFGVSVRTIQRDLDYLQQTG
FT                   LPLYTETGPHGGYRALPNRLLPPLHLARDEALGLFLMLQLLEDIPDIPFGSVRGHLSDH
FT                   YYAELPQDVQDSIDQLKDYISFRMIPTHADSPYTSLILEAALNKRRVNMHYRSASGTKW
FT                   TQVYPIGLYFDHGYWYMPAHNKDRIILYRSDRVITITILDETLDSLPTLQAWLASEDSR
FT                   VGIPSKIKFTALGARLAESDTLFHNVSHQEGLGQEWHGHIPVEEFRYVSRLLLKYGPEA
FT                   EVVYPQELRMLVRKLLQDSLNPYLKDDEE"
FT   gene            660219..663344
FT                   /gene="helZ"
FT                   /locus_tag="PPSC2_02945"
FT                   /old_locus_tag="PPSC2_c0567"
FT   CDS_pept        660219..663344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="helZ"
FT                   /locus_tag="PPSC2_02945"
FT                   /old_locus_tag="PPSC2_c0567"
FT                   /product="DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02945"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54551"
FT                   /db_xref="GOA:E3EF31"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF31"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308559.1"
FT                   /protein_id="ADO54551.1"
FT                   /translation="MNQPLYGIWLGDVFFCFSGETSEPRIDAWSSVIRRLTLKGDLRPF
FT                   RQAALRLAEVRIPNNARVETAGRGGKRRSMLGRTLEGLALEPRETMALLTRMDEKGCAA
FT                   SGITLGEEMQYWQKAAYFALELMQRGEIVPSLTEARPSGPRRRGPDAAVGVWIPRLREE
FT                   EDIRRFHELAAAMPAVCMAAPAVFAGKEPETREDAAGMVLYSFLCAVVHAETTAVLAAS
FT                   DRELGRYRADYRRGGSPLAELWWNSLLTGSRQVAIQGTPAEMEELVLQASSLKGSTMPI
FT                   TEREAKEPVEGQLRLCLRLEPSLEESIQEWRITFWAESDAEPGLRLPALALWAYPERDL
FT                   VRGEIVYRQVQAQLLTRLGQAAEAAPILQEALNRPYPEGLTLEPEMFFRFLTEAVPSLQ
FT                   KNGITVQMPSRWSREGRRRAGLRLKMRSTEQGAKPDGVIADTSSVGINRMISFDAEAVL
FT                   GDTTLTMEELESIVAANLPYVRLGGEWIEVDPKEIRQVLRFIKRGENGEMSLSEWMHLA
FT                   AENESAGEASWKGLSIFGAESAGLLASLAEGGVLRSVEPRPVPETLHGALRPYQERGFQ
FT                   WLAAMRGLGFGVCLADDMGLGKTIQVITCLLDGGIGADDQRPALIICPTSLLGNWQREL
FT                   KRFSPDLSLYIHHGNQRLHGELFQENVREYDIVLTTYHLAGRDGSDLSAVYWSSIVLDE
FT                   AQYIKNARTKQAQSVMKLSAPHRIAMTGTPVENRLSELWSIFQFLNPGYLGTASSFRQR
FT                   YSLAGEERGSALRELHRLVSPFMLRRLKSDPDIRKDLPEKLELKSYCVLTPEQAGLYRG
FT                   VVDQLLGTLDGQVGMARKGLVLSSLTKLKQICDHPGLIIPGRADSSKTENSGKMERLLE
FT                   LVETIRENNESALIFTQYVSMGELLVSRLAKILGEEPYFLHGGLAKTRRDEMVHNFQQG
FT                   KGPNIFVLSLRAGGVGLNLTRASHVIHYDRWWNPAVENQATDRVFRIGQSRNVQVHKLI
FT                   CQGTLEERIDELIESKKALSEQVVGSGEHWLTEMSDDELRGLIALQNDVWIE"
FT   gene            663365..664090
FT                   /gene="M1-706"
FT                   /locus_tag="PPSC2_02950"
FT                   /old_locus_tag="PPSC2_c0568"
FT   CDS_pept        663365..664090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-706"
FT                   /locus_tag="PPSC2_02950"
FT                   /old_locus_tag="PPSC2_c0568"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54552"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF32"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369191.1"
FT                   /protein_id="ADO54552.2"
FT                   /translation="MTRPQVKLKVTDGRWIVELDGNGPEGKSTGVPFAHPVQWTGPVPV
FT                   LNLEQRGAWLEQLKAEPLDIYRLLKGEACLSLDEIVQLAAETAISSRENGVGAVEDVKK
FT                   ALQTGLENEPQHCPALIGMTQEELLEYVFSAWAGELSHMQRTSPALEPTSRAEGGRSGT
FT                   AAISEWIAESAAEGALHRPGAGFHAIEIRLPQKLASKKETDITSLLPGLPRAEEALKLI
FT                   RERVAERAQAAIPQKRHNP"
FT   gene            664242..665147
FT                   /gene="yodJ"
FT                   /locus_tag="PPSC2_02955"
FT                   /old_locus_tag="PPSC2_c0569"
FT   CDS_pept        664242..665147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yodJ"
FT                   /locus_tag="PPSC2_02955"
FT                   /old_locus_tag="PPSC2_c0569"
FT                   /product="peptidase M15"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02955"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54553"
FT                   /db_xref="GOA:E3EF33"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF33"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308561.1"
FT                   /protein_id="ADO54553.1"
FT                   /translation="MKRHIQQTRTSQRWTKALIPGLILPGLLLAACQQGGSGGQESEPL
FT                   KSSTTVQENVQPSTQTDAGNGSTSAGQASADTGSGQADPVMALRSQSALQATVKEEDGT
FT                   AVVTNATSDTVVVNKKRSLPVGYVPDDLVEPQVPFSFEGPHEKRHLRKEAAEALEKLFD
FT                   GAKKDGIELRAVSGYRSYKRQVSIFDNNVKTKGQEYASKVSAVPGTSEHQTGLSIDVSS
FT                   PSVGNVLEQSFGASKEGQWLEQHAPEYGFIIRYMQGKEDVTGYVYEPWHIRYVGVDIAE
FT                   DVAKQGLTLEEYFDENNIKL"
FT   gene            665599..665793
FT                   /gene="M1-708"
FT                   /locus_tag="PPSC2_02960"
FT   CDS_pept        665599..665793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-708"
FT                   /locus_tag="PPSC2_02960"
FT                   /product="M1-708"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02960"
FT                   /db_xref="EnsemblGenomes-Tr:AKA44182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D5ZCC2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016819501.1"
FT                   /protein_id="AKA44182.1"
FT                   /translation="MYWVWHEPAFRSMDQREGSVFTLDLAQRLLDHYTVLGGKTYEFIY
FT                   SVLDPQLKKVHLFVKEVDL"
FT   gene            665793..666131
FT                   /locus_tag="PPSC2_02965"
FT                   /old_locus_tag="PPSC2_c0571"
FT   CDS_pept        665793..666131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_02965"
FT                   /old_locus_tag="PPSC2_c0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02965"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54555"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF35"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019686022.1"
FT                   /protein_id="ADO54555.1"
FT                   /translation="MEHSWETMKSKPGSRARMAAFALMLAVPAALTGCGDDEYYDCDEL
FT                   PVSEQTACRDSGSSGYYYGGSTYYSGGSSYHSSRSSSSSYRKSSSSSSSSHSGFGSSGS
FT                   RSGFFSGG"
FT   gene            666133..667566
FT                   /gene="gspS"
FT                   /locus_tag="PPSC2_02970"
FT                   /old_locus_tag="PPSC2_c0572"
FT   CDS_pept        666133..667566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspS"
FT                   /locus_tag="PPSC2_02970"
FT                   /old_locus_tag="PPSC2_c0572"
FT                   /product="glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54556"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF36"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369195.1"
FT                   /protein_id="ADO54556.1"
FT                   /translation="MSMRTIRQLPYEHDELFKGEISHMIPYHRMYGKSYCVPALTVYRE
FT                   SELAELQAASEAVHRIYRKVQQFIQRYMPDEYLVERLGIHPGLLRAARMEAAPDGITRQ
FT                   DWIVGEAGIKCIENNTDTPTGIPEVAYLEGKLLEVLRCEGMSRDDIDLHGPSSGMDEAI
FT                   QSALTELIHFYSRKGLGTKVYFTCYEWHIEDQTNTKYIMRLCEQAGFEVVYAPLEELEI
FT                   IPNEGLYHRGEQIHILYRLYPLEYLIEDREEDTGLEVGQALMDMVADGKIGLINPPQHI
FT                   ITQSKGFTATVWSLYERNEQTPAFCGFRLFDERELEVIQTYLLPTYFEPSVFLQNKEPY
FT                   VAKGIWGREGKGTHLIEQPEPEKRLEGVLGVAQNAKADQPDLHHQADAPLTPEQEEAAH
FT                   IAAYYEEQPKIYQRLWPMQSAEVQTEEGLFHGYVLTGIFVIGGRFAGVLPRIGEKVTGD
FT                   MAYYCAAAVANEPSNPPAV"
FT   gene            667638..668051
FT                   /gene="yshE1"
FT                   /locus_tag="PPSC2_02975"
FT                   /old_locus_tag="PPSC2_c0573"
FT   CDS_pept        667638..668051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yshE1"
FT                   /locus_tag="PPSC2_02975"
FT                   /old_locus_tag="PPSC2_c0573"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02975"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54557"
FT                   /db_xref="GOA:E3EF37"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF37"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308564.1"
FT                   /protein_id="ADO54557.1"
FT                   /translation="MDSHISLGNALGNVGIGLLILFAILIIGYFVFSLLTRYNDNQEIA
FT                   RGNEAAGIYMGAKLLGLCIIVGMVSYSSHSWLDMLTWSAVGIVVLCLVYVIFDLVTPRT
FT                   KVCEEIAKGNVALAQLLRSIIIGVSFVVGTFLM"
FT   gene            668289..669365
FT                   /gene="mviM1"
FT                   /locus_tag="PPSC2_02980"
FT                   /old_locus_tag="PPSC2_c0574"
FT   CDS_pept        668289..669365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviM1"
FT                   /locus_tag="PPSC2_02980"
FT                   /old_locus_tag="PPSC2_c0574"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54558"
FT                   /db_xref="GOA:E3EF39"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF39"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308575.1"
FT                   /protein_id="ADO54558.1"
FT                   /translation="MSTSTSPTLPIRMGIIGLGLIAEYHIRSLHSMSGVSIVAVSDVNA
FT                   NRLQAIGEQLQLPASKRYSHYEALIRDPEVDAILSLTPNDVHFDIIRIALEEHKAVLAE
FT                   KPLTLTWSEAGQLKKLYTANPVPLLVHYKHRYGAAFQYTKQLLDEHKLGKIYNIQFRYL
FT                   MDAFSPYRQHPYTWRHNLAKAGSGVVGDTASHIIDLARFLIGEFKSVAALLHIITPERP
FT                   DPVTGLPVKVDVEDLAAFHGIIGDNTVGTFITHKNAIGKRHDIEVDIYGELGTLHASLN
FT                   NRESIRIVLRDLEHPDAEYETWAVPAIYNHTADGDFVKLARGEFVDRAPLFDDGYNNQW
FT                   VLEKILQSWRENGRLVEV"
FT   gene            complement(669420..670898)
FT                   /gene="ydiC1"
FT                   /locus_tag="PPSC2_02985"
FT                   /old_locus_tag="PPSC2_c0576"
FT   CDS_pept        complement(669420..670898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiC1"
FT                   /locus_tag="PPSC2_02985"
FT                   /old_locus_tag="PPSC2_c0576"
FT                   /product="multidrug MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02985"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54560"
FT                   /db_xref="GOA:E3EF40"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF40"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369199.1"
FT                   /protein_id="ADO54560.1"
FT                   /translation="MSSTTTTATTAATYQENIEVQKKRWMILIVLNLFTFMSTLDGSIV
FT                   NIALPVLSRTLHLPVAQIEWVTTAYLMAICTAILFFGKLGDMVGKIKIFKIGTIIFILG
FT                   SLLCGLSSSLSLLLISRIIQAIGASMTMANSQGIVTDIFPSTERGKALGLIGTFVSLGS
FT                   IAGPSLGGIIVSSLGWQYIFWVNVPIGLIAVFLGWRLLPKDLIKVKDKIDVPGSLVFAI
FT                   FILTLFVGLLLGQQVGYGDPRIIASLVVAVVAFAIFIWLELRRPQPLLQLALFKNPLFS
FT                   LSILCAFLVFVANFCFNIISPFYAQNMLNLSPFYAGFLLMLFPISMVIVAPLSGALSDK
FT                   IGSELLTFAGLVVMVVAQIGLAELHAGSSIPLVGLWIAMLGIGSGLFQSPNNSLIMSKV
FT                   PRTQLGSAGSVNSLVRNVGMVVGITLATTILFNVMSKEAGYRVTGLVPGHPEIFLEGMH
FT                   VVFMTSASICLVSALLTGWRLIGTKRARTQQEKR"
FT   gene            671063..671485
FT                   /gene="slyA3"
FT                   /locus_tag="PPSC2_02990"
FT                   /old_locus_tag="PPSC2_c0577"
FT   CDS_pept        671063..671485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyA3"
FT                   /locus_tag="PPSC2_02990"
FT                   /old_locus_tag="PPSC2_c0577"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54561"
FT                   /db_xref="GOA:E3EF41"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF41"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308578.1"
FT                   /protein_id="ADO54561.1"
FT                   /translation="MRKKPIGKLISHLYRRNQKILSKKLAPYGIGSGGQHSFLKLILQR
FT                   PGITQEQLTNELKFDKATTARSVKQLEESGYIERKTDPNDRRSQLVSPTAKALEFAPVL
FT                   QAILDELNAGLVHNLSEEEEDLLIDLLQKISIDPDE"
FT   gene            complement(671605..672183)
FT                   /gene="ydeS"
FT                   /locus_tag="PPSC2_02995"
FT                   /old_locus_tag="PPSC2_c0578"
FT   CDS_pept        complement(671605..672183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeS"
FT                   /locus_tag="PPSC2_02995"
FT                   /old_locus_tag="PPSC2_c0578"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_02995"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54562"
FT                   /db_xref="GOA:E3EF42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF42"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016819508.1"
FT                   /protein_id="ADO54562.1"
FT                   /translation="MQSKRGRPRNVESQKSILAASYDLLLEQGFGAVTVEKIAERAKVS
FT                   KATIYKWWPNKAAVVMDGFLSATMARLPVPDTGRVLDDILIHATNLVRFLISREGKIIT
FT                   ELIGEGQLDAGLSEAYRTRYFHPRRLEARHLIERGIERGELKEHLDVELCIDLIYGPVF
FT                   YRLLVTGYPLDDAYVRQLVMNAFEGISLD"
FT   gene            672372..673595
FT                   /gene="ydeR1"
FT                   /locus_tag="PPSC2_03000"
FT                   /old_locus_tag="PPSC2_c0579"
FT   CDS_pept        672372..673595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeR1"
FT                   /locus_tag="PPSC2_03000"
FT                   /old_locus_tag="PPSC2_c0579"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54563"
FT                   /db_xref="GOA:E3EF43"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF43"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369202.1"
FT                   /protein_id="ADO54563.1"
FT                   /translation="MQREQQAVEGNRISNWMMFLLAAACGLIVANLYYAQTLVGPIHVA
FT                   MDLSSTTAGFIVTLTQIGYVVGLLFIVPISDIIENRRLMVVSLIITVCALLVAAFAPNA
FT                   TLFLTASLFIGVGSVVAQILVPYATYLASEEQRGRVVGNVMSGLLLGIMFARPLASFIT
FT                   SIWGWQAVFIMSAIVLTLLTILLSRALPERKPVPTVSYSKLILSLGTLFKQTPALRRRA
FT                   LYQACLFGAFSLFWTVVPLRLADDFGMSQQGIALFALVGVGGAIAAPIAGRLADKGWSK
FT                   GLTGLAMVIAALSFLVIYIFQSHSTAALILLFVSAITLDMAVSGNLVLGQRVIYSLGSE
FT                   ARGRLNGLFMSIFFIGGAIGSSLGGWSYALGGWNFSALIGVILPVLALLYYFTEKETGG
FT                   DVRKKQIG"
FT   gene            complement(673610..674038)
FT                   /gene="M1-716"
FT                   /locus_tag="PPSC2_03005"
FT                   /old_locus_tag="PPSC2_c0580"
FT   CDS_pept        complement(673610..674038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-716"
FT                   /locus_tag="PPSC2_03005"
FT                   /old_locus_tag="PPSC2_c0580"
FT                   /product="M1-716"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03005"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54564"
FT                   /db_xref="GOA:E3EF44"
FT                   /db_xref="InterPro:IPR025058"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF44"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308581.1"
FT                   /protein_id="ADO54564.1"
FT                   /translation="MLELLTWAVGGILFVLSGMHLYWVFGGQKGAKAAIPSTGTDLLFK
FT                   PSKIGTSIVAILLALAAWFVLELGRVVPIQFFHFFYFYGAGLLSCLFILRSIGDFKWVG
FT                   FFKRKKGTVFAKWDTVLYSPLCFLLGTAILMMMLLRTA"
FT   gene            complement(674051..674605)
FT                   /gene="tetR1"
FT                   /locus_tag="PPSC2_03010"
FT                   /old_locus_tag="PPSC2_c0581"
FT   CDS_pept        complement(674051..674605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetR1"
FT                   /locus_tag="PPSC2_03010"
FT                   /old_locus_tag="PPSC2_c0581"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54565"
FT                   /db_xref="GOA:E3EF45"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF45"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017428020.1"
FT                   /protein_id="ADO54565.2"
FT                   /translation="MPKIIVTEEQWIQKGMERFEQGGIDQLIVEKMATALGCSKSSFYW
FT                   YFTNRSSYIRQIVETWKAQTTQQVMTASITHATADERIREVLTQMFGKTKRGDFLFYLR
FT                   KLSLKDDSYRSLLNEVEQMRMEFMKELLVQKGMQPEKASQRSWMLYHYYLGWYERLKQE
FT                   TLSEEAIQQHIHMIWTEWISN"
FT   gene            675153..677066
FT                   /gene="thrS"
FT                   /locus_tag="PPSC2_03015"
FT                   /old_locus_tag="PPSC2_c0583"
FT   CDS_pept        675153..677066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="PPSC2_03015"
FT                   /old_locus_tag="PPSC2_c0583"
FT                   /product="threonine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03015"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54567"
FT                   /db_xref="GOA:E3EF47"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF47"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369206.1"
FT                   /protein_id="ADO54567.1"
FT                   /translation="MSIQVKLPDGAVREYEQGVTIADVAGSISSGLKKNAVAGKVNGKA
FT                   VDLNTVLDENVDLEIITLDGADGLEIYRHSTAHLLAQALKRIYGEKNVKLGIGPVIDSG
FT                   FYYDIDIENPLSVDDLAKIEKEMAKITQENLPITRRVVSREEATRIFGEMEDPLKLELI
FT                   RDLPEEAEITIYDQGEFFDLCRGPHLPSTGRIKAFKLLSVAGAYWRGDSNNKMLQRIYG
FT                   TAFPKKAQLDEHLHLLEEAKKRDHRKLGKELELFMFSEEAPGMPFYLPKGMVVRTALED
FT                   YSRDIQRLHGYEEVRTPLMMNNRLWEQSGHYEHYKENMYFSEVDETTFALKPMNCPGHM
FT                   LVFKNELHSYRDLPIRISEFGQVHRHELSGALNGMMRVRTFCQDDAHIFVTPGQIEKEI
FT                   TDVIKLINEMYSVFGFDFTVELSTRPDDFMGEPALWDQAEQALQNVLDHLGINYRINAG
FT                   DGAFYGPKIDFHILDALKRSWQCGTIQLDFQMPEKFDLTYVGEDNQKHRPVVIHRAIYG
FT                   SIDRFMGILTEHFTGAFPLWLAPVHAKLLPVSENYIETANEVQEALLKAGLRVEVDTRN
FT                   EKLGYKIREAQLEKVPYMFVIGENEKTTGTVAVRKRGEGDLGSFSIADIVEKISTEIHE
FT                   KQ"
FT   gene            complement(677226..678026)
FT                   /gene="relA1"
FT                   /locus_tag="PPSC2_03020"
FT                   /old_locus_tag="PPSC2_c0584"
FT   CDS_pept        complement(677226..678026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA1"
FT                   /locus_tag="PPSC2_03020"
FT                   /old_locus_tag="PPSC2_c0584"
FT                   /product="GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54568"
FT                   /db_xref="GOA:E3EF48"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF48"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016819513.1"
FT                   /protein_id="ADO54568.1"
FT                   /translation="MNEPDWKHLNAVPLPLQEFQLQLDQNSVDAKQLEEWKKIPVLYQL
FT                   ALEELKNKIKLIQTEWKLIDGFSPIEHIKTRIKEPHSIVEKVRRKGHEVTLDNILREIH
FT                   DIAGMRVVCAFVKDIYRLMDHLRTREDIRILEVKDYIAHPKPNGYQSLHVIVEIPLILF
FT                   EGTRWIKVEIQLRTLAMDFWASMEHILYYKFDKKVPEHVVNGLTEAARATYELDQKMLK
FT                   LRGEILSLSEEQDVEEAPVKRAEESALKALSLPADHATSRSQTC"
FT   gene            678303..678764
FT                   /gene="luxS"
FT                   /locus_tag="PPSC2_03025"
FT                   /old_locus_tag="PPSC2_c0586"
FT   CDS_pept        678303..678764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="PPSC2_03025"
FT                   /old_locus_tag="PPSC2_c0586"
FT                   /product="S-ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03025"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54570"
FT                   /db_xref="GOA:E3EF50"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF50"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007428584.1"
FT                   /protein_id="ADO54570.1"
FT                   /translation="MAKVESFQLDHTIVKAPYVRAAGVEHDEKGSTVQKYDLRFLQPNE
FT                   DALPTAAVHTLEHLLATYLRDEIKGIIDISPMGCRTGFYLILWNEHEPEEIALALEKTL
FT                   KRILETTEVPAVTALECGNYKDHSLFSAQEYVKIVLEAGISRDPFKRVF"
FT   gene            678770..679540
FT                   /gene="fabG3"
FT                   /locus_tag="PPSC2_03030"
FT                   /old_locus_tag="PPSC2_c0587"
FT   CDS_pept        678770..679540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG3"
FT                   /locus_tag="PPSC2_03030"
FT                   /old_locus_tag="PPSC2_c0587"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54571"
FT                   /db_xref="GOA:E3EF51"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF51"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019686029.1"
FT                   /protein_id="ADO54571.1"
FT                   /translation="MISIDLSHQTAVVTGGKSGIGKGIVELFIQSGAKVISADISYEEP
FT                   YRVVNSQLVETQLDISKPDDIERWCNLLISETGVPDILVNCAGTSTMDYVIDSELADWE
FT                   KVFSINSTGLYVASKRFAKEMVDARKPGRIIQIASQAGKNGYRAMGGYCASKHAVLGLT
FT                   KVMAIELAPHQILVNAVCPGIVETPMKHRERIEGGVIRGMTAQDIYEEDCSQVPLGRTA
FT                   EVEDVANVVLFLASPLSAYMTGQAINVTGGMTMH"
FT   gene            679570..680451
FT                   /gene="metQ1"
FT                   /locus_tag="PPSC2_03035"
FT                   /old_locus_tag="PPSC2_c0588"
FT   CDS_pept        679570..680451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ1"
FT                   /locus_tag="PPSC2_03035"
FT                   /old_locus_tag="PPSC2_c0588"
FT                   /product="metal ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03035"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54572"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF52"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369211.1"
FT                   /protein_id="ADO54572.1"
FT                   /translation="MKKSFVLLLGISLLLVAAGCGNKSTDSNGSSSASGAETQKVVIGS
FT                   MGSDAQIWKHIAQSQAAKDAKLDIEVKEINGGIETNNATRQGDVDVNAFQSWAYLVSYN
FT                   KESKADLKAIATTYLEPMGIYSQKFKSIDEVTDGALVALADNPANTARGLKLLEASGLI
FT                   KLKADFNDALGTVNDITSNPKNLKFELIDDKTGPRVIQDVGLVLIGNTIALEGGLNVLK
FT                   DSLFHEEISQATKNNINVLVTSSDKANDKGLQKLADLYHNEDTQKYIKDEFGGTKVEVK
FT                   EPVSYLEGQTAK"
FT   gene            complement(680529..681356)
FT                   /gene="msmR1"
FT                   /locus_tag="PPSC2_03040"
FT                   /old_locus_tag="PPSC2_c0589"
FT   CDS_pept        complement(680529..681356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msmR1"
FT                   /locus_tag="PPSC2_03040"
FT                   /old_locus_tag="PPSC2_c0589"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54573"
FT                   /db_xref="GOA:E3EF53"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF53"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369212.1"
FT                   /protein_id="ADO54573.1"
FT                   /translation="MIEYLPRSKQHSELYLTQFGIEKCIPSHFFGPAIRDHYLLHYVLD
FT                   GEGTFEVGGFSYRLRKGQWFLICPQVITYYQADAVNPWSYCWFGFNGTLAETLLKQAAL
FT                   TMTSPILYFEGDHLIYQYLQQMNESSGCLKARETRLTGLLYLMLSELIEFSPAASSDQK
FT                   EGRAEIYVEKVKDFIEMNYAQKITIEHIAHFIGLNRSYLCSLFKQRVNTSIQDYLIRYR
FT                   INKACEMMGNAELSIGDISRSVGYNDPLLFSKIFKKVKGFSPKHYRAETHAQI"
FT   gene            681597..683780
FT                   /gene="melA1"
FT                   /locus_tag="PPSC2_03045"
FT                   /old_locus_tag="PPSC2_c0590"
FT   CDS_pept        681597..683780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="melA1"
FT                   /locus_tag="PPSC2_03045"
FT                   /old_locus_tag="PPSC2_c0590"
FT                   /product="alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03045"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54574"
FT                   /db_xref="GOA:E3EF54"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF54"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369213.1"
FT                   /protein_id="ADO54574.1"
FT                   /translation="MAIIVQEQPGLFHLQSSGMSYIIQIVDGFPVHVYWGDRLKHREPM
FT                   ADLLLHTPTTAGLDRLPQEYPQYGSGDFRTPAYQVELEDGTRITELKYDGYRIIKGKPS
FT                   LPGLPAVYTENEAEADTLELELKDAFSGLKVVLLYTVFADRNVIARSARLSNEGEQSLR
FT                   LLRALSASVDFSGKSDLEFMYLSGAWAREGNITRKPILQGETRIDSKRGMSSHQLNPFT
FT                   ALVTQETTERHGEAFGFSLVYSGGFEAGAELDSFGSTRFSIGVNSFDFSWLLSPGESFQ
FT                   TPEAVMVYSGQGLGEMSRTYHRLYRTRLCRGTYRDEERPILVNNWEATYFDFNADKLVS
FT                   IAKEGAELGIELFVLDDGWFGKRDSDNSSLGDWYEDRRKLPDGLADVAKRINQLGLKFG
FT                   LWFEPEMISPDSELYRKHPDWCLHVPGRRRSEARWQLVLDYTRKEVRDYIYDSLAAIFS
FT                   SAPVSYVKWDMNRCLTEIGSAELPPERQSETAHRYVLGLYELLERVTTDFPHILFESCS
FT                   SGGGRFDPGMLYYMPQVWTSDNTDAVERLKIQYGTSLVYPVSATGAHVSAVPNHQVGRI
FT                   TPLDFRGDVAMSGNFGYELDLTKFTDEEKETVKRQIAVYKQIRGLVQKGDLYRLKSPFE
FT                   DNESAWMFVSEDQEDAIVYYFQVMAVPNAPWRALRLDGLNPELEYEVQSGNSGQKSIHG
FT                   GDRLMKLGLPLVYRQKDYESGWFRLRALRSNKA"
FT   gene            683911..685692
FT                   /locus_tag="PPSC2_03050"
FT                   /old_locus_tag="PPSC2_c0591"
FT   CDS_pept        683911..685692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPSC2_03050"
FT                   /old_locus_tag="PPSC2_c0591"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03050"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54575"
FT                   /db_xref="GOA:E3EF55"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF55"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369214.1"
FT                   /protein_id="ADO54575.1"
FT                   /translation="MFFIRMMNDMKLRKKMTLTFISVAVLPLLLCGLFLTGKLREAVIK
FT                   DAFMQASNNVERVQNRTEELIKVPLDISYRLTNDNRMKMVASQKYDSYIEVIQAYREYT
FT                   GIRDYLQLYKEISGIRVYVPNPGALNNWEFIQPDDRIITADWYKEAIAQKGLAGWNLIK
FT                   DERYNADYLSLIRSFSVNSPGRKGVLVINVNQRQLNSILNQESFPTLIVDSRNQIVASN
FT                   EAELFGKNLSEIHADENILFQQEGSYNTLINGKASKVVIANLTPQNSWNGLRIISVFSV
FT                   SEITRDANQVIWLGGVVITASLIFAALLIYASASLLSRRLLRLSKHMTQVGAGSWETYL
FT                   HIDGKDEVGLLSREFNALVSNVNHLVQEVQETNRQKNLVEQRQNEIKFKMLASQINPHF
FT                   LFNSLESIRMEAHIRQQDDIAKAVWQLSALLRSSLEAGNDKIPLRKELEQVCCYLDLQK
FT                   FRYEDRLEYRLMVDPDLEETLVPPLIIQPLVENSIVHGLDNQAEGAVIEVKVKKIPEGV
FT                   RVMVCDNGAGFTDDRLVLVQAELAASVHEQEVQRIGLRNVNDRLVLLYGTSSALHIESE
FT                   PGKGTCIQFFIPGGETK"
FT   gene            685689..687239
FT                   /gene="araC7"
FT                   /locus_tag="PPSC2_03055"
FT                   /old_locus_tag="PPSC2_c0592"
FT   CDS_pept        685689..687239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC7"
FT                   /locus_tag="PPSC2_03055"
FT                   /old_locus_tag="PPSC2_c0592"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03055"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54576"
FT                   /db_xref="GOA:E3EF56"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF56"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308590.1"
FT                   /protein_id="ADO54576.1"
FT                   /translation="MIKVVIVDDEPKLRQGLQTLIPWESLGCIVTATAANGKEALEVIE
FT                   EKAPDVVIVDIRMPVMDGLQLIEHLRSGGHHLHFIILSGYADFEYAKQAIKYGVFGYLL
FT                   KPVDIDEMTSSIKRIRERIEEERLQEEWRKREVINRDLYLHSLLVPQEKTEDPAKLRSK
FT                   AIEADLLWTSYEVVVVYPRVSEVDRSDVAYQLSNGLKAKIEGQMMGLVTVIPPYTVLLL
FT                   NAPLRGRERREILHNEIRNAAGNVRFVAATGGAVSAPEDICKSFLKAQEAVKQSFFSEK
FT                   NRLLGPHPFFSPALDSPRLSADKAEETMEEFIFRLYYSLEVGNQTVILPLLNEAAAFFL
FT                   QQGQDEKSIKESFFFLSNAVIHKLTAGFCIELKETEEVSRFLNGIYQHDHLHDLLEETY
FT                   RFLLALAKDSEPRGKEQEFKKMIDFIHSHYTDNLKLETLAGLLNYSTAYLGQLFKNKTG
FT                   EYFNTYLDRVRIHKAKELLDQGMKVYEVAESVGYTSVNYFYSKFKRYEGCSPSEYRNP"
FT   gene            687325..688281
FT                   /gene="lplB1"
FT                   /locus_tag="PPSC2_03060"
FT                   /old_locus_tag="PPSC2_c0593"
FT   CDS_pept        687325..688281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplB1"
FT                   /locus_tag="PPSC2_03060"
FT                   /old_locus_tag="PPSC2_c0593"
FT                   /product="protein lplB"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03060"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54577"
FT                   /db_xref="GOA:E3EF57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF57"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013308591.1"
FT                   /protein_id="ADO54577.2"
FT                   /translation="MKAVTANSENVYNKPKRNAWKVFKSQRYLYYMSIPFVIWVFIFQY
FT                   LPLWGWTMAFQKYRPGLSFFEQKWVGLEHFRTLFQDDHFYQVLRNTLAMSLMGLVAGFI
FT                   VPVVFALLLNEVRIQVVKRFVQTVSYLPHFVSWVVAAGIVTKMLSADGGVVNDMLMGLG
FT                   IIDQPVQFMAQGKLFWWVVTFGDIWKETGWNAIIYLAAIAGIGPELYEAARVDGASRFQ
FT                   QMWHITLPGIRPTIIILLIMSIGHLLGTGFEKQFLLGNHLVIDYSEVLDLYALNYGLAM
FT                   GRYSFGTAINIFNSVISLVLLFAANGIFKRYTNESIM"
FT   gene            688296..689234
FT                   /gene="lplC1"
FT                   /locus_tag="PPSC2_03065"
FT                   /old_locus_tag="PPSC2_c0594"
FT   CDS_pept        688296..689234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplC1"
FT                   /locus_tag="PPSC2_03065"
FT                   /old_locus_tag="PPSC2_c0594"
FT                   /product="sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03065"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54578"
FT                   /db_xref="GOA:E3EF58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF58"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369217.1"
FT                   /protein_id="ADO54578.1"
FT                   /translation="MEAVKSTTPVSGLNNKLKSKSPQDRILEVVVYVFMIVVTVLTIYP
FT                   FLNVLAISFNDSVDTIRGGITIWPRQFTLKNYDLIFTYEGLITGFKISFLRTVIGTVAG
FT                   LVSGSMLAYTLARSDFQARRFISIFLAVTMYVSGGLIPGFILMKELHLIDTFAVYILPG
FT                   LVSAFNVFIIRSFIDGLPYALQESAKLDGANDFTIYWRVILPLCKPALATVALFLAVGQ
FT                   WNSWFDTYLFNGSNESLTTLQYELMKILQSTTTSATNSQDAANMAERMAQVSPESVKMA
FT                   ITIIVTVPILIVYPFLQKYFVKGMTLGAVKS"
FT   gene            689273..690952
FT                   /gene="lplA3"
FT                   /locus_tag="PPSC2_03070"
FT                   /old_locus_tag="PPSC2_c0595"
FT   CDS_pept        689273..690952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA3"
FT                   /locus_tag="PPSC2_03070"
FT                   /old_locus_tag="PPSC2_c0595"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03070"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54579"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF59"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369218.1"
FT                   /protein_id="ADO54579.1"
FT                   /translation="MKSRKNRMIVSFVMSLTLVATLAGCSGNNPSEATKAVTTGDITLT
FT                   YFSEDSSTNWNNMKDEVGKVIAEKTGVTLDAEFAVGDPVQKISLIAATGNYPDLIAAKA
FT                   DVGKLVDAGAIIDLTDLIDKHAPNIKKMLGDKLVRTKYSLDDQSIYVIPTWSAVEEEKI
FT                   KPDVGFKLQHRVVKEAGYPDIRTVQDFEKVIKDYITKHPTDENGNKNIGLSLNADDWHM
FT                   YQVTNSGFQTTGGPDDGEYFIDQKTHQATYHFRRPEEKEYFRWLNHMNAIGLLDPESFV
FT                   QKTDQFKAKVASGRVLGLADPEWDYGDGQNALKAEGKFDQTYGHYPVTMSKEYKDTNFW
FT                   LPGFDGGYGISISSKCKDPVRAIQFLDFLASEEGQVLNNWGIEGKHYTVKDGKRTIIPA
FT                   VLERMNNDNAAFQKESGIGLYWNLMVHYGDGIKDSTGNYFTRSYPELLTATYNKSEKEV
FT                   LKAYKIEHWKDLFPKEDEFQPRAYGAAYTMPLPNDDPAVILGAKMKDITWKRIPEAVMT
FT                   KPENFDKVWDAYMAELEKAGVQEMEQSFTKHIQDRIKLWSTN"
FT   gene            complement(691175..693145)
FT                   /gene="maNB"
FT                   /locus_tag="PPSC2_03075"
FT                   /old_locus_tag="PPSC2_c0597"
FT   CDS_pept        complement(691175..693145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maNB"
FT                   /locus_tag="PPSC2_03075"
FT                   /old_locus_tag="PPSC2_c0597"
FT                   /product="beta-mannanase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03075"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54581"
FT                   /db_xref="GOA:E3EF61"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF61"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017428011.1"
FT                   /protein_id="ADO54581.1"
FT                   /translation="MPDPWKRRSFGILSFVLLSFLLVSLNLIPSLAKAESAPLVTGVED
FT                   RTVMNASQDLSTNGNSSPIVVSSKDAILQGYGVEKRDTPYTGDTLYKGDGYVSFFYDYD
FT                   PNSGKSDGTATFKVNVPTAGLYRLSLGYYIPADTGSKDTSIKVNGTMAENITLATPPKG
FT                   AAVNEKMVTKIMLNAGTNELTFSRGWGYYGIEYVKVEFANLPAAISKMEAEDGAITGKV
FT                   SIEAADTGYSGTGYATFKGTGSLTFAYNAASSGLYNLAIGYSNPNGDKKTQLVVNGQTS
FT                   ETSLPTTASYTEVSGGKLMLSAGNNTIQFNVDSDQYHIDYVKLSAVSPPKLYQIEKKPV
FT                   NPNATAETKALMGYLVDSYGSNILSGQHTLEDAQWIKDQTGKYPAILSTDMMDYSPSRI
FT                   EHGATSTEVEKAIQWAKEGGIVTFAWHWNAPKGLHDIPGKEWWRGFYTDATTFDVQYAL
FT                   THPESEEYQLILRDIDAIAAQLKRLQDAHVPVLWRPLHEAEGKWFWWGAQGPDSAKQLY
FT                   HIMYDRLTNYHHLNNLIWVWNSESPEWYPGDDVVDIVSVDIYNQAANYSPSIGKYDSLV
FT                   NLVQGKKLVGLSENGPIGDPELLQTYSAHWLFFTTWTGDFIRNGQYNSLDHLIKVFNSD
FT                   YVITRDELPQDLFTSSKNEAE"
FT   gene            693585..694379
FT                   /gene="yncA"
FT                   /locus_tag="PPSC2_03080"
FT                   /old_locus_tag="PPSC2_c0598"
FT   CDS_pept        693585..694379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yncA"
FT                   /locus_tag="PPSC2_03080"
FT                   /old_locus_tag="PPSC2_c0598"
FT                   /product="GCN5 family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54582"
FT                   /db_xref="GOA:E3EF62"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF62"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019686035.1"
FT                   /protein_id="ADO54582.1"
FT                   /translation="MISHRLLSDETVYQLTNQIHRDQHLLFYSYLSQRKEQAKFVGQYV
FT                   DDKLTGVLAYFCGLSFPAFSFHCINREKLNFSALIAFTEELIQLKKNTVCGTILCDRDL
FT                   QLFQSHGLITGNPQRFLTMKHMDQSKLLDSNLAELVKENEVPEIVDLLRNGGMKFFTRS
FT                   ELEQYPFLGIKECGHFIAVGGFHFYDSKLVELGNIYTSPAHRGKGLAKHLTSQLTKLGR
FT                   TLSSDVYLGVLEENQAAVQLYKGLGYEVTAEQTIVDFKLSID"
FT   gene            694404..694670
FT                   /gene="M1-733"
FT                   /locus_tag="PPSC2_03085"
FT                   /old_locus_tag="PPSC2_c0599"
FT   CDS_pept        694404..694670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-733"
FT                   /locus_tag="PPSC2_03085"
FT                   /old_locus_tag="PPSC2_c0599"
FT                   /product="M1-733"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54583"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF63"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369222.1"
FT                   /protein_id="ADO54583.1"
FT                   /translation="MEQNDINIHQLTDEIYQILHKRMDKLGIAYGIVTEFSYNPEEPTS
FT                   WTISIENSKIVLTSAILFQYMKQHHNLEDTLTHFMRDHFSYFN"
FT   gene            694801..696135
FT                   /gene="M1-734"
FT                   /locus_tag="PPSC2_03090"
FT                   /old_locus_tag="PPSC2_c0600"
FT   CDS_pept        694801..696135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="M1-734"
FT                   /locus_tag="PPSC2_03090"
FT                   /old_locus_tag="PPSC2_c0600"
FT                   /product="M1-734"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54584"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF64"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016819526.1"
FT                   /protein_id="ADO54584.1"
FT                   /translation="MWFGKNETQLDRIKDKLNQAMHKDKDFSVFGASSHQYRVKEKLTA
FT                   KELADWQAHNQVILPEPYALFLTNIGNGGAGPYYGIYPIEKATSYTEHQALLAKSVLHL
FT                   GMAKEEWNHLIEPLTKDEDIPDEEYDDARNKVLGGMLCIGTQGCEYDMYLVLEGKYRGR
FT                   IVYTSDFHPDHPFFFVYEDSFLDWYERWLDEIILDYDIGWFGSRMPGDENALIQMYQSA
FT                   PNEEIQAKALDGMFKFKEVAQPTLGFLKNIAEQSPKNRTTAVWLICKTSFDTGRKYLLE
FT                   LLQSDEHRDFLQALTILHASSKTANLTEFIPVILQSLDRIHDPETLRYAGYILEDYGEI
FT                   TLRNFAPFLCHADPKMQTTAIYAARSCENKQGSWQIIEQMLIGSDPQVLKNMILYWGII
FT                   PHEKLLPYYKAVWPEYKKNPNFKEKFIGCLRELHLPDDYFNKDES"
FT   gene            complement(696248..697009)
FT                   /gene="dltE1"
FT                   /locus_tag="PPSC2_03095"
FT                   /old_locus_tag="PPSC2_c0601"
FT   CDS_pept        complement(696248..697009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltE1"
FT                   /locus_tag="PPSC2_03095"
FT                   /old_locus_tag="PPSC2_c0601"
FT                   /product="cytochrome C553"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03095"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54585"
FT                   /db_xref="GOA:E3EF65"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3EF65"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013369224.1"
FT                   /protein_id="ADO54585.1"
FT                   /translation="MKLSGNTILITGGSTGIGLAFAERFLKAGNKVIVTGRREHVLQKA
FT                   KEKLPSLITHVSDLNIESERIAVSDWVTTNYPEVNVLVNNAGIQQRFNVLKTDAKNNWD
FT                   YFSKEITTNIEAPFHLSMLLAPYFATKEEATIINVTSGLAFTPFVIAPIYSATKAALHS
FT                   FTISLRHQLSDTSVEVIEVVPPAVNTDLGGAGLHTQGEPLDDFADGIFKGLEEGKIEIG
FT                   YGTSVARLRMSRNEVDEHVENMYKATKNSIE"
FT   gene            complement(697306..699741)
FT                   /gene="yjcD"
FT                   /locus_tag="PPSC2_03100"
FT                   /old_locus_tag="PPSC2_c0603"
FT   CDS_pept        complement(697306..699741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcD"
FT                   /locus_tag="PPSC2_03100"
FT                   /old_locus_tag="PPSC2_c0603"
FT                   /product="ATP-dependent DNA helicase UvrD"
FT                   /db_xref="EnsemblGenomes-Gn:PPSC2_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ADO54587"
FT                   /db_xref="GOA:E3EF67"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"