(data stored in SCRATCH3701 zone)

EMBL: CP002217

ID   CP002217; SV 1; circular; genomic DNA; STD; PRO; 4077097 BP.
XX
AC   CP002217; ADJP01000000-ADJP01000040;
XX
PR   Project:PRJNA37721;
XX
DT   24-SEP-2010 (Rel. 106, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Burkholderia sp. CCGE1003 chromosome 1, complete sequence.
XX
KW   GSC:MIGS:2.1.
XX
OS   Burkholderia sp. CCGE1003
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia.
XX
RN   [1]
RP   1-4077097
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Daligault H., Davenport K., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G.,
RA   Martinez-Romero E., Rogel M.A., Auchtung J., Tiedje J.M., Woyke T.;
RT   "Complete sequence of chromosome1 of Burkholderia sp. CCGE1003";
RL   Unpublished.
XX
RN   [2]
RP   1-4077097
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Daligault H., Davenport K., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G.,
RA   Martinez-Romero E., Rogel M.A., Auchtung J., Tiedje J.M., Woyke T.;
RT   ;
RL   Submitted (16-SEP-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 465c3fb616a682eb38b8c1f3fff66a60.
DR   BioSample; SAMN00008621.
DR   EnsemblGenomes-Gn; BC1003_R0001.
DR   EnsemblGenomes-Gn; BC1003_R0002.
DR   EnsemblGenomes-Gn; BC1003_R0003.
DR   EnsemblGenomes-Gn; BC1003_R0004.
DR   EnsemblGenomes-Gn; BC1003_R0005.
DR   EnsemblGenomes-Gn; BC1003_R0006.
DR   EnsemblGenomes-Gn; BC1003_R0007.
DR   EnsemblGenomes-Gn; BC1003_R0008.
DR   EnsemblGenomes-Gn; BC1003_R0009.
DR   EnsemblGenomes-Gn; BC1003_R0010.
DR   EnsemblGenomes-Gn; BC1003_R0011.
DR   EnsemblGenomes-Gn; BC1003_R0012.
DR   EnsemblGenomes-Gn; BC1003_R0013.
DR   EnsemblGenomes-Gn; BC1003_R0014.
DR   EnsemblGenomes-Gn; BC1003_R0015.
DR   EnsemblGenomes-Gn; BC1003_R0016.
DR   EnsemblGenomes-Gn; BC1003_R0017.
DR   EnsemblGenomes-Gn; BC1003_R0018.
DR   EnsemblGenomes-Gn; BC1003_R0019.
DR   EnsemblGenomes-Gn; BC1003_R0020.
DR   EnsemblGenomes-Gn; BC1003_R0021.
DR   EnsemblGenomes-Gn; BC1003_R0022.
DR   EnsemblGenomes-Gn; BC1003_R0023.
DR   EnsemblGenomes-Gn; BC1003_R0024.
DR   EnsemblGenomes-Gn; BC1003_R0025.
DR   EnsemblGenomes-Gn; BC1003_R0027.
DR   EnsemblGenomes-Gn; BC1003_R0028.
DR   EnsemblGenomes-Gn; BC1003_R0029.
DR   EnsemblGenomes-Gn; BC1003_R0030.
DR   EnsemblGenomes-Gn; BC1003_R0031.
DR   EnsemblGenomes-Gn; BC1003_R0032.
DR   EnsemblGenomes-Gn; BC1003_R0033.
DR   EnsemblGenomes-Gn; BC1003_R0034.
DR   EnsemblGenomes-Gn; BC1003_R0035.
DR   EnsemblGenomes-Gn; BC1003_R0036.
DR   EnsemblGenomes-Gn; BC1003_R0037.
DR   EnsemblGenomes-Gn; BC1003_R0038.
DR   EnsemblGenomes-Gn; BC1003_R0039.
DR   EnsemblGenomes-Gn; BC1003_R0040.
DR   EnsemblGenomes-Gn; BC1003_R0041.
DR   EnsemblGenomes-Gn; BC1003_R0042.
DR   EnsemblGenomes-Gn; BC1003_R0043.
DR   EnsemblGenomes-Gn; BC1003_R0044.
DR   EnsemblGenomes-Gn; BC1003_R0045.
DR   EnsemblGenomes-Gn; BC1003_R0046.
DR   EnsemblGenomes-Gn; BC1003_R0047.
DR   EnsemblGenomes-Gn; BC1003_R0048.
DR   EnsemblGenomes-Gn; BC1003_R0049.
DR   EnsemblGenomes-Gn; BC1003_R0050.
DR   EnsemblGenomes-Gn; BC1003_R0051.
DR   EnsemblGenomes-Gn; BC1003_R0052.
DR   EnsemblGenomes-Gn; BC1003_R0053.
DR   EnsemblGenomes-Gn; BC1003_R0054.
DR   EnsemblGenomes-Gn; BC1003_R0055.
DR   EnsemblGenomes-Gn; BC1003_R0056.
DR   EnsemblGenomes-Gn; BC1003_R0057.
DR   EnsemblGenomes-Gn; BC1003_R0058.
DR   EnsemblGenomes-Gn; BC1003_R0059.
DR   EnsemblGenomes-Gn; BC1003_R0060.
DR   EnsemblGenomes-Gn; BC1003_R0061.
DR   EnsemblGenomes-Gn; BC1003_R0062.
DR   EnsemblGenomes-Gn; BC1003_R0063.
DR   EnsemblGenomes-Gn; BC1003_R0064.
DR   EnsemblGenomes-Gn; BC1003_R0065.
DR   EnsemblGenomes-Gn; BC1003_R0066.
DR   EnsemblGenomes-Gn; BC1003_R0067.
DR   EnsemblGenomes-Gn; BC1003_R0068.
DR   EnsemblGenomes-Gn; BC1003_R0069.
DR   EnsemblGenomes-Gn; EBG00001461189.
DR   EnsemblGenomes-Gn; EBG00001461190.
DR   EnsemblGenomes-Gn; EBG00001461191.
DR   EnsemblGenomes-Gn; EBG00001461192.
DR   EnsemblGenomes-Gn; EBG00001461193.
DR   EnsemblGenomes-Gn; EBG00001461194.
DR   EnsemblGenomes-Gn; EBG00001461195.
DR   EnsemblGenomes-Gn; EBG00001461196.
DR   EnsemblGenomes-Gn; EBG00001461197.
DR   EnsemblGenomes-Gn; EBG00001461198.
DR   EnsemblGenomes-Gn; EBG00001461199.
DR   EnsemblGenomes-Gn; EBG00001461200.
DR   EnsemblGenomes-Gn; EBG00001461201.
DR   EnsemblGenomes-Gn; EBG00001461202.
DR   EnsemblGenomes-Gn; EBG00001461203.
DR   EnsemblGenomes-Gn; EBG00001461204.
DR   EnsemblGenomes-Gn; EBG00001461205.
DR   EnsemblGenomes-Gn; EBG00001461206.
DR   EnsemblGenomes-Gn; EBG00001461207.
DR   EnsemblGenomes-Gn; EBG00001461208.
DR   EnsemblGenomes-Gn; EBG00001461209.
DR   EnsemblGenomes-Gn; EBG00001461210.
DR   EnsemblGenomes-Gn; EBG00001461211.
DR   EnsemblGenomes-Gn; EBG00001461212.
DR   EnsemblGenomes-Gn; EBG00001461213.
DR   EnsemblGenomes-Gn; EBG00001461214.
DR   EnsemblGenomes-Gn; EBG00001461215.
DR   EnsemblGenomes-Gn; EBG00001461216.
DR   EnsemblGenomes-Gn; EBG00001461217.
DR   EnsemblGenomes-Gn; EBG00001461218.
DR   EnsemblGenomes-Gn; EBG00001461219.
DR   EnsemblGenomes-Gn; EBG00001461220.
DR   EnsemblGenomes-Gn; EBG00001461221.
DR   EnsemblGenomes-Gn; EBG00001461222.
DR   EnsemblGenomes-Gn; EBG00001461223.
DR   EnsemblGenomes-Gn; EBG00001461224.
DR   EnsemblGenomes-Gn; EBG00001461225.
DR   EnsemblGenomes-Gn; EBG00001461226.
DR   EnsemblGenomes-Gn; EBG00001461227.
DR   EnsemblGenomes-Gn; EBG00001461228.
DR   EnsemblGenomes-Gn; EBG00001461229.
DR   EnsemblGenomes-Gn; EBG00001461230.
DR   EnsemblGenomes-Gn; EBG00001461231.
DR   EnsemblGenomes-Gn; EBG00001461232.
DR   EnsemblGenomes-Gn; EBG00001461233.
DR   EnsemblGenomes-Gn; EBG00001461234.
DR   EnsemblGenomes-Gn; EBG00001461235.
DR   EnsemblGenomes-Gn; EBG00001461236.
DR   EnsemblGenomes-Gn; EBG00001461237.
DR   EnsemblGenomes-Gn; EBG00001461238.
DR   EnsemblGenomes-Gn; EBG00001461239.
DR   EnsemblGenomes-Gn; EBG00001461240.
DR   EnsemblGenomes-Gn; EBG00001461241.
DR   EnsemblGenomes-Gn; EBG00001461242.
DR   EnsemblGenomes-Gn; EBG00001461243.
DR   EnsemblGenomes-Gn; EBG00001461244.
DR   EnsemblGenomes-Gn; EBG00001461245.
DR   EnsemblGenomes-Gn; EBG00001461246.
DR   EnsemblGenomes-Gn; EBG00001461247.
DR   EnsemblGenomes-Gn; EBG00001461248.
DR   EnsemblGenomes-Gn; EBG00001461249.
DR   EnsemblGenomes-Gn; EBG00001461250.
DR   EnsemblGenomes-Gn; EBG00001461251.
DR   EnsemblGenomes-Gn; EBG00001461252.
DR   EnsemblGenomes-Gn; EBG00001461253.
DR   EnsemblGenomes-Gn; EBG00001461254.
DR   EnsemblGenomes-Gn; EBG00001461255.
DR   EnsemblGenomes-Gn; EBG00001461256.
DR   EnsemblGenomes-Gn; EBG00001461257.
DR   EnsemblGenomes-Gn; EBG00001461258.
DR   EnsemblGenomes-Gn; EBG00001461259.
DR   EnsemblGenomes-Gn; EBG00001461260.
DR   EnsemblGenomes-Gn; EBG00001461261.
DR   EnsemblGenomes-Gn; EBG00001461262.
DR   EnsemblGenomes-Gn; EBG00001461263.
DR   EnsemblGenomes-Gn; EBG00001461264.
DR   EnsemblGenomes-Gn; EBG00001461265.
DR   EnsemblGenomes-Gn; EBG00001461266.
DR   EnsemblGenomes-Gn; EBG00001461267.
DR   EnsemblGenomes-Gn; EBG00001461268.
DR   EnsemblGenomes-Gn; EBG00001461269.
DR   EnsemblGenomes-Gn; EBG00001461270.
DR   EnsemblGenomes-Gn; EBG00001461271.
DR   EnsemblGenomes-Gn; EBG00001461272.
DR   EnsemblGenomes-Tr; BC1003_R0001-1.
DR   EnsemblGenomes-Tr; BC1003_R0002-1.
DR   EnsemblGenomes-Tr; BC1003_R0003-1.
DR   EnsemblGenomes-Tr; BC1003_R0004-1.
DR   EnsemblGenomes-Tr; BC1003_R0005-1.
DR   EnsemblGenomes-Tr; BC1003_R0006-1.
DR   EnsemblGenomes-Tr; BC1003_R0007-1.
DR   EnsemblGenomes-Tr; BC1003_R0008-1.
DR   EnsemblGenomes-Tr; BC1003_R0009-1.
DR   EnsemblGenomes-Tr; BC1003_R0010-1.
DR   EnsemblGenomes-Tr; BC1003_R0011-1.
DR   EnsemblGenomes-Tr; BC1003_R0012-1.
DR   EnsemblGenomes-Tr; BC1003_R0013-1.
DR   EnsemblGenomes-Tr; BC1003_R0014-1.
DR   EnsemblGenomes-Tr; BC1003_R0015-1.
DR   EnsemblGenomes-Tr; BC1003_R0016-1.
DR   EnsemblGenomes-Tr; BC1003_R0017-1.
DR   EnsemblGenomes-Tr; BC1003_R0018-1.
DR   EnsemblGenomes-Tr; BC1003_R0019-1.
DR   EnsemblGenomes-Tr; BC1003_R0020-1.
DR   EnsemblGenomes-Tr; BC1003_R0021-1.
DR   EnsemblGenomes-Tr; BC1003_R0022-1.
DR   EnsemblGenomes-Tr; BC1003_R0023-1.
DR   EnsemblGenomes-Tr; BC1003_R0024-1.
DR   EnsemblGenomes-Tr; BC1003_R0025-1.
DR   EnsemblGenomes-Tr; BC1003_R0027-1.
DR   EnsemblGenomes-Tr; BC1003_R0028-1.
DR   EnsemblGenomes-Tr; BC1003_R0029-1.
DR   EnsemblGenomes-Tr; BC1003_R0030-1.
DR   EnsemblGenomes-Tr; BC1003_R0031-1.
DR   EnsemblGenomes-Tr; BC1003_R0032-1.
DR   EnsemblGenomes-Tr; BC1003_R0033-1.
DR   EnsemblGenomes-Tr; BC1003_R0034-1.
DR   EnsemblGenomes-Tr; BC1003_R0035-1.
DR   EnsemblGenomes-Tr; BC1003_R0036-1.
DR   EnsemblGenomes-Tr; BC1003_R0037-1.
DR   EnsemblGenomes-Tr; BC1003_R0038-1.
DR   EnsemblGenomes-Tr; BC1003_R0039-1.
DR   EnsemblGenomes-Tr; BC1003_R0040-1.
DR   EnsemblGenomes-Tr; BC1003_R0041-1.
DR   EnsemblGenomes-Tr; BC1003_R0042-1.
DR   EnsemblGenomes-Tr; BC1003_R0043-1.
DR   EnsemblGenomes-Tr; BC1003_R0044-1.
DR   EnsemblGenomes-Tr; BC1003_R0045-1.
DR   EnsemblGenomes-Tr; BC1003_R0046-1.
DR   EnsemblGenomes-Tr; BC1003_R0047-1.
DR   EnsemblGenomes-Tr; BC1003_R0048-1.
DR   EnsemblGenomes-Tr; BC1003_R0049-1.
DR   EnsemblGenomes-Tr; BC1003_R0050-1.
DR   EnsemblGenomes-Tr; BC1003_R0051-1.
DR   EnsemblGenomes-Tr; BC1003_R0052-1.
DR   EnsemblGenomes-Tr; BC1003_R0053-1.
DR   EnsemblGenomes-Tr; BC1003_R0054-1.
DR   EnsemblGenomes-Tr; BC1003_R0055-1.
DR   EnsemblGenomes-Tr; BC1003_R0056-1.
DR   EnsemblGenomes-Tr; BC1003_R0057-1.
DR   EnsemblGenomes-Tr; BC1003_R0058-1.
DR   EnsemblGenomes-Tr; BC1003_R0059-1.
DR   EnsemblGenomes-Tr; BC1003_R0060-1.
DR   EnsemblGenomes-Tr; BC1003_R0061-1.
DR   EnsemblGenomes-Tr; BC1003_R0062-1.
DR   EnsemblGenomes-Tr; BC1003_R0063-1.
DR   EnsemblGenomes-Tr; BC1003_R0064-1.
DR   EnsemblGenomes-Tr; BC1003_R0065-1.
DR   EnsemblGenomes-Tr; BC1003_R0066-1.
DR   EnsemblGenomes-Tr; BC1003_R0067-1.
DR   EnsemblGenomes-Tr; BC1003_R0068-1.
DR   EnsemblGenomes-Tr; BC1003_R0069-1.
DR   EnsemblGenomes-Tr; EBT00001615412.
DR   EnsemblGenomes-Tr; EBT00001615413.
DR   EnsemblGenomes-Tr; EBT00001615414.
DR   EnsemblGenomes-Tr; EBT00001615415.
DR   EnsemblGenomes-Tr; EBT00001615416.
DR   EnsemblGenomes-Tr; EBT00001615417.
DR   EnsemblGenomes-Tr; EBT00001615418.
DR   EnsemblGenomes-Tr; EBT00001615419.
DR   EnsemblGenomes-Tr; EBT00001615420.
DR   EnsemblGenomes-Tr; EBT00001615421.
DR   EnsemblGenomes-Tr; EBT00001615422.
DR   EnsemblGenomes-Tr; EBT00001615423.
DR   EnsemblGenomes-Tr; EBT00001615424.
DR   EnsemblGenomes-Tr; EBT00001615425.
DR   EnsemblGenomes-Tr; EBT00001615426.
DR   EnsemblGenomes-Tr; EBT00001615427.
DR   EnsemblGenomes-Tr; EBT00001615428.
DR   EnsemblGenomes-Tr; EBT00001615429.
DR   EnsemblGenomes-Tr; EBT00001615430.
DR   EnsemblGenomes-Tr; EBT00001615431.
DR   EnsemblGenomes-Tr; EBT00001615432.
DR   EnsemblGenomes-Tr; EBT00001615433.
DR   EnsemblGenomes-Tr; EBT00001615434.
DR   EnsemblGenomes-Tr; EBT00001615435.
DR   EnsemblGenomes-Tr; EBT00001615436.
DR   EnsemblGenomes-Tr; EBT00001615437.
DR   EnsemblGenomes-Tr; EBT00001615438.
DR   EnsemblGenomes-Tr; EBT00001615439.
DR   EnsemblGenomes-Tr; EBT00001615440.
DR   EnsemblGenomes-Tr; EBT00001615441.
DR   EnsemblGenomes-Tr; EBT00001615442.
DR   EnsemblGenomes-Tr; EBT00001615443.
DR   EnsemblGenomes-Tr; EBT00001615444.
DR   EnsemblGenomes-Tr; EBT00001615445.
DR   EnsemblGenomes-Tr; EBT00001615446.
DR   EnsemblGenomes-Tr; EBT00001615447.
DR   EnsemblGenomes-Tr; EBT00001615448.
DR   EnsemblGenomes-Tr; EBT00001615449.
DR   EnsemblGenomes-Tr; EBT00001615450.
DR   EnsemblGenomes-Tr; EBT00001615451.
DR   EnsemblGenomes-Tr; EBT00001615452.
DR   EnsemblGenomes-Tr; EBT00001615453.
DR   EnsemblGenomes-Tr; EBT00001615454.
DR   EnsemblGenomes-Tr; EBT00001615455.
DR   EnsemblGenomes-Tr; EBT00001615456.
DR   EnsemblGenomes-Tr; EBT00001615457.
DR   EnsemblGenomes-Tr; EBT00001615458.
DR   EnsemblGenomes-Tr; EBT00001615459.
DR   EnsemblGenomes-Tr; EBT00001615460.
DR   EnsemblGenomes-Tr; EBT00001615461.
DR   EnsemblGenomes-Tr; EBT00001615462.
DR   EnsemblGenomes-Tr; EBT00001615463.
DR   EnsemblGenomes-Tr; EBT00001615464.
DR   EnsemblGenomes-Tr; EBT00001615465.
DR   EnsemblGenomes-Tr; EBT00001615466.
DR   EnsemblGenomes-Tr; EBT00001615467.
DR   EnsemblGenomes-Tr; EBT00001615468.
DR   EnsemblGenomes-Tr; EBT00001615469.
DR   EnsemblGenomes-Tr; EBT00001615470.
DR   EnsemblGenomes-Tr; EBT00001615471.
DR   EnsemblGenomes-Tr; EBT00001615472.
DR   EnsemblGenomes-Tr; EBT00001615473.
DR   EnsemblGenomes-Tr; EBT00001615474.
DR   EnsemblGenomes-Tr; EBT00001615475.
DR   EnsemblGenomes-Tr; EBT00001615476.
DR   EnsemblGenomes-Tr; EBT00001615477.
DR   EnsemblGenomes-Tr; EBT00001615478.
DR   EnsemblGenomes-Tr; EBT00001615479.
DR   EnsemblGenomes-Tr; EBT00001615480.
DR   EnsemblGenomes-Tr; EBT00001615481.
DR   EnsemblGenomes-Tr; EBT00001615482.
DR   EnsemblGenomes-Tr; EBT00001615483.
DR   EnsemblGenomes-Tr; EBT00001615484.
DR   EnsemblGenomes-Tr; EBT00001615485.
DR   EnsemblGenomes-Tr; EBT00001615486.
DR   EnsemblGenomes-Tr; EBT00001615487.
DR   EnsemblGenomes-Tr; EBT00001615488.
DR   EnsemblGenomes-Tr; EBT00001615489.
DR   EnsemblGenomes-Tr; EBT00001615490.
DR   EnsemblGenomes-Tr; EBT00001615491.
DR   EnsemblGenomes-Tr; EBT00001615492.
DR   EnsemblGenomes-Tr; EBT00001615493.
DR   EnsemblGenomes-Tr; EBT00001615494.
DR   EnsemblGenomes-Tr; EBT00001615495.
DR   EuropePMC; PMC4029289; 24883196.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP002217.
DR   SILVA-SSU; CP002217.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085515
CC   Source DNA and organism available from James M. Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James M. Tiedje (tiedjej@msu.edu)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Burkholderia sp. CCGE1003
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Host, Rhizosphere, Rhizosphere-colonizing
CC   num_replicons       :: 2
CC   ref_biomaterial     :: Missing
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Facultative
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi03923
CC   Funding Program     :: DOE-CSP 2007
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4077097
FT                   /organism="Burkholderia sp. CCGE1003"
FT                   /chromosome="1"
FT                   /strain="CCGE1003"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:640512"
FT   gene            362..1975
FT                   /locus_tag="BC1003_0001"
FT   CDS_pept        362..1975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   bxe:Bxe_A4462 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56010"
FT                   /db_xref="GOA:E1T3W2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3W2"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADN56010.1"
FT                   /translation="MNEFWQHCSALLERELTPQQYVTWIKPLAPVAFDAAANTLSIAAP
FT                   NRFKLDWVKSQFSGRIADMARDFWHAPIDVQFVLDPKAGMRAPAAAAPAPARAGSSSAP
FT                   GGNFGGNAAGGPGSHSGGNAAVDAAVGAVQAAQAARANPALAAQNANARAAAEDAADLD
FT                   LPSLDANEAAAARRTWRPGQSASSNGSGDNDSMYERSKLNPVLTFDNFVTGKANQLARA
FT                   AAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLMDKAGARIRYIHAEQYVSDVV
FT                   KAYQRKAFDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDT
FT                   YPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEFVSLNEDVAFFVAKHL
FT                   RSNVRELEGALRKILAYSKFHGREITIELTKEALKDLLTVQNRQISVENIQKTVADFYS
FT                   IKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADE
FT                   RSKDAQLNHELHVLEQTLKG"
FT   gene            2201..3304
FT                   /locus_tag="BC1003_0002"
FT   CDS_pept        2201..3304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: bpy:Bphyt_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56011"
FT                   /db_xref="GOA:E1T3W3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3W3"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADN56011.1"
FT                   /translation="MQLVKTERDNLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGGETVATTVAARKLLDILRAMPDGQVTLTLNDKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQAKDYGASLVVPQKTFRQLLGMVHFSMAQQDIRYYLNGMLLVV
FT                   DGDQLMAVATDGHRLAFSSMKIEGSFARQEVIIPRKTILELQRLLEDIDDTLKIDIAQT
FT                   QVKFTFGQVELVSKLVEGKFPDFQRVIPKSHKNQFVIGREELQRSLQRAAILTSDKFKG
FT                   VRCIIEPGQLKIMSTNADQEEAQEELEIAYDGDSVDIGFNVTYLLDVLANLKVDMLQVS
FT                   LGDASSSALITIPENDEFKYVVMPMRI"
FT   gene            3418..5889
FT                   /locus_tag="BC1003_0003"
FT   CDS_pept        3418..5889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; KEGG: DNA gyrase, B subunit; SMART: DNA
FT                   topoisomerase II; ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56012"
FT                   /db_xref="GOA:E1T3W4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3W4"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADN56012.1"
FT                   /translation="MTETNNTQPDNSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGLH
FT                   HLVFEVLDNSIDEALAGYCNDIQVIIHADNSISITDNGRGVPTGLKMDDKHEPKRSAAE
FT                   IVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSAWLRLTVRRDGKKHFMEFHRGVPQ
FT                   NRVLEEIDGVMTSPMQVIGDTENRGTEVHFMADETIFGNVEYHYDILAKRIRELSFLNN
FT                   GVRIRLLDQRSGKEEDFAFVGGVKGFVEYINKTKSVLHPTIFHITGEKDGVGVEVAMQW
FT                   NDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVLNKYIADHEVAKKAKVETSGDDMRE
FT                   GLSCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEEVVAKALEEFLLETPNDAKIICSKIV
FT                   DAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKSEIYIVEGDSAGGSAKQG
FT                   RDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLITALGCGIGKDDYNLEKLRYHRII
FT                   IMTDADVDGAHIRTLLLTFFYRQMPEMIERGYIYIAQPPLFKIKAGKDERYLKDETEVN
FT                   AHILKLALQGSELLPSENGTAITGEALGELARAYLLAQAVVDRLSRLYDAGALEAVMDG
FT                   VAIDLSSEAAAEASAKALEAKLRDDALKPEVTVTQMYDPVRELRSLKVARTHHGNQKIS
FT                   VFDEEFQLTADYQQLVNTANTFKGLIGSGAVIKRGERSMAVSDFKSAMKWLLADAERNV
FT                   SKQRYKGLGEMNPEQLWETTMDPAVRRLLRVQIEDAIAADGIFTTLMGDDVEPRRAFIE
FT                   SNALRAGNIDV"
FT   gene            6190..7980
FT                   /locus_tag="BC1003_0004"
FT   CDS_pept        6190..7980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_02497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56013"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3W5"
FT                   /inference="similar to AA sequence:KEGG:PFHG_02497"
FT                   /protein_id="ADN56013.1"
FT                   /translation="MADIRLKLLGDLNPSSRTSDSTLAPKYIASITAENLAALLKYRRQ
FT                   KGKHPIRLEPESTIKVDTEVQRGMTDVGNLRQEDKKIDEIRDALLGKANAAPRIFLGSL
FT                   IWNVRESGLGVFKKLKVSEDGQAPEYELAIKAPAIWLTDSAHRHFGIAEAFRAFSQNPQ
FT                   EYPRFRTDYEFSIEIYNLDRNGERLLFNELNAKQKKITAAKQLQLDTTSDIGILKDRIA
FT                   TIDLEEKRMLYQNIEVNSNTNDRHTLMTMSVFTSSIKEMFSNSLIAEVAKDEELRDELA
FT                   QYYCDYLYKLQETVRTRVTIGGADTTIAPFSNLYTEIISPAENEAAEHDDEVAEQILQA
FT                   ARDQAKRRNAEIRAEEKIHSNSFIRALFWLGGQIRMMKSWPQVVEQIQNKLVLEKDGRY
FT                   FQKSNTKLTTPNERGVAIGVIKDDGALNIQVQTHVIQEIKRFLIEELDLEVSRELFYRD
FT                   GGMTHSLTAAGSNKVAWLSRVNSNRLELQLDFITGSEVIVDKSLLRMKVVPEMKDDNWK
FT                   DAERRGEKRLIAHDLNQVAGWQHPVYGDSLAKYTATFVLDTPAFSRPTADTFTLKLDVY
FT                   GFDLAGNPTQDEFSLACQAQ"
FT   gene            7984..8787
FT                   /locus_tag="BC1003_0005"
FT   CDS_pept        7984..8787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmm:PMM0427 putative penicillin binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56014"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3W6"
FT                   /inference="similar to AA sequence:KEGG:PMM0427"
FT                   /protein_id="ADN56014.1"
FT                   /translation="MGLYSASLVLDRVHANRCLTGNESLLVGEYIYCRRCLPSIYGGKL
FT                   STVDKKKSGELISSLLEENKAIRETMRDSQLARQRLQSFFALLLANGGESLEAFVHAYM
FT                   FLFWEHLAFLGAIAGHPRGQLFWMAKSPPTGTAYKEVGGTAGSVIERLSQEGVQIDLAA
FT                   VDPQAETLWLLEIKRDDLDDRAVGQMLRYFDRAVRCLPSREFRALDINHVRPVIVLESV
FT                   DPRLWRSIPLHFRELLEIYAFGKPGGVDNPLRLARVRRQLLSGVG"
FT   gene            complement(8815..9699)
FT                   /locus_tag="BC1003_0006"
FT   CDS_pept        complement(8815..9699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abc:ACICU_00637 pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56015"
FT                   /db_xref="GOA:E1T3W7"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3W7"
FT                   /inference="similar to AA sequence:KEGG:ACICU_00637"
FT                   /protein_id="ADN56015.1"
FT                   /translation="MNALLKEIDKNSTITSAQLALAQASLSEVKELTEYQDQKSNRLLT
FT                   IVAFLTAAAGALFAKFFDAYPLIDGNRVMVLEGAIAANYLVFALFLFFVACGALVTFHA
FT                   TLTRFVWDDQTADDSKLYDVALSYLFYKSIIQTSPVAWSRAFVGDSSKPVTEQTLRNQY
FT                   YKNYIIESYLVAAKFGDKLRFLEPAQRLLQWAIRFLIVWLLSVFIVVAIVPREQKNAST
FT                   ETTENRQSEQRSESTGANNVASQPIIGLQHQEQLQDHSHGTQNTSEVIASGTKPVSPVS
FT                   GSVHHSASSALGK"
FT   gene            complement(10050..10805)
FT                   /locus_tag="BC1003_0007"
FT   CDS_pept        complement(10050..10805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0007"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: dau:Daud_1387 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56016"
FT                   /db_xref="GOA:E1T3W8"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3W8"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADN56016.1"
FT                   /translation="MDQRIILSDADNTLWDTDAVFAGAQLQFLEEVEAAIQIRCTEADR
FT                   LDFVRRYDQELALQHHLHFRYPPIMLVFALSNGLTGMSAHTAATAAISGNLTKLISIPR
FT                   GEEVVSNYQTFLNQTPPLLPGVVQGLRLAAESELPLYVITEGMIEKQRKILDSYNLSKM
FT                   IRGVFEISKSIAGFERLKQRFAPSQIAVIGDQPDRDITPAKIVGLTTVAVPSRFRPAWN
FT                   CEDEWADATYIAANYYEAVKWIQSSQFLS"
FT   gene            complement(10959..11324)
FT                   /locus_tag="BC1003_0008"
FT   CDS_pept        complement(10959..11324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0008"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="KEGG: vap:Vapar_4096 6-pyruvoyl tetrahydropterin
FT                   synthase and hypothetical protein; manually curated; PFAM:
FT                   6-pyruvoyl tetrahydropterin synthase and hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56017"
FT                   /db_xref="GOA:E1T3W9"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3W9"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ADN56017.1"
FT                   /translation="MNYELSQKFYFEAAHTLHREIDAEGSRRIHGHTYHAQVFVRGTPD
FT                   PMTKMVIDLGFLCREIERVRELLDHRFLDEISTLGPATLESLCTFILDELSKSIPAISR
FT                   VRVERTASGDACDLSTV"
FT   gene            complement(11377..12081)
FT                   /locus_tag="BC1003_0009"
FT   CDS_pept        complement(11377..12081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0009"
FT                   /product="exsB protein"
FT                   /note="KEGG: bmj:BMULJ_00115 ExsB protein; TIGRFAM: exsB
FT                   protein; PFAM: Queuosine synthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56018"
FT                   /db_xref="GOA:E1T3X0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3X0"
FT                   /inference="protein motif:TFAM:TIGR00364"
FT                   /protein_id="ADN56018.1"
FT                   /translation="MKTHALVLFSGGQDSTTCLAWALDRYQHVETIGFDYGQRHAIELE
FT                   CRQTVLASLRKQFPEWTCKLGDDHMLDLSILGQISDTALTAGKAIEMQKNGLPNTFVPG
FT                   RNLLFFTLAAAVAYRRGLQVLVGGMCETDYSGYPDCRDSTLKALQVAIALGMDQPVVIE
FT                   APLMWIDKAQTWQMASQLGGAKLVDLILDETHTCYVGDHTTQHQWGYGCGTCPACELRQ
FT                   RGYEAFVSAATV"
FT   gene            complement(12095..13171)
FT                   /locus_tag="BC1003_0010"
FT   CDS_pept        complement(12095..13171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0010"
FT                   /product="DGQHR domain protein"
FT                   /note="TIGRFAM: DGQHR domain protein; KEGG: sal:Sala_2646
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56019"
FT                   /db_xref="InterPro:IPR017601"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3X1"
FT                   /inference="protein motif:TFAM:TIGR03187"
FT                   /protein_id="ADN56019.1"
FT                   /translation="MSVYRFKAIRASQAPEHDVFTFAATPEQIWGFAEIERVGREEDGQ
FT                   LRGFQRHQIASHIKEIRDYLRREDALLPNALIVAFIGGVKVKDKGDGAVDIEIKVGDGK
FT                   PGFVVDGQQRLSALSGITKPGFQVFVSALICKDYNELRQQFVLINNTRPLPKTLIYELL
FT                   PNVEGLPERFTARKFAARIVDRLNFTRGSALYGEIRQHTNPKGVLSDTAMQKLVMNSAS
FT                   DGAIREFIKDGDFEGRAYEFVNAFFEAVVAVFGSEWIGMSPKTSRLRHGAGIVAMGFVM
FT                   EFLYSSEGATTRVEFEHGLKLLKEYTAWTSGQWRLAPNDERPWNGIQNTPSDIDLLTNY
FT                   LVRSMKRALRKPRQVANS"
FT   gene            complement(13168..14463)
FT                   /locus_tag="BC1003_0011"
FT   CDS_pept        complement(13168..14463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sal:Sala_2647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56020"
FT                   /db_xref="GOA:E1T3X2"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3X2"
FT                   /inference="similar to AA sequence:KEGG:Sala_2647"
FT                   /protein_id="ADN56020.1"
FT                   /translation="MKFLYSDTQDYVDPGYDFINDLNAPGRRRYWDDMYAHEMMDPAPY
FT                   DGLLVSMSAVRQAAGVASSKVRYTTAEEQRMLRDGVRRFLRYGGPKFKNAMILGDCGAF
FT                   AYASCETPAYPPQEVVEFYTDAGFTHGVSPDHIIFDCLTDNPPASEMAPAVVERFDITL
FT                   ANAEEFLRLTDAEGYPFEPLGAVQGWSPASMADAAVRLEKMGYRYLAIGGLVPLKVEVI
FT                   KQVLHALRNAIKPETNIHLLGFAKADTIDQFTNFGITSFDSTSPLIRAFKDAKANYYME
FT                   SPKGGLEYYAAIRIPQAIENPRLMQGIKRGIFSAEDLQKREQKALAALRKFDHGGRKVS
FT                   EALDAVMDYQRFLTLGDGLPIEKHEKELMKMRTLVERTLDEAPWKRCKCSICSAAGVEV
FT                   IIFRSSNRNKRRGFHNLGVYHKHVQRTLENHR"
FT   gene            complement(14460..15581)
FT                   /locus_tag="BC1003_0012"
FT   CDS_pept        complement(14460..15581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0012"
FT                   /product="DGQHR domain protein"
FT                   /note="TIGRFAM: DGQHR domain protein; KEGG: sal:Sala_2648
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56021"
FT                   /db_xref="InterPro:IPR017601"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3X3"
FT                   /inference="protein motif:TFAM:TIGR03187"
FT                   /protein_id="ADN56021.1"
FT                   /translation="MARKEIVVRALRTTQGEGLDVYAFFIEGADVVRIADISRVERDES
FT                   DELKGFQRPEIRSHVKGILDYLNQGNVLFPNAIILAMSPAIHFAAARGTKPTGDQGIAQ
FT                   AGTLTIPVYDEGQRVAWIVDGQQRSLALAQAGRKSIPVPVVGFVSDSLEVQREQFILVN
FT                   KAKPLPTRLINELLPETRSILLPRELSVRKVPSEICNLLNRDPESPFHKLIKRISEKGS
FT                   DTSVITDTAVIAMIRNSMNNPLGALAQYKSGGRDGVDVEGMYHVLVTYWSAVRDVFPDA
FT                   WGADPRRSRLMHSAGIEAMGVLMDRIYARLSGHGEDYKTVRKELEKMAPACRWTKGTWE
FT                   SLGVAWNEIQNTHRDIRKLQDALVRAYTSTMKQ"
FT   gene            complement(15589..16524)
FT                   /locus_tag="BC1003_0013"
FT   CDS_pept        complement(15589..16524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sal:Sala_2649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56022"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3X4"
FT                   /inference="similar to AA sequence:KEGG:Sala_2649"
FT                   /protein_id="ADN56022.1"
FT                   /translation="MSHKTIVVTNCTNRKRVGDDAVVLSAANMVGSLPSLAARWGSAIT
FT                   KSHSSGQAQDIYMGRAFSEARQVTAMLGGTLYVISAGLGVVSAQDEIPSYNLTVAEGSN
FT                   SLKPLLAQLGKQPSDWWAALIAELGKQRSVRAMLERNADALALFALPGSYIALIAEDLA
FT                   SLTQEQLGRIRIITSDHGRSLLPEQAHHVVLPYDERLEGSSYAGTRTDFPQRALRHFVE
FT                   VLSGQQLAIDDAKAAVTAAMCAFKKPIIPVRERKTDSEILMLLRKNWHRFDGASTRLLR
FT                   YLRDDALVACEQSRFRNLWNRLQQDLTTKG"
FT   gene            16686..16799
FT                   /locus_tag="BC1003_0014"
FT   CDS_pept        16686..16799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56023"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3X5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADN56023.1"
FT                   /translation="MGTYATPDPDLDEHGPAGMFRRHTVTTEVRYLIEKNQ"
FT   gene            17072..17476
FT                   /locus_tag="BC1003_0015"
FT   CDS_pept        17072..17476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0015"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="manually curated; PFAM: helix-turn-helix domain
FT                   protein; KEGG: bcm:Bcenmc03_0013 XRE family transcriptional
FT                   regulator; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56024"
FT                   /db_xref="GOA:E1T3X6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3X6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADN56024.1"
FT                   /translation="MTALGNFIRNRRKALGLTQTQLALRIGVDDAYVSAIERGLRTPDG
FT                   ATFLEGVGAALDLDLDGLRQLTEVAKRSKRYVRLPDELPLRKHQVITALVGDRLLTDAD
FT                   METIASVYAAIVRNRTVAMSAVQTTDGGLM"
FT   gene            17724..18428
FT                   /locus_tag="BC1003_0016"
FT   CDS_pept        17724..18428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56025"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3X7"
FT                   /inference="similar to AA sequence:KEGG:PputW619_0005"
FT                   /protein_id="ADN56025.1"
FT                   /translation="MKTGSCRRLALISRPPRPVRRVVTRSGSIPRGFFPSLKNGQMVAY
FT                   EQLLEADACLLFEMSPRVRRYREQPARVWFPDEDQIHRYTLDYELELIDGRRVLVEIKP
FT                   ENQLRRPEVRGRMDLIQEYMAEQEVPFLVLTDDTIRQQPRLNNLRVLWRDAPLASTPDD
FT                   SLCHITRRLISARVQTFGALTSRLSRGTALILFARGYATCSLASNVTNDTPISLSVEKD
FT                   HVWFQIAPRYGF"
FT   gene            18391..20352
FT                   /locus_tag="BC1003_0017"
FT   CDS_pept        18391..20352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0017"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   mmb:Mmol_0072 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56026"
FT                   /db_xref="GOA:E1T3X8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3X8"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADN56026.1"
FT                   /translation="MSGFRLRRGMAFEFDGIAVQIHRIWDDGTVTLEQRGTMKLSQTTE
FT                   RQLLDAYRDGRIVVSDPLRHERSSDRLMAAGRPFSDFSHELQQEAIRRKSYLDALSLSG
FT                   PPVFTPSILRPAIRCAALSRGDEKTPSPSSIYRWWKAFERTQDIRSLLPRNSARGPRGP
FT                   RTSAAIIELYIESLTETSKLLPRLSLQDAQIRLKQKLERENCMRSSADRLSMPSMRTLQ
FT                   RLFRRLSEYDVAVLCDGVDAANRTYRITKSGVPVTRILERVEVDHTPQDLFVIDGKTGL
FT                   PCGRPTLTILIDVYSRMVLGYYVSFNDTSTLSVMRALRHAILPKTPTPAVVPGIVVLHS
FT                   WVCYGRPEVLVTDNGSEFHSDALHKTCLGLGIQLLFCPARQPRFKGTVERFLKTLNHNL
FT                   SHRLPGTSLERYTERGEYDPTKHAVLTIDEYAHVLEKWVLDEYAQKIHTGIGTTPWEKW
FT                   CESARNYPPDLPANREEITAHFGISATRSLRHDGILLNGLRYADDALLPIMKTYGEGVS
FT                   VNVLYDPDDLAAILVRDPDAAEYIKVPAIHPDYAKGLRLASHKLVRRRARSIRAHVGDQ
FT                   DALLVARQEINEAVSALARSRKLRRRRQAAKIAGVSNERPTGIRPPRVSDRQPMVAREH
FT                   TRPEQRERKLMRVQRKII"
FT   gene            20365..21381
FT                   /locus_tag="BC1003_0018"
FT   CDS_pept        20365..21381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0018"
FT                   /product="TniB family protein"
FT                   /note="KEGG: bcm:Bcenmc03_0016 AAA ATPase; PFAM: TniB
FT                   family protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56027"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3X9"
FT                   /inference="protein motif:PFAM:PF05621"
FT                   /protein_id="ADN56027.1"
FT                   /translation="MDQFSPKLTSVQYDALLKFRQETILFPRFDAVYRSVSESLALYRA
FT                   TGLANHLAVYGSTGCGKTTVCNFVLGENPRVVDGERNVIPVLYASIPALATISSVAEAL
FT                   LVSLGDAFPSKGTNSSKTERLILLIRRCSVGMVILDELQHVHDRGQSPALYKVGDWIKN
FT                   LSDRVACPVVLVGIPRAKALVEANEQLRRRFGTSLILDRMTIDTDESFAEFGDVVASLS
FT                   EALPVAFRCNLQSHDTVERLHFATDGRIGYLAELLQKALLSSFQADNAPIDNTLLQKTF
FT                   TERIWSNGTGKLNPFHKDFCFRRLDRSGEPFNGGDTGRADIRTVTNWMESNSVEALS"
FT   gene            21378..23309
FT                   /locus_tag="BC1003_0019"
FT   CDS_pept        21378..23309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0019"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: ppw:PputW619_0008
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56028"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Y0"
FT                   /inference="similar to AA sequence:KEGG:PputW619_0008"
FT                   /protein_id="ADN56028.1"
FT                   /translation="MSFPLLIRDRPYPDEPMAEYLRRISDLNGYPQGPGFMRAVSGRDW
FT                   PTIKDIAQLVRLDTERLARLPEPWPSWMIRAASGKSRDNAESRVRLNRTRVRWCPACLV
FT                   EEPYMRAVWSHKLIVACARHRLMLRESCDSCGEVYSWTSAPFTWCACGRALGNMHAETA
FT                   SDAVVGLMSLCFPSDNVMPAMPRNHLPADPLSRLTPSTILNLLYTLAPLVPGYAKSLPG
FT                   IFPKLHELSHAVRYMNECAAILLSWPSGFQALLQKYVDPVPAETSIRRRFGPLYRVLYK
FT                   NLAGPEFDFMRREFEHHLGGHWYGVIDGRHRAFRGRKHPVMSGKAMRVQIKCSRETLRR
FT                   LMETGVLKGHVLNSPSGRRFVVADRSDVLNAKRILDDLLTLRVASRQLGLSRKRMRILM
FT                   GAGLIASKLRRRQGVGRWFIPRHEVNRLLELPVVRRDDLDPEESWTLGHILRHRCRDHA
FT                   TFVGFMRALLEGKITSIGRASGMRGMSGFLVSKADMELAVTDAVRLPEDGMTAQTVARR
FT                   LAVKEEVAYQLIRCGLLKSYDYHVNGRAITMVTESSLRDFQQNYIPLIEFARFRRTSPN
FT                   AAYRWLSKHGFHAVTGPSVDGMRQYFYRTLDIATAARESIMSSYAGGTRAPDGVVRLDE
FT                   SRKDLNRN"
FT   gene            23540..24388
FT                   /locus_tag="BC1003_0020"
FT   CDS_pept        23540..24388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0020"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bph:Bphy_3312
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56029"
FT                   /db_xref="GOA:E1T3Y1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Y1"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADN56029.1"
FT                   /translation="MTTDTGRYQALHSYPLNTLGRDLVVGDVHGCFSMLDAALKEMDFD
FT                   PTRDRLFGVGDLVDRGGESPDILDAVRRHQIKAVRGNHEQMILDWAMKGGPEHGRAHRA
FT                   YLASPQAGFDQIATDVAHCQGETSALIDNGGEWFIEMSCRADGSAKFKAQRIVDYFASM
FT                   PLAIEIETAHGLMGIVHADVPVDNWSSLRRALAHGENEMCETMLWDRRRWKGRAVSDFI
FT                   AGVIAVIVGHSPTYDVAQCGNVIDIDTGAAYGNKLTILNLADVPEWLAHGDRTITRNPE
FT                   R"
FT   gene            24526..24813
FT                   /locus_tag="BC1003_0021"
FT   CDS_pept        24526..24813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mms:mma_1743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56030"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Y2"
FT                   /inference="similar to AA sequence:KEGG:mma_1743"
FT                   /protein_id="ADN56030.1"
FT                   /translation="MLRDKLRALMFGIPIGVISHDVEGEKVVCLMDVPLELEYSLRSWL
FT                   WSQPELVREDSPKYSLRFVKEERMAIPWDVWEQYLSWMQVTLARAADAPD"
FT   gene            25409..28099
FT                   /locus_tag="BC1003_0022"
FT   CDS_pept        25409..28099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0022"
FT                   /product="Rhs element Vgr protein"
FT                   /note="KEGG: bch:Bcen2424_6418 rhs element Vgr protein;
FT                   TIGRFAM: Rhs element Vgr protein; type VI secretion system
FT                   Vgr family protein; PFAM: Protein of unknown function
FT                   DUF2345"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56031"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Y3"
FT                   /inference="protein motif:TFAM:TIGR01646"
FT                   /protein_id="ADN56031.1"
FT                   /translation="MPISSLTPASNPLAGLSDAFQQFDQLLSKFTQSQRLLKTQFAPDA
FT                   GLPANALLPYRLTGSEGICEPLHYRLQCLSTDIRLPLKAVTGVPVAFQITDFTGSTRTI
FT                   CAIVTGVDQLASDGGFVLSELTCEDGLSILRERVTWRVFPSKSVVDITNDILTAHIQGN
FT                   SVLAGAFRLDTGSLQESYPKRAFTMQAGESDAAFLMRLWRQEGISWYFSHSINDGWPVH
FT                   TLHLVDNPHSWQDNPAGTVRFHRADATEKDDTVTSFRAHRSVTSGGVLGGSSDYRTGRV
FT                   QQVEESSIQDQGKHGKALSATLTQYHYDSPHVADSGEHYRQINRRRQQAHELRSKYFSG
FT                   ESVVRAFSGAAGTVFSLSGHVEIDQHAAAQRRFVLTSVETEVHNNLLPQSPGDALKGGD
FT                   QNEPGYVNRFRCVRADIPVVPEYDPASAPSVGPMTARVVGAPGLEIDVDEQGRIAVQFP
FT                   FARPEDHPVAGASGTPRDSARIRFAPPWADQQAGAALWPRVGSEVLILFQHNDPDKPIA
FT                   IASLHGANHAPTQFSGAGSLPGNAALYGIRSKEVGGVGYGELQFDDTTGQTKTKLSSEY
FT                   GKTQLNQGWIGHPRAEGKSDKRGEGFELRTDLSGAIRAAQLLISTDVRASATGKVLDRQ
FT                   ELIGQLEAALAIAKQLASLSETHEADTTDTGPQQKLVDQIKQWDSGQQDGAAIAMSAPD
FT                   GIALSSPHNVVASAGTHIDVTAVQDANISAGRKILLRAAQGLSAFAKAGMKLIAGTGDI
FT                   TVQAQQGKAEIGSSERLHLYSLKELLIEAPSVVIKANGVTYSLADGKVLASSSGTHRIE
FT                   SAGFSHTGGGGGSPDLPHMPASTMKTDEKFAVATRNGRAYTSLQHQVEDETSAVRDAGK
FT                   LATDGANQNVVQDAQIRPLTLIPKL"
FT   gene            28115..29857
FT                   /locus_tag="BC1003_0023"
FT   CDS_pept        28115..29857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aci:ACIAD3425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56032"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Y4"
FT                   /inference="similar to AA sequence:KEGG:ACIAD3425"
FT                   /protein_id="ADN56032.1"
FT                   /translation="MSTSTAEMDAQTAVHQKARRRVPLQFDENGDPYFGSVTSPESFKM
FT                   RALCVMPPRHVIPVIFVPGIMGTNLSSNGKNQKEGASAWTPPNGIWQGLGEVRRRSRQT
FT                   PANRQQQMSPDAVKVDNTGPVHVPRTLFTLTEKEAKRRGWGEVHLDSYGKVLAELEMGL
FT                   NEQYSDAGTADHSLLPVWQIAKTLKYRNEDVRKHWNPVNPDLQPLSDDEFTRLDDYYYP
FT                   VWACGYNWLGSNEASSDQLVARIQEALDWYAKGKYWIPVGKVIIVTHSMGGLVARRAVQ
FT                   KAQDRILGVVHGVQPVGGAPVVYRRMRAGTETNGWFDLAGMAAAAVLGWSAADITCVMA
FT                   NSPGPLELLPTKHYPPGWLRFEQNRGGKTKELMPALPVANPYQEIYSKTAQEVWWGMID
FT                   ETLIDPAGLAADKKRLPIDVYVDTLRTAETFHDAVQLDCHPVTYAHYGSDPKQVSFGRV
FT                   VWTTSDDISADALSGLSGLKAESSTLFGKSTLAFGEQKVKLTLEGHEAPTEHDKVNAGD
FT                   GTVPLPSGALISDATPAPKAFSMTGFDHAASYKDENVLNNVLYCLAKIVQLAPAVSTLP
FT                   STKG"
FT   gene            29934..31178
FT                   /locus_tag="BC1003_0024"
FT   CDS_pept        29934..31178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS00395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56033"
FT                   /db_xref="InterPro:IPR040761"
FT                   /db_xref="InterPro:IPR041290"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Y5"
FT                   /inference="similar to AA sequence:KEGG:RS00395"
FT                   /protein_id="ADN56033.1"
FT                   /translation="MTNVKTYCFGRYLVDIPADAQINGEAYQYKYGAIEAQHVADSRVA
FT                   VKDYTARTVSSLKSTKAESGYAYDSSVDVDPQTTIVVSISKPYGRENFGIDVVRADKNV
FT                   LFTMKERSFRATVLQDDVLPSLKAKVLPNLHARGVGEIPSQSGFCLKDGFIADDGKTAQ
FT                   YEEAGITFKFPQWPGVLVSVNSSTVTKLGEPKLLERMAKAPIPDAYKSLMNSIHDIRKG
FT                   TRVAAGREGEEILSTVPTDGGYRLHQFQWEAQGSKINDPLDPTLTVEFESGMTRIDGQP
FT                   ARPKLSDEEAVRLFDAVVNSIRLRPTDGSGKVSGIEPAPTLLLGTLAQTGSVCPQSGWW
FT                   TCPEANGQEVVGGVRQHFAAGTVMPQVRVVSRTAFLDRMLGKQQEHAVNTTWKLVSFDD
FT                   EPPTEAPGDSAPNEG"
FT   gene            31198..31461
FT                   /locus_tag="BC1003_0025"
FT   CDS_pept        31198..31461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_1g25290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56034"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Y6"
FT                   /inference="similar to AA sequence:KEGG:bglu_1g25290"
FT                   /protein_id="ADN56034.1"
FT                   /translation="MKNVIRVGDPTSHGGVVETGDSTFEVDGRAVARVGDICTCPIAGH
FT                   QGCIIVEGDPAFVIGGRAVAFDGHKTSCGAVLHSTASTFGGE"
FT   gene            31588..32043
FT                   /locus_tag="BC1003_0026"
FT   CDS_pept        31588..32043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_4809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56035"
FT                   /db_xref="GOA:E1T3Y7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR033390"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Y7"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_4809"
FT                   /protein_id="ADN56035.1"
FT                   /translation="MRIFVDTEFTDFIDCDLISIALVADDGREFYAERTDFDRHACAAF
FT                   VREAVLPQLGQYPERMFSRASLHAALHEWLAQFGGGTFCMDFHGDWDLLVDILDGAPDG
FT                   WAASLVWDEVDKARLESYFQQFGGRHHALHDARALRHAVQGDMSPHC"
FT   gene            complement(32052..32264)
FT                   /locus_tag="BC1003_0027"
FT   CDS_pept        complement(32052..32264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_5758 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56036"
FT                   /db_xref="GOA:E1T3Y8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Y8"
FT                   /inference="similar to AA sequence:KEGG:Bmul_5758"
FT                   /protein_id="ADN56036.1"
FT                   /translation="MYSYEERMRAVELYLKLGKPVKATIRQLGYPTKNSLKAWCDELEM
FT                   SGDLQKGGSCSRCCAYLLAIEWQAC"
FT   gene            32787..33623
FT                   /locus_tag="BC1003_0028"
FT   CDS_pept        32787..33623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: asa:ASA_3613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56037"
FT                   /db_xref="GOA:E1T3Y9"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Y9"
FT                   /inference="similar to AA sequence:KEGG:ASA_3613"
FT                   /protein_id="ADN56037.1"
FT                   /translation="MLDKTLKVVREYPVEICVRALGVVASLTFFYYFPMLVFVTYMGYK
FT                   GFFAYDMFTSGRVGLDSFYMASELLTIILSLYVAGFITLLIRRHTAKNPDLAPPYKAAP
FT                   PYESKNRWHLLGVLFINLAIFLLLAYQIIGHAYKGPHWNDFNSTEFADAISLFFGIIAI
FT                   SCWAAMHIGVVIYQRAKRVFVSLGVGVALLVGVCLIMPQAIAKMLDGSLQYFGVGGGLP
FT                   LTVSVEDGQQARQISSKLVLLTPTAIFAGGESHQVMVFDRSKVTEISIDNKSAFHR"
FT   gene            complement(33938..34660)
FT                   /locus_tag="BC1003_0029"
FT   CDS_pept        complement(33938..34660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56038"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Z0"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_6889"
FT                   /protein_id="ADN56038.1"
FT                   /translation="MTVKNDFETLGFLADLPNDRNARKARFQERFDTCYQLSHDATRLA
FT                   HFLVAQPMPKRHQQVAAALWLRCAGAGQGAVLLAERGMPAEAASLARSSLECLFWGAAL
FT                   LKNPDVLQLLSDNDRSSVKKTANGMLSLKTVQLSKEDVALLQERGAGADVASTSVFKAA
FT                   ELGDLLYLYQSAYRGLSRWGVHAGIATASFSVLDGRLAFAPTDIFIVQVLEAVEQGVGA
FT                   EGLPRFAEFANGLARSKT"
FT   gene            complement(34811..36097)
FT                   /locus_tag="BC1003_0030"
FT   CDS_pept        complement(34811..36097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfs:PFLU3412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56039"
FT                   /db_xref="InterPro:IPR029470"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Z1"
FT                   /inference="similar to AA sequence:KEGG:PFLU3412"
FT                   /protein_id="ADN56039.1"
FT                   /translation="MADYSSEILIDYFFADANVQRLVTLTAAWQPLRICYPKEVNVSRF
FT                   LAWLLDPSEGHGLGDLAIQSLLTRAWWNSDDADVPLTIRRFLSPSNVQTEGFSSALITT
FT                   EVDLNGRSLDVLVVDASRRRYIAIENKFGAQQSRAQLKDYRKHLEKLLPDFLGVHIFLD
FT                   SREAVPEDAAWIPVGYDWLAEFLREAEKREATAQHVQQALAQFRNVIEDETEDSMGKSS
FT                   FGRLVTEVAGGHPEVLELMTPWARHGSKGARAHMLTELMSEANTLDGKSMLRLFQLYCR
FT                   RPSVWDHCIRQAQFAPFVSALRQRFDDVLVDPKRVRTGFSLLRWDSLIDLEQFPNWNYY
FT                   PAGVTVRQTGETFQVTTFVQLNHVRAEKRDALIEAAEVLRRTNGVRRQMSDEQSFVVLR
FT                   RLRDLNKTRAINETVSQFVELQARLEPIR"
FT   gene            complement(36510..37412)
FT                   /locus_tag="BC1003_0031"
FT   CDS_pept        complement(36510..37412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0031"
FT                   /product="RepB plasmid partition"
FT                   /note="PFAM: RepB plasmid partition; KEGG:
FT                   bcm:Bcenmc03_0026 RepB plasmid partition"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56040"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Z2"
FT                   /inference="protein motif:PFAM:PF07506"
FT                   /protein_id="ADN56040.1"
FT                   /translation="MSTVALGFIPEPLLVPIGNILPSRRLSAGMTISRKFRQIRGSIEE
FT                   VGMIEPLSVMPADTVSGQHVLLDGHLRLAALKDLHLETAACLVATDDESYTFNNRVNRL
FT                   STIQEHHMIRRAVERGVSPERLAKALAVDVSQILKRMALLDGICAEAAELLKDRQFSPE
FT                   LVRALRKMKTTRQVECVELMTAANNLSVAYAEALLVATPASRLVDGKKPKKLTGVGPEQ
FT                   IAKMEREMGNLQGQYKLVEQTYGQDVLNLVLAKGYLARLLENESVEQYLKAQQADLLAE
FT                   FRVIVDTITLDQPALEASA"
FT   gene            complement(37409..38311)
FT                   /locus_tag="BC1003_0032"
FT   CDS_pept        complement(37409..38311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0032"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; RepB plasmid partition; KEGG:
FT                   bcm:Bcenmc03_0027 ParB-like partition protein; SMART: ParB
FT                   domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56041"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Z3"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ADN56041.1"
FT                   /translation="MSPHGQPAEVRMIPIDQIEVINPRERNSRIFDEIVGNIKAIGLKK
FT                   PIVVTPRATAGGVERYLLVCGEGRVKAFRALGETTIPALVATVSDEDAFIMSLTENIAR
FT                   RQCRPLELLAGIRDLQERGYAPKAIAEKTGLTAQYVQGILTLLRQGEERLVIAVEKGQV
FT                   PLNAALSIVGAGDNDEAVQAALQEAYESGKLRGRQLMDARRVIERRKALGHGAGRNMSR
FT                   KTADITTSSLVRTYQREIERQKAMVRKAEFTQQRLLFVVGALRQLFADENFVNLLRAEG
FT                   LATLPKYLAERVWSGGSPA"
FT   gene            complement(38308..39885)
FT                   /locus_tag="BC1003_0033"
FT   CDS_pept        complement(38308..39885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0033"
FT                   /product="Recombinase"
FT                   /note="PFAM: Recombinase; Resolvase domain; KEGG:
FT                   bcm:Bcenmc03_0028 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56042"
FT                   /db_xref="GOA:E1T3Z4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Z4"
FT                   /inference="protein motif:PFAM:PF07508"
FT                   /protein_id="ADN56042.1"
FT                   /translation="MEQIVDLDCIGEPVVTRASTLRAVEYVRMSTEHQQYSTENQRDRI
FT                   RDYAARRGLEIVGTYADEGKSGLRIDGRQALQTLIRDVESGAANFQVILVYDVSRWGRF
FT                   QDADESAYYEYICRRAGIQVAYCAEQFENDGSPVSTIVKGVKRAMAGEYSRELSAKVFA
FT                   GQCRLIELGFRQGGPAGYGLRRILVDQSGLMKSELQRGEHKCLQTDRVILMPGPESEVR
FT                   TINLIYRWFIDESLNEYEIAARLNDMHIQTDLGRDWTRATVREVLTNEKYIGNNVYNRV
FT                   SFKLKKARVVNPPDMWIRKERAFEPIVPSETFYTAQGIMRARARRYSSEDLIERLRNLY
FT                   RSRGFLSGVVIDETEGMPSASVYAYRFGSLIRAYQTVGFTPGRDYRYIEANRFLRQLHP
FT                   GIVAETEKRIAALGGTVTRDLATDMLTVNSEFTACIVLSRCQAHQSGRNHWKVRFDTSL
FT                   LPDITVAVRLDHSNETTLDYYLLPRLDFGQPRIHLADWNPLEFESYRFDTLDYLYGMAQ
FT                   RARLRRAA"
FT   gene            complement(40036..40479)
FT                   /locus_tag="BC1003_0034"
FT   CDS_pept        complement(40036..40479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mms:mma_3461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56043"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Z5"
FT                   /inference="similar to AA sequence:KEGG:mma_3461"
FT                   /protein_id="ADN56043.1"
FT                   /translation="MKPDRICAACGALFTPLVHVPNQRYCSLATCQLARRRAWQHERLQ
FT                   TDPDYRANQAKAQAAWRARHPDYSRHYRETHPACRDRNRVMQRTRNARRNAHPVAKMDA
FT                   SHSFQPLASGFYLLCDALEAGIAKMNAWTVHIAVLSAPQPLPA"
FT   gene            complement(41548..41886)
FT                   /pseudo
FT                   /locus_tag="BC1003_0035"
FT   gene            42306..44531
FT                   /locus_tag="BC1003_0036"
FT   CDS_pept        42306..44531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0036"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="KEGG: bph:Bphy_5373 TonB-dependent siderophore
FT                   receptor; TIGRFAM: TonB-dependent siderophore receptor;
FT                   PFAM: TonB-dependent receptor; TonB-dependent receptor
FT                   plug"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56044"
FT                   /db_xref="GOA:E1T3Z6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Z6"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ADN56044.1"
FT                   /translation="MFRNTPLAAAVLVAFATPLYAQTTATPATGAQPASSSSTSTPSAS
FT                   QSSDAATLPAVKVTGQNGAQAEFAADVSSVGAKVPTALRDIPQAAVVVPKSVLQSQAAS
FT                   SFTDALRNVPGITIGGAEGGQIGNNINLRGFSARTDIYLDGFRDRGQYYRDTFNLESID
FT                   VLYGPSSLYFGRGSTGGVINQVSKQPTLKPRADVSVQAGTHDRYRTTVDLNAPITSTSA
FT                   FRINAFGQDQGSSRDVMKNKDYGVAPEVKFGIGTPTEITLSALIQHNRDQPDYGIPALN
FT                   GHPAPVNRGTFYGFTDDRTIQDVQTLNARIEHRFSDNLKLRNQTQFSHYSTEARATNAA
FT                   SVLTGPLPTSRALSNGNYTTIDPSKLFVKLQGKDRNINDHSVYNSTDIEAKFDTGLIKH
FT                   DVVAGVDLSHETYSNQSFATTTPGLPSNTIAIVPLVDPSYTKRPSNAKTVATNLAESSA
FT                   NGVGVYANDTVSIGEHWKVVGGLRWDRYEASIHNSINSPSYATQTNYFTSVRGGVIWQP
FT                   TDWQSYYVSYGTSFNPSLEALTLTNRQQNLPPEHNKSYEIGAKLDLLGGGLSVTQSLFN
FT                   IEKTNARTLNADGSYTLDGDVRVRGYQLGVAGHITNKWQVFGGYTYMDATILKALDGTA
FT                   GKTPANTPRNMLTLWTTYAFTPHWEIGGGPIYTSSRYAANNNFVQVGGYTRWDAMAAYH
FT                   AKKYDVQFNVLNLTDKNYYDALIPSDGGRAVPGNGRTFLATLNYRFF"
FT   sig_peptide     42306..42371
FT                   /locus_tag="BC1003_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            44643..45329
FT                   /locus_tag="BC1003_0037"
FT   CDS_pept        44643..45329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0037"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="KEGG: bph:Bphy_5374 putative hydroxylase; PFAM:
FT                   2OG-Fe(II) oxygenase; SMART: Prolyl 4-hydroxylase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56045"
FT                   /db_xref="GOA:E1T3Z7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Z7"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ADN56045.1"
FT                   /translation="MIVSIPDVFSPADAAAMRAQLEAATGSWVDGRATAGYQGAPVKRN
FT                   QQIAEGSPIALEMGDRILAALERHPLFISAALPNKVYPPLFNRYEGGMHFGSHVDGAIR
FT                   LVPGSGARVRTDLSVTLFLTPPGDYDGGELLIEDTFGVQEVKLPAGHAIVYPGTSLHQV
FT                   RPVTRGARVSSFFWVQSLVRDDTQRAMLFDMDGAIQRLNASNADDAARRTLVGCYHNLL
FT                   RMWSET"
FT   gene            45623..46276
FT                   /locus_tag="BC1003_0038"
FT   CDS_pept        45623..46276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0038"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="KEGG: reu:Reut_B4984 peroxidase; PFAM: alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56046"
FT                   /db_xref="GOA:E1T3Z8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Z8"
FT                   /inference="protein motif:PRIAM:1.11.1.7"
FT                   /protein_id="ADN56046.1"
FT                   /translation="MSIRLGEEAPDFTAETTEGTIRFHEWIGDQWAVLFSHPKDFTPVC
FT                   TTELGYMAGLKPEFEKRNTKIIGLSVDPVSDHQRWVKDIEETQGHAVNYPLIGDADLNV
FT                   AKLYDMIHPNASGGTRTAADNATVRSVFIIGPDKKIKAMLVYPMSSGRNFDEVLRLLDS
FT                   LQLSAKHSVATPVNWKPGDDVIIPTSVSNDDAAKKYPEGFKTLKPYLRYVAQPR"
FT   gene            46350..47423
FT                   /locus_tag="BC1003_0039"
FT   CDS_pept        46350..47423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0039"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: bpy:Bphyt_4191 beta-lactamase domain protein;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56047"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E1T3Z9"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADN56047.1"
FT                   /translation="MLIFRQLIDPQSSTYTYLLADSTTREAVLIDPVFEQVRRDSALIQ
FT                   ELGLRLLYTIDTHVHADHVTGAWMMKRRVGSEIAISAASGAQGADRYLNHGDRCEFGTR
FT                   YLEVRATPGHTNGCISLALDDGTMMFTGDCLLIRGTGRTDFQQGDARTMYRAIHGQIFS
FT                   QPDTCLLYPAHDYRGLTVTSVAEERRFNPRLGGELCEDDFVGYVTNLRLPHPKQIDVAV
FT                   PANLKCGEAASDPTQAAEPDWAPLAYTFAGIWEVGPQWLEDNLRSVQIVDVREPDEFDG
FT                   PLGRIPHAQLISLGNLAARAAELSKDCPVVTVCRAGGRSAQATVILRQAGFDKVANLAG
FT                   GMLRWRAESRVVENGSL"
FT   gene            47514..48101
FT                   /locus_tag="BC1003_0040"
FT   CDS_pept        47514..48101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0040"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bpy:Bphyt_0034 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56048"
FT                   /db_xref="GOA:E1T400"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1T400"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADN56048.1"
FT                   /translation="MSVLLSMAAFALASSISPGPVNVVALSAGAQHGFAASLRHVSGAT
FT                   VGFTLLLLLVGLGLHELLVHVPVLVEVVKWAGVAFLLYMAYRLAVDEGRLGADAQSRGP
FT                   SFAYGAAMQWLNPKAWLASLAGMGAYAADGDGQLVWQFAVIYFVVCYVSIASWAYAGTH
FT                   LRKYLQAPRRVRLFNRAMAALLGASALYLVAT"
FT   sig_peptide     47514..47585
FT                   /locus_tag="BC1003_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.574 at
FT                   residue 24"
FT   gene            complement(48166..49032)
FT                   /locus_tag="BC1003_0041"
FT   CDS_pept        complement(48166..49032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0041"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bpy:Bphyt_0033 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56049"
FT                   /db_xref="GOA:E1T401"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E1T401"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN56049.1"
FT                   /translation="MSTTKAAITHVNRASAQVDLASEPRFWRSDALPYIEARSIEDGRD
FT                   ICYAKHSHETFSIGAVTGGRSVYVNRHAREWTGTGAVVLMNPDDVHACNPVADERWSYR
FT                   MLHVDVAWLTDLQHELGFSASRAFRAFSQTMSTDAELFDGLNRLHGILVDSETDLLRKQ
FT                   SAAITFFTEVQQRLNRAPCCGDPASRQLARAAEFIADNCTRALRLEDICEAAGLSASHL
FT                   IRAFKERYGMTPHAYLINRRIQYSRAQLRRGRVIAEVALDAGFADQAHLQRTFKRLVAA
FT                   TPGQYRS"
FT   gene            complement(49178..49972)
FT                   /locus_tag="BC1003_0042"
FT   CDS_pept        complement(49178..49972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0042"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: bxe:Bxe_A4434 ABC amino acid transporter,
FT                   periplasmic ligand binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56050"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E1T402"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADN56050.1"
FT                   /translation="MKLLKPWLALACAFASVAASPAALAADTSTLRFGLEAQYPPFESK
FT                   GPNGELQGLDIDVGNAVCAAAHMTCKWVETSFDGLIPALQGRKFDAINSAMNATEQRRQ
FT                   TIDFTTVVYRVPTQLIAKRDSGLLPSAEALKGKRVGVLQASIQETFAKTHWEPAGVTVV
FT                   AYQDQNQVYTDLVAGRLDATLVLAPAGQTGFLSKPNGKDYAFVGQPVRDDKILGSGIAY
FT                   GIRKGDTALRERLNAAIAKVQADGTVKTLATKYLGNIDVSAK"
FT   sig_peptide     complement(49895..49972)
FT                   /locus_tag="BC1003_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            complement(50092..51246)
FT                   /locus_tag="BC1003_0043"
FT   CDS_pept        complement(50092..51246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0043"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   bpy:Bphyt_0031 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56051"
FT                   /db_xref="GOA:E1T403"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1T403"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADN56051.1"
FT                   /translation="MQSALQARSKLPDVGTTIFTVIGQLAAQHDALNLSQGAPNFAPDA
FT                   KLIDGVAHAMRAGHNQYAPMSGIAALREALADKVQTLYGVRYDPADEVTVIASASEGLY
FT                   SAISALVHPGDEVIYFEPSFDSYGPIVRLQGATPVPIKLSLSDFRVNWDEVAAAVTPKT
FT                   RMLIINTPHNPTATVFSEADIARLKALTRHTDIVILADEVYEHVVFDGAKHESMACHSE
FT                   LAERSVIVSSFGKSYHVTGWRVGYCLAPAELMNEIRKVHQFMVFSADTPMQYAFVDALA
FT                   NRESYLGLSAFYQQKRDLLAHGLRESRFELLPSAGSFFMLARFRGFSDEKDSDFVLRLI
FT                   RDARVATIPLSAFYSDGTDSGLIRLSFSKDDATLIEGARRLCEI"
FT   gene            complement(51461..52864)
FT                   /locus_tag="BC1003_0044"
FT   CDS_pept        complement(51461..52864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0044"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: bxe:Bxe_A4436 ATP-dependent RNA helicase DbpA;
FT                   PFAM: DEAD/DEAH box helicase domain protein; helicase
FT                   domain protein; DbpA RNA-binding domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56052"
FT                   /db_xref="GOA:E1T404"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T404"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADN56052.1"
FT                   /translation="MNSPITAGAPFSQLPLPPAALANLTQLGYVEMTPIQAASLPIALA
FT                   GHDLIAQAKTGSGKTAAFSLALLARLDARNFAVQAMVLCPTRELADQVTQEIRRLARAE
FT                   ENIKVLTLCGGTPMRPQTASLEHGAHIVVGTPGRIMDHLERGSLPLQSLNTLVLDEADR
FT                   MLDMGFFDDIATVVKQCPKERQTLLFSATYPEGIVKLSQQFLRNPKEVKLAERHDNTKI
FT                   RQRFYEVTEDERLHAVGLLLNHYRPVSTIAFCNTKQQCRDLLEVLRAQGFHALALHGEL
FT                   DQRERDQVLIQFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVHVHRIGRTGR
FT                   ADQEGWALSLASMDEMGRVGGIEQAQKREVEWHKLSELTATSNEPLLPPMETLQILGGR
FT                   KEKIRPGDVLGALTGEAGFAGSQIGKINVTEMSTYVAVERSIAREAVRKLSAGKVKGKK
FT                   VKVRLMDDA"
FT   gene            complement(52974..53174)
FT                   /locus_tag="BC1003_0045"
FT   CDS_pept        complement(52974..53174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56053"
FT                   /db_xref="UniProtKB/TrEMBL:E1T405"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4437"
FT                   /protein_id="ADN56053.1"
FT                   /translation="MFTCRNQSCGAQWEQSDVVIKNEGQGLLFRCPLCGARNYVERFED
FT                   EDGAVLYEQMEGRPSPGPMAE"
FT   gene            complement(53220..53651)
FT                   /locus_tag="BC1003_0046"
FT   CDS_pept        complement(53220..53651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0046"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; KEGG: bpy:Bphyt_0028
FT                   transcriptional regulator, MerR family; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56054"
FT                   /db_xref="GOA:E1T406"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:E1T406"
FT                   /inference="protein motif:TFAM:TIGR02047"
FT                   /protein_id="ADN56054.1"
FT                   /translation="MKIGELAKIAHCTTETIRFYEKEGLLPEAERTEANYRSYTARHVE
FT                   RLRFIRNCRALDMTHDEIRALLRLTDAPASGCGGVNDLIDEHIAHVEMRIDELQQLKAQ
FT                   LHALREQCHGERAVEDCGIVQGLSDMNVSAPRARHTHLG"
FT   gene            53730..56072
FT                   /locus_tag="BC1003_0047"
FT   CDS_pept        53730..56072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0047"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: bxe:Bxe_A4439 heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase;
FT                   TIGRFAM: heavy metal translocating P-type ATPase;
FT                   cadmium-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56055"
FT                   /db_xref="GOA:E1T407"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1T407"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADN56055.1"
FT                   /translation="MQRAHEPNADPTEEPQTRVRGHEHGPEHAHEAHAGDSACGSCCGA
FT                   ASHAPLPLRAVVPPSEAVQGDVRTAMRIMQMDCPTEEALIRKKFSRMSEVRSMEFNLMQ
FT                   RVLTVVHAPDALDSILVALRSLDFTPELADAESQRPRGAAQHASSAQPAPRRWWPLAFA
FT                   GVAAAASEAAGWAGAPAWVAAGLALVAIASCGLSTYRKGWLAIRHGNLNINALMSIAVS
FT                   GALILGQWPEAAMVMVLFTVAELIEARSLDRARNAIQGLMQLTPEQASVQQPDGGWQLT
FT                   RLEVIAPGALVRVKPGERIALDGEIVAGRSSVDQAPITGESLPVDKTVGDAVFAGTVNQ
FT                   AGSFDYRVTAAASNTTLARIIHAVEAAQGSKAPTQRFVDQFARVYTPLVFAVALAVALV
FT                   PPLIFGGMWQAWIYKALVMLVIACPCALAISTPVTIVSGLAAAARKGILIKGGAYLEQG
FT                   RKLRRLAFDKTGTITHGKPVQTDFAVLAKADSNTDADADTDAARCRTLAASLAARSDHP
FT                   VSMAIASAAQKDGIASVMVDSFEALAGRGVRGVINGLTYWLGNHRLAEELGLCSPSLEA
FT                   RLDALERQGKTVVLLSDAQRVLALFAVADTVKETSRAAIAELHRAGVTTAMLTGDNPHT
FT                   AAAIAAQVGIDEARGNQLPQDKLDAVAQWSAEGATVGMVGDGINDAPALARADIGFAMG
FT                   AMGTGTAIETADVALMDDDLRKIPLFIRLSQATHAVLVQNIALALGIKSVFLVLTVMGL
FT                   GTMWMAVFADVGASLVVVANGLRLLRK"
FT   gene            complement(56121..57185)
FT                   /locus_tag="BC1003_0048"
FT   CDS_pept        complement(56121..57185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0048"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bpy:Bphyt_0025 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56056"
FT                   /db_xref="GOA:E1T408"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E1T408"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN56056.1"
FT                   /translation="MTIESLSDSAVSSTPGAAPVPAAQAAFRVQTCIAHDADEQARNLQ
FT                   GWHQTYDQLASGSFVGGLTELCLDDMQVFVETTSHTLRQTCEVQKDAYWFGIPTRGAGA
FT                   GRIDAQMIGSDALAFRPGGIEFELLTSSGYEIFGVVVKGDALRRYAAQVEQVSLADALP
FT                   DKEVVSIGADRKERLCASLRALLERSAASGAPLSRSACDSLQAAVLASLFDAGALPASP
FT                   GQMAMPVRARRQSIVSEARDYVLAHRDRAVGVPELCERLHVSRRTLQYCFQDVLGMAPA
FT                   HYVRALRLNGARRDLCNASRDSRSVQDVATAWGFWHLSQFATDYRKLFGMRPSDTLKAA
FT                   IGAHGATTSRPLAH"
FT   gene            57529..59049
FT                   /locus_tag="BC1003_0049"
FT   CDS_pept        57529..59049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0049"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: bxe:Bxe_A4441
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56057"
FT                   /db_xref="GOA:E1T409"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E1T409"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADN56057.1"
FT                   /translation="MNHAEMQFLTTEFPYKKQYANFIGGEWVKPVGGEYFDNVSPITGE
FT                   PFTSIPRSREADVELALDAAHRAKAAWGKTSTTDRANILNRIADRMEANLQRLAVAETI
FT                   DNGKPLRETMAADIPLAIDHFRYFAGAVRAQEGSISEIDDDTVAYHFHEPLGVVGQIIP
FT                   WNFPILMAVWKLAPALAAGNCVVLKPAEQTPASILVLVELIQDLLPAGVLNVVNGFGLE
FT                   AGKPLASSKRIAKIAFTGETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVMNQDDS
FT                   YFDKALEGFAMFALNQGEVCTCPSRVLIDEKIYDRFMERALKRVAAITQGHPLDMKTMI
FT                   GAQASQEQLEKILSYVDLGKQEGAECLIGGERNVLGGELSKGYYVKPTVFRGNNKMRIF
FT                   QEEIFGPVVSVTTFKTEEEALEIANDTLYGLGAGVWTRDGTRAYRFGRQIQAGRVWTNC
FT                   YHAYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLVSYSEKPLGFF"
FT   gene            59121..59516
FT                   /locus_tag="BC1003_0050"
FT   CDS_pept        59121..59516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0050"
FT                   /product="protein of unknown function DUF779"
FT                   /note="PFAM: protein of unknown function DUF779; KEGG:
FT                   bxe:Bxe_A4442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56058"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:E1T410"
FT                   /inference="protein motif:PFAM:PF05610"
FT                   /protein_id="ADN56058.1"
FT                   /translation="MADEQEVARVIATPAAVELIDRLRAQHGDVLFHQSGGCCDGSAPM
FT                   MFPQSEFMIGASDVKLGTLAGVPFYMSDSQFEYWQHTQLIIDVVPGNGGMFSLERPTGL
FT                   RFLTRSRLFDDGENAWLAAHPVQRGDA"
FT   gene            complement(59525..60361)
FT                   /locus_tag="BC1003_0051"
FT   CDS_pept        complement(59525..60361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0051"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="KEGG: bpy:Bphyt_0022 ethanolamine ammonia-lyase
FT                   small subunit; PFAM: Ethanolamine ammonia-lyase light
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56059"
FT                   /db_xref="GOA:E1T411"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:E1T411"
FT                   /inference="protein motif:PRIAM:4.3.1.7"
FT                   /protein_id="ADN56059.1"
FT                   /translation="MSDSVDKNPWNALRQFTNARIALGRAGNSVPTAPLLAFNLSHAQA
FT                   RDAVHHPLDTDALHQQLHALSLRTLDVHSAAPDREHYLRRPDLGRRLSEESRAALAQLK
FT                   DESPDLVFVIGDGLSAFAASKQAVPLLQAVLLRLADWKIAPVVVARQARVALGDEIGEL
FT                   LHAKIVVMLIGERPGLSSPDSLGIYLTYAPKVGCSDAQRNCISNVRPEGLDYPLAAHKL
FT                   HYLLTHARRLGLTGVGLKDDSDALLQAAPAAAAIGGAASTHPQPEPASPDANASAT"
FT   gene            complement(60358..61752)
FT                   /locus_tag="BC1003_0052"
FT   CDS_pept        complement(60358..61752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0052"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="KEGG: bxe:Bxe_A4444 ethanolamine ammonia-lyase heavy
FT                   chain; PFAM: Ethanolamine ammonia lyase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56060"
FT                   /db_xref="GOA:E1T412"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1T412"
FT                   /inference="protein motif:PRIAM:4.3.1.7"
FT                   /protein_id="ADN56060.1"
FT                   /translation="MSYTETIGSRTYRFADLKTLMAKASPQRSGDQLAGVAAASEEERV
FT                   AAKMALAQVPLRTFLNEALVPYESDEVTRLVIDDHSPQAFAEISHLTVGDFRNWLLSTS
FT                   TDAEALTRIAAGLTPEMVAAVSKLMRNQDLIAAARKRPVITRFRNTVGLPGHMSVRLQP
FT                   NHPTDDVKGIAASMLDGLMYGCGDAMIGINPASDNLAAITRLLQMVDDFRQRYQVPTQS
FT                   CVLTHVTNTIAAIEKGAPVDLVFQSIAGTEKANAGFGISLALLHEAYEAGLSLKRGTVG
FT                   SNLMYFETGQGSALSADAHFGVDQQTCEARAYAVARKFNPFLVNTVVGFIGPEYLYDGK
FT                   QITRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDNLLTLLGVAGINFIMGIPGAD
FT                   DVMLNYQSTSFHDALYVRDVLGLRRAPEFEEWLESMQITDARGALLSASAQQPLLEGAR
FT                   DWMGMA"
FT   gene            complement(61808..63211)
FT                   /locus_tag="BC1003_0053"
FT   CDS_pept        complement(61808..63211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0053"
FT                   /product="ethanolamine transporter"
FT                   /note="KEGG: bpy:Bphyt_0020 ethanolamine transproter;
FT                   TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56061"
FT                   /db_xref="GOA:E1T413"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:E1T413"
FT                   /inference="protein motif:TFAM:TIGR00908"
FT                   /protein_id="ADN56061.1"
FT                   /translation="MKSESNSQHVGKVTHHELKQTLGTWQLWGIAVGLVISGEYFGWSY
FT                   GWASAGTLGFVITAIFIAAMYTTFIFSFTELTTSIPHAGGPFAYARHAFGPTGGYLAGA
FT                   ATLVEFVFAPPAIALAIGAYLHVQFPGLEPKHAAMGAYLVFMALNIVGVQIAAAFELCV
FT                   TLLAIFELLVFMGVVSPGFQWSNFTKGGWAGADTFSMGSFNGMFAAIPFAIWFFLAIEG
FT                   VAMAAEEAKNPRRSIPVAYVAGILTLVVLAIGVMVFAGAAGDWTKLSNINDPLPQAMKF
FT                   IVGENSGWMHMLVWLGLFGLVASFHGIILGYSRQIFALARAGYLPEWLSKVHPRFKTPH
FT                   RAILAGGVIGIAAIYSDELIQFGGQTLTANIVTMSVFGAIVMYIISMLSLFKLRRAEPD
FT                   MERPFRAPLFPLFPGFALVAAVICLATMVYFNFLVAVVFAIFLALGYVYFLLTRHQREA
FT                   APADALLEE"
FT   gene            complement(63867..64646)
FT                   /locus_tag="BC1003_0054"
FT   CDS_pept        complement(63867..64646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_2916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56062"
FT                   /db_xref="GOA:E1T414"
FT                   /db_xref="UniProtKB/TrEMBL:E1T414"
FT                   /inference="similar to AA sequence:KEGG:Bmul_2916"
FT                   /protein_id="ADN56062.1"
FT                   /translation="MPRSQSMTKPETELKDAVWEMTKKATPVNFIFPTLATGVSYAAYA
FT                   DDLAVSGWPWKIGVLVTLICLFVPFAVSIMYRRSNLLWVSGLVLSVAIFAMYFFFGIFA
FT                   YFYYFLFAPMAPFLRWPGLLGGLVLTLYWAVMSRQAVMNTITQTSFVKRAFEESASGFH
FT                   YRTQAGMALFERLHKERSPFPRIYSYIVFGIAPCYLILGRLLSSNFGTNGVLFALAVLG
FT                   MPVSLWFAGLLVRIYLVMIGVPRKLQREHLKPVLVAD"
FT   gene            complement(64881..65330)
FT                   /locus_tag="BC1003_0055"
FT   CDS_pept        complement(64881..65330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_2613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56063"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4J9"
FT                   /inference="similar to AA sequence:KEGG:Sros_2613"
FT                   /protein_id="ADN56063.1"
FT                   /translation="MATHFSFSTGELDAGKGLVLAPGRTTAQDVIEAGWRALDAHNGWE
FT                   SFANDKLVIWRHSFAVSARFHLGGFAQIDCIWNDGSILKQDWSATDDDLLREKKTLAKL
FT                   IKEEAQTTPVATSLGADTFAFQWGTISVRADQRSMIVLVTIGYSR"
FT   gene            complement(65501..65881)
FT                   /locus_tag="BC1003_0056"
FT   CDS_pept        complement(65501..65881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_0684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56064"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4K0"
FT                   /inference="similar to AA sequence:KEGG:Psyr_0684"
FT                   /protein_id="ADN56064.1"
FT                   /translation="MLPVTDKQMLSRRLKWIVLLCAFSLAARFLCRPVVVLHYSADAQK
FT                   PVIYFLNENDRITRGELAPGQTEKFYTPMFASRDAWIEVSLPFASRDGVDIKPPYSRVD
FT                   VYIDAGTKIERTDTKHGFFARF"
FT   gene            65884..66477
FT                   /locus_tag="BC1003_0057"
FT   CDS_pept        65884..66477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbo:BBOV_IV000430 tetratricopeptide repeat
FT                   (TPR) domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56065"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4K1"
FT                   /inference="similar to AA sequence:KEGG:BBOV_IV000430"
FT                   /protein_id="ADN56065.1"
FT                   /translation="MRPLGCSVTCSPRHRNGRYLAKQKVGRQLVRLCARIEINAELNRN
FT                   TIRHIVGAARPCTVLRMILHGRPASVRHIATSVTSSLRETSTVSQLTRAKADRHADIAI
FT                   VNVRPDIVEVVVLSVFLPTAIENSFCLQGMADDRFVVPRTIRRDPFSPHLISSKLLPRS
FT                   HAVKIRHSTKLCVPWQRKECCGYSAPRLLSRASR"
FT   gene            complement(66832..67401)
FT                   /locus_tag="BC1003_0058"
FT   CDS_pept        complement(66832..67401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_2g10850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56066"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4K2"
FT                   /inference="similar to AA sequence:KEGG:bglu_2g10850"
FT                   /protein_id="ADN56066.1"
FT                   /translation="MEHVKALRSSVVTAIALSTLCACNMAFAGPKDSCITTHDLQTLQR
FT                   DFFTNFPDGQAFAKYVDKSQFELRTNAPEGRKLEQGGSPTAEKIDWLIRTMNTHKDLFS
FT                   GFVFDKPDFTYMRGQLRGGQPSVDNLRTSKRFPKNECVQEVNYEIPAGACVMSQRLNRL
FT                   SITFVKDERPLSLSSVEMFFIACTAK"
FT   sig_peptide     complement(67315..67401)
FT                   /locus_tag="BC1003_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(67388..68024)
FT                   /pseudo
FT                   /locus_tag="BC1003_0059"
FT   gene            complement(68173..68319)
FT                   /pseudo
FT                   /locus_tag="BC1003_0060"
FT   gene            68514..69017
FT                   /pseudo
FT                   /locus_tag="BC1003_0061"
FT   gene            complement(69043..69118)
FT                   /locus_tag="BC1003_R0001"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(69043..69118)
FT                   /locus_tag="BC1003_R0001"
FT                   /product="tRNA-Lys"
FT   gene            69316..69720
FT                   /locus_tag="BC1003_0062"
FT   CDS_pept        69316..69720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0062"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bpy:Bphyt_0301 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56067"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4K3"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADN56067.1"
FT                   /translation="MDEKETTELLERVLAPWVRELALTAVKADAESATLRLPFAGALRH
FT                   SGGVICGQVFMAVADTAMIVAISAALGGFKPMTTVSLNISFMRAVRKGDVLVTARVLRL
FT                   GRNLVFGEVELFDETGNMAVHATTTYALLE"
FT   gene            69767..70630
FT                   /locus_tag="BC1003_0063"
FT   CDS_pept        69767..70630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0063"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: bpy:Bphyt_0302 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56068"
FT                   /db_xref="GOA:E1T4K4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4K4"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADN56068.1"
FT                   /translation="MFDQVVFAGGGNRCWWQAGFWDVVQPELRIRPRVITGISAGAATA
FT                   CMLYTRDSAWVMRYYEDALRHNSRNAYWGNLLRGQSVFPHYRIYRQALLDIYGERFSAL
FT                   AEAPEIRIGVSHLPRWLGARSAVAAGLIAYNIEKYVRKTLHPTLGQTLGFHPEFVRAQD
FT                   CATVEDLADLILQSSSTPPFTPVLRRNGRPVLDGGMVDNVPVGALDADAPGNVLVMVTR
FT                   LYPRPQMFVVPHGVQQRLYVQPSRKVPISSWDYTNPSQMVHAYNLGRVDGETFLERMPD
FT                   LLEFAA"
FT   gene            complement(70663..71700)
FT                   /locus_tag="BC1003_0064"
FT   CDS_pept        complement(70663..71700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0064"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: bxe:Bxe_A4423 putative
FT                   2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56069"
FT                   /db_xref="GOA:E1T4K5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4K5"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADN56069.1"
FT                   /translation="MVRRKIHTMKIAILDDYQDAVRKLDCFQLLADHEVKVFNNTVRGL
FT                   GQLASRLSEVDALVLIRERTRISSQLLDKLPRLRMISQTGKVSNHIDLAACTERGIAVL
FT                   EGSGSSIAPAELTWALIMAAQRRIPQYVANLKQGAWQQSGLKTSALPPNFGLGQVLRGQ
FT                   TLGVWGYGKIGRLVAGYGKAFGMNVLIWGREHSREAAREDGYGVAESREALFEQSDVLS
FT                   LHLRLHDDTRGIVKQEDLMRMKPTALLVNTSRAELLDENALVNALSHNRPGMVAIDVYE
FT                   SEPILQGYSLLRMENVICTPHIGYVERESYELYFSAAFKNILAFDAGDTASVANPEALQ
FT                   GGRRR"
FT   gene            72050..73918
FT                   /locus_tag="BC1003_0065"
FT   CDS_pept        72050..73918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0065"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="KEGG: bpy:Bphyt_0304 phosphoenolpyruvate
FT                   carboxykinase; PFAM: phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56070"
FT                   /db_xref="GOA:E1T4K6"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4K6"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ADN56070.1"
FT                   /translation="MNLPSFEAHPTAKASVEAPAWVRHRKLIDWVQRVAAMTKPDKIVW
FT                   CDGSQEECDRLCAQMVEAGTLRKLNPAKRPNSYLAWSDPSDVARVEDRTFICAERREDA
FT                   GPTNNWVAPDEMRTTLNGLFDGAMRGRTMYVVPFSMGPLASPIAHIGVELSDSPYVVTN
FT                   MRIMTRMGRKVYEVLGEDGEFVPCVHSVGAPLEAGAKDVPWPCNPTKYIVHFPETREIW
FT                   SYGSGYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPEGRKHHVAAAFPSAC
FT                   GKTNFAMLIPPEGLNGWKISTIGDDIAWIKPGKDGRLYAINPEAGYFGVAPGTSEKTNF
FT                   NAMATLKENVIFTNVALTDDGDVWWEGMTDEPPAHLIDWQGKDWTPASAKESGRKAAHP
FT                   NARFTAPASQCPSIDPDWENPAGVPIDAFIFGGRRSTTVPLVTEARNWVEGVYMAATMG
FT                   SETTAAAAGQQGVVRRDPFAMLPFCGYNMSDYFGHWLKTGERLQQLNAKLPKIFCVNWF
FT                   RKDADGKFVWPGFGENMRVLGWMVGRIEGTAQGEEHAFGVSPHYDDIDWSGLAFSREQF
FT                   EQVISVDDAAWRAELALHGELFDTLQQGLPPALAQAKSELESKLAA"
FT   gene            74259..75362
FT                   /locus_tag="BC1003_0066"
FT   CDS_pept        74259..75362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0066"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_0305 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56071"
FT                   /db_xref="GOA:E1T4K7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4K7"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN56071.1"
FT                   /translation="MDHLQSMRVFVKVADLGSFARAASALDISNAVATRHVADLEGRLG
FT                   TRLLNRTTRSLSLTESGQVYLERARQILDELEDVEQMVVARNHEPVGTLRIVAPVVFGL
FT                   HNLAPVLQTYAERYPKVIPDVTLVDRQVDLVEEGFDVGVVIARQMRSASIVTRRLTTGC
FT                   MTVCATPAYLEKHGTPTRPEHLLEHPCLSLPSEYWGDERVFTGPEGEVRVRPSNVIVAN
FT                   NTEMLRQFALLGMGIAILPSYLIGRDMTRGRLVRLLGDYRLPQVEINIAYPSRRHLPAK
FT                   VRTFIDHLVEHFSQTPNSLLGEQWIKDGVGHPASAASFESADAAMPPEAFDGAEPLSSL
FT                   LDSELAPVAKTLGKPANRSRPTALTPL"
FT   gene            complement(75564..78236)
FT                   /locus_tag="BC1003_0067"
FT   CDS_pept        complement(75564..78236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0067"
FT                   /product="DNA topoisomerase III"
FT                   /note="TIGRFAM: DNA topoisomerase III; PFAM: DNA
FT                   topoisomerase type IA central domain protein; TOPRIM
FT                   domain-containing protein; KEGG: bpy:Bphyt_0306 DNA
FT                   topoisomerase III; SMART: DNA topoisomerase I DNA-binding;
FT                   DNA topoisomerase I ATP-binding; Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56072"
FT                   /db_xref="GOA:E1T4K8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4K8"
FT                   /inference="protein motif:TFAM:TIGR01056"
FT                   /protein_id="ADN56072.1"
FT                   /translation="MSKALIIAEKPSVANDIARALGGFTKHDEYYESDEYVLSSAVGHL
FT                   LEIAAPEEYEVKRGKWSFANLPVIPPHFDLNPIAKSESRLKVLTKLLKRKDIDRLINAC
FT                   DAGREGELIFRLIAQHAKAKQPVQRLWLQSMTPAAIRDGFARLRSDEEMQPLADAARCR
FT                   SEADWLVGINGTRAMTAFNSKGGGFFLTTVGRVQTPTLSIVVEREEKIRRFVPRDYWEV
FT                   KAEFVCAAGFYEGRWFDPKFKRDEFDPEKRDSRLWSLPAAETIVAACRGQLGTVTEESK
FT                   PSTQLSPALFDLTSLQREANGRFGFSAKNTLGLAQALYEKHKVLTYPRTDARALPEDYM
FT                   ETVKQTLGMLKESNNYLPFAKQVLDKGWVKPNKRIFDNSKISDHFAIIPTLQAPKNLSE
FT                   PEQKLYDLVVKRFLSVFFPAAEYRVTTRITEVVGHHFKTEGKVLVEPGWLQVYGREISG
FT                   EDANLVPVQKDEKVKTDKIAAQQLVTKPPARYNEATLLSAMEGAGKLVEDDELREAMAA
FT                   KGLGTPATRAAIIEGLLGEKYLIREGRDLIPTAKAFQLMTLLRGLGVKELTAPELTGEW
FT                   EYKLSQMERGNLPRDAFMQEIARMTQTIVKRAKEYDSDTIPGDYATLQTPCPNCGGQVK
FT                   ENYRRFACSKCEFSISKIPGGRQFEIEEVEELLKNKTIGPLSGFRSKMGRPFSAILKLS
FT                   LDDEIKNYKLEFDFGQDAGGEDGEPPDFSDQQPVGACPKCKGRVFEHGMSYVCENSVAN
FT                   PKTCDFRSGKVILQQEIAREQMAKLLEEGRTDLLTNFKSSRTGRNFKAFLVKQNDGKIG
FT                   FEFEKKEPSAKTAAKTAAAKSAAKAGGPELESDDDETSVAVKAAPAAKKTAAKKAPATK
FT                   TAAAKKAPAKKTAARKTGS"
FT   gene            complement(78544..78921)
FT                   /locus_tag="BC1003_0068"
FT   CDS_pept        complement(78544..78921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0068"
FT                   /product="thioredoxin domain protein"
FT                   /note="KEGG: bpy:Bphyt_0307 thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56073"
FT                   /db_xref="GOA:E1T4K9"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4K9"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0307"
FT                   /protein_id="ADN56073.1"
FT                   /translation="MPALNLDTDQDRIAGRVNDPDTLFVACLCAEWCGTCREYREAFDK
FT                   LAERHPEICFAWIDIETHADRFDDLDVENFPTILIEDSVTTRFFGTVLPQAAIVERMLA
FT                   DLTALPGVVGAPKLRPALTAV"
FT   gene            complement(79016..80317)
FT                   /locus_tag="BC1003_0069"
FT   CDS_pept        complement(79016..80317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0069"
FT                   /product="DNA protecting protein DprA"
FT                   /note="KEGG: bxe:Bxe_A4417 smf protein; TIGRFAM: DNA
FT                   protecting protein DprA; PFAM: SMF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56074"
FT                   /db_xref="GOA:E1T4L0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4L0"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ADN56074.1"
FT                   /translation="MHTLPSTETELAAWLRLSLAPGLKPAALRLLLSAFGLPEAILQQD
FT                   RETLAAIAGEAAARAALAPAGPDFDAQLDAVIAWRELPGNQIVTLDDPAYPPALLTMPD
FT                   PPPLLYIKGRLDLLHTRAVALVGSRSATPQGLEDAERFARTISAAGVTVVSGLAQGIDG
FT                   AAHRGGLAGIGSTVAVIGTGADLVYPSAHHALARQIAVQGVILSEWPLGTPARAANFPQ
FT                   RNRLIAGLVSGVLVVEAAMRSGSLITARLANEMGRDIFALPGSIHAPLSRGCHRMIKQG
FT                   AKLVETPEEVLDELGFARAAPAVSSVDAGVHVQRSATCTFADAAAGCLPTDSPDSREPE
FT                   CGAQLPSTEPAPAEARRPVATVATVATVAFEPDAQRLLAALGHAPTSLEILATRTEMDY
FT                   AVLQATLLQLELAGHVSALPGGRYARVSRGEPAR"
FT   gene            80560..81063
FT                   /locus_tag="BC1003_0070"
FT   CDS_pept        80560..81063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0070"
FT                   /product="peptide deformylase"
FT                   /note="KEGG: peptide deformylase; TIGRFAM: peptide
FT                   deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56075"
FT                   /db_xref="GOA:E1T4L1"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4L1"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ADN56075.1"
FT                   /translation="MALLNILNYPDKRLHKVAKPVEEVNDRIRRLVADMAETMYAAPGV
FT                   GLAATQVDVHERVIVIDVSDAHDQLLAFINPEIVWSSNEKKLSEEGCLSVPGIYDNVER
FT                   AEKVRVRALNEKGETFEMDCEGLLAVCIQHEMDHLMGRVFVEYLSPLKQTRIKSKMKKL
FT                   AHAM"
FT   gene            81101..82087
FT                   /locus_tag="BC1003_0071"
FT   CDS_pept        81101..82087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0071"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="KEGG: bxe:Bxe_A4415 methionyl-tRNA
FT                   formyltransferase; TIGRFAM: methionyl-tRNA
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56076"
FT                   /db_xref="GOA:E1T4L2"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4L2"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ADN56076.1"
FT                   /translation="MSHSLRVVFAGTPEFAAAALAAIHGAGFPVPLVLTQPDRPAGRGM
FT                   KLQASPVKRYAVEHGLALAQPQSLRRAGRYPAEAAAAIDQLRATPHDVMVVAAYGLILP
FT                   QEVLDIAPFGCINIHASLLPRWRGAAPIHRAIEAGDAQTGITLMQMDAGLDTGAMISET
FT                   RTPISADDTTATLHDRLAQDGARLIVEALVELEKSGKLTSTPQPADGVTYAEKIGKHEA
FT                   ALDWRRPAAALARQVRAFDPFPGGVGTLEDGTSIKIWAATAENATSHAAPGTVIGVSAE
FT                   GVVVACGEGALCLTQLQKPGGKRLPVREFLAGFALAAGQRFQLPEAG"
FT   gene            82213..82854
FT                   /locus_tag="BC1003_0072"
FT   CDS_pept        82213..82854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0072"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bxe:Bxe_A4414 amino acid efflux pump, RhtB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56077"
FT                   /db_xref="GOA:E1T4L3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4L3"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADN56077.1"
FT                   /translation="MFGITHFEFFVVAVFLLNVTPGPDTAYIVGRSVAQGRGAGLMSAL
FT                   GISAGCCVHSLACAFGLTALLAASATAFTVIKFVGAIYLIYLGVRLIFARPAVDEARGT
FT                   ARAAGAPKSLRQLFLQGFWTNVLNPKVVLFFVSFFPQFVAAGTEQKALAFLTLGAVFVV
FT                   MSMLWNSFVAWVAGSVTQRFSGKPSVKKWLDRGVGSAFVGLGIKLATASR"
FT   gene            82959..83816
FT                   /locus_tag="BC1003_0073"
FT   CDS_pept        82959..83816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0073"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bxe:Bxe_A4413 M48
FT                   family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56078"
FT                   /db_xref="GOA:E1T4L4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4L4"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADN56078.1"
FT                   /translation="MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALVIALGMNFFS
FT                   YWFSDKMVLRMYNAQEVDETSAPQFYRMVRELSTRAGLPMPRVYLINEDAPNAFATGRN
FT                   PEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTISATMAGAISALANFAMF
FT                   FGGRDESGRPVNPIAGIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASA
FT                   LDKIHRYASGIPFPAAEQHPATAQMMIMNPLAGGGIANLFSTHPATEERIARLMEMART
FT                   GRFE"
FT   sig_peptide     82959..83051
FT                   /locus_tag="BC1003_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.747) with cleavage site probability 0.612 at
FT                   residue 31"
FT   gene            84003..85442
FT                   /locus_tag="BC1003_0074"
FT   CDS_pept        84003..85442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0074"
FT                   /product="sun protein"
FT                   /note="KEGG: sun protein; TIGRFAM: sun protein; PFAM: Fmu
FT                   (Sun) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56079"
FT                   /db_xref="GOA:E1T4L5"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4L5"
FT                   /inference="protein motif:TFAM:TIGR00563"
FT                   /protein_id="ADN56079.1"
FT                   /translation="MIPKPSSRSASSSARPRESRLSVLHLAPESLGFALDCAAQAVGAV
FT                   RLGAALPAALQSVFVSAPEGSAAAARGAVQDIAYRTMRRLGTAEWLIARLVKKAPPPHV
FT                   GHVLACALALLIDDEASAAYTPFTVVDQAVRAISARREFTFAKGLVNAVLRNFLREREQ
FT                   LLTEAQSDEVARWNYPTWWIDAVRRAWPEAWQDVLAAGNTQGPLTLRVNARHSTVEAYL
FT                   QLLEQHHIAASKAGEHAVKLATPMPVDRIPGFNEGVVSVQDAGAQLAAQLLGVRDGMRV
FT                   LDACAAPGGKTGHLLELANLQLVALESDVARARRIGENLQRLKLEAEVRIGDAGAPSKW
FT                   HDDIDQPFDRILADVPCSASGIVRRHPDIRWLRRASDIPALVDEQRRILGALWPLVKPG
FT                   GELLYVTCSIFPEEGELQAQWFGNNHQDAVRLDAPGQLLPSVARAPADTSAGSHAGGFA
FT                   DTSAGANSDHDGFFYARFQKR"
FT   gene            85439..86038
FT                   /locus_tag="BC1003_0075"
FT   CDS_pept        85439..86038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56080"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4L6"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4411"
FT                   /protein_id="ADN56080.1"
FT                   /translation="MTIKRFFPLRLVAVLWVALAVWLAAPGAAHAEPIAVQRASLQADN
FT                   SGWSLEARFDFELNSNLEDAVNKGIPLYFTTDFELSRPRWYWFDEQPVNVSQTLRLSFQ
FT                   PLTREYRVQGVSSGGLQFGFSTLKDALAVIKHVSSWHVIERSDVHPGETYTASVRMQLD
FT                   IALMPKPFQIDAVNNRDWNLASEWKRFTFTVTERAK"
FT   sig_peptide     85439..85534
FT                   /locus_tag="BC1003_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            86028..88442
FT                   /locus_tag="BC1003_0076"
FT   CDS_pept        86028..88442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0076"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bxe:Bxe_A4410 multi-sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase HAMP region domain protein; PAS domain containing
FT                   protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56081"
FT                   /db_xref="GOA:E1T4L7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4L7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN56081.1"
FT                   /translation="MLNKVRSATSVSSIVVRVLVSTVAVTAVLLLVLLAAASANTEFFD
FT                   RYYQWLYAANLVVAIIFLLVVATLVVVIIARLRRGKFGTRLLAKLAFFMALVGVVPGGI
FT                   IYVVSYQFVSRSIESWFDVNVETALTSGLNLGRGMLDASLSDLQTKGRLMSEQLASADA
FT                   AGTTLTLLRLRDQFGVQDATIVEPTRSMSGATPDMHVVAQASGNYATLVPNDLPTSLMI
FT                   DQARRRGYAAIEGEVDGDPRVQGSKGALRLRVVQRIPDSNATLLQPTERFLQLTQPVSQ
FT                   SLARNADAVQRAYREYQEKALGRTGLRKMYIGTLTLALFLATFIAMMLALALGNQLARP
FT                   LFLLAQGTKEITEGDYTPKREIKSRDELGFLTQSFNAMTRQLAEARAAVENNRIALEHS
FT                   KAYLESILANLTAGVFVFDRQFRLTTANRGAERIFRQQFQEMLGSALEQIAVLSEFGGM
FT                   VRKAFADREAASGDAHDDGGHWQQQFSIQVPGETEPLTLLVRGARLVSATDRDAQDMQT
FT                   SGYVVVFDDISDVISAQRSIAWGEVARRLAHEIKNPLTPIQLSAERLQMKLADKLAPSD
FT                   ADVLKRGATTIVNQVAAMKQMVDNFRDYARTPPAVLVHLQLNDLVSEVLTLYGIEEGKG
FT                   AIQVELSELPAIRGDATQLRQVIHNLLQNAQDAVADVERPRVLLETRTVEYGDPDAQGK
FT                   ARVAVRLTVSDNGPGFPTRILTRAFEPYVTTKAKGTGLGLAMVKKIVDEHGARIDIRNR
FT                   MKAGDVIEGAQISILFLQLADDAAAPEAGPRPAHGGASQGKTKATVQTKAA"
FT   gene            88443..89132
FT                   /locus_tag="BC1003_0077"
FT   CDS_pept        88443..89132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0077"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="KEGG: bpy:Bphyt_0316 two component transcriptional
FT                   regulator, fis family; PFAM: response regulator receiver;
FT                   helix-turn-helix Fis-type; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56082"
FT                   /db_xref="GOA:E1T4L8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4L8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN56082.1"
FT                   /translation="MATILVVDDEMGIRELLSEILSDEGHVVEAAENAQQAREFRLRQA
FT                   PDLVLLDIWMPDTDGVTLLKEWAAQGQLTMPVIMMSGHATIDTAVEATKIGALNFLEKP
FT                   IALQKLLKAVEQGLARGTAAVQPGGAAAKSALPMNSSAVASAAALPMLSADGHGSGVLA
FT                   AQTASISFDIPLRDARDAFERAYFEYHLARENGSMTRVAEKTGLERTHLYRKLKQLGVD
FT                   LGKNKGE"
FT   gene            89228..89303
FT                   /locus_tag="BC1003_R0002"
FT                   /note="tRNA-Phe1"
FT   tRNA            89228..89303
FT                   /locus_tag="BC1003_R0002"
FT                   /product="tRNA-Phe"
FT   gene            89736..90467
FT                   /locus_tag="BC1003_0078"
FT   CDS_pept        89736..90467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0078"
FT                   /product="exsB protein"
FT                   /note="KEGG: bpy:Bphyt_0317 ExsB protein; TIGRFAM: exsB
FT                   protein; PFAM: Queuosine synthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56083"
FT                   /db_xref="GOA:E1T4L9"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4L9"
FT                   /inference="protein motif:TFAM:TIGR00364"
FT                   /protein_id="ADN56083.1"
FT                   /translation="MIRKDAKRSALVLFSGGQDSATCLAWALERYETVETLGFDYGQRH
FT                   RVELECREGFRSAVARTFPAWGERLGDDHMIDLSVLGAISDTAMTREIEIEATANGLPN
FT                   TFVPGRNLMFMTIAAAIAYRRGLQVLVGGMCETDFSGYPDCRDDTMKALQVALNLGMDS
FT                   RFLLETPLMWLDKADTWRLAHELGGDELVELVRVETHTCYVGERAELHAWGFGCGECPA
FT                   CRLRKRGYEAYLAGEKVTEPA"
FT   gene            90575..91207
FT                   /locus_tag="BC1003_0079"
FT   CDS_pept        90575..91207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0079"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   bxe:Bxe_A4406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56084"
FT                   /db_xref="GOA:E1T4M0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4M0"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADN56084.1"
FT                   /translation="MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAV
FT                   CRFCDTDFVGTDGENGGKYRSAEELVRMIASQWPQGEGQRFVVCTGGEPMLQIDQPLVD
FT                   ALHAAGFEIAIETNGSLPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLSDYA
FT                   KLDFQYFLVQPMDGPSRDINTRLAIDWCKRHPQWRLSMQTHKYLNIP"
FT   gene            91214..91660
FT                   /locus_tag="BC1003_0080"
FT   CDS_pept        91214..91660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0080"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: bpy:Bphyt_0319 queuosine
FT                   biosynthesis protein QueD"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56085"
FT                   /db_xref="GOA:E1T4M1"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4M1"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ADN56085.1"
FT                   /translation="MLTITRKLEFDAGHRIPDHRSQCRNLHGHRYVLEITLQGDLVDTE
FT                   GAPDRGMVMDFADVKSLAVQHLVDKWDHAFLVYEGDSQVRGFLETMAGHKTVVLDRIPT
FT                   VENLAAVAFEVLANVYDAHYGVNLRLHKVRLYETPNCWADVVRD"
FT   gene            91737..91898
FT                   /locus_tag="BC1003_0081"
FT   CDS_pept        91737..91898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56086"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4M2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADN56086.1"
FT                   /translation="MPVTALRRSRYTSRPFPGEAVCLNHSTGTLARGSCKDAHRSCKDG
FT                   FQTHGARP"
FT   gene            91895..92677
FT                   /locus_tag="BC1003_0082"
FT   CDS_pept        91895..92677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0082"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="KEGG: bpy:Bphyt_0320 2-dehydro-3-deoxyglucarate
FT                   aldolase; PFAM: HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56087"
FT                   /db_xref="GOA:E1T4M3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4M3"
FT                   /inference="protein motif:PRIAM:4.1.2.20"
FT                   /protein_id="ADN56087.1"
FT                   /translation="MSTFTNPLKQRLKEADPLFGLWLSLGSDAAAEALAHAGFDWLLID
FT                   MEHAPNDSGDVTSQLRAIAAAHLPSEPVVRLPAREPWLVKRVMDAGARTLMFPNIESAE
FT                   EAAHAVRLTQYPSAESVDGLRGVAGVVRAAAYGMRRDYVQTANAQIATIVQIESARGLD
FT                   EVEKIAATPGVDCLFVGPADLAASLGHLGDSKHADVQAAMARIVSAADKAGIAAGIFSM
FT                   DAASARQHRDAGFRFIALAADVMWMLRATRQALQEVRA"
FT   gene            92674..93375
FT                   /locus_tag="BC1003_0083"
FT   CDS_pept        92674..93375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0083"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: bxe:Bxe_A4403 hypothetical protein; PFAM: Sel1
FT                   domain protein repeat-containing protein; SMART: Sel1
FT                   domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56088"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4M4"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADN56088.1"
FT                   /translation="MKWLRQGVVARVAVAAALMTGMAAHAQDRVAKSNDPETQTAVADY
FT                   NAGNMTAALSEFRKAAQRGSRLAQFNYAMMLLNGEGTAANVDEGKKWLRKAADANMSHA
FT                   QYVYGKMYDDGEFVGRDPVEAHRWFLKAAQQGHVQAELALANQFLDGRGTDRDNKQAFL
FT                   WYKKAAEGGDMTAQYVTGSFYERGGDGVDRNLNVARAYYAAAAAQGDPAARLKYQQLSS
FT                   QLRDQKEVKPQ"
FT   sig_peptide     92674..92754
FT                   /locus_tag="BC1003_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(93442..94590)
FT                   /locus_tag="BC1003_0084"
FT   CDS_pept        complement(93442..94590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0084"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="KEGG: bpy:Bphyt_0322 rod shape-determining protein
FT                   RodA; TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56089"
FT                   /db_xref="GOA:E1T4M5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4M5"
FT                   /inference="protein motif:TFAM:TIGR02210"
FT                   /protein_id="ADN56089.1"
FT                   /translation="MQFDKRAWLDRIKRMFAGFDRPLALIVFLLLCVGLVTLYSASLDV
FT                   PGRVEDQLRNIMLTFVLMWALANVPPTTLMRFAVPLYTFGIALLVAVALFGLTRKGAKR
FT                   WINVGVVIQPSEIMKIATPLMLAWYYQRREGVMRWYDFLVGLLILAVPVGLIAKQPDLG
FT                   TAVLVFAAGFFVIYFAGLSFKLIVPVLIAGVIAVASVAAFQDKICQPDVQWPLMHDYQK
FT                   HRICTLLDPTSDPLGKGFHTIQAVIAIGSGGPLGKGWLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEFGLAGGIVLLTLYMLLIARGLYIAANGATLFGRLLAGALTMAFFTYAFVNIGMVS
FT                   GILPVVGVPLPFMSYGGTALTTLGVAIGLIMSVARQKRLMQS"
FT   gene            complement(94601..97078)
FT                   /locus_tag="BC1003_0085"
FT   CDS_pept        complement(94601..97078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0085"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein 2; KEGG:
FT                   bxe:Bxe_A4401 peptidoglycan glycosyltransferase; PFAM:
FT                   penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56090"
FT                   /db_xref="GOA:E1T4M6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4M6"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ADN56090.1"
FT                   /translation="MTEFKDTQQQLSKFRVRVAAAGLFVFVCFGLIGFRFLFLQVWHHS
FT                   KYSLQADENRISVAPIVPNRGIITDRNGVVLAKNYSAYTLEITPSKLNAPLESVIDDLA
FT                   TVVSIDARDRRRFKKLQEDSKNFESLPIRTRLTDDEVARFTAQRFRFPGVEVRARLFRQ
FT                   YPLGPTAAHVIGYIGRISQRDQERIDDASDRNDSDPEHYDPRLDANNYKGTDYIGKIGV
FT                   EQSYETELHGQTGFEEVEVTAGGRPVRTMSRTQATPGNNLVLSLDIGLQQVAEQAFAGR
FT                   RGALVAIEPSTGDVLAFVSAPSFDPNSFVDGIDQQTWDELNNSPDHPLLNRPLHGTYPP
FT                   GSTYKPFMALAALTLHKRTPGWGFQDPGSYTFGGHTFRNDVRSGQGWVDMNRAIVVSND
FT                   TYFYMLAHDLGVNNIANFMKPWGFGQITGIDIAGEARGILPSTDWKRKAYRKPEQQKWY
FT                   EGETISLGIGQGYNSFTILQLAHATATLANNGVVMKPHLVRDIENPITKDTRPVVRDPS
FT                   DRIPVKQSDIDIIKRAMEGVVTNGTASKVFIGAPYLAAGKTGTAQVYSLQGANYKGHAI
FT                   AEHLRDHALFIAFAPADQPKIALALIVENGGWGAEAAGPIARKVLDYYLVGKNKPGAEA
FT                   AAVAAAASATQDASAPEVGAAPAPQEATQPVKIAAGFTALPMPGAASAASAASAATAAS
FT                   AAAAASSAAGASAAAAAPPANRASGPAGTAGVASSATATTSRAPAAVAGPSAPRKQPAS
FT                   GAAASTPATASAAAADHATPRKSGAPRLPRPASAPAPAAAARPASNGGPQPSRDSGTEP
FT                   ASPRQPVSGGIDE"
FT   gene            complement(97220..97732)
FT                   /locus_tag="BC1003_0086"
FT   CDS_pept        complement(97220..97732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0086"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="KEGG: bxe:Bxe_A4400 rod shape-determining protein
FT                   MreD; TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56091"
FT                   /db_xref="GOA:E1T4M7"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4M7"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ADN56091.1"
FT                   /translation="MNRPQYILQPVNPYFIAFSLAAAFLLNLMPWGRLVGVPDFVALVL
FT                   LFWNVHQPRKVGMGIAFFLGLLMDVHNASLLGEHALAYTLLSYGAITIHRRVLWMSLGV
FT                   QTFAVMPLLVIAQLVPFIIRLLTGAAFPGWGYLIDGFVEAALWPVASVLLLMPQRRPAD
FT                   PDDTRPI"
FT   gene            complement(97729..98832)
FT                   /locus_tag="BC1003_0087"
FT   CDS_pept        complement(97729..98832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0087"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="KEGG: bpy:Bphyt_0325 rod shape-determining protein
FT                   MreC; TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56092"
FT                   /db_xref="GOA:E1T4M8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4M8"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ADN56092.1"
FT                   /translation="MEYSPPPLFKQGPSALARLVFFVVLALALLISDARFRTLEIVRGV
FT                   LGAGLYPLQRAALVPRDVFMGAADLAVTSATLRSDNEKLRTRNLQLSQQANTAAELSAE
FT                   NAHLRALLQLSQRATTQSLPAEIQYDTRDPFTQKVVINRGAQQGIQNGSPVVNEDGVIG
FT                   QVTRVFPLQAEVTLLTDKDQAVPVQIVRTGLRSVIYGTPKGDTLDLRFVPISADVQTGD
FT                   ELVTSGLDGVYPPGLPVAKVVRVDKQADTAFARVICLPIAPVRGARQLLVLHYVNDLPP
FT                   RPVEEPETPTKDGKAKKGAKSADSKAAADKSAKPSEKSASNAAGQAAQAASAGKPAGTE
FT                   QKSASAAAKKPAAPEKAKPQTAPGAKP"
FT   gene            complement(98984..100027)
FT                   /locus_tag="BC1003_0088"
FT   CDS_pept        complement(98984..100027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0088"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: cell shape determining protein, MreB/Mrl
FT                   family; TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56093"
FT                   /db_xref="GOA:E1T4M9"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4M9"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADN56093.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   gene            100402..100701
FT                   /locus_tag="BC1003_0089"
FT   CDS_pept        100402..100701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0089"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="KEGG: bxe:Bxe_A4397 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit C; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit; PFAM: Glu-tRNAGln
FT                   amidotransferase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56094"
FT                   /db_xref="GOA:E1T4N0"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4N0"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ADN56094.1"
FT                   /translation="MALTLTDVKRIAHLARLELADADAEHTLVQLNEFFGLVEQMQAVD
FT                   TTGIAPLAHPIEQIEDVALRLRDDAVTETIEREAFQRPAPAVQDGLYLVPKVIE"
FT   gene            100880..102367
FT                   /locus_tag="BC1003_0090"
FT   CDS_pept        100880..102367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0090"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="KEGG: bxe:Bxe_A4396 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56095"
FT                   /db_xref="GOA:E1T4N1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4N1"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ADN56095.1"
FT                   /translation="MHEKSLTELRAALAARECSAVELAQLYLKRIDAAAGLNAFIQVDP
FT                   ELTLAQAKAADALLHSGHGGPLTGVPVAHKDVFVTKGWRSTAGSKMLSNYESPFDATVV
FT                   ERLQTAGMVCVGKTNMDEFAMGSSNENSYFGPVKNPWDRQAVPGGSSGGSAAAVAARLV
FT                   PAATGTDTGGSIRQPASFSGITGIKPTYGRVSRYGMIAFASSLDQGGPMAQSAADCATL
FT                   LNAMAGFDSRDSTSLVRDDEDYTRYLGEPWKQGDAGKPLAGLRIGLPKEYFGAGLADDV
FT                   RAAIDAALKQYEALGATLVEVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAE
FT                   YRDLLDMYKKSRAEGFGPEVKRRIMVGAYVLSHGYYDAYYLQAQKIRRIIAQDFQQAFT
FT                   QCDVIMGPVAPSVAWDLGAKGDDPVQMYLADVYTLSVSLAGLPGMSVPCGFGAGANAQR
FT                   PVGLQIIGNYFNEARMLQVADAFQRATDWHRKAPAGV"
FT   gene            102373..103848
FT                   /locus_tag="BC1003_0091"
FT   CDS_pept        102373..103848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0091"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="KEGG: bxe:Bxe_A4395 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit B; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, B subunit; PFAM: GatB region; Asn/Gln
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56096"
FT                   /db_xref="GOA:E1T4N2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4N2"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ADN56096.1"
FT                   /translation="MTKQWEVVIGLETHAQLSTQSKIFSGAPTQFGAAPNTQACPVDLA
FT                   LPGTLPVMNRGAVERAIQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQG
FT                   GQVTIQVPGNEKAGTPAYSKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEI
FT                   VTEPEMRSAAEAVAYAKTLHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAE
FT                   IKNLNSFRFLEEAIQYEVRRQIELIEDGGTVVQETRLYDPDRRETRSMRSKEDAHDYRY
FT                   FPDPDLMPLVIDAAWVERVKREMPELPEAIQQRFVSQYGLTPYDANVLTSSKATAAYFE
FT                   AVVGKLGAANAKVAANWVMGEVSSQLNREGLEIAECPVSSAQLALLLQRIADGTISNKI
FT                   AKEIFLTIWEEKANDEAAADRIIEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGK
FT                   EKAFNALIGQAMKATKGKANPAQVNELLKKKLS"
FT   gene            104044..104877
FT                   /locus_tag="BC1003_0092"
FT   CDS_pept        104044..104877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0092"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bpy:Bphyt_0330 protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56097"
FT                   /db_xref="GOA:E1T4N3"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4N3"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ADN56097.1"
FT                   /translation="MAKRPELDDFRVPYFDGKKSKFSLDDFDPAAKPFSTGAKDSDRER
FT                   LSEIGAELDVFQERLHAQRKRRVLLVLQGMDTSGKDGTIRAVFHEVDPLGLRIAPFKAP
FT                   TPDELAHDFLWRVHAQAPAAGELTIFNRSHYEDLLVPTVLGSIDARAFDMRCRHIRQFE
FT                   ELLADSETAIIKCMLHISKEEQRERLQARIDDQTKHWKFDVSDLDARKQWDKYLSVYGD
FT                   ALAATSTEYAPWYVIPADSKTHRNLMVAELLLRTFRELKLEFPPAKESLKGVKVE"
FT   gene            104959..105738
FT                   /locus_tag="BC1003_0093"
FT   CDS_pept        104959..105738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0093"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; KEGG: bxe:Bxe_A4393
FT                   exodeoxyribonucleaseiii xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56098"
FT                   /db_xref="GOA:E1T4N4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4N4"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADN56098.1"
FT                   /translation="MLRVITANLNGIRSAAKKGFFDWFGEQNADVLCVQEIKCSQDDMT
FT                   PEFMAPHDFTGYFQHAVKKGYSGAGVYTRHEPDEVVIGFGSEEFDPEGRYVELRFGKLS
FT                   IVSVYVPSGSSGEERQQAKYRFMDEFMPHLAGLAREREVIVCGDVNIVHKEIDIKNWKS
FT                   NQKNSGCLPEERAWLTKLFDEVGYVDVFRTLDQRPEQYTWWSNRGQAYAKNVGWRIDYQ
FT                   IATPGIAGKAKRTEVFRDIKFSDHAPLTVDYDHDVKK"
FT   gene            complement(105856..107133)
FT                   /locus_tag="BC1003_0094"
FT   CDS_pept        complement(105856..107133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0094"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bpy:Bphyt_0332
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56099"
FT                   /db_xref="GOA:E1T4N5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4N5"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADN56099.1"
FT                   /translation="MKTFLAKQSACWRARRVTGRVAGRGVLRDAFTLACASFLSAAIPL
FT                   NAHAAAASPVAANSAAAGASANAANAVAGAPQPTAPTPKSAAAAANAESAAAAPPVANG
FT                   VNNAGSAPAAGTSPGSSVQPSASGKATSPASPSVTGGTKPPATAAASVPYSPNNQLRYG
FT                   GYLVFRNLIPSPMLEAQAAEEFSQIVYGAEHANRLYDDADAHVTRVRSIVDKMVPYSLK
FT                   WNERAKGWKWDVAVVRSPDIRMYCLPGGKIVVYGGLLDRARLNDNELGMLIGHEIAHAL
FT                   REHARERLGQLQGSQLASSGTISQLFGLADLGAAPLGIGSRLLEMKYENTDETEADVIG
FT                   SDIASRAGFDPRAAVTLWDKLAQATRSSREQGFIYVHPYSQSRRQDIIKRLPDMLPLYA
FT                   KAIGKTVDALPDYAGMGRPRRKLARD"
FT   sig_peptide     complement(106984..107133)
FT                   /locus_tag="BC1003_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.895 at
FT                   residue 50"
FT   gene            complement(107130..108530)
FT                   /locus_tag="BC1003_0095"
FT   CDS_pept        complement(107130..108530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0095"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0333 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56100"
FT                   /db_xref="GOA:E1T4N6"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4N6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56100.1"
FT                   /translation="MSNPPHEAPAPAVTAHEEHPGWRAFFNTRMLICVFLGFTSGLPLF
FT                   TLVYLVQAWLRSEGVNLKEIGLFALIQFPYTWKFIWAPLMDRYVPRLPGWRPGRRRGWM
FT                   LVTQILVAGAIGALGFVSPRDSIWTVAALTALVAFFGASQDISIDAYRRELLSDTEQGL
FT                   GNAVHVNAYKIAALVPGSLALILSDHLPWTTVFMVTGAFMLPGIVMTLVVREPEIHGTP
FT                   PRNLREAIVQPFREFLERDGWRGALFVLGFIFLYKLGDTMATTLSTSFFLDIGFSRTQI
FT                   GVIAKTTAFAASLAGGIVGGVWLMKIGIGRGLWIFGVLQMVSTLGFAWLAHLGPASPGL
FT                   TAIYDIAVGISTGTTKLLSWVGIDWSVQLEPRLVALALVYGFETFSTGLTMAAFTAYIA
FT                   STTDPRYTATQFALFTSLASVPRTLASAASGYVVAQIGWFDYFNVCTALALPGMLLLLR
FT                   IAPWRVRS"
FT   gene            complement(108545..109153)
FT                   /locus_tag="BC1003_0096"
FT   CDS_pept        complement(108545..109153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0096"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="KEGG: bpy:Bphyt_0334 methionine biosynthesis protein
FT                   MetW; TIGRFAM: methionine biosynthesis protein MetW; PFAM:
FT                   Methionine biosynthesis MetW protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56101"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4N7"
FT                   /inference="protein motif:TFAM:TIGR02081"
FT                   /protein_id="ADN56101.1"
FT                   /translation="MNQRALDYLALRPDFRAIARWVEPRATVLDLGCGDGSLLSLLSEE
FT                   LDVQGYGIEINDAGVLAATQNGVNVIQQNLEDGLRLFEDGSFDFAILSQTLQTIHQTAA
FT                   ILRETVRVGRECIVSFPNFGYWAHRLSVLQGRMPVSKSLPYQWHNTPNVRVLTIKDFEA
FT                   LAPEVGIEILDRVVLHDGQTVRWGVNWRGSLAVYRVKKS"
FT   gene            complement(109150..110295)
FT                   /locus_tag="BC1003_0097"
FT   CDS_pept        complement(109150..110295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0097"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="TIGRFAM: homoserine O-acetyltransferase; KEGG:
FT                   bpy:Bphyt_0335 homoserine O-acetyltransferase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56102"
FT                   /db_xref="GOA:E1T4N8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4N8"
FT                   /inference="protein motif:TFAM:TIGR01392"
FT                   /protein_id="ADN56102.1"
FT                   /translation="MESIGIVAPTKMHFPEPLRLQNGSSLAGYDLMVETYGTLNAARSN
FT                   AVLVCHALNASHHVAGVYADNPKDIGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTG
FT                   PMSIDPATGKPYGATFPVVTVEDWVNAQARVADQFRIERFAAVMGGSLGGMQALAWSMM
FT                   YPQRVAHCIVVASTPKLSAQNIAFNEVARSAILSDPDFHGGNYYAHGVKPKRGLRVARM
FT                   IGHITYLSDDDMAEKFGRSLRRAEGALDAYNFNFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAFDGDLTAALAHTTAKYLIASFTTDWRFAPARSRELVKALLDHK
FT                   RTVTYAEIDAPHGHDAFLLDDARYHNLMRAYYERIANEVNA"
FT   gene            complement(110612..111328)
FT                   /locus_tag="BC1003_0098"
FT   CDS_pept        complement(110612..111328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0098"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bpy:Bphyt_0336
FT                   nucleoid occlusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56103"
FT                   /db_xref="GOA:E1T4N9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4N9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADN56103.1"
FT                   /translation="MQPIDKPDEALAEHAPAHDPALTSPPRAQRPKPGERRVHILQTLA
FT                   AMLEAPKSEKVTTAALAARLGVSEAALYRHFASKAQMFEGLIEFIEQTIFGLINQIVDK
FT                   ENNGVLQARAIALMLLNFSAKNPGMTRVLTCEALVGEHERLTMRVNQMLERVEASLKQC
FT                   LRVATANANANANANANADAFAQDAPAPVPAGYDPAVRASLLLSYVIGRWHRFVRSGFV
FT                   RLPADDADQQLRVILQ"
FT   gene            complement(111295..112098)
FT                   /locus_tag="BC1003_0099"
FT   CDS_pept        complement(111295..112098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0099"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: bxe:Bxe_A4386 HAD family hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56104"
FT                   /db_xref="GOA:E1T4P0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4P0"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADN56104.1"
FT                   /translation="MRTPTFRRRRPQIAGGRPVWLFDLDNTLHHASHAIFPAINQAMTQ
FT                   YIVDALQVELAEANRLRTGYTQRYGAALLGLTRHHPLDANDFLKVVHTFSDLGSMIRHE
FT                   RGVARLVAALPGRKIVLTNAPEAYARAVLAQLRIERLFEQVIAIEHMRDRRQWRAKPDH
FT                   AMLRKAMRDAHVSLKDVVLVEDTRSHLKNYRRLGIRTVWITGHLPRKPHADGVPTRLPG
FT                   TGRPHYVDRSIRSLKSLRLSTRSVRLKRQQTGRQPCSRSTSLMKP"
FT   gene            complement(112296..113195)
FT                   /locus_tag="BC1003_0100"
FT   CDS_pept        complement(112296..113195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0100"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; KEGG:
FT                   bpy:Bphyt_0338 acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56105"
FT                   /db_xref="GOA:E1T4P1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4P1"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ADN56105.1"
FT                   /translation="MSELPDLSQIAPTLKAEILAEALPYIRQYHGKTVVIKYGGNAMTE
FT                   ERLKQGFARDVILLKLVGINPVIVHGGGPQIDQALKKVGKQGTFIQGMRVTDEETMEVV
FT                   EWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARKMLMPDRDNPGQYVDIGQVGEV
FT                   EAINPAVVKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLAVVLNAEKLVMMTNIP
FT                   GVMDKEGNLLTDLSAREIDGLFADGTISGGMLPKISSALDAAKSGVRSVHIIDGRIEHS
FT                   VLLEILTEQPFGTMIRSH"
FT   gene            113461..113685
FT                   /locus_tag="BC1003_0101"
FT   CDS_pept        113461..113685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0101"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: bte:BTH_I0161 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56106"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4P2"
FT                   /inference="similar to AA sequence:KEGG:BTH_I0161"
FT                   /protein_id="ADN56106.1"
FT                   /translation="MKPSASRPPGSARCPRCGNAFDCAMHAEPFDCWCRQMPPLPRERL
FT                   DPSGRCLCPECLAAEIARVAQPEPGAESP"
FT   gene            complement(113721..115310)
FT                   /locus_tag="BC1003_0102"
FT   CDS_pept        complement(113721..115310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0102"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_A4384 hypothetical protein; PFAM:
FT                   Tetratricopeptide TPR_1 repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4P3"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADN56107.1"
FT                   /translation="MRHAALARRSGAQELEAQALHAAAQLHSLDDAALASLTHTLIQQQ
FT                   RHGDAIDLAAIIAQLDERNASAHFRLGYALQMADRHGEAIAPYQRALALDPALPSLRCN
FT                   LAGALAFTGLDLDQQIALLEEAVKQDPADGNAWINLTNAYRKNMNLPRALEAGERAVHC
FT                   VPLSPLAHNNYALTLREAQRWDTAAQAAQTACALAPTDAAMRSNLAMLQLMRGDYANGW
FT                   LSHEARWSGSAELRGIRPALPAPTWRGEPLAGKTLLVWGEQGMGDVLQFSRYIPLVAER
FT                   VHLEGGRLAWNSFPQMGELLLRSLGGHVDHYSAGGGVETLPPFDFEIPLLSLPLIFGTR
FT                   EPTIPAATPYLHADAAAVERWRDRFAGEPRLKVGLTWTGSHTHQRNPFRRVGLERYAKY
FT                   FAGMRNVAFYSLQPGGGDEVNAARAAGLPINDYTAEFATFDDTAACVSALDLVITVCTS
FT                   TAHLSGALGQRTWVLLDVNPHWVWLTERRDSPWYPSATLYRQPAFAEWESALAALAHDL
FT                   AALAARHVAAPR"
FT   gene            115456..116766
FT                   /locus_tag="BC1003_0103"
FT   CDS_pept        115456..116766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0103"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: bpy:Bphyt_0340 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56108"
FT                   /db_xref="GOA:E1T4P4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4P4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN56108.1"
FT                   /translation="MHRITNTGRVNLGHLFWLRSLAIIGQLLTIAVVQIFIGVHLPLPA
FT                   MLLVIALEVIFNALTWWRVAQQRPESNIELFGQIWVDLGALSALLFLSGGTTNPFVSLY
FT                   LPSLAIAAAVLPWHLMAWLAAFAVACYAVLGFDSVPLNLDNPANLFDYFRAGMWVNFMV
FT                   SVGLIAWFVARMSRALRLRDAALGEAQQRLLHDERAVALGVQAATVAHEIGTPLSTIAM
FT                   LSEELRDAARTDNGLAPYSADLELLEQQMSLCTSALARLRSRATTATNRQPVGEWLESF
FT                   ADQWRLRHPHVKFERLGAPPADVSLDDTVAVSQILTILLDNAARASRDHVTLSCRLTAR
FT                   GDQVEFEVCDAGPGIPAALRGSLGTMPVESTQGGHGVGLYLAFSAAARLKGSIELTDAN
FT                   TARPRGTRAVLRLPLTERKISGPGRQGVAPSNTEKQA"
FT   gene            116763..117305
FT                   /locus_tag="BC1003_0104"
FT   CDS_pept        116763..117305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0104"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="KEGG: bpy:Bphyt_0341 two component transcriptional
FT                   regulator, fis family; PFAM: response regulator receiver;
FT                   helix-turn-helix Fis-type; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56109"
FT                   /db_xref="GOA:E1T4P5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4P5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN56109.1"
FT                   /translation="MSEMNFLVIDDDEVFSGILARGLTRRGYTVSEAHNADEAIRLANQ
FT                   QKFSQITVDLHLGNDSGLTLVAPLRDLQPDARMLVLTGYASIATAVQAVKDGADNYLAK
FT                   PANVETILSALQSEASALQAEEAIEHPTPLSVARLEWEHIQRVLAEHGGNISATARALN
FT                   MHRRTLQRKLAKRPVKQ"
FT   gene            complement(117471..118817)
FT                   /locus_tag="BC1003_0105"
FT   CDS_pept        complement(117471..118817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0105"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; KEGG:
FT                   bpy:Bphyt_0342 ATP-dependent protease ATP-binding subunit
FT                   HslU; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56110"
FT                   /db_xref="GOA:E1T4P6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4P6"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ADN56110.1"
FT                   /translation="MSTMTPAEIVSELDKHIIGQGRAKKAVAVALRNRWRRQQVEEPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLI
FT                   EIAVKQTRESEMRKVRTKAEDQAEDRILDILLPSARPVGFGSSSSAADTADEGSTTRQT
FT                   FRKRLREGLLDDKEIELDVEQPQVGMDIMGPPGMEDMTEQIRSMFANIGGGKKTRRKMK
FT                   VKEALKVLTDEEAGKMLNDEEVKTKAVQNVEQNGIVFLDEIDKIASRSEAGGGEVSRQG
FT                   VQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSL
FT                   SVNDFESILVSTDASLVKQYQALLATEDVHLEFADDGIRRLAEIAYAVNEKTENIGARR
FT                   LYTVIEKLLEEVSFSAGNHSGNTVKIDAAYVDRALNEVAEDEDLSRYVL"
FT   gene            complement(118827..119363)
FT                   /locus_tag="BC1003_0106"
FT   CDS_pept        complement(118827..119363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0106"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   bph:Bphy_0070 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56111"
FT                   /db_xref="GOA:E1T4P7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4P7"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ADN56111.1"
FT                   /translation="MEQFHGTTIVSVRRGDQVALGGDGQVTLGNIVMKGGAKKVRRIYN
FT                   GKVLVGFAGGTADAFSLLDRFEAKLEKHQGNLTRAAVELAKDWRTDRMLRRLEAMLITA
FT                   DATTTLVITGNGDVLDPEGGICAIGSGGAYAQAAAKALADNTALSPREIVEKSLEIAGD
FT                   MCIYTNHNRVIETIE"
FT   gene            complement(119628..120047)
FT                   /locus_tag="BC1003_0107"
FT   CDS_pept        complement(119628..120047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0107"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="TIGRFAM: RNA polymerase-binding protein DksA; KEGG:
FT                   bpy:Bphyt_0344 transcriptional regulator, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56112"
FT                   /db_xref="GOA:E1T4P8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4P8"
FT                   /inference="protein motif:TFAM:TIGR02420"
FT                   /protein_id="ADN56112.1"
FT                   /translation="MTTKRLLTEAEILKMSDKDYMNEDQLAFFKNKLEQLQAEILRNAG
FT                   QTTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSLARIDSGDYGWCEE
FT                   TGEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
FT   gene            120217..120360
FT                   /pseudo
FT                   /locus_tag="BC1003_0108"
FT   gene            complement(120853..121950)
FT                   /locus_tag="BC1003_0109"
FT   CDS_pept        complement(120853..121950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0109"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bxe:Bxe_A4377
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56113"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4P9"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADN56113.1"
FT                   /translation="MIPVTILTGFLGSGKTTLLKRILNEKHGMKIAVIENEFGEENIDN
FT                   DILVQDTSEQIIQMSNGCICCTIRGDLSRVLGDLAAQKQSGKLDFDRVVIETTGLANPG
FT                   PVAQTFFMDDQIAGEFLLDAIITLVDAKHANHQLDEHEVVQRQVGFADRLFITKSDLVD
FT                   EQQLADLRHRLLHMNPKAAIKVVNFGDADIKEIFDLRGFNLNSKLEIDPDFLAEDEHAH
FT                   NHAHAHDEHGHTHDHDHDHANCDHDHGHCDHEGHHHGHHHHAHHDDKIKSFVYRNDRPF
FT                   DPNKLEDFLGGILQIYGEHLLRYKGVLYMKGVDRKVVFQGVHQMMGSDLAAKWQPAEKK
FT                   TNKMVFIGIDLPQDLITDGLDACLV"
FT   gene            complement(122150..123352)
FT                   /locus_tag="BC1003_0110"
FT   CDS_pept        complement(122150..123352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0110"
FT                   /product="Conserved hypothetical protein CHP00095"
FT                   /note="KEGG: bpy:Bphyt_0346 PUA domain containing protein;
FT                   PFAM: Conserved hypothetical protein CHP00095; SMART: PUA
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56114"
FT                   /db_xref="GOA:E1T4Q0"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4Q0"
FT                   /inference="protein motif:PFAM:PF03602"
FT                   /protein_id="ADN56114.1"
FT                   /translation="MNTVTLKPSKEKSLLRRHPWVYANAIDRIDGHPAPGATVLVRAHD
FT                   GRFLARAAYSPHSQIRARVWSFDEAEPIDHAFFKRRVQRALAHRQAMVHDTGAVRLIFG
FT                   EADGLPGLIVDHYVAEDEGQRSQLVCQFMAAGVEAWKDAIVAALVGATGCPNVYERSDV
FT                   SIRQKEGLEQITGVLAGEAPSETLIARENGVRYHVDVRHGHKTGFYVDQRDNRLLVQQF
FT                   AEGREVLNCFCYTGGFSLAALKGGAKRVVSIDSSGEALALAQQNVAANGFDAERATWLD
FT                   ADAFKTLRRLYDEGQRFDLIVLDPPKFAPSREHVDRASRAYKDINLTGFKLLRPGGLLF
FT                   TYSCSGAIDSELFQKIVASAAADARVDARILKRLGAGVDHPLLTAFPEGEYLKGLLLQI
FT                   A"
FT   gene            complement(123444..124367)
FT                   /locus_tag="BC1003_0111"
FT   CDS_pept        complement(123444..124367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0111"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="KEGG: bxe:Bxe_A4375 site-specific tyrosine
FT                   recombinase XerC; TIGRFAM: tyrosine recombinase XerC; PFAM:
FT                   integrase family protein; integrase domain protein SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56115"
FT                   /db_xref="GOA:E1T4Q1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4Q1"
FT                   /inference="protein motif:TFAM:TIGR02224"
FT                   /protein_id="ADN56115.1"
FT                   /translation="MTETDFIAAYLSNLEHERRLSAHTLRGYTHELDELRLLAKGRPLQ
FT                   SLTAVDIRGAVARAHAGGLTARSISHRLSAWRAFYRWLAGRIDLPANPVATVRAPKQPK
FT                   TLPKALSVDDANRLMETPPAASAEGLRDHAMLELFYSSGLRLAELVGLDVRFADADGYR
FT                   SAGWLKLDSAEVEVLGKGNRRRIVPVGSKALEALNAWLAVRDQMVRLDPHPLFLSARGN
FT                   RLSPNVVRERVKRAALVAGIPANVHPHVLRHSFATHVLQSSGDLRAVQELLGHASITAT
FT                   QVYTGLDFQHLARVYDQAHPRAKKRD"
FT   gene            complement(124449..125168)
FT                   /locus_tag="BC1003_0112"
FT   CDS_pept        complement(124449..125168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0112"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   bpy:Bphyt_0348 protein of unknown function DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56116"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4Q2"
FT                   /inference="protein motif:PFAM:PF04340"
FT                   /protein_id="ADN56116.1"
FT                   /translation="MNDREVAEYLLANPEFFAEHAEVLATIRLANPHGKAAVSLQERQM
FT                   EMLRDKNKHLERRLAELLRYGHENDSIAAKFNRWTIRVMAERDPYALPRTIANGLREIF
FT                   DVPQAALRVWDVADPYAQADFARHVGEEVRIFANSLTAPYCGANTGFEAAQWLIPSAAA
FT                   SDENPAGGAAPEPAHATESIALLALRDPEASEDAPVFGLLVMGSADARRFHDGMATDFL
FT                   TQIGALASAALSRLLPR"
FT   gene            complement(125307..126170)
FT                   /locus_tag="BC1003_0113"
FT   CDS_pept        complement(125307..126170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0113"
FT                   /product="diaminopimelate epimerase"
FT                   /note="KEGG: bpy:Bphyt_0349 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56117"
FT                   /db_xref="GOA:E1T4Q3"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4Q3"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADN56117.1"
FT                   /translation="MKLKFTKMHGAGNDFVVLDGYTQPVNLSPAQVRALADRHFGVGAD
FT                   QLLLVEKPTVEGVDFRYRIFNCDGGEVEHCGNGARCFVKFVRDSGLTDQRSVRVQVQKG
FT                   TITLTMQENGEVLVDMGAPVFEPERVPFATKGIQGRREGADTLWPLDVNGTTRWISVVS
FT                   MGNPHAVQVVDDVEAFPVLVEGPVIERHARFPQRVNAGFMQIVGRSEIKLRVYERGAGE
FT                   TLACGTGACAAVAAGIRRGLLDSPVLVHTHGGKLTISWDSSQESEPLLMAGPATTVFQG
FT                   EIELAD"
FT   gene            complement(126270..127154)
FT                   /locus_tag="BC1003_0114"
FT   CDS_pept        complement(126270..127154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0114"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56118"
FT                   /db_xref="GOA:E1T4Q4"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4Q4"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ADN56118.1"
FT                   /translation="MLSRFGPRLAIGLLKLFALLPYGFVARLGDGLGWLLYQIPSRRKR
FT                   IVHTNLKLCFPEWSDERREEVAQKHFRHAIRSYLERSVQWFGSAKKLEKLIQVDSAIDL
FT                   TDPNLPPTLFLGFHFVGIEAGSIFLNYSLKRQCGSLYQPMSNPELEEVAKAARARFGAD
FT                   MASRADSARIVLRWLRERKPVMLGADMDYGARNSTFVPFFGVPTCTLTAVGRLAKVGHA
FT                   QVVPFIGEVLPNYKGYRLRVFKPWDNYPTGDDDADARRMNAFLEEQIPSMPEQYYWVHK
FT                   RFKTRPPGVPGVY"
FT   gene            127428..128618
FT                   /locus_tag="BC1003_0115"
FT   CDS_pept        127428..128618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0115"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="TIGRFAM: S-adenosylmethionine synthetase; KEGG:
FT                   bpy:Bphyt_0351 S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56119"
FT                   /db_xref="GOA:E1T4Q5"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4Q5"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ADN56119.1"
FT                   /translation="MANDYLFTSESVSEGHPDKVADQISDAILDAILSQDKYSRVAAET
FT                   LCNTGLVVLAGEITTTANVDYIQIARNTIKRIGYDNTDYGIDYRGCAVLVAYDKQSPDI
FT                   AQGVDRAHDNNLDQGAGDQGLMFGYACEETPELMPLPIHLSHRLVERQANLRRDGRLSW
FT                   LRPDAKSQVTVRYVDGKPHSIDTVVLSTQHSPDIDLGTLREAVIEEVIKPTLPANLIKG
FT                   DIKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYA
FT                   GRYVAKNIVAAGLASRCLIQVSYAIGVAQPTSVMVNTFGTGRVSDATITRLVQEHFDLR
FT                   PKGIIQMLDLLRPVYEKSAAYGHFGREEPEFTWEATDKALALAEAAGTEPVAALAD"
FT   gene            complement(128898..129269)
FT                   /locus_tag="BC1003_0116"
FT   CDS_pept        complement(128898..129269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56120"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4Q6"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4370"
FT                   /protein_id="ADN56120.1"
FT                   /translation="MHTLLSTRFTRAALKAARPARRHVVRALRHHATRTRALGEQWRDA
FT                   KAVDGIRTWFNSFFSALRMRGGARPLSLRTLLRKPTPLRLTTTPRAPVATRSQRASRRP
FT                   RRMSTSGSTGWFAFAFATR"
FT   gene            129768..130529
FT                   /locus_tag="BC1003_0117"
FT   CDS_pept        129768..130529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0117"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: bxe:Bxe_A4369
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56121"
FT                   /db_xref="GOA:E1T4Q7"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4Q7"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ADN56121.1"
FT                   /translation="MSLHSKKEQIHTLREQGFVVVPGLVSAERCEQMKQVAQRQLEEAA
FT                   APIEFEADLQYPGAPSSKLAPGGHTVRRLLDAYGRDAGFAQWATAPEIRGWMELYFGEE
FT                   PRLSRAHHNCMMTKHPAYGSLTGWHRDVRYWSFERDDLVSVWLALGNETVDNGALWFVP
FT                   GSHSAAFTGDRFDEAKFFRSDLEENQEWIRAAVSPELKAGDVVFFHCNTLHSAGKNLSD
FT                   QVKFSLVFTYHGASNVPLPGTRSAAKPEIAF"
FT   gene            complement(130615..130821)
FT                   /locus_tag="BC1003_0118"
FT   CDS_pept        complement(130615..130821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0118"
FT                   /product="Protein of unknown function DUF3185"
FT                   /note="PFAM: Protein of unknown function DUF3185; KEGG:
FT                   bpy:Bphyt_0354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56122"
FT                   /db_xref="GOA:E1T4Q8"
FT                   /db_xref="InterPro:IPR021521"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4Q8"
FT                   /inference="protein motif:PFAM:PF11381"
FT                   /protein_id="ADN56122.1"
FT                   /translation="MTKAISIALIVGGVLLLYFGGQAFNSVSSDVSRVFTGSPSNKAIM
FT                   LIVGGVVATLAGITGMALSGRKR"
FT   sig_peptide     complement(130744..130821)
FT                   /locus_tag="BC1003_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.501 at
FT                   residue 26"
FT   gene            131033..132076
FT                   /locus_tag="BC1003_0119"
FT   CDS_pept        131033..132076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0119"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bpy:Bphyt_0355
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56123"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4Q9"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADN56123.1"
FT                   /translation="MAYEAASERYSDMQYRVCGKSGLKLPALSLGLWHNFGDTTPLSTQ
FT                   REILRTAFDLGITHFDLANNYGPPYGSAETNFGRHFKDDFKPYRDELLISSKAGWDMWP
FT                   GPYGQGGGSRKYVLASLDQSLKRMGLDYVDIFYSHRFDAHTPLEETAGALASAVQQGKA
FT                   LYIGISSYSASKTLEMTKLLAEYKVPLLIHQPAYNMLNRWIERELLDTLEQVGAGTIAF
FT                   TPLAQGLLTGKYLNGVPQDARVNKPGGASLKQEHLSAENIEHVRKLNEIAQRRGQSLAQ
FT                   MALAWALRDPRVTSVLIGASRAEQVRENVGALKNLAFSKEELAEINRYATEGGINLWEK
FT                   PSTDQAI"
FT   gene            complement(132156..132341)
FT                   /locus_tag="BC1003_0120"
FT   CDS_pept        complement(132156..132341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56124"
FT                   /db_xref="GOA:E1T4R0"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4R0"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4366"
FT                   /protein_id="ADN56124.1"
FT                   /translation="MTTYFTIGDFILVIPMALAGALFVGALPCKTELRHNVLRVLGALL
FT                   GVVFAVMLVEGLPALV"
FT   gene            complement(132644..133876)
FT                   /locus_tag="BC1003_0121"
FT   CDS_pept        complement(132644..133876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0121"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: bxe:Bxe_A4365 major facilitator transporter;
FT                   manually curated; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56125"
FT                   /db_xref="GOA:E1T4R1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4R1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56125.1"
FT                   /translation="MVLVLSVVPNASDTPYLERGTRAYWRASIALLFAGYATFSLLYCV
FT                   QPLLPSFSSAFNVTPAQSSLTVSLSTAALAFSIFTAGFVSEGWSRHKLMTMSLTVSALL
FT                   TIGVSIAPQWHQLLVLRALEGLALGGVPAVAMAYLAEEVHPDGLGLAMGLYVGGTAIGG
FT                   MAGRVITGVVADLFSWRVAIGTIGVLGLLSMLAFRALLPPSRHFVPRRGLGFTHHRSAL
FT                   LRQFTRPGLPLLFLLGFVLMGSFVTLYNYIGYRLLAPPYRLSQSEIGAIFVVYLTGVVA
FT                   SPWSGRMADTFGRARVLAASLLLMGAGLALTTFTALAAIVGGIACVTFGFFAGHAVASG
FT                   WVGRLAKEAKGQAAALYLLAYYIGSSVVGSYGGHMWAGFGWSGVAALVAALLVIGMLAA
FT                   LRLGRLDPAHG"
FT   gene            134316..134528
FT                   /locus_tag="BC1003_0122"
FT   CDS_pept        134316..134528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56126"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4R2"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4361"
FT                   /protein_id="ADN56126.1"
FT                   /translation="MQIGSIVRSVHIAVPQGARGIVMRILGDMAMVAWYAGEPGASPQL
FT                   NTEPFFLEDLIDTGELVRPSSAQMH"
FT   gene            134629..135654
FT                   /locus_tag="BC1003_0123"
FT   CDS_pept        134629..135654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0123"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bxe:Bxe_A4360 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56127"
FT                   /db_xref="GOA:E1T4R3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4R3"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADN56127.1"
FT                   /translation="MNDILDPQDGAARTVPFARLQPELVLDALDSVLATVGVRTDGRML
FT                   PLNSYENRVYQVGVEDGPPVVAKFYRPERWSDAAILEEHAFVAELAAREIPAVPARAFE
FT                   GRTLHTFEGFRFSIFERRGGRAPDLDRRDTLEWLGRFIGRIHAVGQTQHYTERPALDIQ
FT                   TFGYEPRDFLLAHSFIPDDVRDAWQTVVNLALEGVERAFERAGEIRTLRMHGDCHPSNV
FT                   LWTDAGPHFVDFDDSRMGPAVQDLWLLLPGERAEASRALTDLLAGYEDFCDFEPRELHL
FT                   VEALRTLRLIHYQAWLARRWDDPAFPAAFPWFNTQRYWEDRILEMREQLGAMQEGPLWP
FT                   V"
FT   gene            135881..136621
FT                   /locus_tag="BC1003_0124"
FT   CDS_pept        135881..136621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56128"
FT                   /db_xref="GOA:E1T4R4"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4R4"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4358"
FT                   /protein_id="ADN56128.1"
FT                   /translation="MNAPDSIDMKPAANGASRYVAHDEPPGRHLMDGAEQAARRQRSRR
FT                   ANFIKWLRKVHGWVGLWGAVLGLMFGATGFLLNHRAGPMKVSTGQPQVEELQMAVPDKP
FT                   FHSPMDMAKWLKSELKIDGKPGRMKREPAHPVAWGDRSTIQPEFWQVAFAAPTQNVQAE
FT                   YWVGNGFVAVKRTQNTFLATMTNLHKGTGLSIGWMLLVDTIAGSLILLSLTGVLLWTEL
FT                   NKRRVVGVVLVGGSIVAAVVCGLM"
FT   gene            complement(136771..137796)
FT                   /locus_tag="BC1003_0125"
FT   CDS_pept        complement(136771..137796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0125"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   bpy:Bphyt_0364 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56129"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4R5"
FT                   /inference="protein motif:PFAM:PF02625"
FT                   /protein_id="ADN56129.1"
FT                   /translation="MDSVDLEVLKSSARWLEEGHRALLVTVVKTWGSSPRPEGAMLVVR
FT                   DDGLVVGSVSGGCIEDDLIDRVRQQGIEQTRPEAVKYGITAEEAHRFGLPCGGTIQLVL
FT                   EPLTPQSGIAELCAAVEEGRLVARELDMTTGVARLDKALATDGVHFDGQRLLTIHGPRY
FT                   RMLVIGAGQLSRYLCNIAVGLDYQVTVCDPREEYTEEWSIPGTKIVRTMPDDTVLDMKL
FT                   DERCAVIALTHDPKLDDLALMEALKTPAFYVGALGSRRNNQARRERLKEFDLSETELAR
FT                   LHGPVGIYIGSRTPPEIAVSILAEVTAAKNGVSLPTLIQVEGAKAAREIAASAGGAACS
FT                   A"
FT   gene            complement(137769..138389)
FT                   /locus_tag="BC1003_0126"
FT   CDS_pept        complement(137769..138389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0126"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   bpy:Bphyt_0365 carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56130"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4R6"
FT                   /inference="protein motif:PFAM:PF06240"
FT                   /protein_id="ADN56130.1"
FT                   /translation="MELTETHTLPVSQQRTWEALNDTEILRACIPGCESIDPDGENAYL
FT                   VVLSAAVGPVKARFKGRMQLTDIDAPNAYNIVFEGQGGAAGFAKGNARVTLEADGDAST
FT                   KLSYTASAQVGGKLAQIGSRLVDGAARKIAGEFFKRFGAQFGASDCADAARAGDADDAA
FT                   DGGGTAADGAAGHNTASTEAADNESGGDATKRKKSWTAWISKS"
FT   gene            complement(138380..139699)
FT                   /locus_tag="BC1003_0127"
FT   CDS_pept        complement(138380..139699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0127"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; KEGG:
FT                   bpy:Bphyt_0366 VWA containing CoxE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56131"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4R7"
FT                   /inference="protein motif:PFAM:PF05762"
FT                   /protein_id="ADN56131.1"
FT                   /translation="MTPPTRADNPDHGDAPPAQRQPDAGQRLAASPENGTPTLARNVVH
FT                   FVRVLRGAGLPMSPAHAVDALAALHYIDLARRDDVRAALAATLVSAPDERELFDAAFEL
FT                   FWRDPDWEGKLRALLLPKVRDGLPPPKRNNRLADALAVRAPPSPHTPEPQETEQQELRA
FT                   HLTFSAEERLRHRDFDTLSADEWRALRHLIRAQRLPLAKEPTRRLKAASHGTHADLRAS
FT                   ARQAVRAGGDWTVWKYRAVVERKPPLVLLLDISGSMSSYSRAVLYFCHALVHSRERLQV
FT                   FLFGTRLTNATRWLRERDPDVAIATLTEQVLDWSGGTRIGATLAEFNRRWARRVLAGRA
FT                   TVLLVTDGLDHEAIDVLDTEMARLRRFAHRIVWLNPLLRFSGFSPKARGVQAILPYVDA
FT                   HRPVHNLETLAAFGRDFAQLARAPRPGVPAMPTAGARSWN"
FT   gene            complement(139705..140592)
FT                   /locus_tag="BC1003_0128"
FT   CDS_pept        complement(139705..140592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0128"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="KEGG: bpy:Bphyt_0367 ATPase associated with various
FT                   cellular activities AAA_5; PFAM: ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56132"
FT                   /db_xref="GOA:E1T4R8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4R8"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADN56132.1"
FT                   /translation="MHPASIDDTLAQLAAQNYFASRELATALYLALRMERPLFVEGEPG
FT                   VGKTELAKAAAGMLGTSMLRLQCYEGLDTASALYEWDYPRQIMALRLAEAAGERPDNDT
FT                   LYRGEFLLKRPLLQALLPDENHPGARRVLLIDEIDRADEPFEAFLLELLSDFQVSIPEY
FT                   GTVRAAQPPLVVMTSNRTREVHDALKRRCLYQWIGYPDRERELQIVAARAPQTSAQLQR
FT                   RAVDFVHRLRGIDLFKAPGIAETIDWCRALEALSVTELDPQSVQNTLGVLLKYQDDLAR
FT                   VDAAQIAQCLAAPE"
FT   gene            complement(140687..141484)
FT                   /locus_tag="BC1003_0129"
FT   CDS_pept        complement(140687..141484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0129"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   bxe:Bxe_A4353 putative carbon monoxide dehydrogenase,
FT                   medium subunit (CoxM)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56133"
FT                   /db_xref="GOA:E1T4R9"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4R9"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ADN56133.1"
FT                   /translation="MYSFEYQRATDPQAAAAAIAADSDAKFLAGGQSLLPTMRLRLAQP
FT                   SQLIDVTRIPALKSISVEANVVKIGAAVCHADVAEHAEVRGALPALADLAAHIGDRQVR
FT                   ALGTLGGSLANNDPAACYPAAAMGLDATIVTQRRRISSSDFFVGMYETALEPDELIVGV
FT                   EFPVPERAAYEKFRNPASHFALVGVFVAKFASGVRVAVTGAAASVFRVPELESALSANF
FT                   TPEAARAVNLAGANLNDDMHASAEYRAHLIPVLAARAVAKANS"
FT   gene            complement(141507..143894)
FT                   /locus_tag="BC1003_0130"
FT   CDS_pept        complement(141507..143894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0130"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: bxe:Bxe_A4352 xanthine
FT                   dehydrogenase, molybdenum binding subunit apoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56134"
FT                   /db_xref="GOA:E1T4S0"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4S0"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ADN56134.1"
FT                   /translation="MNAPETHNLIGASVERKEDYRFLTGNGQYTDDILLPQQTYAVFLR
FT                   SPHAHAKINSIDTTAAQQSPGVVAIFTGKDMAAENVGGLPCGWLIHSTDGKPMNEPPHP
FT                   VIAHTKVRHVGDQVALVIADSIKAAKDALELIEVDYDVLPAVVDTAHAADAGQPAVHDE
FT                   VPDNVCYNWGHGDKAATDAAFAKAAHVTTLDIVNNRLVPNAIEPRAVNASYSAQDDSYT
FT                   LYVANQNPHVERLLMAAFVLSLPESKLRVIAPDVGGGFGSKIFLYAEDVALTWASKKIR
FT                   RPVKWTAERSEAFLSDAHGRDHVTKAELALDADGKFLGMRIHTIANMGAYLSTFASSVP
FT                   TILYATLLAGQYATPAIYAEVKAVFTNTVPVDAYRGAGRPEATYVVERLVETAAREMKI
FT                   DPAEIRRRNFIREFPYATPVGLTYDTGDYDAILARALELADVKGFEARRQQSEKNGKRR
FT                   GLGYSCYIEACGLAPSNIAGALGARAGLFEVGQIRVHPTGSVTVFTGSHSHGQGHETTF
FT                   AQVVADRLGIALESVEIVHGDTGRIPFGMGTYGSRSIAVGGSAIMKALDKIEAKAKKIA
FT                   AHLLEAAAEDIEFKDGVFRVAGTDRTKAFAEISLAAYVPHNYPLEVLEPGLEESAFYDP
FT                   SNFTYPSGAYICEIEVDPDTGVCEIQQFTAVDDFGNVINPMIVEGQVHGGLAQGIGQAM
FT                   LERCVYDNESGQLLSGSYMDYAMPHASDLPDFTVETAKGTPCTHNPLGVKGCGEAGAIG
FT                   SPPAVINAIIDALAPLGVTDLQMPATPHRVWSAIHAATQAAH"
FT   gene            complement(143905..144459)
FT                   /locus_tag="BC1003_0131"
FT   CDS_pept        complement(143905..144459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0131"
FT                   /product="(2Fe-2S)-binding domain-containing protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain-containing protein;
FT                   ferredoxin; KEGG: bxe:Bxe_A4351 putative carbon-monoxide
FT                   dehydrogenase, small subunit (CoxS)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56135"
FT                   /db_xref="GOA:E1T4S1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E1T4S1"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADN56135.1"
FT                   /translation="MAISISLTVNGAPISASVEPGTLLVQFLRDQLRLTGTHIGCDTAQ
FT                   CGACTVHLDGRAIKSCNILAAQADGARVTTIEGLAKDGALHPMQAAFKHCHGLQCGFCT
FT                   PGMVMSAISLVERQPNLTGDDVRAQFDGNLCRCTGYHNIVKAVLEGAEGMKSSGAAGST
FT                   ASQAAGTGANAPAASTAQATA"
FT   gene            145123..145290
FT                   /locus_tag="BC1003_0132"
FT   CDS_pept        145123..145290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56136"
FT                   /db_xref="UniProtKB/TrEMBL:E1T565"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADN56136.1"
FT                   /translation="MILPQCLIASLKLGSSWNMFRIAVYIYSTRVQETAGRLRMCRQRT
FT                   GSEEPDIYIT"
FT   gene            145305..147416
FT                   /locus_tag="BC1003_0133"
FT   CDS_pept        145305..147416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0133"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="KEGG: xca:xccb100_3497 extracellular protease; PFAM:
FT                   peptidase S8 and S53 subtilisin kexin sedolisin; PKD domain
FT                   containing protein; SMART: PKD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56137"
FT                   /db_xref="GOA:E1T566"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E1T566"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADN56137.1"
FT                   /translation="MQTKRRIRDQNRPRPNAAKLQFGALKINGRGIRAGLIGISLALTA
FT                   CGGSNSAGNVEPLGKASDPQVIAAMDAASSAVVTAVAAMRMNASAISADSQTDRFIVRY
FT                   KVGTTARSDSTAVQSRLDRLASAFPARARHARRMGLGADVLTIDRKLNAKEAKAFMRAI
FT                   ASDPDVEYVEPDIVISATSAPNDPLYSQQWGLFSNLDPSQPYAGIRVSDAWKIATGAGI
FT                   TIGVVDNGLTGHSDLDANVIPAGYDFTFLGPPGGSNPGIGSNGRVISYHGTHVAGIMAA
FT                   VTSNGIGISGIAPSAKLVSARSLNQWGGGLLSSTSDALIWASGGSVAGIPNNPHPASVI
FT                   NLSLEAVGYCAKTFQYAIDDANSRGATVVVAAGNDSADASNVQPANCRGVIAVGNTQKD
FT                   GSRSYTSNYGLTVDIAAPGTDILSTWNDGTYSLGSESYALQTGTSMAAPMVSGVVALIK
FT                   SVASKQYSAAEMRTLITQHSQPFPKRPDQPIGAGILDASAAVAAARSGEIPAAADFICA
FT                   QGTVGMLVTCTDLSTARGAASIRSWAWNMGYDDKGDTVSTESRNSSHDYEYPGTYNVSL
FT                   TITDSNGAVSRVSRPITVVAPQATDMAFDTELMFSGKANVPQYYKLELPSGAPVMRANL
FT                   SSRSSFDSGMMFVKAGSPTSVNADCSRYFASGSGAQCFLWNPRPGTYYLVIKPASDVVD
FT                   TKLFATFTP"
FT   gene            147507..149342
FT                   /locus_tag="BC1003_0134"
FT   CDS_pept        147507..149342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0134"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="PFAM: Tetratricopeptide TPR_1 repeat-containing
FT                   protein; KEGG: bxe:Bxe_B2618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56138"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1T567"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADN56138.1"
FT                   /translation="MSAMSPAYTEDVERSALTSKADALFSASCVAEAASIYELVLATEP
FT                   GNVHVLHQMGLACARLNKIVEASAYLERALRLEPERGDLWEHAGLIAAMRGDYANSEQF
FT                   YRRALSLIGSTATLHRNLADCLRLRGRLREAKAQYIKAIAREPELHHAVRAVAQISTDL
FT                   GESDDAADFWLRALAIDNSSLKDGIDALLAFGKVKLELPLSRLVSELRMRHATDATALE
FT                   ALCLALYRIDRFAEMFSVARQGIALDLQSVRLHRYAAHALSVRGYVKEAMAYSAEAVRL
FT                   QPADEISQFQHAELEINASNYEVGWSRHNLFYNTPLARSTRVFPEFRIWEGEPVNGRTF
FT                   LLVGEQGRGDEIQFVRFAEWLHQQGAVVDVLVSEPVAVIARSMTGVRSVLTRLPRGPYD
FT                   YWSHMQRMPEHMGLKLSTLPIAMPYVTAQPHLIAFWKARLEALAPSVNRSGKLRVGIVW
FT                   AGGPHSALDRFRSIDIHALRPLFSVPGTTWFSLQKGEREREGEALTDAFDFHTLGPVIE
FT                   DFGDTLAILATLDLVVSVDTSVAHLAGAANLPVWVLVPAYAQWRWLQERTDSPWYPSMR
FT                   LFRQRELGNWDSAIGEVRAALEERHLQASEKSPDR"
FT   gene            complement(149607..150998)
FT                   /locus_tag="BC1003_0135"
FT   CDS_pept        complement(149607..150998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0135"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bxe:Bxe_A4348 basic amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56139"
FT                   /db_xref="GOA:E1T568"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E1T568"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADN56139.1"
FT                   /translation="MSLFRKKSVEHMLATSAQSADLKKALGALDLTFLGVGAIIGTGIF
FT                   VLTGTGAVQAGPALMVSFLVAAVACGFAALAYAEFASTIPVAGSIYTYSYATLGELAAW
FT                   IIGWDLMLEYGLATSAVSVGWSGYLQSLLSGFGVALPDALRAAPGALPGHETFFNLPAF
FT                   LVMMAITALLSVGVRESARINNLMVAIKVTVVLLVIVVGVFHVTPANWHPFMPNGWNGV
FT                   FGAAAVMFFAFIGFDSVSSAAEEVKNPKRDLPVGIIASLGVCAVLYVAVAAVVTGIVPS
FT                   AQFANISHPVSYALQVAGEKWVAGFIDLGAVLGMLTVILVMAYGQTRVIFAMSRDGLLP
FT                   ARLSRVHPRFATPFFTTWLVGIFFGLIGALVPLDVLAELINIGTLAAFSMVSIAVLVLR
FT                   RTHPELPRAFRCPGVPVVPVLAVASCLFLMVNLKAVTWAAFVVWLVVGMVIYFGYSRRR
FT                   SKLAA"
FT   gene            complement(151190..151846)
FT                   /locus_tag="BC1003_0136"
FT   CDS_pept        complement(151190..151846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0136"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bxe:Bxe_A4347 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56140"
FT                   /db_xref="GOA:E1T569"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E1T569"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN56140.1"
FT                   /translation="MTLRILLADDHAVVRQGVRQLLLDRGVAREVTEAQTGAEALDAVA
FT                   TQGYDVVLLDISLPDMNGVEVLKRLKRKAPRVAVLMFSMYREDQYAVRALKAGAAGYLS
FT                   KTVDAAQMIGAIQQVAAGRKYVSPAMAEALADYVSFDGEQMPHEKLSDREYQTLCMLAS
FT                   GKRLTDIAEALSLSVKTVSVYRTRLLEKMKLRNNAELTFYVMSNRLVDLNPAMAG"
FT   gene            complement(151857..152633)
FT                   /locus_tag="BC1003_0137"
FT   CDS_pept        complement(151857..152633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0137"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="KEGG: bpy:Bphyt_0375 putative signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56141"
FT                   /db_xref="GOA:E1T570"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1T570"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN56141.1"
FT                   /translation="MERELARLRARVRELSAELVQAQEAACRHVARELHDGVGAELTAT
FT                   RFALASVETWLPADAPAQCSTALAVANRSLDAVCAATRQAVAELHAPALEAGIVGALAQ
FT                   WTGEFAARTQLRTSFVCSADVRLTRLPADAALAVFRVAQEALNNIAKHARAASADVRIE
FT                   TSRRHLTLIVSDDGVGVARHAQRQSGHFGLSGMKARCAAFDGTLRVSARRAEPQGPGQA
FT                   RRSAGDGARGTLVRARFAWDAMLADAQPAGLRAAQS"
FT   gene            complement(153184..153954)
FT                   /locus_tag="BC1003_0138"
FT   CDS_pept        complement(153184..153954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0138"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="KEGG: bxe:Bxe_A4345 ferredoxin--NADP reductase;
FT                   PFAM: Oxidoreductase FAD-binding domain protein;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56142"
FT                   /db_xref="GOA:E1T571"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E1T571"
FT                   /inference="protein motif:PRIAM:1.18.1.2"
FT                   /protein_id="ADN56142.1"
FT                   /translation="MSNLNSQTVLSVHHWTDTLFSFTCTRDPSFRFENGQFTMVGLEVD
FT                   GKPLLRAYSLASANYEEHLEFLSIKVQDGPLTSRLQHLKVGDQVLIGKKPVGTLMADNL
FT                   LPGKTLWLLSTGTGLAPFMSIIKDPDIYDRYERVILTHTCRFVDELAYKEYITDHLPAH
FT                   EHLGELVQEKLLYYPTVTREAFQNRGRITELIETEKLFADLGVPGFSLENDRVMLCGSP
FT                   HMLRDTRKLLDDMGFQEGSNNEPGHYVVEKAFVG"
FT   gene            complement(154551..155348)
FT                   /locus_tag="BC1003_0139"
FT   CDS_pept        complement(154551..155348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0139"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   bpy:Bphyt_0384 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56143"
FT                   /db_xref="GOA:E1T572"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E1T572"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADN56143.1"
FT                   /translation="MRNPEELIRESAAPKDFVAVSWNLHKGRTPLGFQAWQAMQRWVQS
FT                   THADAYFLQEAMARRMPSPVLASSFGAPVTDPLSDVWHCQATEIARALQLEIALGPNVF
FT                   KPSWRHGNAILSPHPLDLGGRWDISAHRFEKRGLLVARATFGGHSVTLLCAHLALTRSA
FT                   RLRQMNWIAHWISKEAPDGPLVLAGDFNDWRNDSVPLFGEHGLHEVATLLGESGRTFPA
FT                   FSPALALDKMFVRGMKPIEWIQPTQETAWLSDHLPYMARLRVE"
FT   gene            complement(155494..156099)
FT                   /locus_tag="BC1003_0140"
FT   CDS_pept        complement(155494..156099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0140"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56144"
FT                   /db_xref="UniProtKB/TrEMBL:E1T573"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4336"
FT                   /protein_id="ADN56144.1"
FT                   /translation="MWKTSIVALLFGTSLLAHAQQRPPQQVVQWELQVLRDGQQIDAFE
FT                   GTTTVGQARTDTHHKVVQHNVGCKDQPAGSIDLARTLTVSPLRVEGNDVTLSIEAQETL
FT                   EDSAARQTDTGCKLPPQPRQVGASHPGLKVPVGQWTSWTIIDKDPTLVYRVRASLTNGA
FT                   NAGSGASAASGVSAASGVSGAASGVTTASGVSAASAVK"
FT   sig_peptide     complement(156040..156099)
FT                   /locus_tag="BC1003_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            156442..157419
FT                   /locus_tag="BC1003_0141"
FT   CDS_pept        156442..157419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0141"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="manually curated; PFAM: AAA ATPase central domain
FT                   protein; KEGG: bxe:Bxe_A4335 putative ATP-dependent
FT                   protease La; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56145"
FT                   /db_xref="GOA:E1T574"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T574"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADN56145.1"
FT                   /translation="MTTAMVRQEIAVASFSQVYDLDQVETALNDLGEGANEALRTTYEK
FT                   MLKTGNLRFCVKPNRMPSIDDLIDALPNFADPLDDIRKQVALCLETEDRLELMPILLLG
FT                   DPGIGKTHFAKQLARLLGTAYQYVAMSSLTAGWILSGASSQWKNAKPGKVFDALVNGSY
FT                   ANPVITVDEIDKATGDSQYDPLGALYALLEHDTARSFIDEFAEIPINAGHVIWIATAND
FT                   ERAIPEPILNRMNVYEIPPPDREGARRIAQSIYAEIRGAHNWGLRFPELLGDAALEALK
FT                   NASPREMRRAILNGFGAARIDGRDEIGGGDIRLDFGNRRRPIGF"
FT   gene            157647..158753
FT                   /locus_tag="BC1003_0142"
FT   CDS_pept        157647..158753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0142"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bpy:Bphyt_0387 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56146"
FT                   /db_xref="GOA:E1T575"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1T575"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADN56146.1"
FT                   /translation="MDQIECVVIGAGVVGLAVARALAARGREVIVLEAAEAIGVGTSSR
FT                   NSEVIHAGIYYPRGSLKATLCVRGREMLYDYCAERNVPHSRCGKLLVATSNNQIAQLEG
FT                   IMHKGRENGVLDLMRISASEAQALEPALECVAAVFSPQTGIVDSHQLMLALQGDAERDG
FT                   AMFAFHSPVDAIEAGNGRFVVKVGGEAPAAISAACVVNSAGLHANALARRIRGLDARHV
FT                   PPLYLARGNYFSISGRAPFSRLIYPMPNEAGLGVHLTIDLGGQARFGPDVEWVDAISYE
FT                   VDPERAESFYSAIRAYWPALPDHALQPAYAGIRPKLSGPGEPAADFVIQGPAAHGVRGL
FT                   VNLFGIESPGLTASLAIAQRVCELSARG"
FT   gene            158955..159266
FT                   /locus_tag="BC1003_0143"
FT   CDS_pept        158955..159266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0143"
FT                   /product="High potential iron-sulfur protein"
FT                   /note="PFAM: High potential iron-sulfur protein; KEGG:
FT                   bxe:Bxe_A4333 putative high potential iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56147"
FT                   /db_xref="GOA:E1T576"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:E1T576"
FT                   /inference="protein motif:PFAM:PF01355"
FT                   /protein_id="ADN56147.1"
FT                   /translation="MKASRRTFLISTIGVASSLALSRQAFADAPKVAESDPTAQALGYK
FT                   EDASKVDKAKFAKYAPGQDCGNCSFYQGKASDPYAPCPMFAGKQVAAKGWCSAYNKKA"
FT   sig_peptide     158955..159038
FT                   /locus_tag="BC1003_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            159526..160818
FT                   /locus_tag="BC1003_0144"
FT   CDS_pept        159526..160818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0144"
FT                   /product="general substrate transporter"
FT                   /note="KEGG: bpy:Bphyt_0389 general substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56148"
FT                   /db_xref="GOA:E1T577"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T577"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0389"
FT                   /protein_id="ADN56148.1"
FT                   /translation="MSPASRSLNARAVVAAVIGNALEWYDFTVFGLLTVVIAQLFFPAG
FT                   NAHTSLLLATASFGVAFVMRPVGAIVLGLYADRAGRKAALVVVIALMTLGTLLLAIAPP
FT                   YSAVGIGAPLMIVLGRLLQGFSAGGEFGSSTALLIEAAPFSRRGFYGSWQMASQAAALL
FT                   FGSLVGAAITHGLTPEALKSWGWRVPFIIGLLIGPVGIYIRRHLADSEVFLLAQKTARR
FT                   ATLRELFGGHSRDVLCALGCVIALTVTLYVLISYLPTFAVTQLKLPYAQSFYAVIAGNL
FT                   LLMVLSPLTGAWSDRIGRKWLSLWSLVLTLAIIYPLCAWLAAAPSVSKLVAVQALLSIT
FT                   LSGYYGPFGAMIAELFPAYVRSTGLSLAYNVAVIMFGGFGPFVVTWLTEVTGSPLAPTY
FT                   YVMAGLAASITAVACMPGQRHVDLDARRKPA"
FT   gene            complement(160957..162495)
FT                   /locus_tag="BC1003_0145"
FT   CDS_pept        complement(160957..162495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0145"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bpy:Bphyt_0390 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56149"
FT                   /db_xref="GOA:E1T578"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E1T578"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADN56149.1"
FT                   /translation="MLSDYLAHDAFALAELVRTREVSARELLDTAISRAEAVNPAINAI
FT                   VLKDYDAARERASRFDANMANGVNAAHGHDAGGQETAQSALAGVPYLIKDLGAAVAGLR
FT                   MTMGSRHYRHFIPADDAPVVALAKAAGLNIFGKTSTSELGQMPYTEPELFGACRNPWNL
FT                   DHTPGGSSGGAAAAVAAGIVPLAHASDGGGSIRIPASCCGLFGLKPSRGRVPRMPAAVV
FT                   AGELGVDHAVSRSVRDSALLLDLLAGNADRPLGAPGTFLAASREPCKPLSIAYVTEPML
FT                   AASLSADARAALEDAAQLARSLGHNIEPISLGIDFAAVRHAFLTLWSVTAEDLVLNAER
FT                   ITGRKPLRDEFEISTWAMAHVGRKLGERGLPAALEEQRRITARLTDLLSRYDVILCATL
FT                   AGAPIKIGEMQPTPAERMQMRAVSAMPLEPLLKKLLAEASDKAFAWAGCTELFNLSGQP
FT                   AMSVPLYWNARGLPVGVQFAAREGGEATLLRLAAQLEAARPWFDRRPPLLNARS"
FT   gene            complement(162747..163445)
FT                   /locus_tag="BC1003_0146"
FT   CDS_pept        complement(162747..163445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0146"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="KEGG: bxe:Bxe_A4330 carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56150"
FT                   /db_xref="GOA:E1T579"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1T579"
FT                   /inference="protein motif:PRIAM:3.1.1.45"
FT                   /protein_id="ADN56150.1"
FT                   /translation="MSITSRWIDIPAGNDTFGGYLAVPKGGKGPAVIIIQEIFGVNSHI
FT                   RSVADQYAQDGYVALAPDVFWRVQPRVELTYEGADRAKGIELMQKLDTNQAADDIGAAA
FT                   AALRAMPEVTGKLAAIGFCYGGLLAYLSAARGSVDAAVAYYGGGIQNRLDEAAKVKVPM
FT                   QFHYGELDTHIPLSAVGQIQERFAGRTDTEFHIYPNADHGFNCSDRASYNQRAAALAHG
FT                   RTLTFLGERL"
FT   gene            163749..164849
FT                   /locus_tag="BC1003_0147"
FT   CDS_pept        163749..164849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0147"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   bpy:Bphyt_0392 2-nitropropane dioxygenase NPD"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56151"
FT                   /db_xref="GOA:E1T580"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1T580"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ADN56151.1"
FT                   /translation="MTEGNFVTPFAERFALRVPVVQAPMAGATTPELVAAVSNSGGLGT
FT                   LAGAALSPEKIASDVAAIRALTDRPFGVNLFVLEPAAPDDATVRRALEAIDPVRADLGL
FT                   PPGRPLERYAPDFRAQLEALIETRVPVVSFTFGLLSREDVAQFHANGQYVIGTATHVAE
FT                   GVAWRDAGADAIAAQGSEAGAHRGTFLGSFEDALVGTMALVPQLVDATGLPVLAAGGIM
FT                   DGRGIVAALALGAQAAVMGTAFLTSRESAIPQAWKERLRSISDTSTSVTRAITGRHARG
FT                   IRNPLMQRLSEAPQKIAPYPVQNALTQELRQTAGRAQNGDYLSLWSGQGAPLGRARREG
FT                   FGAAELMAQLEEEWRAASARIAAFKP"
FT   gene            165350..166495
FT                   /locus_tag="BC1003_0148"
FT   CDS_pept        165350..166495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0148"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bph:Bphy_0112 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56152"
FT                   /db_xref="GOA:E1T581"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1T581"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADN56152.1"
FT                   /translation="MNIKIQKLLPISAAAMLFATLATTAAADTVVKIGHVAPLTGGIAH
FT                   LGKDNENGARLAVEEINAKGLTIGGQKITLQLDAQDDAADPRTATQVAQKLVDDKVVAV
FT                   VGHLNSGTSIPASKIYSDAGIVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALANYA
FT                   AKGLKVKSVAIVDDSTAYGQGLANEFEKTAKSLGLNVMSHDATNDKAVDFRAILTKIKG
FT                   ENPDAIMYGGMDATGGPFAKQAKQLGLRAKVLAGDGVCTDKLSDLAGDATDNIVCSEAG
FT                   MALEKMEGGSAFQAKYQKRFGQPIQIYAPFTYDAVYIIVDAMKRAGSTDPAKILAAMPN
FT                   TDYKGVIGQTSFDSKGDLKHGVISLYNYKSGKKTLLDVVKM"
FT   sig_peptide     165350..165433
FT                   /locus_tag="BC1003_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.862 at
FT                   residue 28"
FT   gene            complement(166724..167935)
FT                   /locus_tag="BC1003_0149"
FT   CDS_pept        complement(166724..167935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0149"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A4324 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56153"
FT                   /db_xref="GOA:E1T582"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T582"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56153.1"
FT                   /translation="MSDRSTDFTAIPAAHRNLSDTARQRARIATMALFFIAGMVYGSWG
FT                   VHVPTVRDRFHLSPAMLSLALLAVAGGSIGAMAANASWIARVGTRRACLTGGLVMALCV
FT                   ALILVVPFYWLLLIVLAVFGAGMATLDVAMNAEASAVEKALRKPIMSSLHGMFSVGGMA
FT                   GAAVGGALLAHGMAPAVHLALASAVSALVLIAACPSVLPHVPHDEHPDSAAPRTSRWRS
FT                   PALWALGTVALVALIAEGAMYDWATVYMRDVVLATPASASAAYAAFSGGMAVARFAGDA
FT                   VRARFGAPQLVMGSATLALVGMIGALLLPTTVAALIGFTLMGLGLANMMPVLFAAAASV
FT                   KGVHAAEGLAHVAGLAYFGLLFGPVVIGAVAQVTNLSIGLSVVAVCCALIAIVGPKVLQ
FT                   RLKI"
FT   gene            168211..168873
FT                   /locus_tag="BC1003_0150"
FT   CDS_pept        168211..168873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0150"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bpy:Bphyt_0397 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56154"
FT                   /db_xref="GOA:E1T583"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E1T583"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADN56154.1"
FT                   /translation="MNIPAQAPLHLLHTAAVGTLATHARQPEGFPYPSVLPFAPDDAHR
FT                   PTILISRLAEHTHNLHADPRAGFLVVDAPDGDVLNGQRVTLLGRFEPVDPAPGLIARYL
FT                   RYHPDAERYLVLGDFTFWAMKLDRLRYIGGFGAMGWLGGDELDPLAPLEQHDEDALIGE
FT                   FADALLSASGYQLIGVDRYGVDLRQNGLRKRFAFESGKPDIEILHGALEDCIRRQGG"
FT   gene            169266..169568
FT                   /locus_tag="BC1003_0151"
FT   CDS_pept        169266..169568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0151"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="KEGG: bxe:Bxe_A4321 putative HNS-like
FT                   transcriptional regulator; PFAM: histone family protein
FT                   nucleoid-structuring protein H-NS; SMART: histone family
FT                   protein nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56155"
FT                   /db_xref="GOA:E1T584"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:E1T584"
FT                   /inference="protein motif:PFAM:PF00816"
FT                   /protein_id="ADN56155.1"
FT                   /translation="MSSYKELLAQREKLEKQIEEAKSREYAEVLNEIKQKMADYGISLS
FT                   ELGGGRAAKGSKAARPRAGVAPKYRDPESGSTWSGRGKPPRWIAGMDRDKFLIQK"
FT   gene            169889..171130
FT                   /locus_tag="BC1003_0152"
FT   CDS_pept        169889..171130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0152"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: bpy:Bphyt_0399 cation diffusion facilitator
FT                   family transporter; TIGRFAM: cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56156"
FT                   /db_xref="GOA:E1T585"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E1T585"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADN56156.1"
FT                   /translation="MSSAAVESAEKHRVARKSTFVSIALNTVLMALQIAVGVFAHSQAL
FT                   VADGIHSLADLISDFVVLFANRHSGAKPDADHNYGHSRYETVASLFLGALLIAVGFGML
FT                   WRAGTRLADLDNIPAVHLSALVVAVLVLVSKEGLFRYMLREAQRVRSAMLIANAWHARS
FT                   DAASSLVVALGILGSLAGVRLLDPIAAAIVGFMVARMGWMFGWDALQDLSDRALDEAAT
FT                   ADMRALLLSTPGVRDVHEMRTRKMGDFALVDAHILVDPLISVSEGHYIAETARLRVLND
FT                   SRVLDALIHVDPENDAVAHPPVGLPPRERIVADVNAALAAGGAKAAAVNIHYLSTGLDV
FT                   DVVLPAQTSRDPRGGDAQGMERIDLAALKRRIGARRLQVLREVSTPATQSGSSTEGGAA
FT                   NDRRDERAAPHSAA"
FT   gene            complement(171441..171899)
FT                   /locus_tag="BC1003_0153"
FT   CDS_pept        complement(171441..171899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0153"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: transcriptional regulator, AsnC family; PFAM:
FT                   Transcription regulator AsnC-type-like; SMART:
FT                   Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56157"
FT                   /db_xref="GOA:E1T586"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T586"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADN56157.1"
FT                   /translation="MTLDTFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRIKDMEQ
FT                   SGVIQRYTALLDREKLGLHVCALAHIHLTRHTEGGVEQFEREIATCPEVTECYSTTGES
FT                   DYILKIVAPDIKAYDTFLHERIFKIPAVAQVRTSVVLREIKFDTQLPL"
FT   gene            complement(171990..172619)
FT                   /locus_tag="BC1003_0154"
FT   CDS_pept        complement(171990..172619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56158"
FT                   /db_xref="GOA:E1T587"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E1T587"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4318"
FT                   /protein_id="ADN56158.1"
FT                   /translation="MSSEIYVSTDVEADGPIPGPHSMLSFASAAYTEDKQLIGTFSANL
FT                   ELLEGAAPHPVQEAWWKTQPEAWAACRTDLQRPEAALAAYVDWVEALPGKPVFVAMPAG
FT                   FDFTYMFWYMMRFVGRCPFSWSALDIKTLAFAMTGLPYRKNIKPRFPKHWFDEHPHTHV
FT                   ALDDAIEQGALFCNMLKDLRTLQAAGAAASQEGDASGQNPAEAPAN"
FT   gene            complement(172616..173260)
FT                   /locus_tag="BC1003_0155"
FT   CDS_pept        complement(172616..173260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0155"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: bpy:Bphyt_0402 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56159"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1T588"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0402"
FT                   /protein_id="ADN56159.1"
FT                   /translation="MKVTLIPVTPFQQNCSLLVCEATGRAAVVDPGGDLEVIQGEIARQ
FT                   KVSVEKVFLTHGHIDHCAGAKTLALHYGVPIEGPHADERFWLDKLPDQSTRFGFPAAEA
FT                   FEPDRWLDTGDTVQFGEETLEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDF
FT                   PRGNHADLVRSIREKLWPLGDDVTFVPGHGPTSTFGAERRSNPYVGDGVVA"
FT   gene            173874..174506
FT                   /locus_tag="BC1003_0156"
FT   CDS_pept        173874..174506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0156"
FT                   /product="rare lipoprotein A"
FT                   /note="KEGG: bxe:Bxe_A4315 rare lipoprotein A; TIGRFAM:
FT                   rare lipoprotein A; PFAM: Rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56160"
FT                   /db_xref="GOA:E1T589"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E1T589"
FT                   /inference="protein motif:TFAM:TIGR00413"
FT                   /protein_id="ADN56160.1"
FT                   /translation="MRLDNVIARLMKTRLSRGLGTLFAFFVLAGCATPPGADNSVANAV
FT                   PLRTNNAQAASFGPQAYGSAPASDAAAKGPSLADAKPLTDDGSDVSDFHQTGRASWYGR
FT                   GFHGRRTANGERYDMHALTAAHRTLPLGSYVRVTNPATSRSVVVRINDRGPYARGRVID
FT                   LSMAAANMLEMRHAGTARVKIEGLTQEEARAAREEMLASNSGSTAQK"
FT   sig_peptide     173874..173987
FT                   /locus_tag="BC1003_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.776 at
FT                   residue 38"
FT   gene            complement(174720..175598)
FT                   /locus_tag="BC1003_0157"
FT   CDS_pept        complement(174720..175598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0157"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: bxe:Bxe_A4314
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56161"
FT                   /db_xref="GOA:E1T590"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1T590"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADN56161.1"
FT                   /translation="MTPLSELAQGQQYPAAALYVVATPIGNVADITLRALHVLGLVNRI
FT                   AAEDTRNTGQLLARYGISKPLIAVHQHNERAAAQRIVEHLQAGERVAYVSDAGTPGISD
FT                   PGAKLVDAVREAGLAVIPLPGASALATALSAAGDWVATFSFLGFLPPKAKARAAMLQTL
FT                   AGHPHAMVFYEAPHRIVETVQALADALGGERRLLIARELTKLHEALHCGTLAEAPTWLA
FT                   ADPNRQRGEFVLVVEGARQEAAGEHDHDALLNILLEELTVSSAAKVAAAITGTSRNALY
FT                   TRALALKKDED"
FT   gene            175636..176118
FT                   /locus_tag="BC1003_0158"
FT   CDS_pept        175636..176118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0158"
FT                   /product="Uncharacterized protein family UPF0102"
FT                   /note="PFAM: Uncharacterised protein family UPF0102; KEGG:
FT                   bpy:Bphyt_0405 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56162"
FT                   /db_xref="GOA:E1T591"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E1T591"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ADN56162.1"
FT                   /translation="MCHAGRGASGAVPVENAARAKPAPGPRPRAPLPDNFSGQAESKLV
FT                   GAAFEVRAQQFLQRQRLRLVARNVSCRGGEIDLVMRERDGALVFVEVRARAQRKYGGAA
FT                   ASIGWQKRQRIVRAAQHYLATQVSRAGPQPACRFDVIAFEAGRLVWLRDAFRADEV"
FT   gene            176378..176965
FT                   /locus_tag="BC1003_0159"
FT   CDS_pept        176378..176965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0159"
FT                   /product="phosphoheptose isomerase"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG:
FT                   bxe:Bxe_A4312 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56163"
FT                   /db_xref="GOA:E1T592"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:E1T592"
FT                   /inference="protein motif:TFAM:TIGR00441"
FT                   /protein_id="ADN56163.1"
FT                   /translation="MSVERIQQHFRDSAAVKLEALEALSMPIAAAIDTMFAALANGNRI
FT                   LACGNGGSAADAQHFAAELIGRFERERPGLPAVALSTDTSVLTAIANDYSFEQIFSKQV
FT                   WALGQPGDVLLAISTSGNSANVLAAIEAAHEREMIVVALSGKGGGRMQEVLSDTDIHIC
FT                   VPSDRTARIQEVHLLTIHCLCDGIDAMLLGED"
FT   gene            176991..177782
FT                   /locus_tag="BC1003_0160"
FT   CDS_pept        176991..177782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0160"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: bxe:Bxe_A4311
FT                   periplasmic phospholipid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56164"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:E1T593"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADN56164.1"
FT                   /translation="MSVFRVKKTLVRTVLVVGFAAGLSATLQGCFLAVAGAAGGSALVA
FT                   TDRRTLGAQTEDREIQVKALAQISQNLPDSAHVNVTVFNRRVLLTGEVAGDASKQRAES
FT                   IVRGLNNVNTIVNELAIMPASSFSSRTNDTYLETRVKTALIAEKDISANDFKVVAERGS
FT                   VYLMGLVTMDEGNRGADVASRVPGVTQVVKVFQYIQPQEAAAAAAAAATAPVAASQPDA
FT                   SAATVGTIPDSSVSARPLEQQAPAPVTNSNAVHPGNPKAAQ"
FT   sig_peptide     176991..177098
FT                   /locus_tag="BC1003_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.647 at
FT                   residue 36"
FT   gene            177779..178129
FT                   /locus_tag="BC1003_0161"
FT   CDS_pept        177779..178129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0161"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bpy:Bphyt_0408
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56165"
FT                   /db_xref="GOA:E1T594"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1T594"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADN56165.1"
FT                   /translation="MKYALAGVLMGLTVSAAAGLFGPAAFAADAPSGQRIAAANACMGC
FT                   HAVDRKLVGPSFQQIAARYKGDAAAPAKLARKVKDGGSGVWGMIPMPAHQSMSDADVRA
FT                   VVDWVLAGAPSK"
FT   sig_peptide     177779..177862
FT                   /locus_tag="BC1003_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            178206..178281
FT                   /locus_tag="BC1003_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            178206..178281
FT                   /locus_tag="BC1003_R0003"
FT                   /product="tRNA-Ala"
FT   gene            complement(178393..180126)
FT                   /locus_tag="BC1003_0162"
FT   CDS_pept        complement(178393..180126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0162"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bpy:Bphyt_0409 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56166"
FT                   /db_xref="GOA:E1T595"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:E1T595"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADN56166.1"
FT                   /translation="MAALNRFSIKAKLIAGFGTLSVIVVAVAGLSLKSLADSTDGFSNF
FT                   VRGINARADMVVQVRTAVDRRAIAARNLVLVVKPEDFEIEKAQVMRAHEDVATNLKKLN
FT                   EMIKDPGATGQARSLVAEIDRVEAAYGLVATDIVNLALANKRDEAIVKMDDQCRPLLAA
FT                   LIRATDAYANYAHARQEETIAEYAAHYENRRNLLIAISLFAVALAVAACVVITRAVSRP
FT                   LSVAIDVARTVSEGDLRTRITIDGKDETSKLLGALREMNERLTTIVGRVRDASTSIAGA
FT                   AREIAAGNMDLSQRTEQQAASLQETASSMEQLTSTVKQNADNAQQGSMLAANASSVAQK
FT                   GSAVVGQVVSTMQEISDSSTKIADITGIIEGIAFQTNILALNAAVEAARAGEQGRGFAV
FT                   VASEVRSLAQRSSSAAKEIKELIASSVDRIRDGSSLAGEAGKTMTEVTHAVARVTDIMS
FT                   EIAAASSEQSRGIEQVNLAITQMDNVTQQNAALVEQAAAASRSMEEQGQQLNETVGFFR
FT                   VVEGVGGGLVGRGGRDGGAGAATHASAPAAVRVSGMKRLAGKVNPLPVAVAGVDHGWDK
FT                   F"
FT   sig_peptide     complement(180016..180126)
FT                   /locus_tag="BC1003_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.712) with cleavage site probability 0.684 at
FT                   residue 37"
FT   gene            180652..182163
FT                   /locus_tag="BC1003_0163"
FT   CDS_pept        180652..182163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0163"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bpy:Bphyt_0410 diguanylate
FT                   cyclase; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56167"
FT                   /db_xref="GOA:E1T596"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E1T596"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADN56167.1"
FT                   /translation="MVTRRPNFIIAISGVLASAILAIAVWVLAQMHDDALRRAQDSVFN
FT                   VSLLIERDVSRNLEIYDLSIRTVIQGLKQPGVAQLDPALRQMVLFDGSATAKDMGSILV
FT                   IDETGYIKFDSQSVPPRHVYLGDRDYFKVHRDSPNVGLYVSHPFMPRTTGADMSIGLSR
FT                   RITKADGSFGGVVVGTMRLKYFRRLFEGMNLGAGGSMALMLSDGTMLMRRPYDPKTIGI
FT                   NLTGTANYSRFVEQPSGDFFGTAAIDGVERWYAFRHIDMYPLILDVALSTRDIYVGWRR
FT                   RAWIIGSLIGALDLTLIALAVLFAQQMRGRLLAEEELRVLARTDGLTGVDNRRTFEHAL
FT                   ESECRRVQRHGGPLSLLLIDVDNFKGFNDLYGHSAGDDALITVARCIARNVQRSGDTMA
FT                   RYGGEEFAVLLPDTDQDGARALAETIRASVEALALSHVASSHHVLTVSIGVATMRGEAL
FT                   TASRRLVDAADQALYAAKDAGRNRVFTYGASTPAGREGSMVVVSR"
FT   gene            182249..182881
FT                   /locus_tag="BC1003_0164"
FT   CDS_pept        182249..182881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0164"
FT                   /product="Protein of unknown function DUF2239"
FT                   /note="PFAM: Protein of unknown function DUF2239; KEGG:
FT                   bpy:Bphyt_0411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56168"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:E1T597"
FT                   /inference="protein motif:PFAM:PF09998"
FT                   /protein_id="ADN56168.1"
FT                   /translation="MTTHPRTCSAFEGHRLIASGELAPVALAVKQVLERGEQAPVLVFD
FT                   DTTAAPVEFDLRGTAQEILARLNSVQTESSRDASNEAEAADASDAAVAPRGRGRPKLGV
FT                   VAREVTLLPRHWDWLNAQPGGASVALRKLVETARAAGEHHDRKRAAQEAVYRFMTALAG
FT                   NLPDYEEATRALYAGDRPRFEEKIAQWPEDVRAYTARLAANAFTAHN"
FT   gene            183336..184643
FT                   /locus_tag="BC1003_0165"
FT   CDS_pept        183336..184643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0165"
FT                   /product="uracil-xanthine permease"
FT                   /note="KEGG: bxe:Bxe_A4294 nucleobase/cation symporter,
FT                   (NCS2) family; TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56169"
FT                   /db_xref="GOA:E1T598"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:E1T598"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ADN56169.1"
FT                   /translation="MADSYFPRWRVQPDAVEGRIVGTDERLAWPQMFAMGIQHVVAMFG
FT                   STVLAPLLMGFDPNLCIFMSGIGTLLFFVLVGGRVPSYLGSSFAFIGLVIAVTGYGGHG
FT                   PNMNIPVALGGIIACGVVYAIIGVIVSAVGTRWIETLMPPVVTGAIVCVIGLNLAPIAV
FT                   RGVSGSNFDSWMALVTVLCVGAVAVFAHGMLQRLLILVGLLMAYVIYAIVTNGLGMGKP
FT                   IDFSIVANAAWFGMPHFTAPVFNAQAMTLLAPIAVILVAENLGHIKAVSAMTGQNLDRY
FT                   IGRAFLGDGLATVVSGFAGGTGVTTYAENIGVMAVTKIYSTLVFVIAALIALVLGFSPK
FT                   FGAVIQTIPGPVLGGVSIVVFGLIAVTGARIWVVNKVDFSDNRNLIVAAVTLVLGAGDF
FT                   SLKLGGFGLGGIGTATFGAIILYALLRRKPAQGPVA"
FT   gene            complement(184710..186359)
FT                   /locus_tag="BC1003_0166"
FT   CDS_pept        complement(184710..186359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0166"
FT                   /product="Na+/H+ antiporter"
FT                   /note="KEGG: bpy:Bphyt_0414 Na+/H+ antiporter; TIGRFAM:
FT                   Na+/H+ antiporter; PFAM: sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56170"
FT                   /db_xref="GOA:E1T599"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:E1T599"
FT                   /inference="protein motif:TFAM:TIGR00831"
FT                   /protein_id="ADN56170.1"
FT                   /translation="MEIVFTVLILMLAVAASGVVTRLLPLPLPLVQIAMGAMLAWPKLG
FT                   LHVTFDPEIFMLLFIPPLLFADGWRIPKREFFMARRSILMLALGLVFMTVLAVGYFVHA
FT                   LVPTMPLPVAFALAAVLSPTDAVALSGIAGKGKVPGRLMHILEGEALMNDASGLVALKF
FT                   AIAAALTGVFSLRDASISFVIIAAGGLATGAAVSWLFSFVSVRFLNLAEEGDPAPGVVM
FT                   TLLIPFAAYLIAERFELSGILAAVAAGMMMNYTTLATSGPVASRLRASNTWMMIEFVFN
FT                   GMVFILLGLQFPHILGRALLEAHHTSDAQVWRLIGYIAAVGAALYALRFVWVWLLRWFA
FT                   SRGAVRHGVVNAVPGLRTVAVTTVAGVRGAVTLAGVLSLPETLPGGAELPGRDLAIFIA
FT                   SGVILLSLVIGVIALPLLLRGWRRGKDPHAAEEVLARTMAAQAAIRAVDDVHDKACANL
FT                   DESASAYAADVTARVMDIYRRRLTALGEDQEPREMARRADALEFRMKISAMRAERQVLL
FT                   RLRSSGAINDETFNKLMNEVDLAESALTARKK"
FT   gene            186838..188115
FT                   /locus_tag="BC1003_0167"
FT   CDS_pept        186838..188115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0167"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="KEGG: bpy:Bphyt_0415 diguanylate phosphodiesterase;
FT                   PFAM: EAL domain protein; SMART: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56171"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5A0"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADN56171.1"
FT                   /translation="MTIAQQERTATAPHGFEVEMTSGLERFSVQHGELTLTSVFQPIFS
FT                   LSHMRAVGYEGLLRAHDMLDRPVSPLDVFGEAARVGDVLHLDRLAQTLHLENFKVLGAE
FT                   REWLFLNVHPGALTDPYLSAALLATLKRLGLPPRRIVLEVLEHRAEDLERLADAVRQFR
FT                   ERGFLIALDDFGAGHSNVERIWQLNPDIVKLDRIMLSHAAHRADMATILPGLVALLHEA
FT                   GKLVLIEGVETEHEAQMALACNADFVQGFFFGRPSPGAADATHAATCIGELTERYRDQT
FT                   EARERRNASRLAPYLRAFERAAERLAAGEPLDEVCWNFLALDHAARCFLLDSKGRQAGR
FT                   NVVLRADRAAHETRFLPLADAQGANWLRRPYFRDAISAPERVHVTRPYLSINEALPCVT
FT                   LSVATRVGEKTCVLCGDIDWVDDEGI"
FT   gene            188151..188867
FT                   /locus_tag="BC1003_0168"
FT   CDS_pept        188151..188867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0168"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG: bxe:Bxe_A4291
FT                   putative copper homeostasis protein CutC"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56172"
FT                   /db_xref="GOA:E1T5A1"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5A1"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /protein_id="ADN56172.1"
FT                   /translation="MSVLLEVIATTVADARLAAQAGADRLELVTAMSEGGLTPSIGLIE
FT                   AVVEAVSIPVNVIVRPHSRSFVYDADDHAVMVRDVRAVKAAGANGVVIGMLNADGTIDR
FT                   DQLARAIDAADGLAVTFHRAFDEVRDQRKALDVLLGFDEVTNVLTSGARASVLDAEATI
FT                   RELVRHASGSHCTVLAGAGLTVDAVAGFVSRTQVEAVHFGSGVRVGGNGLAPIDTDKVA
FT                   RVRALLDEQAGSPRAQ"
FT   gene            complement(189032..192619)
FT                   /locus_tag="BC1003_0169"
FT   CDS_pept        complement(189032..192619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0169"
FT                   /product="Pyruvate/ketoisovalerate oxidoreductase,
FT                   catalytic domain protein"
FT                   /note="PFAM: Pyruvate/ketoisovalerate oxidoreductase,
FT                   catalytic domain; KEGG: bpy:Bphyt_0417 2-oxoacid ferredoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56173"
FT                   /db_xref="GOA:E1T5A2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5A2"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ADN56173.1"
FT                   /translation="MTARLPIDGTPALADYKLSDNLTATRGRIFLTGTQALVRLALMQR
FT                   ALDKARGMNTAGFISGYRGSPLGMVDQQLWKAKTLLSASDIRFLPAINEELGGTAVLGT
FT                   QRVEADPERTVEGVFAMWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSS
FT                   SMPHQSDFAMMAWHMPVVNPSNIADMLEFGLYGWALSRFSGAWVGYKAISETVESGSTV
FT                   DLDALRTEWTAPHDFTAPAGGLHNRWPDLPSLTIESRMHAKLDAVRHFAKTNSIDKWIA
FT                   PSPQANVGIVTCGKAHLDLMETLRRLDLTVADLDAAGVRIYKVGLSFPLEMTRIDTFVE
FT                   GLSEVLVIEEKGPVIEQQIKDYLYNRPQGARPAVIGKHAQDGSMLLSSLGELRPSRILP
FT                   VFAEWLAKHKPALDRRERVVDLVAPQILSNAADSVKRTPYFCSGCPHNTSTKVPEGSIA
FT                   QAGIGCHFMASWMERDTTGLIQMGGEGVDWASHSMFTKTRHVFQNLGDGTYFHSGILAI
FT                   RQAVAAKATITYKILYNDAVAMTGGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKY
FT                   DGHHGLFPKGTTFHHRSELDTVQRELRNTDGVTVLIYDQTCAAEKRRRRKKGEFPDPDK
FT                   RLFINEEVCEGCGDCGVQSNCLSVEPVETVLGRKRRIDQSSCNKDYSCVNGFCPSFVTV
FT                   EGGKLKKAAGVAFDPQALTERVNALRLPATHLDAAPYDILVTGVGGTGVVTVGALISMA
FT                   AHLEGKSASVLDFMGFAQKGGSVLSFVRFAARDEWLNQVRIDTQQADVLLACDMVVGAS
FT                   ADALQTVRHGRTRIVVNTHAIPNATFVTNPDATLHADALIDKMRHAAGAERLSTCDAQA
FT                   LATRFLGDTIGANILMLGFAWQLGLVPVSFGALMRAIELNNVAVQMNQLAFSIGRLAAA
FT                   DPAALESLWQARHAVKESVRVDTLDELIAHREGRLQTYGGARYVKRYRALVEAARRAEH
FT                   AVDARSERVTRAVATTFYRLLAVKDEYEVARLHTDAAFRQALEAQFEGVAGKDFGIKFN
FT                   LAPPTLARAHDGARPAKKTFGQWMWPVLGGLAKVRGLRGTLLDPFGRTLERKMERELAD
FT                   DYEATLHRALAKLDAGNLEDVAKLADLHARVRGYGHVKLANLAAVKRSERDLAARLGIE
FT                   AATGASVKKSLEEVKGAGQLRGIPVVVAK"
FT   gene            complement(192889..193848)
FT                   /locus_tag="BC1003_0170"
FT   CDS_pept        complement(192889..193848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0170"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein; KEGG:
FT                   bxe:Bxe_A4289 putative inward rectifier potassium channel"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56174"
FT                   /db_xref="GOA:E1T5A3"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5A3"
FT                   /inference="protein motif:PFAM:PF07885"
FT                   /protein_id="ADN56174.1"
FT                   /translation="MATEPTDRFPGIGDAESSAQKRRSRGSRELHPDDQVVVAHGMPMR
FT                   FWQDLYHRALTVRWPTFFVSLAVLFVLLNTSFAALYMLGDAPIANQYPPGFGGAFFFSV
FT                   ETLATVGYGDMHPQTVYAHWIATLEIFVGMSGIALATGLIFARFSRPHAKIMFARHAVI
FT                   RPLDGHMTLMVRAANGRQNVIAEAHARLRMLRRETTAEGYTLRRLHDLTLVRDQHPVFK
FT                   LGWTVMHVIDEDSPLFGETAQTLKAHDTSLLLTLEGVDESTSQTMQARHMWPCDQIFWH
FT                   HRFVDIMSERDGVSHIDYAHFHEIVPLDEAPLTTAVRP"
FT   gene            complement(193944..194189)
FT                   /locus_tag="BC1003_0171"
FT   CDS_pept        complement(193944..194189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56175"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5A4"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0421"
FT                   /protein_id="ADN56175.1"
FT                   /translation="MAEELFLYGVYSIHVRPIELSGPRWDAEYEIRHREKAVKAWTTVG
FT                   GDNGYGDAAQAIAAAHQQAVEDIEHGAGIPKLRAFP"
FT   gene            complement(194273..194503)
FT                   /locus_tag="BC1003_0172"
FT   CDS_pept        complement(194273..194503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56176"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5A5"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0422"
FT                   /protein_id="ADN56176.1"
FT                   /translation="MEDITYTKGIYTATASVRELDRDTWQGVVTLTRDEGEASEDQETT
FT                   VYEVEATSSTPAEALEEAKALAHRILGEIEL"
FT   gene            complement(194586..195503)
FT                   /locus_tag="BC1003_0173"
FT   CDS_pept        complement(194586..195503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0173"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: bxe:Bxe_A4286
FT                   putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56177"
FT                   /db_xref="GOA:E1T5A6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5A6"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADN56177.1"
FT                   /translation="MTTMSANNELPVFVSAGDILTDLVRTGASQWLSRPGGAGWNVARC
FT                   VARLGLPTACAGSLGVDNFSDELWDASVAAGLDMRFMQRVERPPLLAIVHRTHPPAYFF
FT                   MGENGADLAFDPARLPAGWMEQVKWAHFGCISLVRQPLGDTLAALAAKLRSQGVKISFD
FT                   PNYRNLMEHGYEPTLRKMAALADLIKVSDEDLRLLFKTDDEASALAQLRSMNPAATILV
FT                   TRGPQTASLIDGATTTEAQPPRVEVVDTVGAGDASIGGLLFSLMSAPQRTWPEHLAFAL
FT                   AAGAAACRHAGAHAPSLDEVVALL"
FT   gene            complement(195500..196783)
FT                   /locus_tag="BC1003_0174"
FT   CDS_pept        complement(195500..196783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0174"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase; KEGG:
FT                   bxe:Bxe_A4285 putative N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56178"
FT                   /db_xref="GOA:E1T5A7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5A7"
FT                   /inference="protein motif:PFAM:PF07221"
FT                   /protein_id="ADN56178.1"
FT                   /translation="MTQSATSHSANGAPAVPPVASFRSREFLLSHIEDTLRFYAPNVLD
FT                   PSGGFFHFFRDDGSVYNRTTRHLVSSCRYVFNYAMAYRQFGDPRHLEYARHGLRFLRDA
FT                   HWDAQHEGYDWEIEWRDGRKRTLDGTRHCYGLAFVLLAYSHAAMAGIEEAKPMIGATFE
FT                   LMEHRFWDAAAGLYADEASPEWRVSSYRGQNANMHTTEALLAAHEATGHLVYLDRAERV
FT                   ASNITLRQAKLSQGLVWEHFHADWSVDWHYNEEDSSNIFRPWGFQPGHQTEWAKLLLIL
FT                   ERYRPLPWLLPRAIELFDAAMAHAWDEDHGGLYYGFGPDGTVCDHDKYFWVQAETFATA
FT                   ALLGKRTGNERFWDWYDEIWRYSWAHFVDHKYGAWYRILTCDNRKYSDEKSPAGKTDYH
FT                   TMGACYEVLAHALPDGATAAAVSAEHAK"
FT   gene            complement(196780..197886)
FT                   /locus_tag="BC1003_0175"
FT   CDS_pept        complement(196780..197886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0175"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: bxe:Bxe_A4284 LacI family transcription
FT                   regulator; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56179"
FT                   /db_xref="GOA:E1T5A8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5A8"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADN56179.1"
FT                   /translation="MPTGIYRSTARFFRAVFAPFYYTIAGLKHRAVALPRPPASMAITI
FT                   RDVARAASVSIGTVSRALKNQPGLSEATRVRVVEAARELGYDAAQLRPRIRRLTFLLHR
FT                   QHNNFAVSPFFSHVLHGVEDACRERGIVPSVLTAGPTEDVIQQMRLHAPDAVAIAGFVE
FT                   PETLATLVEMQRPLVLIDLWAPGLRSVNLDNAAGAALAMRHLFEQGRKRVAFIGGSLAH
FT                   FSIAQRALGYRRAFFEAGLLFDPSLEVTIDAGLDPDTGAARAMQQLLDAPGPRPDAVFA
FT                   YNDAAALAALRACFARGVRVPEEIAIIGFDDIPAAAHATPPLSTISVDKEALGRRGVEL
FT                   LLEEAPAETEVRLPVHLIARASTLVKTP"
FT   gene            complement(197973..199826)
FT                   /locus_tag="BC1003_0176"
FT   CDS_pept        complement(197973..199826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0176"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: bpy:Bphyt_0426 diguanylate
FT                   cyclase/phosphodiesterase; PFAM: EAL domain protein; CBS
FT                   domain containing protein; GGDEF domain containing protein;
FT                   SMART: EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56180"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5A9"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADN56180.1"
FT                   /translation="MQLSSPSRSAAPRIQELIARRELSAVFQPIVDFDGGAILGYEGLI
FT                   RGPAGTSLEAPFALFSQALAEGCTIELEQAAARACIEAFARLGYDGKLFLNFSAGALRR
FT                   LAEAPEGTLALLRQRGLDPERLVIELTEQSTIPDVGGFLPVIACLRTAGAQFALDDYGT
FT                   ANASMNLWVRLQPDVVKIDRFFIHDIACDPLKFEAVRAMQHFASASGARLVAEGIENEA
FT                   DLIVVRDMGIGCGQGFFFGRPHAQPARKVTDDARDALRAGHIAVFPEATRTLGAASPSG
FT                   GMASEKMLVHAPALPRHATNNDVLELFNRLPDLHAVAVVEHDEPIALINRRSFMDRYAL
FT                   PYHRELFGKRPCLLFANASPVVIEKSMTVEQMAKLLASDDQRYLADGFVITENGKYAGL
FT                   GTGENLVRAVTEVRIEAARYANPLTFLPGNIPISSHIARLVSNHAGFYACYVDLNHFKP
FT                   FNDQYGYWQGDEVLKFAAAVLADVCDPMRDFLGHVGGDDFLILFQSDDWRERVLRAIHV
FT                   FNEGAQRFYAPADRLAGGIHGEDRRGNPTFFGFVTMAIGCVRVEPNSADGAPLYNSEEV
FT                   ATVAALAKRRAKLEASGFVLIDAQESAALLRGQPERAMTAG"
FT   gene            complement(200087..201112)
FT                   /locus_tag="BC1003_0177"
FT   CDS_pept        complement(200087..201112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0177"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   bpy:Bphyt_0427 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56181"
FT                   /db_xref="GOA:E1T5B0"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5B0"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ADN56181.1"
FT                   /translation="MARPKLLPDNFTLCLVGTVILASLLPVRGQAAVGFDWVTNVAVGL
FT                   LFFLHGAKLSREAIIAGATHWRLHIVVLLSTFALFPLLGLALKPLLSPLVTPALYGGIL
FT                   FLCTLPSTVQSSIAFTSIAKGNVPAAVCSASASSLLGIFVTPALVSVLVTNQAAGGSSP
FT                   WHTVGNIVLQLLVPFVAGQLLRPLIGKWIERHRGVLKFVDQGSILLVVYGAFSESVTEG
FT                   LWHQIPLSALGGVLLISVVLLALALTVTIFVSKRLGFSRADQITIIFCGSKKSLAAGVP
FT                   MAKVIFASQAVGAVVLPLMLFHQIQLMVCAALAQRWGARDLSGETRAASRERAAAAVAR
FT                   R"
FT   sig_peptide     complement(201017..201112)
FT                   /locus_tag="BC1003_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.621) with cleavage site probability 0.486 at
FT                   residue 32"
FT   gene            201588..202121
FT                   /locus_tag="BC1003_0178"
FT   CDS_pept        201588..202121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56182"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5B1"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0428"
FT                   /protein_id="ADN56182.1"
FT                   /translation="MFAAFAPVPQQARRSSNGALQASLRACESLVDGLSRTKHWPWSAL
FT                   IIALCSFAYAKGPGTPHGGASFRVDGYGHGNYVNRDVGRGFAQPNAAPSNIRRVAGPGA
FT                   YPGEGRGGIPYPGVITPVSAESRPGQRPQSNAPVRSGSIRADVARYNEERSSIRAIQRQ
FT                   ADDGRPPEGSPYRN"
FT   gene            202689..203774
FT                   /locus_tag="BC1003_0179"
FT   CDS_pept        202689..203774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0179"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_A4279
FT                   OmpC family outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56183"
FT                   /db_xref="GOA:E1T5B2"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5B2"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ADN56183.1"
FT                   /translation="MRTNISRVLNTTLKVTACAALLAGASSAFAQSSVQLYGQVDEWVG
FT                   AQKFPGGKTAVQVSGGGMSTSYWGLKGAEDLGNGYKAIFTLEGFFRAQNGQYGRFTGDT
FT                   TFSRNAYVGIESPYGTVTAGRLTTHLFVSTILFNPFIDSYVFSPMVYHVYLGLGTFPTY
FT                   STDQGVTGDSGWNNAVQYQSPNFNGLSASAMYALGNTTQNGAKKWSGQVLYFHGPFAAT
FT                   AVYQYVNFNNSPGDLGSFDSSGVPGLKAQSVAQLGVSYDLKYVKLFGQYMYTHNDQTLT
FT                   SWHVNTAQGGVSVPFGPGTVMASYAYSRDGGGFDQTRQTAAVGYDYPLSRRTDIYAAYL
FT                   YDHISNQSSGNTYGVGLRAKF"
FT   sig_peptide     202689..202781
FT                   /locus_tag="BC1003_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 31"
FT   gene            203977..204924
FT                   /locus_tag="BC1003_0180"
FT   CDS_pept        203977..204924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0180"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_0430 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56184"
FT                   /db_xref="GOA:E1T5B3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5B3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN56184.1"
FT                   /translation="MDTLVSMKVFRQVVEVGSFVGAAERMEMSAAMASKHVMHLEQQLG
FT                   ARLLNRTTRRVAPTEAGREYYERLSQVLTELEEAEQVVGAASVVPQGRLRVSSLSAFGL
FT                   SHVMAAVADYAAQYPQVTVDITLSDRVVELIDEGFDVAIRASPSGLKSSSLIARPIAMA
FT                   HLVLCASPAYLRRRGIPKTAADLARHNFLQYAGVSALDVMQSTGEAARVRLSGNLIVNH
FT                   LEAQRVMVLHGAGIALLGTEVIGADLAEGRLVPLLVDEMPPRELPIHVVYASRRHLSAK
FT                   VRSFVDFLAERFANESLWPSLEQIKALAGAPLAR"
FT   gene            205100..208618
FT                   /locus_tag="BC1003_0181"
FT   CDS_pept        205100..208618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0181"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   KEGG: bxe:Bxe_A4277 methylmalonyl-CoA mutase; PFAM:
FT                   methylmalonyl-CoA mutase; cobalamin B12-binding domain
FT                   protein; ArgK protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56185"
FT                   /db_xref="GOA:E1T5B4"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5B4"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ADN56185.1"
FT                   /translation="MTDLSTPQRAASHELPAGRRLRFVTAAALFDGHDASINIMRRILQ
FT                   ASGVEVIHLGHNRSVDEVATAALQEDADGVAVSSYQGGHNEYFRYLVDLLRARGGERIK
FT                   VFGGGGGVIVPEEIVALEKYGVEKIYSPHDGQRLGLQGMIDDMIGRCVALARESAAARA
FT                   GSLGEGGGPHAAGSPPTDATPHTVSEPHAVNAPPTSGVTPTVHTPDPVAEWIDDLIEGS
FT                   VSHGLSSTQARTEDKNQATFRRLAQLISACETGGIGAAKRDQLAARAQAARIPVLGITG
FT                   TGGAGKSSLTDELIRRFRLDYGDALTIAVLAVDPSRRKSGGALLGDRIRMNAIGDWGGG
FT                   ARVYMRSMATREASSEISNALPDALMLCKAAGFDLIVVETSGIGQGDAAIVPFVDESLY
FT                   VMTPEFGAASQLEKIDMLDFADFVAINKFDRKGAADALRDVAKQVQRNRGDFSTSPDAM
FT                   PVFGTIASRFNDDGVSALYRHLANALRRHGLREGGGRLSVPADVRFSSGRHAIVPPPRV
FT                   RYLAEIAQTVHVYRERAEAQARIARERWQLAEARRMLGETGATQPETASDASAARLDAL
FT                   IEQRTAALGERERKLLDAWPQTVAAYSGDEHVVRIREREIRTALAVTTLSGTQIRKVAL
FT                   PKFSDHGEILRWLMLENLPGYFPFTAGVFPFRRENEDPTRMFAGEGDPSRTNRRFKLLS
FT                   EGMPAKRLSTAFDSVTLYGEEPHERPDIYGKVGNSGVSVATLDDMHALYDGFDLCAPET
FT                   SVSMTINGPAPTILAMFFNVAIDQQIARRAQQLGRELSDDERAATRRSALENVRGTVQA
FT                   DILKEDQGQNTCIFSTEFSLKVMGDIQAYFVEHGVRNFYSVSISGYHIAEAGANPISQL
FT                   AYTLANGFTYVEAYLARGMSIDDFAPNLSFFFSNGMDPEYTVLGRVARRIWAIAMRERY
FT                   GANERSQKLKYHVQTSGRSLHAQEIDFNDIRTTLQALIAIYDNCNSLHTNAFDEAITTP
FT                   TEESVRRAVAIQLIINREWGLAKNQNPNQGSFVIDELTDLVEEAVLAEFDRLTERGGVL
FT                   GAMETGYQRGRIQDESMLYEHRKHDGSYPIVGVNTFLSAHPHEAPQPIALARSTEEEKQ
FT                   SQLARLRDFQARHREAAPAALERLKRAVMDDENVFAVLMDVVRVCSLGQITHALFEVGG
FT                   QYRRNM"
FT   gene            complement(208821..209780)
FT                   /locus_tag="BC1003_0182"
FT   CDS_pept        complement(208821..209780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0182"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   bxe:Bxe_A4276 putative 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56186"
FT                   /db_xref="GOA:E1T5B5"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5B5"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ADN56186.1"
FT                   /translation="MALPAVLQNLALPVVASPMFIVSYPELVLAQCKAGIVGSFPALNA
FT                   RPAELLDEWLTQIQAQLAEHKAANPGARVGPIAVNQIVHQSNTRLEHDVRVCVEHKVPI
FT                   FITSLRAPAREIVDAVHSYGGIVLHDVINLRHAQKALEAGVDGLILVASGAGGHAGTTS
FT                   PFALVGEVRRIFDGPIVLSGAIANGGSILAAQAMGADLAYMGTRFIATKEAHAVESYKQ
FT                   AIVNSSAADIIYTNLFTGVHGNYIRESIVNAGLDPDALPESDKSKMNFANEKAKAWKDI
FT                   WGAGQGVGLMNDVPSVSELVARLKKEYDDAKARLGIAR"
FT   gene            210166..211056
FT                   /locus_tag="BC1003_0183"
FT   CDS_pept        210166..211056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0183"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_A4275
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56187"
FT                   /db_xref="GOA:E1T5B6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5B6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADN56187.1"
FT                   /translation="MAFENFTPFRVVAGDTDIFGVKGGAGPPLLLLHGHPQSHLIWARC
FT                   AAQLAEHFTVIATDLRGYGASGKPASDSAHTPYSKRAMAADQVAVMRHFGFERFLVCAH
FT                   DRGARVAHRMALDHADAVERLMLLDIAPTLAMYEATDRAFATHYFHWFFLIQPEPLPET
FT                   LIGANPAAYVDAVMGSRHAGLAPFEPASLAAYRAALAQPGAVHAMCEDYRASASIDLEH
FT                   DRADIERGHKIACPLRVLWGDKGVIEKCFDALAEWRLVARDVSGRSLPCGHYIPEEAPE
FT                   ELVAEMLSFFQAIER"
FT   gene            complement(211105..211575)
FT                   /locus_tag="BC1003_0184"
FT   CDS_pept        complement(211105..211575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0184"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: transcriptional regulator, AsnC family; PFAM:
FT                   Transcription regulator AsnC-type-like; SMART:
FT                   Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56188"
FT                   /db_xref="GOA:E1T5B7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5B7"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADN56188.1"
FT                   /translation="MSKRLASLAPVALDETDRALIVALAEDARRPVSELARLVGLSAPS
FT                   TAERIRRLEAQGVIERFTVQLDPRALGFTLQAIVRVKPLPGQLHLVEEVIRRIPEFVEC
FT                   DKVTGDDCFICRLYLHSIEQLDEILSKVTERAETSTAIVKSTPVARRLPPLA"
FT   gene            211690..212589
FT                   /locus_tag="BC1003_0185"
FT   CDS_pept        211690..212589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0185"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bpy:Bphyt_0435 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56189"
FT                   /db_xref="GOA:E1T5B8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5B8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADN56189.1"
FT                   /translation="MASNEIRRGAAEMTMAMLMSGTIGWLVVSSQQSAFNVVFFRCIFG
FT                   GATLALVCAVLGLFRRQLFSWKMLGLALLGGAAIVANWVLLFAAYSRASISMATAVYNT
FT                   QPFMLVALGALVFRERISASTVAWLLLAFVGLVFVVKVEPAVLAVPGQYLVGIGYAVGA
FT                   AAMYAVSSIITKRLKGTPPHLIALIQVSLGVVMLAPLVRFDALPATGVQWLELIVLGVV
FT                   NTGLMYVLLYGAIQKLPTSMTGALSFIYPVVAIIVDRIAFGQTLAWIQVLGAVLILLAA
FT                   AGVNLGWRILPQRRVPTV"
FT   gene            complement(212921..213859)
FT                   /locus_tag="BC1003_0186"
FT   CDS_pept        complement(212921..213859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0186"
FT                   /product="putative metallo-beta-lactamase superfamily
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_A4274 putative metallo-beta-lactamase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56190"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5B9"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4274"
FT                   /protein_id="ADN56190.1"
FT                   /translation="MNALPASVHVFERGWLSSNNVLLVDDTGAALVDTGYATHADQTRA
FT                   LVQQALGARPLDLIVNTHLHSDHCGGNALLQATWPCRTLIPASEAEAVRDWDEARLTFR
FT                   ATGQTCERFAFTGTLTPGATLRLGALDWQVLGAPGHDPHSLMLYCEAERLLISADALWE
FT                   NGFGVIFPELEGESGFAEQQAVLETIAALDVRLAIPGHGAPFANVEKALQRAFSRLAWL
FT                   RADPARNAKNALKVLIVFKLLEVRAMSFAALLHMLGNAMAMRAAASMLKPRSEWPALMK
FT                   ALVEELAAGNGPLKVEGEQIVARATVHASEQ"
FT   gene            complement(213856..214347)
FT                   /locus_tag="BC1003_0187"
FT   CDS_pept        complement(213856..214347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0187"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bxe:Bxe_A4273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56191"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5C0"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADN56191.1"
FT                   /translation="MNTPPRIVTIGETFSATLALSVDSVKSFATLVNDLNPLHHDEAYA
FT                   AQSRFGGLIASGTQPTAHFMALLATHFSTYAQPLGLEFDIKLKKAAHAGDTLVMSWRVR
FT                   DAYWKPSLNGDLTHLEGTVTNQRGEVAVVGASTILVMPKAGTPVDAGINISCGSGTAAS
FT                   "
FT   gene            complement(214344..214571)
FT                   /locus_tag="BC1003_0188"
FT   CDS_pept        complement(214344..214571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0188"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289; KEGG:
FT                   bpy:Bphyt_0438 protein of unknown function DUF1289"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56192"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5C1"
FT                   /inference="protein motif:PFAM:PF06945"
FT                   /protein_id="ADN56192.1"
FT                   /translation="MTAENHHATKSGSVPSPCINVCRMDASTGWCEGCLRTIDEIAGWS
FT                   LYDDDEKRAVWDALDSRHAQFVASQAKVQR"
FT   gene            complement(214576..215097)
FT                   /locus_tag="BC1003_0189"
FT   CDS_pept        complement(214576..215097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0189"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: bxe:Bxe_A4271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56193"
FT                   /db_xref="GOA:E1T5C2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5C2"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ADN56193.1"
FT                   /translation="MTDHAFLDSDDLTALPDSARRVALLLRERGHVGRIVMLPETGKTS
FT                   AEAAAGLGCSVAQIAKSILFRRREDDAPVLVVASGANRVDEKKVAAQVGEIGRADAKFV
FT                   REKTGYAIGGVCPVGHAVEPVTLIDEDLLALDSLWAAAGHPHAVFNLTAQELIALTGAP
FT                   VVDVALRETA"
FT   gene            complement(215139..216065)
FT                   /locus_tag="BC1003_0190"
FT   CDS_pept        complement(215139..216065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0190"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   bpy:Bphyt_0440 hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56194"
FT                   /db_xref="GOA:E1T5C3"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5C3"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADN56194.1"
FT                   /translation="MNVPQQVKIVEVGPRDGLQNEKDFVPTATKVELINRLSAAGFRNV
FT                   EAASFVSPKWVPQMADGADVMAGIERRPGTLYSVLTPNLRGFEGALAARADEIVIFGAA
FT                   SEAFSQKNINCSIAESIERFTPVAQAAKQHGLRMRGSVSCALGCPYQGEVPVASVVDVV
FT                   QRFAALGCDEIDIADTIGVGTPKRTREIFEAVTRVFPRERLSGHFHDTYGQALANIYAA
FT                   LQEGIEIYHASVAGLGGCPYAKGATGNVATEDVLYLMNGLGIQTGIDLAQVVAIGDFIS
FT                   TAIGRPNVSRAGKALLAKARSEAANCV"
FT   gene            complement(216139..217191)
FT                   /locus_tag="BC1003_0191"
FT   CDS_pept        complement(216139..217191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0191"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: bpy:Bphyt_0441 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56195"
FT                   /db_xref="GOA:E1T5C4"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5C4"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADN56195.1"
FT                   /translation="MCVARRASAVASFAAALPRALRMRRERELVLTQRSRRMKILFYMP
FT                   NNEAALWLRDFARVLPQAELREWQPGDTAPADFAVVWRPPRELLAGRANLRAIFNLGAG
FT                   VDAILALEREHPGSLPRNAQLIRLEDTGMAPQMAEYVMHAVLRYLRRFDEYQTLQRERR
FT                   WQVLDPHPRETFSVGVLGLGVLGAHVAQSVAALGMPVRGYSRSVKQVEGIATFAGQAEF
FT                   DAFLDGLKVLVNLLPHTPDTANVLNARTFSKLARGAYLINVARGAHLVEADLLDALASG
FT                   QIAAATLDVFQHEPLPPDHPFWQKPRITITPHVSALTLREESVAQIAQKLLALERGEAV
FT                   SGVVNIERGY"
FT   gene            217402..218004
FT                   /locus_tag="BC1003_0192"
FT   CDS_pept        217402..218004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0192"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   bxe:Bxe_A4268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56196"
FT                   /db_xref="GOA:E1T5C5"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5C5"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ADN56196.1"
FT                   /translation="MHSCARSPWPPRLVTVPGLHGSEGAHWQTWLERQFARSLRVEQAD
FT                   WDSPDIAGWANSLCELLARERGPFVLAAHSFGCLATAHALQQATYANEVVGVLFVAPAS
FT                   PQKFAFAGTFEARRLGVPSILIGSETDPWMSLAGSRELAQRLGSAFVNLGDAGHINTAA
FT                   GFGSWPRARYFIDTLVHCAAPLRFRDEPLEVAQHALV"
FT   gene            218191..219222
FT                   /locus_tag="BC1003_0193"
FT   CDS_pept        218191..219222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0193"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="KEGG: bpy:Bphyt_0443 sulfate ABC transporter,
FT                   periplasmic sulfate-binding protein; TIGRFAM: sulfate ABC
FT                   transporter, periplasmic sulfate-binding protein; PFAM:
FT                   extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56197"
FT                   /db_xref="GOA:E1T5C6"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5C6"
FT                   /inference="protein motif:TFAM:TIGR00971"
FT                   /protein_id="ADN56197.1"
FT                   /translation="MAGRTGTLRWLAAGVAAITLGFGLGGTSVAYADVSLMNVSYDVTR
FT                   ELYKDINAGFIAAYKQKSGETVSIRQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLA
FT                   EKGQLLPANWRARLPNDSAPYTTTMVFLVRKGNPKHIKDWDDLAKPGVQVVIANPKTSG
FT                   NGRYTYLAAWGYRKQHGGTDADALNFEKAIFKNVPVLDTGGRGATTTFTQRGIGDVLVT
FT                   FENEVALMNSGVGAGNFEAVYPSVSLLAAPPVSLVDKVVDKRGTRKEAQAYLDYLWSPA
FT                   AQEIIAQHHLRPRDSSVLAKHAAEFKPIKTFTVEEMFGSWQKAQQTHFSDGGTFDQIVV
FT                   DRK"
FT   sig_peptide     218191..218289
FT                   /locus_tag="BC1003_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.954 at
FT                   residue 33"
FT   gene            complement(219229..220323)
FT                   /locus_tag="BC1003_0194"
FT   CDS_pept        complement(219229..220323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0194"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; TIGRFAM:
FT                   biotin synthase; KEGG: bpy:Bphyt_0444 biotin synthase;
FT                   PFAM: biotin and thiamin synthesis associated; Radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56198"
FT                   /db_xref="GOA:E1T5C7"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5C7"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ADN56198.1"
FT                   /translation="MTQLNTAASPAATATAGNVNANANPNANAAIAGKQLARWRVADIV
FT                   ALYELPFNDLMFRAQQTHREHFDANTVQLSTLLSIKTGGCEEDCAYCPQSVHHDTGLQA
FT                   DKLMPVDEVLAAAKAAKENGATRFCMGAAWRNPKDRHLEPIKDMIRGVKAMGLETCVTL
FT                   GMLETHQAQALREAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGINVCCG
FT                   GIVGLGESRRERAGLIAQLANMDPYPESVPINNLVQVEGTPLTGTEAIDPFEFVRTIAI
FT                   ARITMPRAMVRLSAGREQMDEALQAMCFLAGANSIFYGDQLLTTSNPQAEADRKLLSRL
FT                   GIRAEAAQQMPLDKSGCEHGCAPA"
FT   sig_peptide     complement(220258..220323)
FT                   /locus_tag="BC1003_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.767 at
FT                   residue 22"
FT   gene            complement(220359..221108)
FT                   /locus_tag="BC1003_0195"
FT   CDS_pept        complement(220359..221108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0195"
FT                   /product="dethiobiotin synthase"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: bpy:Bphyt_0445
FT                   dithiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56199"
FT                   /db_xref="GOA:E1T5C8"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5C8"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADN56199.1"
FT                   /translation="MTSLPLTHQAPPHAMSLFVTGTDTEIGKTFVSSALLRGFARKGLR
FT                   AAAMKPIAAGAFELNGKLHNEDADQLDAASNVLLPPEMRTPYLLKEPAAPHIAAALENV
FT                   AFDIDHIVACHRQALTHADVVVVEGVGGFRVPLTATQDTADLAVALNLPVVLVVGMRLG
FT                   CINHALLTADSIAARGLTLAGWVANRVDPDMSFPDENIASIREHLAREHHAPLLGIVPR
FT                   MSPASPELAAERLDIEQLLQTLRHSQR"
FT   gene            complement(221105..222289)
FT                   /locus_tag="BC1003_0196"
FT   CDS_pept        complement(221105..222289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0196"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="TIGRFAM: 8-amino-7-oxononanoate synthase; KEGG:
FT                   bxe:Bxe_A4264 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56200"
FT                   /db_xref="GOA:E1T5C9"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5C9"
FT                   /inference="protein motif:TFAM:TIGR00858"
FT                   /protein_id="ADN56200.1"
FT                   /translation="MHLLDTLAQGLREIDERGLRRRRRTADTPCAAHMSVDGREIIGFA
FT                   SNDYLGLAAHPQLIAAIAEGAQRFGAGSGGSHLLGGHSRAHAQLEDDLAEFVGGFVDAP
FT                   RALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGSRLSRADVQIYPHCDIDALS
FT                   AMLDASDSDVKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRG
FT                   AVAEAALRSPNLISIGTLGKAAGVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHA
FT                   VSASLRIIGGAEGDERRVHLRQLIERTRVMLKTTPWLPVDSHTAVQPLIIGANEATLEI
FT                   AASLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSHEDLDRLEAGLQQTGARTA"
FT   gene            complement(222289..223650)
FT                   /locus_tag="BC1003_0197"
FT   CDS_pept        complement(222289..223650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0197"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="KEGG: bxe:Bxe_A4263
FT                   adenosylmethionine--8-amino-7-oxononanoate transaminase;
FT                   TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56201"
FT                   /db_xref="GOA:E1T5D0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5D0"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ADN56201.1"
FT                   /translation="MENSATSPKSTEDWIARSLRAVWHPCTQMKHHERLPLVPVARGQG
FT                   AWLYDRAGHRYLDAISSWWVNLFGHANPRINAALKDQLDTLEHAMLAGCTHEPAVELAE
FT                   RLSALTSNTLGHAFFASDGASAVEIALKMSFHSWRNRGFADKQEFVCIANSYHGETIGA
FT                   LGVTDVALFKDAYDPLIRNAHVVASPDARLAEAGESAADVARRALQHVRALFEARAEKI
FT                   GALIVEPLVQCAAGMAMHDASYIAGLRALCDQYGVHLIADEIAVGCGRTGTFFACEQAG
FT                   IWPDFLCLSKGISGGYLPLSIVLSRDEIFNAFYHDDTARGFLHSHSYTGNPLACRAALA
FT                   TLDLFASDNVLAVNRQKSATLKAALVPLAQHRNVRNLRQCGTLFAFDAVIDNDQDARTF
FT                   SRRFFENALQRELLLRPISTTVYLMPPYILNDEELALLASRTRETFDATLAEVR"
FT   gene            complement(224123..225421)
FT                   /locus_tag="BC1003_0198"
FT   CDS_pept        complement(224123..225421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56202"
FT                   /db_xref="GOA:E1T5D1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5D1"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4260"
FT                   /protein_id="ADN56202.1"
FT                   /translation="MVLSKVLARWAAICAAATCAVATAHANPLADGQPGPLARAQVPRI
FT                   ALPDDVYLPSARLNEQIIRIPVDADGEITLQTTIYKPDGAGPFPMIVFNHGKIPGDPRM
FT                   QERSDPLPLAREFVRRGYVVVAPNRQGFGQSGGVYHQDGCDVERNGMSQAADVAATVDY
FT                   MSKQPYVDASHIVVAGTSHGGLATMAYGTEAARGVRALINFSGGLRQDACGDWQGNLTR
FT                   AFGAYGDKTKVPSLWMYGDNDSVWNAPLIAGMYAAYVAHGASAKMVDYGTYKNDAHRLV
FT                   GDRDGVHVWWPAVEAFLARVGMPTGVQYRVEDPSAPKASGFASVDAVDAVPYVDEAGRN
FT                   GYRNFLRQYPSRAFAVSDTGAWSWAEGGDDPMSVAIANCQKQSSAPCRLYAVDNSVVWG
FT                   DQNSRTADSGAGSSDRSTLSSADEGRHALASRE"
FT   sig_peptide     complement(225341..225421)
FT                   /locus_tag="BC1003_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.916 at
FT                   residue 27"
FT   gene            complement(226076..226525)
FT                   /locus_tag="BC1003_0199"
FT   CDS_pept        complement(226076..226525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56203"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5D2"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0458"
FT                   /protein_id="ADN56203.1"
FT                   /translation="MSKHKSSAQRPVDCPCGGAAPHPSGAAKPPRFAQCCGRYIDGGEL
FT                   APRALELMRSRYSAYVVGATDYLRATWAPATCPADLDADTAAPDAPRWLGLQIKAFAQT
FT                   DPAHATVEFVARYKVAGRAHRLHELSRFVRDDNGRWLYVDGDVRE"
FT   gene            complement(226532..227662)
FT                   /locus_tag="BC1003_0200"
FT   CDS_pept        complement(226532..227662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0200"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: bpy:Bphyt_0459 acyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56204"
FT                   /db_xref="GOA:E1T5D3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5D3"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADN56204.1"
FT                   /translation="MVLDQDHLMVRDALRTFVREAITPYAAAWDRERTFPNDVHRQLAG
FT                   LGAYGVLVPETYGGAGMDALALALILEEIAAGDGGTSTAISVNNCPVCSILLSYGNDAQ
FT                   KRDWLTPLARGEMLGAFCLTEPQAGSDASALRTTAIREGDTYVLNGVKQFITSGKNANV
FT                   AIVMAVTDKAAGKRGISAFIVPTDSQGYVVARLEDKLGQHSSDTAQIVFEDCRVPAANL
FT                   IGAEGEGYRIALSGLEGGRIGIAAQSVGMARAAFEAALSYAKERESFGAPLFSHQAVQF
FT                   RLAEMATQLEAARQLIWHAAALKDAGQPCLTEAAMAKLFASEAAERICSAALQIHGGYG
FT                   YLSDFPVERIYRDVRVCQIYEGTSDIQKILIARGLG"
FT   gene            complement(227675..228352)
FT                   /locus_tag="BC1003_0201"
FT   CDS_pept        complement(227675..228352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0201"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56205"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5D4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN56205.1"
FT                   /translation="MKTVLIVGASRGIGQEFVRQYKESGWRVLATARDGAALDALSQLG
FT                   AQPYSVDVTEPADIAALGWKLDGEHVDLAIVVSGVYGPRSEGIETITAEDFDHVMHTNV
FT                   RGPMQLMPILLPLVEETGGVLAVISSRMGSIADPSGTSGWLYRVSKAALNDALKLASLE
FT                   AQRATCVSLHPGWVQTDMGGAQAAVHPTRSVSGMREVLAQAAASREAFNGRFYQYDGMQ
FT                   LDW"
FT   gene            complement(228400..229608)
FT                   /locus_tag="BC1003_0202"
FT   CDS_pept        complement(228400..229608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0202"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   bxe:Bxe_A4255 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56206"
FT                   /db_xref="GOA:E1T5D5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5D5"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADN56206.1"
FT                   /translation="MSETNMSGTGADPVVIVSAARTPMAAFQGDFASLSAPQLGSIAIE
FT                   AAVQRAGLKPDQIDEVVMGCVLPAGLGQAPARQAALGAGLPLSTGSTTVNKMCGSGMRA
FT                   AMFAHDMLAAGSVEVIVAGGMESMTNAPYLLPKARAGMRMGHGQVIDHMFYDGLEDAYE
FT                   KGRLMGTFAEECAASFDFTREAQDAFAVESLNRAKRANEDGSFAWEIAPVKVQSRKGEV
FT                   SVEHDEQPYKANLDKIPALKPAFSKTGTVTAANSSSISDGAAALVMMRESTAKRLGVKP
FT                   LARVVGHSTFAQEPAKFTTAPVGAIRKLFDKNGWRADEVDLFEVNEAFAVVTMAAMKEH
FT                   KLPHDKVNVHGGACALGHPIGASGARIIVTLIGALKKRGGKRGVATLCIGGGEATAMGI
FT                   ELV"
FT   gene            complement(229601..230377)
FT                   /locus_tag="BC1003_0203"
FT   CDS_pept        complement(229601..230377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0203"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: bxe:Bxe_A4254 putative carbonic anhydrase;
FT                   PFAM: carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56207"
FT                   /db_xref="GOA:E1T5D6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5D6"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADN56207.1"
FT                   /translation="MNMNASNSAHPLAHLFENNDAWVARKLAEDPEYFSRLAHQQTPEY
FT                   LWIGCSDSRVPANQIIGLPPGEVFVHRNIANVVVHTDLNCLSVIQFAVDLLKVKHIMVV
FT                   GHYGCSGVGAALHGRRVGLADNWLHHVQDVRAKHAALLDEWPLGEARHRRLVELNTIEQ
FT                   VVNVCRTTIVNDAWARGQELTVHGWAYGVHDGKVRDLGMTVNNAAALEQTYERCVAGVS
FT                   ASGAHATENDVVAADAARLGDVPAIVEGVIKELKHE"
FT   gene            complement(230492..232375)
FT                   /locus_tag="BC1003_0204"
FT   CDS_pept        complement(230492..232375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0204"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="KEGG: bpy:Bphyt_0463 bifunctional isocitrate
FT                   dehydrogenase kinase/phosphatase protein; PFAM: Isocitrate
FT                   dehydrogenase kinasephosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56208"
FT                   /db_xref="GOA:E1T5D7"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5D7"
FT                   /inference="protein motif:PRIAM:2.7.11.5"
FT                   /protein_id="ADN56208.1"
FT                   /translation="MNHFPKLLSSQIGFDVAQTMLEGFDRHYRIFRDAAIHAKTLFERG
FT                   DWHGLQKLARERITSYDDRVQECVELLEDEYDAENIDSEVWQQIKLHYIGLLTTHRQPE
FT                   CAETFFNSVCCKILHRSYFNNDFIFVRPAISTEYLENDEPAAKPTYRAYYPGKDGLAAT
FT                   LERIVTNFQLEPPFEDLTRDVGCVMQAIHDAFGTFDEAPNFQIHVLSSLFFRNKSAYII
FT                   GRIINGDMLLPFAVPLRHVKPGVLALDTVLLKREQLLIIFSFSHSYFLVDMEVPSAYVE
FT                   FLGMIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHSSDQFIIAPGIKGLVMLVFTL
FT                   PSFPYVFKLIKDNFPPPKETTRAKIQEKYQLVKRHDRLGRMADTLEYSSVALPISRLDE
FT                   TLLRELEKEVPSLLEYDGENVVIRHMYIERRMVPLNLFLQNGSDADVDHGIKEYGNAVK
FT                   ELMQANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRAVPAPRNEEDEMSGEAW
FT                   YSVGPHDIFPETYGTFLLGDPRVRRSFMQHHADFFDPALWQKHKDHLLKGELPDFFPYD
FT                   SSVRFCIRYPERFEPAASGAQKANDADGSQAGLQADRPADPPADERSVRVA"
FT   gene            complement(232609..233049)
FT                   /locus_tag="BC1003_0205"
FT   CDS_pept        complement(232609..233049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0205"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: bxe:Bxe_A4252 MerR family transcriptional
FT                   regulator; PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56209"
FT                   /db_xref="GOA:E1T5T2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5T2"
FT                   /inference="protein motif:PFAM:PF09278"
FT                   /protein_id="ADN56209.1"
FT                   /translation="MTTQYTITELAREFDVTPRAIRFYEDQGLLSPSREGSSGLRRVYS
FT                   GRDRTRLKLTLRGKRLGFTLSEIRDLLDVYESPTDTVPQLHAFLDTVARHREVLERQLE
FT                   DLNATLEDLAQYEAQARALLESGTHAAAGAKDARQARESKSA"
FT   gene            233127..234245
FT                   /locus_tag="BC1003_0206"
FT   CDS_pept        233127..234245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0206"
FT                   /product="putative metallo-beta-lactamase superfamily
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_A4251 putative metallo-beta-lactamase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56210"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5T3"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4251"
FT                   /protein_id="ADN56210.1"
FT                   /translation="MQPAAKYAQGVEEDTRMNALEHQLDYPLKDLLPEPGEAHEVAPGV
FT                   FWLRMPLPFALDHINLWLLRDRIDGQDGWTVVDCGIASDAIRQNWEKVFDTVLDGLPVL
FT                   RVIVTHCHPDHVGLAHWVCSGGDKKRWDARLWMTLGEYMQARVMAAGDGSNAGGEAAAR
FT                   HFALHGVTDAASLEKLRNRQSYYANLVPAVPGQYRRLREADGVRIGKKTWRVVTGYGHS
FT                   PEHCALHCEELGVLISGDMVLPRISTNVSVFAMEPEGSPLALYLESLARYEAMPEDTLV
FT                   LPSHGKPFRGVRTRIAQLREHHDARLAEVREACAAKPHSAADIVPLMFRRELDIHQLTF
FT                   AMGEALAHLHLLWLAGALKRTQDADGVVRFSA"
FT   gene            complement(234346..235932)
FT                   /locus_tag="BC1003_0207"
FT   CDS_pept        complement(234346..235932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0207"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bpy:Bphyt_0468 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56211"
FT                   /db_xref="GOA:E1T5T4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5T4"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADN56211.1"
FT                   /translation="MRFKLLAAAVLVTASAHVLAKPLTVCTESSPDGFDVVQFNSLVTT
FT                   NASADVIFNSLVSYDEAAKKVVPSLADKWEVSADGLTYTFHLRPNVQFQTTDYFKPTRP
FT                   LNADDVVFTFDRMLNDSNPWHKVAGASGFPHAQSMGLPKLIKSISKVDDNTVKFELNAP
FT                   DATFVSILTMGFASIYSAEYADQLLKAGRQTDLNAKPIGTGPFELKSYTKDAVIRYDVN
FT                   PTYWGPKPKIDRLIYAITPDATVRAQKVKAGECQIALSPKPQDLADAKNDKSLAIVQTP
FT                   AFMTAFVALNTQKKPLDNQKVRAALNMAFDRGTYLKTVFDNTATPAVNPYPPNTWSYDK
FT                   AVKAWPYDPVKAKKLLADAGYPNGFETTIWVRPNGSVLNPNPKAGAELLQADFAKIGVK
FT                   ADVKVIEWGELIKQAKQGQHDSLFMGWAGDNGDPDNYLSPLFSCNAVKSGINFARYCDQ
FT                   DLDKLIADGKSTPDQSKRAKAYEAAQQIIHDQALWIPLGYPTAAAITRTNVSGYHVSPF
FT                   GRQNFGAVAVQ"
FT   sig_peptide     complement(235870..235932)
FT                   /locus_tag="BC1003_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.990 at
FT                   residue 21"
FT   gene            complement(236187..237014)
FT                   /locus_tag="BC1003_0208"
FT   CDS_pept        complement(236187..237014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0208"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bpy:Bphyt_0469 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56212"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5T5"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADN56212.1"
FT                   /translation="MCARAVDASGVAHEPAGAGARIVSLVPSITELLFALGLERQIVGR
FT                   TGFCVHPRDKVGSVPKVGGTKAVRIDAVRALQPTHLIVNIDENERDTVEQLRAFVPHVV
FT                   VTHPQTPQDNLSLYALLGAIFDREQPARHLADALQTRLNEAASQSFAAQNVLYLIWREP
FT                   WMTVARDTYISAMLRLVNWHTLPDVQGGAAGASRYPTFELDGAGRAPWLDGVERILLSS
FT                   EPYRFTQAHCDALRLDPRSGGTRIELIDGEMVSWYGVRAIEGIAYLMRRAAAG"
FT   gene            complement(237018..237791)
FT                   /locus_tag="BC1003_0209"
FT   CDS_pept        complement(237018..237791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0209"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bxe:Bxe_A4248 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56213"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5T6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN56213.1"
FT                   /translation="MSSPLKVFITGASSGIGLALAAEYARRGAILGLVARRGEALAAFQ
FT                   RSHPQSSISCYCVDVRDAEALAEAAAQFIAQHGQPDIVIANAGVSRGAVTGEGDLRTFR
FT                   EVMDINYFGMVATFEPFAAAMAAARRGTLVGIASVAGVRGLPGSGAYSASKSAAFKYLE
FT                   ALRVEMRPHGVGVVTIAPGYIRTPMTAHNPYTMPFLMDAQQFAVKAAQAIERRVAFAVF
FT                   PWQMRLVAMLLHAAPRWLYDRVFERAPRKPRAVVE"
FT   sig_peptide     complement(237726..237791)
FT                   /locus_tag="BC1003_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.992 at
FT                   residue 22"
FT   gene            complement(237807..238607)
FT                   /locus_tag="BC1003_0210"
FT   CDS_pept        complement(237807..238607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0210"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bpy:Bphyt_0471 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56214"
FT                   /db_xref="GOA:E1T5T7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5T7"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADN56214.1"
FT                   /translation="MRRRRVIGAASVTGIARTLSMIDHGGSYNRRTPNLKTVTGICVAP
FT                   LFSLLDQHNMKKLLSILFLSLGLLAASAHASPAAPVAGKDYTALASAQPVDVPAGKIEV
FT                   TEFFWYGCPHCNEFEPYLESWLKKQGPDVVFKRVPVAFRDDFIPHSKMYHALDALGVAP
FT                   QLTPKVFNEIHVNKNYLLTPEDQAKFLAKNGVDPKKYMDAYNSFSTQSALQKDKKLLDD
FT                   YKIDGVPTIAVQGKYETGPAATGSLPGTLQVLDFLVQQVRAKKM"
FT   gene            complement(238628..239446)
FT                   /locus_tag="BC1003_0211"
FT   CDS_pept        complement(238628..239446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0211"
FT                   /product="Sporulation domain-containing protein"
FT                   /note="PFAM: Sporulation domain-containing protein; KEGG:
FT                   bpy:Bphyt_0472 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56215"
FT                   /db_xref="GOA:E1T5T8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5T8"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADN56215.1"
FT                   /translation="MQVIHTMAKPRRTTKQSKQTGGTFLGIVLGLIVGLAIAVVVALYI
FT                   TRAPTPFVSKVAPPAASDSSASQAQYDPNRPLQGKSPGQPVPQAAQPAPPNTAPGQTNS
FT                   QTQSGMLEQPQIIEVPPTVGNANNNANGTAVAPKPAQDNGSSSTAAVKKPQGASAPAAT
FT                   AAGSAPKSTSSAAVANAKPGSGAAPAPGDANTGYFLQVGAYKTAADAEQQRARLAFQGF
FT                   ESKVTQRDAGGVTYYRVRIGPFSKFEDMNASRQRLSDAGVDTAVIRFTKQ"
FT   sig_peptide     complement(239330..239446)
FT                   /locus_tag="BC1003_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.695 at
FT                   residue 39"
FT   gene            complement(239508..241310)
FT                   /locus_tag="BC1003_0212"
FT   CDS_pept        complement(239508..241310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0212"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; KEGG:
FT                   bpy:Bphyt_0473 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56216"
FT                   /db_xref="GOA:E1T5T9"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5T9"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADN56216.1"
FT                   /translation="MLPAHKHTLETLLADTVKQVALATQGATEAAFVSPTIALERPKVA
FT                   AHGDVACNVAMQLAKPLRANPRQLAQQIVDTLLAQPQAQGLIESAEVAGPGFINLRLAA
FT                   AAKQAVVAAVLAEKDAYGRSQRDAGKHVLIEFVSANPTGPLHVGHGRQAALGDALSNVL
FT                   ASQGWDVHREFYYNDAGVQIGTLALSTQARARGLAPGDAGWPASAYNGEYIADIAKDYL
FT                   NGVTVCASDGEPVTGARDVENLDAIRRFAVAYLRREQDMDLQAFGVKFDQYYLESSLYT
FT                   EGRVEKTVEALIAAGKTYEQEGALWLRTTDDGDDKDRVMRKSDGTYTYFVPDVAYHVAK
FT                   WERGFTKVINIQGSDHHGTIARVRAGLQGLGIGIPKGYPDYILHKMVTVMRNGEEVKIS
FT                   KRAGSYVTVRDLIEWSGGATPGSEAAVDLIDEETIRRGRDAVRFFLISRKADTEFVFDI
FT                   DLALKQNDENPVHYVQYAHARICSVIAECKSRYGADYGADESALANVDLAPLSSERAMA
FT                   LLNKLAEFPDMLQHAADELAPHAVAFYLRDLAGEFHSFYNDKAERVLVDDAAERNARVA
FT                   LLAATRQVLANGLAVIGVSAPVKM"
FT   gene            241776..242102
FT                   /locus_tag="BC1003_0213"
FT   CDS_pept        241776..242102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0213"
FT                   /product="Domain of unknown function DUF1840"
FT                   /note="PFAM: Domain of unknown function DUF1840; KEGG:
FT                   bxe:Bxe_A4244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56217"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5U0"
FT                   /inference="protein motif:PFAM:PF08895"
FT                   /protein_id="ADN56217.1"
FT                   /translation="MLITFKCRACPDVMMLENLAQYLVGIVGKRLGERGVITHDELADA
FT                   IAKLEAAITVDKQERAEHDGHFHEGEEGHEPHEIPPGLAQRAYPFLDMLRAAQKENADI
FT                   VWGL"
FT   gene            complement(242355..242561)
FT                   /locus_tag="BC1003_0214"
FT   CDS_pept        complement(242355..242561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0214"
FT                   /product="putative acid shock protein"
FT                   /note="KEGG: bpy:Bphyt_0475 putative acid shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56218"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5U1"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0475"
FT                   /protein_id="ADN56218.1"
FT                   /translation="MKKLTLVLTAVSLALGASATLAQTAAPAGSSSVSSYSPPTTKHVK
FT                   KPKKQKMKKGASAPAVAPEAASQ"
FT   sig_peptide     complement(242493..242561)
FT                   /locus_tag="BC1003_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.869 at
FT                   residue 23"
FT   gene            complement(242753..245470)
FT                   /locus_tag="BC1003_0215"
FT   CDS_pept        complement(242753..245470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0215"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="TIGRFAM: methionine synthase; KEGG: bpy:Bphyt_0476
FT                   methionine synthase; PFAM: dihydropteroate synthase DHPS;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   cobalamin B12-binding domain protein; Vitamin B12 dependent
FT                   methionine synthase activation region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56219"
FT                   /db_xref="GOA:E1T5U2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5U2"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ADN56219.1"
FT                   /translation="MTDHTMRLAGLEPFNVTSGTLFINVGERTNVTGSKAFARMILNDQ
FT                   FDEAIAVARQQVENGAQVIDVNMDEAMLDSKAAMVRFLNLIASEPDIARVPIMIDSSKW
FT                   EVIEAGLKCVQGKAIVNSISLKEGEEAFRHHAKMIRRYGAAAVVMAFDEQGQADTFERK
FT                   TQICKRSYDVLVNEVGFAPEDIIFDPNIFAIATGIEEHNNYAVDFINATRWIKENLPYA
FT                   KVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYADLDPELREL
FT                   VEDVVLNRRPDGTDRLLEVADKFKTGAAKKEENLEWRNQPVEKRLSHALVHGITNFIVE
FT                   DTEEVRAKIAAQGGRPINVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHL
FT                   IPFIEEEKKQLAAAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMV
FT                   PCNDILAKAKVEGADIIGLSGLITPSLEEMAYVASEMQRDDYFRVKKIPLLIGGATTSR
FT                   VHTAVKIAPHYEGPVVYVPDASRSVSVASSLLSDEGATKYLDELKADYDRIRAQHASKK
FT                   ALPMVTLAEARANKTPIDWKTYQPVKPKFIGRRVFKNFDLNELANYIDWGPFFQTWDLA
FT                   GPYPAILNDEIVGESARRVFSDGKSMLARLIQGRWLQANGVLALLPANSVNDDDIEIYT
FT                   DETRSEVALTWRNLRQQSVRPVVAGVMRPNRSLADFIAPKESGVADYIGMFAVTAGLGV
FT                   DVKEKQFEKDHDDYSAIMLKALADRFAEAFAEALHARVRRDLWGYAGAENLSNDELIAE
FT                   KYRGIRPAPGYPACPDHLVKRDMFEVLQAGEIGMSVTESLAMLPAASVSGFYLAHPDST
FT                   YFSVGKIGEDQLEDYAQRMSLSKADAERALAPLL"
FT   gene            complement(245557..246627)
FT                   /locus_tag="BC1003_0216"
FT   CDS_pept        complement(245557..246627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0216"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56220"
FT                   /db_xref="GOA:E1T5U3"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5U3"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ADN56220.1"
FT                   /translation="MNQPAQTVKSVRPEPEYTRGKELPALLKSRILILDGAMGTMIQRY
FT                   KLDEARYRGERFKDYGRDIKGNNELLSITQPQIISEIHEQYLAAGADIIETNTFGATTV
FT                   AQADYGMEALAVEMNLESAKLARAACDKFSTPDKPRFVAGAIGPTPKTASISPDVNDPG
FT                   ARNVTFDELHAAYYEQAKALLDGGADLFLVETIFDTLNAKAALFALDELFENTGERLPI
FT                   MISGTVTDASGRILSGQTVEAFWNSLRHAKPLTFGLNCALGAALMRPYIAELAKLCDTY
FT                   VSCYPNAGLPNPMSDTGFDELPADTSGLLKEFAEAGLVNIAGGCCGTTPEHIAAIAKAL
FT                   AEVKPRKWPTQYRDAA"
FT   gene            complement(246941..247198)
FT                   /locus_tag="BC1003_0217"
FT   CDS_pept        complement(246941..247198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0217"
FT                   /product="Protein of unknown function DUF3567"
FT                   /note="PFAM: Protein of unknown function DUF3567; KEGG:
FT                   bpy:Bphyt_0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56221"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5U4"
FT                   /inference="protein motif:PFAM:PF12091"
FT                   /protein_id="ADN56221.1"
FT                   /translation="MQMIYNSPNYCVVEFPPQEGPLAMKSGGYEIVDKNMQREIYIDGA
FT                   MAARFRENVQKLIEEEPSLDEVDEFLGQFDSLMHQPVILH"
FT   gene            complement(247317..248105)
FT                   /locus_tag="BC1003_0218"
FT   CDS_pept        complement(247317..248105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0218"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_A4238
FT                   3-oxoadipate enol-lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56222"
FT                   /db_xref="GOA:E1T5U5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5U5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADN56222.1"
FT                   /translation="MQVNINGIETRYVLSNEGGGPWLTFIHQLGGDLSVWDQLAGYFRD
FT                   DYTVLRYDVRGHGETAASPAPFTIADLAGDLAALLDALGAPATHLVGMSMGGMIAQQFA
FT                   LAHPSRVNTLTIADSTAASLPEARATWDQRAAAARRDGMEPLVPATLERWLTPEFRAAH
FT                   PEAVEPIREALSRTLPEGYAKACEALRDFDVRSKLADIRCATLVVAGRHDTGTPPAASQ
FT                   AIADAIQGAQFELLDAAHLAPVEQSQRFAALLETFLERPV"
FT   gene            complement(248308..249585)
FT                   /locus_tag="BC1003_0219"
FT   CDS_pept        complement(248308..249585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56223"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5U6"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0480"
FT                   /protein_id="ADN56223.1"
FT                   /translation="MALPSTARATSLTPPDEPRLARRAWRWLAVLVVVGALHWIAAQWV
FT                   ERHRATLNPSDDEHVPVQVALLQPERIERDPAAAAAAPAQPERQRPRKAVASKPREHVL
FT                   SALRPAEQAAAASNAASQAAASVPAANAVPASAASGASANDTGSATGNATANAPQAASG
FT                   VKFSVPPSGDLQYDTFYNGVRNQPGTIHWTSSAESYEMVVSVPLPFVGTFVYSSHGRID
FT                   AFGLAPEQYVEKRGRRAEDVSIFNRADHKIAFTRTPTTLPLPDGAQDRFSMVMQLASLV
FT                   RGDPDAYKPGVTRQFFVVDSDSGENWPVETIGDETIRTAQGYVQTRHFKRLPRREGDLR
FT                   RIDVWLAPSLGWLPARLVQTEPNGTQFELVWRGKLNTEDGASAAAPAASPDGPANAPAS
FT                   TAPAEEASPGDTPGDTPGDTSGNIKP"
FT   gene            complement(249628..250539)
FT                   /locus_tag="BC1003_0220"
FT   CDS_pept        complement(249628..250539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0220"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: bxe:Bxe_A4236 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56224"
FT                   /db_xref="GOA:E1T5U7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5U7"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADN56224.1"
FT                   /translation="MPHTARSGASRNDAKADALADTKAAGPLDTAEADDDSADSGEEKL
FT                   RSGIQSIEVGFRLLEVLTHEPRAMMLRDLAQRAGMSPAKAHRYLVSFLRLGVVAQDALS
FT                   GRYELGGFALQLGLARLARVDGVKLARIALAELRDRLDLTVGIAVWGNQGPTMVHWMES
FT                   SHPAKASLKLGDVMPLLSSATGLLFAAYLPPGKTAAMIERELADTRRSSHGVVPRTREE
FT                   VERVLAQVREHEAARVEGMLLPTIHAFSMPVFDSTGELALGLVALGHEGVFDISWGGEI
FT                   DTALRECARKLSYELGYSPTPR"
FT   gene            250702..251685
FT                   /locus_tag="BC1003_0221"
FT   CDS_pept        250702..251685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0221"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bpy:Bphyt_0482 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56225"
FT                   /db_xref="GOA:E1T5U8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5U8"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADN56225.1"
FT                   /translation="MKLATLKDGTRDGQLIVVSRDLHTAAIADAIAPTLQRVLDDWAFY
FT                   APQLHDLYDALNQGRARNTFPFDASDCMAPLPRAFQWADGSSYVNHVELVRRARGAEIP
FT                   PEFWTDPLMYQGGSDDFIGPKDDVVCASEAFGIDFEAEVAVITGDVPMGATPDQALRSV
FT                   RLITLVNDVSLRNLIPAELAKGFGFFQSKPASSFAPVAVTPDELGEHWREGRVHRPMIV
FT                   HWNGRKVGQPDAGTDMVFHFGQLIAHAAKTRNLRAGAIVGSGTVSNKDAKRGYCCIAEK
FT                   RCLETIEHGAPQTEFMKYGDTVKIEMFDEAGKSIFGAIEQSIAPLD"
FT   gene            251801..253135
FT                   /locus_tag="BC1003_0222"
FT   CDS_pept        251801..253135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0222"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bpy:Bphyt_0483 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56226"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5U9"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADN56226.1"
FT                   /translation="MRRAESVGSERVSRANARAWRERLPQFGPQQFRPQFKPQFKLQIR
FT                   SQFTSRPAPRFTRLARAARGVATVCATLASLSPAIALAQVKIGLVLSLTGPAASLGIPA
FT                   RDTATMLPKQIGGQSVEYIVLDDASDTTQAVQDTKKLISENHVDAIIGSSITPNSLAMI
FT                   DVVSDGTTPMISLASSAKIIEPVDAKRRWVFKTPQTDAMMASAIAEHASTRGVKTVAFI
FT                   GQADALGETFYAEVAKFAQLHHMEMVASERFNRTDPSVTGQVLKILATRPDAVVVGAAG
FT                   TPAALPPKTLRERGYKGLIYHNHGVGNNDFLRVCGADCNGTFLPASPVLVAAQLPADHP
FT                   AKRLALDYIARFEALRGPGTVSAFGSYTWDAGMLLEHAVPVALKAASPGTPEFRRALRD
FT                   ALEATRGLADTNGVVNMSAADHLGLDQRARVMVEIRNGKWIYQPR"
FT   gene            253208..254059
FT                   /locus_tag="BC1003_0223"
FT   CDS_pept        253208..254059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0223"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bxe:Bxe_A4233 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56227"
FT                   /db_xref="GOA:E1T5V0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5V0"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADN56227.1"
FT                   /translation="MSQQPHSNDAFYAHYRSLQLHRRPHGVLEVVMSGEGANKSALATA
FT                   DARMHYELAEIWRDIDRDPETRVAVIRGEGKGFSAGGDLQLVEDMATDFDVRARVWREA
FT                   RDLVYNVINCSKPIVSAMHGPAVGAGLVAGLLADISIAAKTARIIDGHTRLGVAAGDHA
FT                   AIVWPLLCGMAKAKYYLMLCEPVSGAEAERIGLVSLAVDESDLLPKAFEVAQKLAQGSQ
FT                   TAIRWTKYALNNWLRSAGPAFDTSLALEFMGFAGPDVREGVNSLRERRAPDFGGADPWR
FT                   AR"
FT   gene            254175..255065
FT                   /locus_tag="BC1003_0224"
FT   CDS_pept        254175..255065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56228"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5V1"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0485"
FT                   /protein_id="ADN56228.1"
FT                   /translation="MTDTSDSPPPFSGFPGFPPAEMLDRMWSMMRLSPFGSAFGGAQPG
FT                   AGLAPSLSMMSDMMAPLTNVEELDKRITDMRAVEQWLKLNLSMLQSAIQALEVQRATLA
FT                   TLRAFGAFAQQSMTQPGATGQAPTPSPAPAPSSSPASGWPHAEASASAAASGPAAAESA
FT                   SAPESESDEQPASAAPAFDPTVWWNLLQSQFNQIAQFAMTQPMAGAADAATGGAQADSA
FT                   GNSADDAADLASEAVGGATDVPRPSPADAAAAAASREPAESAAKRPAAKRAPAAAKRTA
FT                   AGTGSPAPKPPKKSL"
FT   gene            255652..256524
FT                   /locus_tag="BC1003_0225"
FT   CDS_pept        255652..256524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56229"
FT                   /db_xref="GOA:E1T5V2"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5V2"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4230"
FT                   /protein_id="ADN56229.1"
FT                   /translation="MNTMLYPELYKSLESVRWDMEKDIPWDKFDPSLLTDEQAATIKMN
FT                   AITEWSALPATEMFLRDNHHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFKPEMCPTEEE
FT                   LHAVRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKHIYETISRDEARHGG
FT                   AYLRYMKKAMVQTGDIARAAFAKIGVLMASARRTEKPLHPTNLHVNQALFPRDTIQSRL
FT                   PDPEWLERWLDEQIRFDDGWEKKVVERILHNLSLLFERTFTTAQELNRYRKEVVARLQA
FT                   EQNSAGQPA"
FT   gene            256694..257176
FT                   /locus_tag="BC1003_0226"
FT   CDS_pept        256694..257176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0226"
FT                   /product="rfaE bifunctional protein"
FT                   /note="KEGG: bxe:Bxe_A4229 cytidyltransferase-related
FT                   protein; TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56230"
FT                   /db_xref="GOA:E1T5V3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5V3"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ADN56230.1"
FT                   /translation="MAATFERKILTRDALVALRPSLKAPVVFTNGVFDILHRGHVTYLA
FT                   DAKAEGACLIVGVNSDASVRMLGKGDDRPINNEADRMALLAALESVDYVVCFGEKTPVD
FT                   LISALRPDVLVKGGDYDMDALPESAIVRGWGGKALAIPFEHDRSTTALLRKVRTHG"
FT   gene            complement(257204..257443)
FT                   /locus_tag="BC1003_0227"
FT   CDS_pept        complement(257204..257443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56231"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5V4"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4228"
FT                   /protein_id="ADN56231.1"
FT                   /translation="MLRWLIAILFLANLLAFVAVRGVFGPTPTASGREPNHLSREVHAD
FT                   WLKVRPITAAEAGDQAVVGAPAPAAPIAASALPQ"
FT   sig_peptide     complement(257387..257443)
FT                   /locus_tag="BC1003_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.421 at
FT                   residue 19"
FT   gene            complement(257551..258552)
FT                   /locus_tag="BC1003_0228"
FT   CDS_pept        complement(257551..258552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0228"
FT                   /product="transcriptional activator, Baf family"
FT                   /note="KEGG: bxe:Bxe_A4227 pantothenate kinase; TIGRFAM:
FT                   transcriptional activator, Baf family; PFAM: Bvg accessory
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56232"
FT                   /db_xref="GOA:E1T5V5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5V5"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADN56232.1"
FT                   /translation="MTSGAPRLLIDAGNSRVKWAMVAANGTHLAAGALAHGESDSGEWA
FT                   AETTAQWASLPAPCSAWLSNVAGDAAAARIAALVHAQWPGVPLTTIRARERQCGVTNSY
FT                   TTPHALGSDRWAGMIGAHAAFPGEHLLIATFGTATTLEALRADGCFVGGLIAPGWSLMM
FT                   RSLGEHTAQLPTLDANAARGLLGRSGSGGHAGNGSPGGGVGAAGVTETGGNGTSGATDG
FT                   SERAGATAEPFGMRRAPGTGNPTEPAPRGPFFATDTRRSLSAGCTLAQAGFVERTWRDL
FT                   QDEWQVPVRLVVGGGAADEVAGALKVPHTRHDSLVLSGLALIASEQAADQGA"
FT   gene            complement(258549..259466)
FT                   /locus_tag="BC1003_0229"
FT   CDS_pept        complement(258549..259466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0229"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="KEGG: bxe:Bxe_A4226 biotin--protein ligase; TIGRFAM:
FT                   biotin/acetyl-CoA-carboxylase ligase; PFAM: biotin/lipoate
FT                   A/B protein ligase; biotin protein ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56233"
FT                   /db_xref="GOA:E1T5V6"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5V6"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ADN56233.1"
FT                   /translation="MNASRTPPQAPATGAQAADWRIDRERAVTLFGAHAHDWPIEIVEE
FT                   TGSTNADLMARVKALPRRAGALPRPIVRVAYLQTAGRGRRGRPWYAEPGNALLFSVACV
FT                   LPRPLEGLAGLSLAVGVALVDGLRSLPVAGPGQIALKWPNDVLLEGDKLAGILIETAWS
FT                   TEHASAVVIGIGTNVKGADELAAKIGALTADAPPQARGTAPTALQRALPNANLTDTLAA
FT                   ELNALEPALQRFGAEGFAPFQARWNAMHAYAGREVVLLEQGEEVTRGVAAGVDERGQLL
FT                   LDTAAGRQSVATGDVSLRLADGAA"
FT   gene            259537..260706
FT                   /locus_tag="BC1003_0230"
FT   CDS_pept        259537..260706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0230"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   bpy:Bphyt_0491 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56234"
FT                   /db_xref="GOA:E1T5V7"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5V7"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ADN56234.1"
FT                   /translation="MAANPITRLQRSLNYDTPPGLEVAAGSQGKIVRLSGQWTALALAR
FT                   DRATGHVIPQLRSLEGAEGIGQWDLSRIDRMDHVGGQALWRVWGHRMPPDTELTATQRD
FT                   IFERIALLDTVRETAEPVVRFDPLTRLGLGIFSFFEHLYGGVAMLGRVVLDLLAIARKP
FT                   AITPWTEISANIYNAGTRALPITALVAFLIGIVLSYLSAQQLRLFGANQYIVNILGLSV
FT                   IRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVVALGVA
FT                   MPLLVMWTNIIALTGGAVAAKIVLGIDMSYFARALPGVVPVANLWIGLGKGVAFGMLIA
FT                   IVGCHFGFRIKANSQSLGEGTTTSVVTSITIVILADAVFAILFQNVGLG"
FT   gene            260703..261581
FT                   /locus_tag="BC1003_0231"
FT   CDS_pept        260703..261581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0231"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bpy:Bphyt_0492 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56235"
FT                   /db_xref="GOA:E1T5V8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5V8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADN56235.1"
FT                   /translation="MIAPLTQAVRGQPMPSIAEPVIEVIDVTKRYGRHIVHQHLNLDVR
FT                   RGEIVSIVGSSGAGKTTLVRQILGLERPSSGTIKLFGEDLATISPETALLMRSRSGMLF
FT                   QRGALFSSLSVFDNVAQPVRELGKVPEDLLRDIVMLKLEMVGLPCKHASKMPSALSGGM
FT                   IKRVGIARAIALEPELLFLDEPTAGLDPQASDEFVELISALHRALGLTVVMVTHDLDTM
FT                   VALSTRVAVLADRKVLVAAPVEEAAGVDHPFIREYFLGLRGRRALQALPPERRAKLPHA
FT                   ALEPASSALSL"
FT   gene            261611..262573
FT                   /locus_tag="BC1003_0232"
FT   CDS_pept        261611..262573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0232"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bxe:Bxe_A4223 ABC transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56236"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5V9"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADN56236.1"
FT                   /translation="MENKSHAFWAGLFTIVLLAAIATAAFLFNVDRAVRVPYDLIARTN
FT                   VTGLFSDAAVRYRGLDVGKVQSIKFDRDHPGQIVIRILVDTHAPITHSTYGSLGFQGVT
FT                   GIAFIQLDDTGHDPSPLPSSAKQVAQLPMRPGLLDQLQQRGDVLLKKLERVTDDVDNLL
FT                   SKDMVDQLHGTAASIQKAADGVATLTQQMAPAAGKLPATIDKLDSTLASTNQLITSLNR
FT                   PDGPFESNLNKVGTAAQQAGDALTAMNGSLQELSARVGYDTLPRVNSLAEDVRSAARSV
FT                   DRAADTFSTSPRSVLFGAPAAAPGPGEAGFTWPAPHAAK"
FT   sig_peptide     261611..261685
FT                   /locus_tag="BC1003_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.539 at
FT                   residue 25"
FT   gene            262618..263259
FT                   /locus_tag="BC1003_0233"
FT   CDS_pept        262618..263259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0233"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   bpy:Bphyt_0494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56237"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5W0"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ADN56237.1"
FT                   /translation="MSRSIRRLLSSRVTRASAACAALAAVGVLVAGCTSTPAALSDIRY
FT                   DFGPPKPATPAGMQPTVKVLDVSAPEALQSDKLVYRLGYADSQQVAAYANSHWTMPPSV
FT                   LLTQRLRGALSSRGTVLTGADGVAAPVLKIDLSEFEQVFDSQSQSHAAVTARATLMQNG
FT                   KLIGQRTFISRAPSRSADAAGGAQALAAASDDLVAQIGAWLGVQALVAAQ"
FT   sig_peptide     262618..262743
FT                   /locus_tag="BC1003_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.543 at
FT                   residue 42"
FT   gene            263291..264448
FT                   /locus_tag="BC1003_0234"
FT   CDS_pept        263291..264448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0234"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: bxe:Bxe_A4221
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56238"
FT                   /db_xref="GOA:E1T5W1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5W1"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ADN56238.1"
FT                   /translation="MSERSWLRRPSVLSRQALLLYTALIVYGSWYPFMGWRSLGLGPLA
FT                   FLSDPMPQYLTAFDVVTNVLGYMPFGALMVLALYPRWRGPLAVALAFVLGGLLSGLMEA
FT                   VQTYLPTRVASNLDLAANALGALLGAAIMSPATGALLDRGLLRRLRLMWFERDSAALAC
FT                   LVAAWPFATMYPSPRLLGLGNWPRALWARFDSTTQDALFSWAPAVWHVGAWPAWVAAWL
FT                   PEDAWEALITTLNLFAALALASLSVRRHAPRVRLLLLFSVATLGVKAGATFLQSQSGLA
FT                   FDWATPGGLAGLGCGALLGLAALRLRRSARAALAAAALVVTLVLVNLLPVNPYFDVVLA
FT                   DWRQGRYLHFNGLARWLAWVWPYAALVWLAFVVERVWLGRRTRRA"
FT   gene            264564..264887
FT                   /locus_tag="BC1003_0235"
FT   CDS_pept        264564..264887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0235"
FT                   /product="Sucraseferredoxin family protein"
FT                   /note="PFAM: Sucraseferredoxin family protein; KEGG:
FT                   bxe:Bxe_A4220 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56239"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5W2"
FT                   /inference="protein motif:PFAM:PF06999"
FT                   /protein_id="ADN56239.1"
FT                   /translation="MDSFYKYHVFFCLNQREPGAERPSCANCNAQAMQEHAKKRVKKLG
FT                   LAGPGQVRINKAGCLDRCELGPALVVYPEGVWYTYVDESDIDEIVDSHLANGKIVERLK
FT                   IDQ"
FT   gene            264896..265540
FT                   /locus_tag="BC1003_0236"
FT   CDS_pept        264896..265540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56240"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5W3"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0497"
FT                   /protein_id="ADN56240.1"
FT                   /translation="MNVHTKKYLIDGPVGKIEVALDLPDEARENGAAPRGIALVAHPHP
FT                   LFGGTMDNKVAQTLARTLVQLNYITYRSNFRGVGQTQGEHDAGIGERDDLRAVLDHMRA
FT                   QPGQGELPLVLAGFSFGTFVLSHVAAKLRDEGGQIERMVFVGTAASRWEVAPVPENTLV
FT                   IHGETDDTVPIQSVYDWARPQELPVVVIPGAEHFLHRKLHILKRIIVDAWR"
FT   gene            265876..267105
FT                   /locus_tag="BC1003_0237"
FT   CDS_pept        265876..267105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0237"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: bpy:Bphyt_0498 serine-type D-Ala-D-Ala
FT                   carboxypeptidase; PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56241"
FT                   /db_xref="GOA:E1T5W4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5W4"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ADN56241.1"
FT                   /translation="MRFSTSGRLSFPSVASLVPSTLSRAIALGVVLPATLVSSAAFAQV
FT                   PPPAVNARSWVLVDATSNQVLASGNPDERVEPASLTKLMTAYLVFEALQTKKITMDQTV
FT                   TPGEAVRRVRTDESRMFIEANKPVTVHDLVYGMIVQSGNDAAIALAELVGGSEAQFVNM
FT                   MNTEAQRLGMTHTHFADVNGMPDPQHYTTAGDLAVLSARLIRDFPDYYNIFSVKEFTYN
FT                   KIKQPNRNRLLWIDPTVDGLKTGHTQAAGYCLIASAKRSLPGTPDASRRLVSVMMGETK
FT                   EHDRVQDSLKMLNYGYSAYDTVRLYKASQVVGTPRVYKGSQDTVQIGVKSDQYITVPKG
FT                   MADKVKPQIEQIDPLIAPIANGQQVGTAKLVADGKVLAQFPVVALQAVPQAGIVGRVWD
FT                   SLMLMFNKKK"
FT   sig_peptide     265876..266007
FT                   /locus_tag="BC1003_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.996 at
FT                   residue 44"
FT   gene            267118..268041
FT                   /locus_tag="BC1003_0238"
FT   CDS_pept        267118..268041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0238"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG:
FT                   bpy:Bphyt_0499 aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56242"
FT                   /db_xref="GOA:E1T5W5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5W5"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADN56242.1"
FT                   /translation="MTALSDVSLEPIVYLNGEVVPLSEARVPVLDRGFIFGDGIYEVAP
FT                   LYAHAGGRTAFRFEQHLARLARSLDKIGIANPLDNAGWRALIERVCAANEAQAGLAADQ
FT                   DAIAYIQVTRGVAKRAHAFPAGVQPTVFVMVTPLNLPNAAQRAQGVRCMSAEDRRWLHC
FT                   DIKSVSLLGNVLMAQYAAENDAFETIQFRDGLLTEGSSSNVWVVKDGVLAAPPRSHKIL
FT                   EGIRYGLIEELAAECGIRFEVREIAEAEVRAADEIVISSATKEVLPVTRLDDQPVGDGK
FT                   PGAVFAALYAAYQRAKAREAQAANQA"
FT   gene            268064..268333
FT                   /locus_tag="BC1003_0239"
FT   CDS_pept        268064..268333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0239"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   bpy:Bphyt_0500 protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56243"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5W6"
FT                   /inference="protein motif:PFAM:PF04359"
FT                   /protein_id="ADN56243.1"
FT                   /translation="MNPADESLIEYPCDFPIKIMGKSHPEFAETIVTVVRQFDSEVDAS
FT                   RVESRPSSGGNYTGLTVTVRATSRAQLDDIYRALTGHPMVKVVL"
FT   gene            complement(268352..269395)
FT                   /locus_tag="BC1003_0240"
FT   CDS_pept        complement(268352..269395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0240"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_A4215 DNA-binding transcriptional
FT                   activator GcvA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56244"
FT                   /db_xref="GOA:E1T5W7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5W7"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN56244.1"
FT                   /translation="MELRHLPPLNAIKAFEAAARHESFSRAADELFVTHGAVSHQIRAL
FT                   EAELGVALFARDGKRVRLTETGRRYANQVRAALAALCDATRELRAGDRERRLVVSMLSS
FT                   FAARWVTPRVGSFIEAHPQWDLELLSTNALTDFARDDVDVAIRFGYGKYAGLHSELLLE
FT                   EIFFPACAPTFNGGKLPATPAELAHLPLLRSDDELWRPWFDAAGLTDWTEPKRGVLYQD
FT                   SSNLLQAAIDGQGIALTRRSLAMHEIAAGRLVRLFNVDGPSPWQYYFICPPHMLETAKV
FT                   KAFRDWVFAEVGRFKQLFERACEAGPAAGSAGSAAGSTSSSTSPAKVNAAGAASPGSTA
FT                   HALRAAP"
FT   gene            269494..269820
FT                   /locus_tag="BC1003_0241"
FT   CDS_pept        269494..269820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56245"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5W8"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0502"
FT                   /protein_id="ADN56245.1"
FT                   /translation="MREVSSSIAYEIRSGETLPLKVARSTKLVVRGGAVWVTRSDDTED
FT                   YWLQPGQTMRLRRGERLWLSAEGTPRATVAFSVPTRCDERALNWFARMGERFGAWLRGG
FT                   WRTV"
FT   gene            269940..270665
FT                   /locus_tag="BC1003_0242"
FT   CDS_pept        269940..270665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0242"
FT                   /product="lipoate-protein ligase B"
FT                   /EC_number="2.3.1.181"
FT                   /note="TIGRFAM: lipoate-protein ligase B; KEGG:
FT                   bxe:Bxe_A4213 lipoyltransferase; PFAM: biotin/lipoate A/B
FT                   protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56246"
FT                   /db_xref="GOA:E1T5W9"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5W9"
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /protein_id="ADN56246.1"
FT                   /translation="MSASAVSPSPLPAAAPLELRWRGSEPYEASFEAMRAFTDARTAAT
FT                   PDEIWLVEHPPVFTLGQAGDPAHLLAADSGIPLVKVDRGGQITYHGPGQVVAYLLLDLR
FT                   RRKLMVREMVTRIEQAVIDTLAAYNLAGERKAGAPGIYVSAGPQAGLHAGAKIAALGLK
FT                   IRNGCSYHGVSLNVNMDLRPFLAINPCGYAGLETVDMATLGVAAGWDDVARTLAECLTA
FT                   NLDGSPAAVAQPQAGALTA"
FT   gene            270679..271686
FT                   /locus_tag="BC1003_0243"
FT   CDS_pept        270679..271686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0243"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.8"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; TIGRFAM:
FT                   lipoic acid synthetase; KEGG: bpy:Bphyt_0504 lipoyl
FT                   synthase; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56247"
FT                   /db_xref="GOA:E1T5X0"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5X0"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ADN56247.1"
FT                   /translation="MTDVTANLAASPAPEGVPASAAAYDATAKQKAQAKTARIPIKIVP
FT                   IEKLKKPDWIRVKAATGNSRFYEIKQILREHNLHTVCEEASCPNIGECFGKGTATFMIM
FT                   GDKCTRRCPFCDVGHGRPDPLDPEEPANLARTIAALKLKYVVITSVDRDDLRDGGAAHF
FT                   VECIRQTRELSPDTRIEILTPDFRGRLDRALGILNAAPPDVMNHNLETVPRLYKEARPG
FT                   SDYAHSLKLLKDFKALHPDVATKSGLMVGLGETEEEILQVMRDLREHDVDMLTIGQYLQ
FT                   PSEHHLPVRSYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV"
FT   gene            complement(271891..272640)
FT                   /locus_tag="BC1003_0244"
FT   CDS_pept        complement(271891..272640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0244"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); KEGG: bxe:Bxe_A4206 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56248"
FT                   /db_xref="GOA:E1T5X1"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5X1"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ADN56248.1"
FT                   /translation="MQRLANPLAFDHKDNWMSRNLALFDLDHTLLPLDSDQAWAHFVAG
FT                   LGIEGAARHAQDIDEYYRQYVAGTLDMAAYLDRTLAPLARHTREQLDAWHARFMREVIA
FT                   PAILPAARELVRRHMDAGDLCCIVTATNVFVTAPIGKALGFEHLLGIELDTEGGDPLAR
FT                   YTGAAVGVPTFREGKITRTESWLASLGHRLEDFPQSWFYSDSINDVPLLERVTHPVATN
FT                   PDARLRALANERGWPVIELFCEARGGL"
FT   gene            272892..274559
FT                   /locus_tag="BC1003_0245"
FT   CDS_pept        272892..274559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0245"
FT                   /product="sodium-dependent inorganic phosphate (Pi)
FT                   transporter"
FT                   /note="KEGG: bxe:Bxe_A4205 Na+/phosphate symporter;
FT                   TIGRFAM: sodium-dependent inorganic phosphate (Pi)
FT                   transporter; Na/Pi-cotransporter II-related protein; PFAM:
FT                   Na+/Picotransporter; PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56249"
FT                   /db_xref="GOA:E1T5X2"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5X2"
FT                   /inference="protein motif:TFAM:TIGR01013"
FT                   /protein_id="ADN56249.1"
FT                   /translation="MLILLNLLASVALLVWGSHIVRTGILRVLGADLRSVLGRSTRNRW
FT                   RAFVSGVGVTSLVQSSNATAVILTSFAAQGLLPLTSGLAIMLGADVGTALMARVLTLDL
FT                   SWLSPLLILFGVPLFLSRKQTRVGQAGRTLIGLGLILLALHLIVEAAQPMMQGAGVRVM
FT                   FGALTGDTMLDALVGAAFAILSYSSLAAVLLAATLASSGVISLKVALCLVIGANLGSGL
FT                   VALLGAAAQNAAARRLALGSFTFKLAGALLILPFASLLASWLPVLIANPREATVGFHLI
FT                   YNTLRCGVCLSLIDPMARICERVLRDRPMPNGELRPLHLDSAALSTPTLALANAAREVL
FT                   RIGDIVRTMLDNVAELIHHNHLDKARETVRMDDDVDELYAAVKNYLTLISREQLDEADS
FT                   RRWTDIISLTINLEHAGDIIERIVGNIEEKKIAHRLSFSEEGLGELDDLQARLVSNLQL
FT                   GLSVFLNNDLRCAERLLAEKERFRDLERAYSYRHLDRLAGQTLRSIETSALHLDLISDM
FT                   KRLNSLFCSTAYPVLDAAGALHDTRLRKRALDTMHVKE"
FT   gene            complement(274615..275385)
FT                   /locus_tag="BC1003_0246"
FT   CDS_pept        complement(274615..275385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0246"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: bpy:Bphyt_0512 transcriptional regulator, DeoR
FT                   family; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56250"
FT                   /db_xref="GOA:E1T5X3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5X3"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADN56250.1"
FT                   /translation="MWQEDRHQRIRALLSTLHRVSTERIMADLGVSRETVRRDLLDLEA
FT                   LGELRRVHGGAIRPADEAPIAERAQMRVKSKTAIAKAATGLIASGQTLFIDAGTTTAAL
FT                   AEELAKLANLTIVTNSIDVALKLRGATEQTEAANEVILLGGTISDRAMATTGATTVLDI
FT                   QRYRADLALLSPVGVDHRHGATNYDHAETEVARAMVANADRVAILADYSKIGQRSRISY
FT                   CPVERIDVLVTNKRAADAADFTALKKKLDEVVLA"
FT   gene            275693..276457
FT                   /locus_tag="BC1003_0247"
FT   CDS_pept        275693..276457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0247"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: bxe:Bxe_A4202 cytoplasmic glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56251"
FT                   /db_xref="GOA:E1T5X4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5X4"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADN56251.1"
FT                   /translation="MANGIDRATPADWPYPRLVAHRCGGTLAPENTLAGFDACVRYGYR
FT                   MVEFDAKLSSDNQLFLLHDDTLERTTNGYGAAAVYSWAQLALLDAGAWYGPQFAGTRLP
FT                   TLADAAARCAREGIAANIEIKPCPGRDEITGRLVASAALELWQGQTPPLLSSFSFEALA
FT                   AARDAAPSLRRGMLFEEVPADWLRIVRELDCVSLHASHRYLTEPLVAEIRAAGLHVLAY
FT                   TVNDPARAQLLAQWGVDMICTDRIDKLQHDML"
FT   gene            276637..277749
FT                   /locus_tag="BC1003_0248"
FT   CDS_pept        276637..277749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0248"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bpy:Bphyt_0514 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56252"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5X5"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADN56252.1"
FT                   /translation="MNRTVLARVLSMSAAAGVAAAGASGASAAPLDALIAAAKQEGQLT
FT                   VIALPHDWCNYGQLVAGFQKKYGIKINELNPDAGSGDEVEAIKANKGNKGPQAPDVIDV
FT                   GLSFGPTAKAEGLLQPYKVSTWNSIPKESKDPDGYWYGDYYGVLAFEVNADMIDKAPAD
FT                   WSDLLKSDYKNAVSLAGDPRSANQAIQAVYAAGLSQSKGDASKADKAGLKFFADLNKSG
FT                   NFVPVIGKAASLAQGTTPIVVRWDYNALADRDTLKGNPKVQVVIPKTGVLAGVYVQAIS
FT                   AYAPHPNAAKLWMEYLYSDEGQIGWLTGYCHPMRYNELVAAKKVPQALLDKLPPPSSYK
FT                   NVVFPTLQQQDAYKETITKHWDEVVGANVK"
FT   sig_peptide     276637..276723
FT                   /locus_tag="BC1003_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 29"
FT   gene            277849..278784
FT                   /locus_tag="BC1003_0249"
FT   CDS_pept        277849..278784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0249"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bpy:Bphyt_0515
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56253"
FT                   /db_xref="GOA:E1T5X6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5X6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADN56253.1"
FT                   /translation="MSASSDAGSVQPDLPLPVPTPAPRVDGPGRASQMLAWIGVVPFFT
FT                   FALLFLILPTGFLMVGAFQDAQGHFTLANLRDLLQPSVLDAYWISFKVSAASAAGGALI
FT                   GSLLAWAAVQGKLPRWIRPTLMTFSGVASNFAGVPLAFAFICTLGRVGLVTVLLKKYLG
FT                   FNLYSTGFSILSFSGLTLTYLYFQIPLMVLIVTPALDGLKREWREACDCLGGSAFQYWR
FT                   YVALPVLWPSVLGATLLLFANAFGAVATAYALTGSSLNIVPILLFAQIRGDVMHNQNLG
FT                   YALALGMVLVTGLSNGGYIWLRSRAERGRR"
FT   gene            278781..279572
FT                   /locus_tag="BC1003_0250"
FT   CDS_pept        278781..279572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0250"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bpy:Bphyt_0516
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56254"
FT                   /db_xref="GOA:E1T5X7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5X7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADN56254.1"
FT                   /translation="MKSQSRVGAWTATVIGSLYFLIPLIATFEFSLRMKRGTYSFEAYS
FT                   VVLSDPRFQASFGYSILMALLTIVVGILLVVPTAYWVQLRLPKLRPVVEFITLLPLVVP
FT                   AIVIVFGYLRIYNSSSILPLTSNERATDLLLVFGYVTLALPYMYRAVDAGLRAVDVRSL
FT                   TEAAECLGANWPTILFRVIFPNIRSGILSGAFLTFAVVIGEFTLASLLDRPAFGPYLQL
FT                   IGANRAYEPSALAIIAFMITWASMGLIQVFGSARAAAGQKL"
FT   gene            279619..280689
FT                   /locus_tag="BC1003_0251"
FT   CDS_pept        279619..280689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0251"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; KEGG:
FT                   bxe:Bxe_A4198 ABC spermidine/putrescine transporter, ATPase
FT                   subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56255"
FT                   /db_xref="GOA:E1T5X8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5X8"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ADN56255.1"
FT                   /translation="MAFLEIENLHKSFGANIALHHFDMKIERGEFITFLGPSGCGKTTV
FT                   LRMIAGFETPTRGAIRLDNKDVTHLRTRQRKVGMVFQSYALFPNMTVAENIGFGLKITH
FT                   RPQAEINQRVEEMLHLIKLPQMGGRYPWQLSGGQQQRVALARALAGKPQVLLLDEPLSA
FT                   LDAKIRISLRQDIRALQRELGITSIFVTHDQEEALSISDRIVVMNEGRVEQIGSPSEIY
FT                   NYPRTRFVASFVGTLNILAGHVVDPATGRMAVDGQELITTQELPAGDAGKKRLLALRPE
FT                   AIVLEPAAPGRNTLNATVEEVNFLGAVVRIRTRVKDAVISLDVFNDPNRGLPERGQPVS
FT                   LGFSHENLLVLEEGNA"
FT   gene            281012..282343
FT                   /locus_tag="BC1003_0252"
FT   CDS_pept        281012..282343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0252"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bph:Bphy_0225 C4-dicarboxylate transporter DctA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56256"
FT                   /db_xref="GOA:E1T5X9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5X9"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ADN56256.1"
FT                   /translation="MMRSVAGHELTHIAGNIVKKPIHKVLYVQVIVAIIIGIALGHYYP
FT                   TLAVDMKPLGDAFIKLIKMVIGPIIFCTVVTGIAGMEDMKKVGRVGGKALLYFEVVSTF
FT                   ALLLGLAATHLLRPGVGFNVDPATLNGKEVASYAAKAHGQTTVDFLMHIIPDTLVSAFS
FT                   QGEILQILLIALLFGAVLAHVGDRGKPVTSFIESLSSILFGMVGIITKLAPIGAFGAMA
FT                   FTIGKYGIGSLLPMLKLIGTFYLTSIVFVVVVLGLIARAVGFNVLRFIAYIKEEMLIVL
FT                   GTSSSEAALPQLMLKLEKLGCSRSVVGLVVPTGYSFNLDGTNIYMTMAVLFIAQATNTD
FT                   LTWTQQLTLLAVTMLTSKGASGVTGAGFITLAATLAVVPTIPLSGMVLILGIDRFMSEC
FT                   RALTNIVGNGVATVVVSAWEKELDRSKLNAALRGDVPLKEPAGV"
FT   gene            282405..284405
FT                   /locus_tag="BC1003_0253"
FT   CDS_pept        282405..284405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0253"
FT                   /product="histidine kinase"
FT                   /note="KEGG: bxe:Bxe_A4196 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56257"
FT                   /db_xref="GOA:E1T5Y0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Y0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN56257.1"
FT                   /translation="MQPVTARPTPVPSADEARAEGASPYATISDHTRPDIANVTRRLLI
FT                   LFALVAGLVAACGLTYSVAWQSGIDSLRLNAAGRVDRTTSSLKSTLERYESLPYLLAEH
FT                   PIVQDVLVDPSPANVKRANLYLEDLNRHARATVTYIIPLNGYCVAASNWQGPGSFIGAG
FT                   YHFRPYFVDAIKGGVGRFFGIGTISQAPGYYISQPVRRDGKIVGVAVVKLDLEWFQGAD
FT                   AFEPLVVTDDHGVIFLSSVPAWKYHTIRPLSGQVADSIYQARQYAQQPIEPLPVTIERK
FT                   LEGDAQIVRVGGGRYAPRYLASRRGMGEPDWHLITMAPVSPVDADARNATIVTGFGYVS
FT                   LVLLAFYWRMRRARVREVMRSRALLQKAYAELNQRVAERTADLSQANEQLQKEVSERTR
FT                   AEQELRAAHDELIQASKLAALGQMAAGITHELNQPLAALRGFSDNTRVLLERGDQASAR
FT                   ENLEAIAALTERMGKITNQLKLFVGRARPRSARAPAVRALRNAVALLQKRLQGVELELA
FT                   LFDVESGTRSPLDLAGDHPDLIAHCDDLRLEQVLINLLGNALDATAGMAAPRISVLIEV
FT                   TAGSLSFAVGDNGPGIPEDVLPRLFEPFFTTKEMGQGLGLGLAISSSIARDCGGTLVAR
FT                   NAPQGGALFVLTLRRPRMQTSHTADPLTTGS"
FT   gene            284422..285774
FT                   /locus_tag="BC1003_0254"
FT   CDS_pept        284422..285774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0254"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: bpy:Bphyt_0520 two component, sigma54
FT                   specific, transcriptional regulator, fis family; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   response regulator receiver; helix-turn-helix Fis-type;
FT                   SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56258"
FT                   /db_xref="GOA:E1T5Y1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Y1"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADN56258.1"
FT                   /translation="MLNDGLQVLYIEDDELVRRASVQSLQLAGFDVVGHASAESAAKSI
FT                   SADFCGVIVSDIRLPGASGLELLAQCHERAPDVPVILVTGHGDISMAVQAMRDGAYDFI
FT                   EKPFASERLIETVRRALERRKLVLENHALRRELAGQNTVAPRIIGRSPAIEQVRRLIAN
FT                   IAPTDASVLINGDTGAGKELIARSLHELSPRRDKPFIAVNCGALPEPMFESEMFGYEPG
FT                   AFTGAARRRIGKLEHASGGTLFLDEIESMPLALQVKLLRVLQDGVLERLGSNQPIRVNC
FT                   RVVAAAKGDMAERVADGSFRRDLLYRLNVVTIALPPLGERREDIVPLFEHFLLDAAVRY
FT                   QRPAPMLTDRQRASLMQRDWPGNVRELRNAADRFVLGVVDDPVTSFGDEGSEPQPLKER
FT                   VEQFERAVIAEALEQCGGAVALAADRLQLGKATLYEKIKRYGLAAKGDAER"
FT   gene            complement(285898..286431)
FT                   /locus_tag="BC1003_0255"
FT   CDS_pept        complement(285898..286431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0255"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: bpy:Bphyt_0521
FT                   redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56259"
FT                   /db_xref="GOA:E1T5Y2"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Y2"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ADN56259.1"
FT                   /translation="MSSITSTSAVTRTNPLRYLIIAAVAVAIGVAGYFAFAGQQRVPDA
FT                   TFTLLSGQKVTTADLKGKVYLVNFWATSCDTCMKEMPQMVQTYNRFKGKGLEFVAVAMS
FT                   YDAPMYVTNYTQTRQLPFKVAMDDGSAAKQFGNVQLTPTTFLVDKDGKILKRYVGEPQF
FT                   AELDQLLEKALNAA"
FT   sig_peptide     complement(286318..286431)
FT                   /locus_tag="BC1003_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.791 at
FT                   residue 38"
FT   gene            286767..287465
FT                   /locus_tag="BC1003_0256"
FT   CDS_pept        286767..287465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56260"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Y3"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4193"
FT                   /protein_id="ADN56260.1"
FT                   /translation="MLMSSDPLYRHHCPMLQIFFRFFPLLSKSASRFFFPFAAGRNAGN
FT                   RTLPNRARLRSPVRMAACALAVGVALGACSPTFDWRTIMNNDNGYTIDLPAKPGNDQRA
FT                   VQVDGTPMQMAMQTAEAGDAVFAVGTLMLPDESEATQRKALEFLRTGLARNVGVAPDAH
FT                   AVQIPLAAGGKVLGLEMKLTGEAGSAHETRTVYARLVARGRHAYQAAIIASKPLAPEQV
FT                   EQFFSSFKLY"
FT   gene            complement(287798..289540)
FT                   /locus_tag="BC1003_0257"
FT   CDS_pept        complement(287798..289540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0257"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: bpy:Bphyt_0523 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56261"
FT                   /db_xref="GOA:E1T5Y4"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Y4"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADN56261.1"
FT                   /translation="MSLAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRES
FT                   RERVRAALQNCNFDFPVRRITVNLAPADLPKESGRFDLPIALGILAASGQIPAESLLDR
FT                   EFAGELSLTGALRPMRGAFAMACGTARAAATGTGAGGASGAGNAAVGTGAGAGAGAGAG
FT                   AGAGAGAGAGAGNPDLGASVTSGSSAILATTAADATAGQASHKRTPQLYLPAASAAEAA
FT                   LVPGVDVYGATDLPSLCAHLANAPDARLYPVAAPDLALSTPAVMPDMGDVIGQRGARRA
FT                   LEVAAAGGHHVLLIGPPGAGKSMLAARLPGLLPPMTDDEALCSAALLSASRAGFTPAQW
FT                   RQRPFRAPHHSSSAAALVGGRNPPQPGEITLAHLGVLFLDELPEFDRDVLETLREPLEA
FT                   GRITISRAALQADFPAACQLIAAMNPCPCGWRGDPNGRCRCTPEVAARYLRKLSGPLLD
FT                   RIDIQLEVPALTSAELSARANTAGETSEVIARRVLAARERQLARQGKTNRELNGREVDE
FT                   VCRLDSAGEALLREAGERFGWSARAYYRVLKVARTIADLAGAHMPSAAQVGEAVQYRRA
FT                   FGSG"
FT   gene            complement(289664..289921)
FT                   /locus_tag="BC1003_0258"
FT   CDS_pept        complement(289664..289921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0258"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   bpy:Bphyt_0524 protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56262"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Y5"
FT                   /inference="protein motif:PFAM:PF04380"
FT                   /protein_id="ADN56262.1"
FT                   /translation="MKQPNDVFNDIQARMSELFKNSPAKDVERNVKAMLSQGFSKLDLV
FT                   TREEFDTQTQVLVRTRARLEELERRVAELEQKLPVTSQAV"
FT   gene            290518..290856
FT                   /locus_tag="BC1003_0259"
FT   CDS_pept        290518..290856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0259"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bpy:Bphyt_0525 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56263"
FT                   /db_xref="GOA:E1T5Y6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Y6"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADN56263.1"
FT                   /translation="MKLITAIIKPFKLDEAREALSAIGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVSDDIVDQAIEALERAARTGKIGDGKIFVTPIEQVIRIRT
FT                   GETGADAL"
FT   gene            290901..292370
FT                   /locus_tag="BC1003_0260"
FT   CDS_pept        290901..292370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0260"
FT                   /product="ammonium transporter"
FT                   /note="KEGG: bpy:Bphyt_0526 ammonium transporter; TIGRFAM:
FT                   ammonium transporter; PFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56264"
FT                   /db_xref="GOA:E1T5Y7"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Y7"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADN56264.1"
FT                   /translation="MRKLLMSLLMAGSLLAGGIGAALADDASAPVAASAAASDAAASAP
FT                   AADASAAPAASAPAAAAPAASAAAAAAPAAPTAPFSVDSSKINSGDTAWMLTSTALVLF
FT                   MTIPGLALFYGGMVRKKNVLATLMQSFAITCLVTIIWAVVGYTLAFTPGGSFIGGFSRF
FT                   FMSGMNYIKGDTTTLTVSHLAPTIPESVYFVYQMTFAIITPALITGAFADRMKFSAMLV
FT                   FMTLWSIIVYSPVAHMVWEPTGWLASAGVLDFAGGTVVHINAGIAGLVCCLVLGKRVGY
FT                   GKEAMAPHNLTLTLIGGAMLWVGWFGFNAGSAVAADGRAGFAMFATQVATAAAALAWMF
FT                   AEWAAKGKPSVLGIVSGAVAGLVAITPASGFVGMTGSLVIGIVAGVVCFWSATWLKHKL
FT                   GYDDSLDAFGVHCIGGIVGALLTGVFAVKDIGGFDGSVVLQAKGVLTTLIYSGVVSFIL
FT                   LKIIDMVMGIRVTEEEEREGLDVSLHGEHVE"
FT   sig_peptide     290901..290975
FT                   /locus_tag="BC1003_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            292693..293982
FT                   /locus_tag="BC1003_0261"
FT   CDS_pept        292693..293982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0261"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="KEGG: bpy:Bphyt_0527 glutamate/cysteine ligase;
FT                   TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56265"
FT                   /db_xref="GOA:E1T5Y8"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Y8"
FT                   /inference="protein motif:TFAM:TIGR02049"
FT                   /protein_id="ADN56265.1"
FT                   /translation="MVPHLVTALNGPLLDLERKILDATPAIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDTNLFPGAFNNLPQEVLPLAVQAAMASIEKICPDAKNLLVIPERHT
FT                   RNAFYLENVARLAAIMRQAGLNVRFGTLDESINGPVTIALSDGQKLVLEPLERSQRRLG
FT                   LKNFDPCSILLNNDLSGGIPPVLENLHEQYLLPPLHAGWAVRRKSTHFSCYDDVAKKFA
FT                   KMVEIDPWMINPYFAHVEGVDFQERTGEEALAEAIDGVLKKIAKKYREYGISEKPYVVI
FT                   KSDAGTYGMGVMTVHDASEVAALTKRERAKMAATKDGLEVHDVIVQEGVYTFERIGEEV
FT                   AEPVVYMIDRYVVGGFYRVHGSRERDQNLNAPGMHFVPLGFEHTALPDAHAKPGAAPPN
FT                   RFYMYGVVARLGLLAASVELEKTDPEAIQV"
FT   gene            294079..295035
FT                   /locus_tag="BC1003_0262"
FT   CDS_pept        294079..295035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0262"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutathione synthetase; KEGG:
FT                   bpy:Bphyt_0528 glutathione synthetase; PFAM: glutathione
FT                   synthetase ATP-binding; glutathione synthetase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56266"
FT                   /db_xref="GOA:E1T5Y9"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Y9"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ADN56266.1"
FT                   /translation="MDILFIADPLTQFKIYKDSTYAMMAEAARRGHTLYACEPKHLAWT
FT                   GGDVEANVRRFAITGDVTDLHRDEWYAAESAAPRALKSFSAVVMRKDPPFDMEYVTSTW
FT                   LLELAERAGARIFNKPQAIRDHSEKLAIGEFAQFVAPTLVTRDPARLRAFHEQHGDVIL
FT                   KPLDGMGGMGVFRVKADGMNLGSIIEMLSHDGARTVMAQKFIPEIKDGDKRILLIGGEA
FT                   VPYSLARIPQGNEVRGNLAAGGLGVARPLTEHDRKIADTLAPVLAARGLLLVGLDAIGD
FT                   WLTEVNVTSPTCFREIMDQTGFDVAAMFIDALERAAG"
FT   gene            295393..295881
FT                   /locus_tag="BC1003_0263"
FT   CDS_pept        295393..295881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0263"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: bxe:Bxe_A4186 putative sugar transport PTS system IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56267"
FT                   /db_xref="GOA:E1T5Z0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Z0"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ADN56267.1"
FT                   /translation="MAGILIIAHAPFATALRDCISHIYGGLPARIGVIDVSPDCDPAQM
FT                   VSFAESEIARLKEENGALVLTDMFGATPANIAGRLAAVPDVRVLCGVNLPMLVRAVCYR
FT                   ATPLDTLVDKALAGATKGIHAIGPATPAPAEAVAVAGDCLPALPADAELTQKSGPAGL"
FT   gene            295998..296267
FT                   /locus_tag="BC1003_0264"
FT   CDS_pept        295998..296267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0264"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="KEGG: bxe:Bxe_A4185 HPrNtr; TIGRFAM: phosphocarrier,
FT                   HPr family; PFAM: phosphoryl transfer system HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56268"
FT                   /db_xref="GOA:E1T5Z1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Z1"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADN56268.1"
FT                   /translation="MLQQETTIVNKLGLHARASAKLTQLAGSYQSEIWMSRNGRRINAK
FT                   SIMGVMMLAAGIGSTVLIEVEGADEKEAMDALLKLIADKFGEGQ"
FT   gene            296549..298297
FT                   /locus_tag="BC1003_0265"
FT   CDS_pept        296549..298297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0265"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="KEGG: bpy:Bphyt_0531 phosphoenolpyruvate-protein
FT                   phosphotransferase; TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein domain protein; PEP-utilising protein
FT                   mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56269"
FT                   /db_xref="GOA:E1T5Z2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Z2"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADN56269.1"
FT                   /translation="MSFTLHGIPVSRGIAIGRAYLIAPAALDVDHYLIEPAQIEGEVER
FT                   FRTAQQRVHEELDALRADLAADAPSEMGAFINVHSMILNDAMLVQETIDLIRTRRYNVE
FT                   WALTEQLERLSRHFDDIEDEYLRERKADIEQVVERVLKALAGASATLADGVHGACDEMI
FT                   VVAHDIAPADMMQFKTQTFQGFVTDLGGRTSHTAIVARSLGIPAAVGVQHASALIRQDD
FT                   LIIVDGDHGIVIVDPAPIVLEEYSYRQSEKALEQRKLQRLKFSPTQTLCGTRIELCANI
FT                   ELPEDARAALDAGATGVGLFRTEFLFMNHKDRMPEEEEQFEAYRRAVELMNGLPVTIRT
FT                   IDVGADKPLDSMSGGDGYETAPNPALGLRAIRWSLSEPQMFLTQLRAILRASAFGSVKI
FT                   LVPMLAHAQEIDQTLDLIREAKRQLDDAGIAYNPNVQVGAMIEIPAAAIALPLFLKRLD
FT                   FLSIGTNDLIQYTLAIDRADNSVAHLYDPLHPAVLHLIAFTLREAKRAGVPVSVCGEMA
FT                   GDPTLTRLLLGMGLTEFSMHPSQLLEVKQEVLRSHLKTLEKPVADVLASFEPEEVQAAL
FT                   KRVAQA"
FT   gene            complement(298448..299206)
FT                   /locus_tag="BC1003_0266"
FT   CDS_pept        complement(298448..299206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0266"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: bxe:Bxe_A4183 putative
FT                   molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56270"
FT                   /db_xref="GOA:E1T5Z3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Z3"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADN56270.1"
FT                   /translation="MNDDQLLRYSRHILVDEIGIEAQQRFIDAHAIIVGAGGLGSPAAM
FT                   YLAAAGVGRLTLVDADTVDLTNLQRQILHVSASVGRKKVESGRDTLAQINPEVSVNAVA
FT                   ERVDDAWLDREVPGATVVLDCTDNFATRHAINRACVKHGVPLVSGAALRFDGQISTFDF
FT                   RDEASPCYACVFPEDQPFEEVACSTMGVFAPTVGIIGSMQAAEALKVIGRIGTPLSGRL
FT                   TMLDSLRMEWTTMRISRQTDCPVCKERHRA"
FT   gene            complement(299275..300849)
FT                   /locus_tag="BC1003_0267"
FT   CDS_pept        complement(299275..300849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0267"
FT                   /product="carboxyl-terminal protease"
FT                   /note="TIGRFAM: carboxyl-terminal protease; PFAM: peptidase
FT                   S41; PDZ/DHR/GLGF domain protein; KEGG: bxe:Bxe_A4182
FT                   peptidase S41A; SMART: peptidase S41; PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56271"
FT                   /db_xref="GOA:E1T5Z4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Z4"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADN56271.1"
FT                   /translation="MRKNLKNIGLIAAGLATGVFATLQLSASAQQPASAATPLPLDQLR
FT                   LFAEVFGQIKHEYVEPVDDKKLLTAAIKGMVSSLDPHSSYLDKTDYEELQEQTKGRFAG
FT                   LGIEISSEDGLIKVISPIEDTPAFRAGIRPGDLITRINDKPVRGMTLDQAVKQMRGEPG
FT                   TKVTLTIFRKTDDRTFPLTVTRAVIKVQSVKMKILAPGYAYVRITSFQERTTPDLAAKL
FT                   QEIARQQPNLKGLVLDLRNNGGGLLQSAVGVAGAFLPPNSVVVSTNGQIPDSKQVYRDT
FT                   YDNYRLQSFDSDPLKDEAPIFKTVPMVVLTNAYSASASEIVAGALQDQHRALIVGKTTF
FT                   GKGSVQTVRPMTADTALRLTTAYYYTPSGRSIQNKGIRPDIAVDQYAEGDPDDALVTRE
FT                   VDYSNHLANTQDPNEKKEAEKREQDRMDQLRQLEEQNDKKTPEQRQKDRERKPVEFGSA
FT                   DDFMLAQALNKLEGKPVQESKSITERRLAQNKPATSASAPVAVKPTQPVPGASNTAPAS
FT                   APATQSK"
FT   sig_peptide     complement(300760..300849)
FT                   /locus_tag="BC1003_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.755 at
FT                   residue 30"
FT   gene            complement(301310..302056)
FT                   /locus_tag="BC1003_0268"
FT   CDS_pept        complement(301310..302056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0268"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="KEGG: bpy:Bphyt_0534 phosphoglycerate mutase 1
FT                   family; TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56272"
FT                   /db_xref="GOA:E1T5Z5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Z5"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ADN56272.1"
FT                   /translation="MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREAQQAGVLLKE
FT                   SGYTFDIAYTSVLRRAIRTLWHVQDQMDQMYIPVVHSWRLNERHYGALSGLNKAETAAK
FT                   FGDEQVLVWRRSYDTPPPALEPTDERAPYDDPRYAKVPREQLPLTECLKDTVARVLPLW
FT                   NESIAPAIKSGRKVVIAAHGNSIRALVKYLDNISDADIVGLNIPNGVPLVYELDEDLKP
FT                   IKHYYLGDQEAIAKAQAAVAKQGKAG"
FT   gene            302146..302619
FT                   /locus_tag="BC1003_0269"
FT   CDS_pept        302146..302619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0269"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: bxe:Bxe_A4180 putative rhodanese-related
FT                   sulfurtransferase; PFAM: Rhodanese domain protein; SMART:
FT                   Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56273"
FT                   /db_xref="GOA:E1T5Z6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Z6"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADN56273.1"
FT                   /translation="MGGLPFPISLFFGGFSVKFFTDYTNLVLIAIVLISGGLLLWPSIS
FT                   RRGRGGLSAAEATQLINRRNAAVIDLRPSADFAKGHLPAARHLEFAELQAKVAQLVKNK
FT                   NNPVLLVCQTGQQSNKAARIVQDAGYAEVHVLEGGVDAWQKAGMPVVKQGVAK"
FT   gene            302616..302876
FT                   /locus_tag="BC1003_0270"
FT   CDS_pept        302616..302876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0270"
FT                   /product="glutaredoxin 3"
FT                   /note="KEGG: glutaredoxin 3; TIGRFAM: glutaredoxin 3; PFAM:
FT                   glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56274"
FT                   /db_xref="GOA:E1T5Z7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Z7"
FT                   /inference="protein motif:TFAM:TIGR02181"
FT                   /protein_id="ADN56274.1"
FT                   /translation="MNKVIMYSTQVCPYCQMAERLLKSRGVENIEKVLIDKDPARREEM
FT                   MTRTGRRTVPQVFIGEKHVGGYDDLSALDRAGGLTPLLETA"
FT   gene            303030..303500
FT                   /locus_tag="BC1003_0271"
FT   CDS_pept        303030..303500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0271"
FT                   /product="protein-export protein SecB"
FT                   /note="KEGG: bxe:Bxe_A4178 preprotein translocase subunit
FT                   SecB; TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56275"
FT                   /db_xref="GOA:E1T5Z8"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Z8"
FT                   /inference="protein motif:TFAM:TIGR00809"
FT                   /protein_id="ADN56275.1"
FT                   /translation="MSDENNQPFFNIQRIYLKDMSLEQPNSPAIFLEQDMPSVEVEVDV
FT                   KAERLAESVFEILVTGTVTAKVSDKVAFLIEAKQAGIFDIRNIPAEQIDPLVGIACPTI
FT                   LFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQMSGQDGAAQNGVTH"
FT   gene            303522..304520
FT                   /locus_tag="BC1003_0272"
FT   CDS_pept        303522..304520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0272"
FT                   /product="NAD-dependent glycerol-3-phosphate dehydrogenase
FT                   domain protein"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: bxe:Bxe_A4177
FT                   NAD(P)H-dependent glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56276"
FT                   /db_xref="GOA:E1T5Z9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T5Z9"
FT                   /inference="protein motif:PFAM:PF01210"
FT                   /protein_id="ADN56276.1"
FT                   /translation="MKVAVLGAGAWGTALAGHLAVRHDTVLWAREPALVAELSASHENA
FT                   RYLAGVALPATLRYEADLSAALDHALADDALCVVATPVAGLRSLIQSMRAAGKVPAHVV
FT                   WLCKGFEADSQLLPHQVVAAELPQHGSNGVLSGPSFAREVGQGLPVALTIASASAACRE
FT                   RTVAAFHHGAMRIYTGDDVIGVEVGGAVKNVLAIATGIADGLGLGLNARAALITRGLAE
FT                   MSRLGVTLGGRAETFTGLTGLGDLILTATGDLSRNRTVGLQLAAGRSLADILGGLGHVA
FT                   EGVRCAQAVLAIARAHSIEMPITQAVCAVLFDGVAPRDAVSALLRRDSKAE"
FT   gene            304638..305186
FT                   /locus_tag="BC1003_0273"
FT   CDS_pept        304638..305186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0273"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="KEGG: bpy:Bphyt_0539 Appr-1-p processing domain
FT                   protein; PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56277"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:E1T600"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ADN56277.1"
FT                   /translation="MLSIDRCTLEARVADITTLDVDAIVNAANSSLLGGGGVDGAIHRA
FT                   AGKELLRECETLGGCATGDAKLTRGHGLPARYVIHAVGPVWRGGTHGEPDLLASCYQRS
FT                   LEVAREANCASIAFPAISCGIYRFPADQAVRIAVETVLENLPRMTQLENVIFACFDHAM
FT                   FERYAAELKGRQAPPSKPV"
FT   gene            complement(305159..305629)
FT                   /locus_tag="BC1003_0274"
FT   CDS_pept        complement(305159..305629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0274"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="KEGG: bpy:Bphyt_0540 RNA methyltransferase, TrmH
FT                   family, group 2; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 2; PFAM: tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56278"
FT                   /db_xref="GOA:E1T601"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E1T601"
FT                   /inference="protein motif:TFAM:TIGR00185"
FT                   /protein_id="ADN56278.1"
FT                   /translation="MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLEDAKLR
FT                   RAGLDYHEYAQMNVHANWAAFIAKESPDASRMFAFTTRGSGRFHEHAFKPGDWFVFGAE
FT                   TRGLPDAVLDQFTGEQRVRLPMRPGNRSLNLSNTVAIVVFEAWRQTGFEGGA"
FT   gene            complement(305648..306349)
FT                   /locus_tag="BC1003_0275"
FT   CDS_pept        complement(305648..306349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0275"
FT                   /product="phosphoribosyltransferase"
FT                   /note="KEGG: bxe:Bxe_A4174 putative competence protein
FT                   F-related protein; manually curated; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56279"
FT                   /db_xref="GOA:E1T602"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1T602"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADN56279.1"
FT                   /translation="MQALLPNACALCGNLSHRPLCAFCDESYWNDGALRCRVCAVPLPV
FT                   TFRGRRTSYRCGDCSSEMPPFDATFALADYRAPLDALAVGLKFRAQLMLAGEFARRLAH
FT                   LAQDAWQDPSDCPDVIAPVPLARRRLIERGYNQAWQIARPLARALRVPADATLLRRVIE
FT                   TAPQSRLDLDARRMNVGRAFQLTRNVERLHVGIVDDVMTTGATLEALARTLKAAGARRV
FT                   TNFVALRTPKN"
FT   gene            306517..307482
FT                   /locus_tag="BC1003_0276"
FT   CDS_pept        306517..307482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0276"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: bxe:Bxe_A4173
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56280"
FT                   /db_xref="GOA:E1T603"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1T603"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADN56280.1"
FT                   /translation="MSPTPPQSGRPAYDSRRLRQIFDRRAANFDDVAFLPREIAQRMRE
FT                   RLEYIKVAPASVLDAGCGAGEDIPALRERFPEAPVFGTDLSRGMLERARHHDSGDTSWR
FT                   RFLPATLGKALGARGPRFAQADFAALPFAPGAFDFIWSNLALHWHSRPDLVFPEWQRVL
FT                   KVNGLLMFSTLGPDTLKELRGAYAEVEAAHGVSSRKHVIDFVDMHDLGDMLVESGFEIP
FT                   VMDQETITITYKSPESLLADVRRWGAYPFGREAFAGAAARRLHEALLAALEARRRPDGT
FT                   IALTFEVIYGHAWKAVPRTTAEGHGIVRIEDIGRGSPRNR"
FT   gene            307786..308259
FT                   /locus_tag="BC1003_0277"
FT   CDS_pept        307786..308259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0277"
FT                   /product="Protein of unknown function DUF2244,
FT                   transmembrane"
FT                   /note="PFAM: Protein of unknown function DUF2244,
FT                   transmembrane; KEGG: bxe:Bxe_A4172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56281"
FT                   /db_xref="GOA:E1T604"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:E1T604"
FT                   /inference="protein motif:PFAM:PF10003"
FT                   /protein_id="ADN56281.1"
FT                   /translation="MEASDLLADSEPVLKDWTMKRNCSMSPRQFICFYVSLALFSLAIA
FT                   FMLVLVGAWLVLPFTGIELLAVGVAFAIYARHAVDYERIRLFPNRLVVEQVSAEQVTQF
FT                   EFNPRWVRIEAGATPRDQIRLVSRGETIMIGQHLAQHRRAQFAGELRMWLARC"
FT   gene            308343..310001
FT                   /locus_tag="BC1003_0278"
FT   CDS_pept        308343..310001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0278"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="KEGG: bxe:Bxe_A4171 putative cytochrome c oxidase;
FT                   TIGRFAM: cytochrome c oxidase, subunit II; PFAM: cytochrome
FT                   c oxidase subunit II; cytochrome C oxidase subunit II
FT                   transmembrane region; cytochrome c class I; OmpA/MotB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56282"
FT                   /db_xref="GOA:E1T605"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1T605"
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /protein_id="ADN56282.1"
FT                   /translation="MEILGKEAMKTIKRALMGVLAMSGLLFAGAALAVGDVPGGPAVNE
FT                   INLQPPATKIAEELYSLHTLMLILCTVIFVGVFAVMFYSIFAHRKSKGHKASNFHESTT
FT                   VEIIWTIVPFIIVVLMALPATKTVVAMKDTTNADVTIKVTGYQWKWGYDYVKGPGEGIS
FT                   FLSTLATPRAETDGRQPISTTYLQEVDNPLVVPVGKKIRIITTANDVVHSWYVPAFGVK
FT                   QDAIPGFVRDTWFKAEKVGTFRGFCTELCGKEHAFMPVVVEVLSTDDYAKWVDAQKKKM
FT                   AAGQDDPNKTYTMAELMERGGKVYAANCAVCHQPTGKGAGAFPALDGSKVANGAIAEHV
FT                   SIVLKGKNAMPAWAPTLNDVEIASVITFERNSWGNHTGDILQPKQVADARNGKLPEGGN
FT                   HLADAGAAASGAEGASGASAGAAGSEAAGAQAAAAGSEGTGATQAALPASVYFDTGKST
FT                   LPADAKAAVEAAAAYAKAHPDAKFTLSGFTDATGSADTNAKLAKSRAEAVRDALKAAGI
FT                   AEDHIILKKPETITGGSDAKEARRVQINAAASPAA"
FT   sig_peptide     308343..308444
FT                   /locus_tag="BC1003_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.987 at
FT                   residue 34"
FT   gene            310045..311658
FT                   /locus_tag="BC1003_0279"
FT   CDS_pept        310045..311658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0279"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /note="KEGG: bxe:Bxe_A4170 cytochrome-c oxidase; TIGRFAM:
FT                   cytochrome c oxidase, subunit I; PFAM: cytochrome c oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56283"
FT                   /db_xref="GOA:E1T6F0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6F0"
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /protein_id="ADN56283.1"
FT                   /translation="MSSIGHDVVAGHEHVHGDHAHETPHGWRRWLFATNHKDIGTLYLI
FT                   FSFTMFLSGGVMALMIRAELFEPGLQIMRPEFFNQLTTMHGLIMVFGAIMPAFVGFANW
FT                   MVPLQIGASDMAFARMNNFSFWLLPVAAVLLVGSFFSPGGATAAGWTLYAPLSTQMGPG
FT                   MDFAIFAVHLMGASSIMGGINIVVTILNMRAPGLTLMKMPMFVWTWLITAYLLIAVMPV
FT                   LAGAITMVLFDRHFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQVIPA
FT                   FSRKPLFGYSSMVYATSSIAILSFMVWAHHMFATGMPVTGQLFFMYATMLIAVPTGVKV
FT                   FNWVATMWRGSLSFETPMLFAVGFLIVFTFGGLSGLMLAMAPLDIQYHGTYFVVAHFHY
FT                   VLVAGSLFALFAGWYYWAPKWTGWMYNETRGKIHFWASLFFFNLAFLPMHFVGLAGMPR
FT                   RYADYPAQFTDWNQVITIGAFGFGLAQVYFLFAVALPAYRGGGDHEKAGDKPWDGATGL
FT                   EWTVPSPAPFHTFENPPTVE"
FT   gene            311879..312013
FT                   /locus_tag="BC1003_0280"
FT   CDS_pept        311879..312013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0280"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: bpy:Bphyt_0546 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56284"
FT                   /db_xref="GOA:E1T6F1"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6F1"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0546"
FT                   /protein_id="ADN56284.1"
FT                   /translation="MTRNPQERRTPEQIRAGNRRLGLVLLAIGAVFFAAVIVNQGWFS"
FT   gene            312057..312671
FT                   /locus_tag="BC1003_0281"
FT   CDS_pept        312057..312671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0281"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: bxe:Bxe_A4169 cytochrome c oxidase
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56285"
FT                   /db_xref="GOA:E1T6F2"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6F2"
FT                   /inference="protein motif:PFAM:PF04442"
FT                   /protein_id="ADN56285.1"
FT                   /translation="MSTQPPAQADRSFNRSMLIKLFVVALMMFGFGFALVPMYRAICQI
FT                   TGINNLVQRDATAREAKNTQVDMSRTISIELDANARGPLGFKPEQHSLDVHPGEVTTVM
FT                   YEVSNEQARTIQAQAIPSYAPKQATEYFKKIECFCFTQQTLKANETRRMPVVFVVDPKL
FT                   PKDVKTITLSYTFFELNTPATAKVGSAALPARTAATTANPA"
FT   gene            312702..312920
FT                   /locus_tag="BC1003_0282"
FT   CDS_pept        312702..312920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56286"
FT                   /db_xref="GOA:E1T6F3"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6F3"
FT                   /inference="similar to AA sequence:KEGG:BC1002_0273"
FT                   /protein_id="ADN56286.1"
FT                   /translation="MSDNSGGPRKSSFGQSMRAVFWSFFGVRKRRDLESDATQLNPLHV
FT                   IVAALISTAIFIGVLILVVRAVVGHGG"
FT   gene            313058..313915
FT                   /locus_tag="BC1003_0283"
FT   CDS_pept        313058..313915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0283"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   bxe:Bxe_A4167 putative cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56287"
FT                   /db_xref="GOA:E1T6F4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6F4"
FT                   /inference="protein motif:PFAM:PF00510"
FT                   /protein_id="ADN56287.1"
FT                   /translation="MSGQNESPYYFVPHPSRHPISAAVGLLIMLGSLAAWINEHELAPI
FT                   GVVVGLLWLLFTLWHWFGDAIAESEGGMYGKNVDKSYRWSMSWFIFSEVMFFGAFFGAL
FT                   FYARAIALHELASLDYKLIWPDFSAVWPNNGPASLVSTFKSMTPWPVPTINTALLLSSG
FT                   ATLTVSHHALRENHRRKAIIWLAATLVLGVCFLFLQGFEYFHAYNELNLTLASGVYGST
FT                   FFLLTGFHGFHVFLGGTMLAVVLVRMIRGHFTADHHFAFEGAAWYWHFVDVVWLGLYVV
FT                   VYWL"
FT   gene            complement(314204..314413)
FT                   /locus_tag="BC1003_0284"
FT   CDS_pept        complement(314204..314413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0284"
FT                   /product="Protein of unknown function DUF2909"
FT                   /note="PFAM: Protein of unknown function DUF2909; KEGG:
FT                   bph:Bphy_0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56288"
FT                   /db_xref="GOA:E1T6F5"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6F5"
FT                   /inference="protein motif:PFAM:PF11137"
FT                   /protein_id="ADN56288.1"
FT                   /translation="MHILVPIAFALIIASMVSALYFMMHDKGKTKRMVWSLATRVGLSI
FT                   SLFLFILFAYWMGWIHSTGIPYGR"
FT   sig_peptide     complement(314354..314413)
FT                   /locus_tag="BC1003_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.663) with cleavage site probability 0.648 at
FT                   residue 20"
FT   gene            314525..315241
FT                   /locus_tag="BC1003_0285"
FT   CDS_pept        314525..315241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56289"
FT                   /db_xref="GOA:E1T6F6"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6F6"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0551"
FT                   /protein_id="ADN56289.1"
FT                   /translation="MKFRLIPALLILLVVALTVRLGFWQRERAQQKEALEARITQFENA
FT                   PAQAVTGAPVALKDIEFHRVKARGTFVADKVVYLDNRPYNDQPGFYVVMPFKLADGGYV
FT                   LVNRGWLPRNMNNRETIAPYATPSGEIEIEGIARADASRAYELGQGGSAAHQLIRQNLD
FT                   VAAYAAETGLPLQPFVIQQLSDDGDRLVRDWPAPASGVERNYGYMFQWWGMAAAALVFG
FT                   LYAARRAARKEHAPGV"
FT   sig_peptide     314525..314593
FT                   /locus_tag="BC1003_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.661) with cleavage site probability 0.435 at
FT                   residue 23"
FT   gene            315320..316006
FT                   /locus_tag="BC1003_0286"
FT   CDS_pept        315320..316006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56290"
FT                   /db_xref="GOA:E1T6F7"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6F7"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4164"
FT                   /protein_id="ADN56290.1"
FT                   /translation="MSTQSPRSPQSGKPAATTSAASAAARPMPGQPNGGGSWQRGRWML
FT                   LLVAIVCGAPIAISYFMYYVVKPTGGTTSYGTLVEPQRPIPESLVVTGEDGKPAKLASL
FT                   RGRWLLISVDNSACDKACATKLYFMRQIRAAQGPERERVVEVWLRTDAGNVPDVIQKAY
FT                   PDTNMLIADLAQVSAWLPVDKGTKVSDHIYMVDPNGNLMMRFPKDPNPSKIKGDVTKLL
FT                   KWSRIG"
FT   gene            316029..317138
FT                   /locus_tag="BC1003_0287"
FT   CDS_pept        316029..317138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0287"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   bxe:Bxe_A4163 putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56291"
FT                   /db_xref="GOA:E1T6F8"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6F8"
FT                   /inference="protein motif:PFAM:PF02628"
FT                   /protein_id="ADN56291.1"
FT                   /translation="MFVLQLGLIGLCIALLPLSYVWVKADDNKFRKLVWLTTFLTLDLV
FT                   MFGGFTRLTDSGLGCPDWPGCYGTSSPFIAHAAITAAHQAMPTGPVSMTKAWIEMIHRY
FT                   FAMAIGVLIIAQTIIAWVARIKRRPLHVSPWWPTSLLLLILVQGAFGAWTVTMKLQPVI
FT                   VTTHLLLGLALLGTLGWLAARQTPLPAYEPQAGRWRAAAVAGLVLLIAQIALGGWVSTN
FT                   YAVLACTDFPTCNGQWVPPMDFAHGFHLWRALGMTGDGDIITQDALVAIHWTHRTFAFV
FT                   VIAYLVWFALKLRRFESLRRPADGVLLVVLLQFVTGLSNIVLQWPLPIAVAHNGGAAVL
FT                   LLLLVMLNFRIAYSRPGRAVLPARDAAPA"
FT   gene            317145..318050
FT                   /locus_tag="BC1003_0288"
FT   CDS_pept        317145..318050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0288"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0554 protoheme IX
FT                   farnesyltransferase; TIGRFAM: protoheme IX
FT                   farnesyltransferase; PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56292"
FT                   /db_xref="GOA:E1T6F9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6F9"
FT                   /inference="protein motif:TFAM:TIGR01473"
FT                   /protein_id="ADN56292.1"
FT                   /translation="MDSTTLSQTPGSRMSQYIALTKPRVTQLAVFCAVIGMFLSTPGMV
FT                   PWTVLIGGTVGIWLLAGAAFAINCLVEQKIDAKMRRTSWRPSARGEITTAQILLFSAVL
FT                   GGLGMWTLYTFANPLTMWLTLATFVGYAVIYTLLLKPATPQNIVIGGASGAMPPALGWA
FT                   AVTGHVPGDAWILVLIIFVWTPPHFWALALYRRKDYEDAGLPMLPNTHGEKYTRLHILL
FT                   YTVILFAVTMMPFISGMSGVVYLAAAVLLGAVFLAYAWKIYLEYSDDLARRTFRYSIVY
FT                   LSLLFAALLVDHYVRVLIGA"
FT   gene            318056..318673
FT                   /locus_tag="BC1003_0289"
FT   CDS_pept        318056..318673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0289"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   bxe:Bxe_A4161 electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56293"
FT                   /db_xref="GOA:E1T6G0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6G0"
FT                   /inference="protein motif:PFAM:PF02630"
FT                   /protein_id="ADN56293.1"
FT                   /translation="MLHTRFARAARAAVIACALGGALFVAGCGKQQPAFQNLDITGNTQ
FT                   FGSNFSLPDTSGKIRSMADYKGKVVVLFFGYTHCPDVCPTTMAELSQALQQLGPEDAKR
FT                   VQVLFVTVDPERDTAALLAQYVPAFNPTFVGLRPADDAQVKKVTKDFRIYYAKVPGKTP
FT                   DSYTMDHTAASYVFDTDGKLRLFARDGQGAAPWVHDIKLLLD"
FT   sig_peptide     318056..318139
FT                   /locus_tag="BC1003_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.591 at
FT                   residue 28"
FT   gene            complement(318906..319196)
FT                   /locus_tag="BC1003_0290"
FT   CDS_pept        complement(318906..319196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0290"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: bpy:Bphyt_0556
FT                   YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56294"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6G1"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADN56294.1"
FT                   /translation="MYVINLIYTAPLERIDDALEAHRAFVAKQFEDGVFVAAGPKVPRD
FT                   GGIILAVRIERDRLDAILATDPFAVQKLARYEVTEFKTTRLAPGLNLPIPA"
FT   gene            319500..320312
FT                   /locus_tag="BC1003_0291"
FT   CDS_pept        319500..320312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0291"
FT                   /product="lipoprotein, YaeC family"
FT                   /note="KEGG: bxe:Bxe_A4158 ABC transporter periplasmic
FT                   ligand-binding protein; TIGRFAM: lipoprotein, YaeC family;
FT                   PFAM: NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56295"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6G2"
FT                   /inference="protein motif:TFAM:TIGR00363"
FT                   /protein_id="ADN56295.1"
FT                   /translation="MQRRNILKALSAVIAGAAIVTSFGAHADEKAIKVGTISGPDAQIW
FT                   EVVTKVAKREGLNVKVVEFNDYVQPNAALDAGDLDANSFQHQPYLDSQIKQRGYKIVSA
FT                   GLTYISPLGVYSKKLKSVKDLPQGAKVAVPNDPSNENRALLLLQAQGVIKLKAGAGTNG
FT                   NNATALDVAENPKKIKLVELDAAQLPRSLADVDAAAINTNFALAAGLQPTKDAIALEDI
FT                   HSPYANLIAVRTQDKDKPWVKKLVAAYQSEDVRQFIKTQFKGSVVPSF"
FT   sig_peptide     319500..319583
FT                   /locus_tag="BC1003_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(320322..321248)
FT                   /locus_tag="BC1003_0292"
FT   CDS_pept        complement(320322..321248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0292"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0559 transcriptional regulator, MarR
FT                   family with acetyltransferase activity; PFAM: GCN5-related
FT                   N-acetyltransferase; regulatory protein MarR; SMART:
FT                   regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56296"
FT                   /db_xref="GOA:E1T6G3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6G3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADN56296.1"
FT                   /translation="MTDSEALQRAQAVRRFNRFYTRLIGALHEHLAQSSFSLTEVRVLH
FT                   ELSRGRAQTASVLGRALGLDSGYLSRLLTNFERRDLITRRPSETDARQSLIALTDNGHA
FT                   AYAPLDAAANQEVLALLGKLSEASQEQLIGAMNLVERLLGDKPRADAVELRAPRPGECA
FT                   WLVHRQAQWFAAQYGWDKSFEGLLARVIADYTQRNDTVREFCVVADQHGTVAGAVCVVA
FT                   VSTTVAGLRLLWVEPDVQRRGIGTRIMAEATRFAQRAGYTKLTLTTASTLVEARRLCKR
FT                   AGFELVSAAPERRFGKDLMIERWELAL"
FT   gene            321616..322350
FT                   /locus_tag="BC1003_0293"
FT   CDS_pept        321616..322350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0293"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bpy:Bphyt_0560 transcriptional regulator, GntR
FT                   family; PFAM: UbiC transcription regulator-associated
FT                   domain-containing protein; regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56297"
FT                   /db_xref="GOA:E1T6G4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6G4"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADN56297.1"
FT                   /translation="METRWSALMPDARNVTPLYLQLARNLATAIHCGVWSAGEALPSER
FT                   TLSDAIGVSRITARKAIELLVEQGLIRRARGAGSFITPRVEDPLSRLTGFTKKMQQRGF
FT                   RPDSVWLERDIRAARRDELVHLGLSPGAAVASLRRLRRADGIVMAVEHSALPVAVVPDP
FT                   LAIGVSLYSYLEQRGAAVVRALQHFRAVNASSEIASLMDIEPRSALLVITRIGYSADQR
FT                   AIELTDTYCRDDYYDFVAELRT"
FT   gene            322457..323560
FT                   /locus_tag="BC1003_0294"
FT   CDS_pept        322457..323560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0294"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; KEGG: bpy:Bphyt_0561
FT                   N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56298"
FT                   /db_xref="GOA:E1T6G5"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6G5"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ADN56298.1"
FT                   /translation="MLTGNILTTDGWIHGTLEFENGRITALTGERVDPATNDAPYILPG
FT                   FIDLHVHGGGGSDVMEAGDAIETITRTHARYGTTSLLATTMTAPRDELMSVVAGLGDVA
FT                   RRRTPGGSRVLGVHLEGPYINPGKLGAQPDAAVSAVMDEVLKYLSIAPIRVVTLAPEIA
FT                   GHMDIISEMAARGVRVQLGHSLGTYDDAVAALKHGACGFTHLFNAMSPLHHRNPGLVGA
FT                   ALAHAEFAEIIPDLLHVHPGAIRAALRAIPRLYVVTDSTSATGMPDGEYRLGSQHVTKC
FT                   LGGVRLADGTLAGSTLTMDQALRNLVSIGLPIADVSNRLSRYAADYLGIEDRGRIARGA
FT                   WADVVVFDRELALCATYVEGEAIVEHA"
FT   gene            323544..324560
FT                   /locus_tag="BC1003_0295"
FT   CDS_pept        323544..324560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0295"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="KEGG: glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing); PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56299"
FT                   /db_xref="GOA:E1T6G6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6G6"
FT                   /inference="protein motif:PRIAM:2.6.1.16"
FT                   /protein_id="ADN56299.1"
FT                   /translation="MSNMLKEALASAETVAAQLKDTSRVEALAARLAEKPRHVALTVAR
FT                   GSSDHAASYFASLTMSRLGVPVASLPMSVATLQQAPLQVRDQLALAFSQSGKSPDLVGT
FT                   MQALRAAGALTVAAVNAPVSPLADACEWHLPLVAGPELSVAATKSYIAMLSISAQLVAH
FT                   WQHDAALLGALNTLPDALQAAGALDWSQAVEQLRGVERMIVIGRGLGLAIAQEAALKLK
FT                   ETSGIQAEAFSSAEVRHGPMELIDRDYPLFVFAPRGPEQAGLLQLARDMQARGARVLLA
FT                   APADIGEATLPLATTAHAALDPIAAIQSFYVMAAGLAAARGRNPDAPRHLNKVTETH"
FT   gene            324599..327169
FT                   /locus_tag="BC1003_0296"
FT   CDS_pept        324599..327169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0296"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="KEGG: bpy:Bphyt_0563 phosphoenolpyruvate-protein
FT                   phosphotransferase; TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PTS system, glucose subfamily, IIA
FT                   subunit; phosphocarrier, HPr family; PFAM: PEP-utilizing
FT                   protein; sugar-specific permease EIIA 1 domain; phosphoryl
FT                   transfer system HPr; PEP-utilising protein domain protein;
FT                   PEP-utilising protein mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56300"
FT                   /db_xref="GOA:E1T6G7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6G7"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADN56300.1"
FT                   /translation="MSHSQGHIVLLAPLTGPVVPLANVPDPVFSGGMFGDGIGVDPLEG
FT                   RLVAPCDATVTHLARTGHAVTLATAEGAEILLHIGIDTVELNGKGFAPMVEQGAQVRAG
FT                   DVLIEFDQDQVALRAPSLVSVIAIANSEAFEIVERAQGGMVKAGETPLLRLRARDGAAA
FT                   AASRELSATSVTEEARAQVTLVHAGGLHARPAARAREAARGFNARVEVRYDGRKAPIES
FT                   VVGLLGLGAGQGATVELLGVGPQAKAAVDAIAHELTREALGEVEEKPARQSSPAPQTTA
FT                   PAADGGAALASHTLAGVCAAPGVAVGKLVRWDDADLDPPEQASGTSAAESRLLDNAIAS
FT                   VDADLGTTVRDASQRGAVGEAGIFAVHRVLLEDPTLLDAARDLISLGKSAGFAWREAIR
FT                   AQTGILSKMEDALLAERAADLRDIEKRVLRALGYTNAVGRTLPDEAVLAADEFTPSDLS
FT                   TLDRSRVTALVMARGGATSHAAILARQAGIPALVAVGDALHAIPEGTQVVVNATTGRLE
FT                   FAPTELDVERARLERSRLAGVREANRRMSQQAAVTADGRAIEVAANIATLEDANTAVEN
FT                   GADSVGLLRTELLFIHRAAAPSAQEHQQSYQAIVDALSGRTAIIRTLDVGADKEVDYLT
FT                   LPPEPNPALGLRGIRLAQVRPDLLDDQLRGLLAVKPFGAVRILLPMVTDVGELIRIRKR
FT                   IDEFARELGRAEPIEVGVMIEVPSAALLADQLAQHADFLSIGTNDLTQYTLAMDRCQAD
FT                   LAAQADGLHPAVLRLIATTVQGANRHGKWVGVCGALAGDPLAMPLIVGLGVTELSVDPV
FT                   SVPGIKARVRNLDYQLCRQRAEDALALESAQAVRAVSRQTWPLD"
FT   gene            327245..329047
FT                   /locus_tag="BC1003_0297"
FT   CDS_pept        327245..329047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0297"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, N-acetylglucosamine-specific
FT                   IIBC subunit; PTS system, glucose-like IIB subunint; KEGG:
FT                   bxe:Bxe_A4152 PTS system, N-acetylglucosamine-specific IIBC
FT                   component; PFAM: phosphotransferase system EIIC;
FT                   Phosphotransferase system EIIB/cysteine, phosphorylation
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56301"
FT                   /db_xref="GOA:E1T6G8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6G8"
FT                   /inference="protein motif:TFAM:TIGR01998"
FT                   /protein_id="ADN56301.1"
FT                   /translation="MDGNPFLKIQRLGRALMLPIAVLPVAGLLLRLGQPDVFNIKMIAD
FT                   AGGAIFDNLPLLFAIGVAVGFAKDNNGVAGLAGAIGYLIEVAVMKDINDKLNMGVLSGI
FT                   VAGIVAGLLYNRYKDIKLPDYLAFFGGKRFVPIVTGVVCLVLGIVFGYVWQPVQAVIDT
FT                   AGHWLTTAGAFGAFVFGVLNRLLLVTGLHHILNSLTWFVFGTFTPPGGAPVTGDLHRFF
FT                   AGDPTAGTFMTGFFPIMMFGLPAACLAMFHEAPKERRAVVGGLLFSMALTSFLTGVTEP
FT                   IEFSFMFLAPVLYAIHALLTGLSLAICSALGIHLGFTFSAGAIDYVLNYGLSTKGWLAI
FT                   PLGLAYSVVYYGLFRFFIRKFNMATPGREPAAADEQAESFSAGGFVSPTAGAAVPRAQR
FT                   YIAALGGASNLSVVDACTTRLRLSVVDSNKVSENELKTIGARGVLKRGATNVQVIIGPE
FT                   ADIIADEIRSAIGQGGSGAALAGTAAAASVPAASAAAGAGAPTLAANAASVANGPLDPD
FT                   PLRWLAVFGGAGNVLSLDAVAATRLRIVVRDPSAVDRQRLAALDTAWVSADTFHIVVGD
FT                   AARRYADTLATRMSPGGGAAPVPA"
FT   gene            complement(329386..330321)
FT                   /locus_tag="BC1003_0298"
FT   CDS_pept        complement(329386..330321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0298"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="KEGG: RNA polymerase, sigma 32 subunit, RpoH;
FT                   TIGRFAM: RNA polymerase sigma factor RpoH; RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56302"
FT                   /db_xref="GOA:E1T6G9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6G9"
FT                   /inference="protein motif:TFAM:TIGR02392"
FT                   /protein_id="ADN56302.1"
FT                   /translation="MSHALTLPSTLSPSSAKAAPAGALALSHSSLLPGQLGNIDAYIQA
FT                   VNRIPMLTPAEERQFATEFREHDNLEAARRLVLSHLRLVVSIARNYLGYGLPHADLIQE
FT                   GNIGLMKAVKRFDPEQNVRLVSYAMHWIKAEIHEYILRNWRMVKVATTKAQRKLFFNLR
FT                   SHKQGLGAFTPDEIDGLAKELNVKREEVAEMETRLSGGDVALEGQVEDGEESYAPIAYL
FT                   ADSHSEPTAVLASRQRDKLQSDGIATALEALDARSRRIIEARWLKVQDDGSGGSTLHEL
FT                   ADEFGVSAERIRQIEASAMKKMRGALSEYA"
FT   sig_peptide     complement(330265..330321)
FT                   /locus_tag="BC1003_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.974 at
FT                   residue 19"
FT   gene            330684..331247
FT                   /locus_tag="BC1003_0299"
FT   CDS_pept        330684..331247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0299"
FT                   /product="Lipid A 3-O-deacylase-related protein"
FT                   /note="PFAM: Lipid A 3-O-deacylase-related; KEGG:
FT                   bpy:Bphyt_0571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56303"
FT                   /db_xref="GOA:E1T6H0"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6H0"
FT                   /inference="protein motif:PFAM:PF09411"
FT                   /protein_id="ADN56303.1"
FT                   /translation="MKNKKKRLRGLALKSGCAALLLGLSAAAAADQFGIQVAGGLGDHH
FT                   VKKLDLGLVWDPNLTWWQIGDWHFALIGEAHFAWWHTNEGNVHENIGEIGVTPIIRFIK
FT                   GSGSVRPFVEAGAGVRLLSSPRISSTFTLSTAFQFADMAGVGLQFGGHQQYQAGYRFQH
FT                   VSNAGIKEPNPGINFHQLYLQYNF"
FT   sig_peptide     330684..330776
FT                   /locus_tag="BC1003_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.771 at
FT                   residue 31"
FT   gene            331288..331671
FT                   /locus_tag="BC1003_0300"
FT   CDS_pept        331288..331671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56304"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6H1"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4144"
FT                   /protein_id="ADN56304.1"
FT                   /translation="MAAKTIEAIRGLERERFRAMVDGDGQSLDALLADNVSYVHTNGKR
FT                   ETKRQFIDGITAGRRRYRQIEVQSQDVLPVGRETCVVTGRALIEMEANNGALLFPIAYT
FT                   AIHTQEDGQWRLIAWQATRCAIE"
FT   gene            complement(331674..332645)
FT                   /locus_tag="BC1003_0301"
FT   CDS_pept        complement(331674..332645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0301"
FT                   /product="Glycosyl transferase, family 3-like protein"
FT                   /note="PFAM: Glycosyl transferase, family 3-like; KEGG:
FT                   bxe:Bxe_A4143 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56305"
FT                   /db_xref="GOA:E1T6H2"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6H2"
FT                   /inference="protein motif:PFAM:PF02885"
FT                   /protein_id="ADN56305.1"
FT                   /translation="MTDSADTANPFPCARFIKEIGRGPNGARALTAEDTRALYTAMLDG
FT                   RVGDLELGAILLAYRVKGETADELAAMLAGAHASFEPVHQPPGEFRPVSIPSYNGARKQ
FT                   PNLVPLLALLLAREGVPVLVHGVTEDPGRVTSAEIFTHLRIPHAGSHDDIEDGLAERRV
FT                   AFASIEVLAPKLARLLALRRRMGVRNSTHTLVKILQPFAPAGLRLVNYTHPPYRDSLTQ
FT                   LFSTHPDAAVGGALLARGTEGEAVADTRRQVQVDWLHDGICETRVPHERSSRDAPEVEL
FT                   PEARDAATTAAWIGAVLRGEAPVPGAIARQVEVIVDVARASA"
FT   gene            332874..333572
FT                   /locus_tag="BC1003_0302"
FT   CDS_pept        332874..333572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0302"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bxe:Bxe_A4142 putative fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56306"
FT                   /db_xref="GOA:E1T6H3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6H3"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADN56306.1"
FT                   /translation="MSYVFAPAPVVAVPVVGSSEQFPVRRIYCVGRNYEAHAREMGHDP
FT                   DREPPFFFSKPADAVLYVAPGETGEFPYPSLSKNVHFEMELVAAIGKGGKDIAAERALE
FT                   HVYGYALGLDMTRRDLQAEAKKLGRPWDTAKGFDHSAPLGPIHPVSTVGHVGQGAIWLS
FT                   VNGEDKQRSDVSQLIWSVAETIAYLSTLFELQPGDLIFTGTPDGVGAVVQGDLMKGGVD
FT                   GLGELSVRVV"
FT   gene            333599..334243
FT                   /locus_tag="BC1003_0303"
FT   CDS_pept        333599..334243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0303"
FT                   /product="maleylacetoacetate isomerase"
FT                   /note="KEGG: bpy:Bphyt_0577 maleylacetoacetate isomerase;
FT                   TIGRFAM: maleylacetoacetate isomerase; PFAM: Glutathione
FT                   S-transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56307"
FT                   /db_xref="GOA:E1T6H4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6H4"
FT                   /inference="protein motif:TFAM:TIGR01262"
FT                   /protein_id="ADN56307.1"
FT                   /translation="MKLYSYFRSSASYRVRIALNVKGLPYEYVPVHLVRDGGEQLKPEY
FT                   RKINPDGVVPTLVDGHDLVPQSLAIIEYLEETHPEPPLLPKAPADRAYVRSVALQVACE
FT                   IHPLNNLRVLKYLKHTLRVDDDAKDAWYRHWVEAGFATLEAHLAGEPRTGKLCFGDTPT
FT                   LADACLIPQVFNAQRFKVDTARFPTIQRIYDHAMQIDAFARAAPGAQPDAE"
FT   gene            complement(334359..335546)
FT                   /locus_tag="BC1003_0304"
FT   CDS_pept        complement(334359..335546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0304"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; KEGG: bxe:Bxe_A4140 signal recognition
FT                   particle-docking protein FtsY; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56308"
FT                   /db_xref="GOA:E1T6H5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6H5"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ADN56308.1"
FT                   /translation="MFSFFKRFKGSKEAENAPDESQDAPNALVDDLTRQALAAPPADAA
FT                   PPFTTPFAPETQPDSPLRTPAQPASQPEAVFDDSSLETVEIVPPPVQDASAKRSWLTRL
FT                   KTGLSKTSSSLTGIFVGTKIDEDLYEELETALLMSDAGVDATEFLLEALREKVRTERLT
FT                   EPQQVKAALRALLVDLLKPLEKSLMLGRAKPLVMMIAGVNGAGKTTSIGKLAKHLQSFN
FT                   QSVLLAAGDTFRAAAREQLAIWGQRNNVTVVAQESGDPAAVIFDAVGAARARKIDVMMA
FT                   DTAGRLPTQLHLMEELRKVKRVIGKAQDGAPHEVLLVIDANTGQNALAQVKAFDDALGL
FT                   TGLIVTKLDGTAKGGILAAIARQRPIPVYFIGVGERVEDLQPFSAEEFSDALLGG"
FT   gene            335801..336415
FT                   /locus_tag="BC1003_0305"
FT   CDS_pept        335801..336415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0305"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="TIGRFAM: methyltransferase; KEGG: bpy:Bphyt_0579
FT                   methyltransferase; PFAM: Conserved hypothetical protein
FT                   CHP00095"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56309"
FT                   /db_xref="GOA:E1T6H6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6H6"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ADN56309.1"
FT                   /translation="MPRSAPSRAHGASPKGGKPHAIRIIGGDWKRTPLPVLDLEGLRPT
FT                   PDRVRETLFNWLGQRLDGERCLDLFAGSGALGFEAASRGAARVLMVERNARAAAQLRAN
FT                   QQRLSARVIEIAEADALRLAASLPPASFDVVFLDPPFGDDLLDKALALAAPLVSEDGFL
FT                   YVEAGAALELDGNEALAGWKIVREGKAGAVHFHLLQRENEE"
FT   gene            336528..337043
FT                   /locus_tag="BC1003_0306"
FT   CDS_pept        336528..337043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0306"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="TIGRFAM: pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain protein; KEGG:
FT                   bpy:Bphyt_0580 phosphopantetheine adenylyltransferase;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56310"
FT                   /db_xref="GOA:E1T6H7"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6H7"
FT                   /inference="protein motif:TFAM:TIGR01510"
FT                   /protein_id="ADN56310.1"
FT                   /translation="MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRNKKPFF
FT                   TLKERLDIAHEVLGHYPNVQVMSFKGLLKDFVRTNNARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKWLKEKVAALDPN
FT                   NGAPAGQP"
FT   gene            337107..337364
FT                   /locus_tag="BC1003_0307"
FT   CDS_pept        337107..337364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0307"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: bpy:Bphyt_0581 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6H8"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0581"
FT                   /protein_id="ADN56311.1"
FT                   /translation="MALMITDECINCDVCEPECPNDAISMGPEIYVIDPKKCTECVGHF
FT                   DEPQCIQVCPVECIPRDPEHLETPEGLMAKYHALQAAKSA"
FT   gene            complement(337462..338532)
FT                   /locus_tag="BC1003_0308"
FT   CDS_pept        complement(337462..338532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0308"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="KEGG: bpy:Bphyt_0582 histidinol-phosphate
FT                   aminotransferase; TIGRFAM: histidinol-phosphate
FT                   aminotransferase; PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56312"
FT                   /db_xref="GOA:E1T6H9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6H9"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADN56312.1"
FT                   /translation="MSRYWSDIVHRLTPYVPGEQPALAHPVKLNTNENPYPPSPRVLAA
FT                   IREELGPAGESLRRYPDPTARKLRGTVAAYHGIRADQVFAGNGSDEVLALTFQALLKHD
FT                   KPLLFPDITYSFYPTYARLFDVEYQTIPLDDAFAINVDDYAVANGGILFPNPNAPTGRP
FT                   LPLADIERLLQKNPDSAVVIDEAYVDFGAQSAVTLIDRYPNLLVVQTVSKSRSLAGMRV
FT                   GFAFGNVELIDALNRVKDSFNSYPLDRLAQVAACAAYEDDEWFRDTCAKVIASRERLAA
FT                   GLTELGFDVVPSAANLLFARHNGRDAATLLSRLREREIFVRHFNAPRIDQHLRISVGTD
FT                   AECDVLLDALRAILNA"
FT   gene            complement(338694..339296)
FT                   /locus_tag="BC1003_0309"
FT   CDS_pept        complement(338694..339296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0309"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   bxe:Bxe_A4135 peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56313"
FT                   /db_xref="GOA:E1T6I0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6I0"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADN56313.1"
FT                   /translation="MIKLIVGLGNPGAEYTATRHNAGFWLVDQLAREAGTTLRDERRFH
FT                   GFYAKARLHGEEVHLLEPQTYMNRSGQSVVALAQFFKILPDEILVAHDELDMPPGSVKL
FT                   KLGGGSGGHNGLKDITAHLSSQQYWRLRIGIGHPRDLIPESARAGAKPDVANYVLKPPR
FT                   REEQDVIDASIERALAVMPQIIKGELERAMMQLHRNS"
FT   gene            complement(339448..340065)
FT                   /locus_tag="BC1003_0310"
FT   CDS_pept        complement(339448..340065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0310"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; TIGRFAM: ribosomal 5S rRNA E-loop binding
FT                   protein Ctc/L25/TL5; PFAM: Ribosomal protein L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56314"
FT                   /db_xref="GOA:E1T6I1"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6I1"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADN56314.1"
FT                   /translation="MKVVAFERSLQGTGASRRLRNSGKTPGIVYGAGAETQLVELDHNA
FT                   LWHALKKEVFHSSILDLEIGGKSQQVLLRDVQYHPFRQLVLHVDFQRVDATKKLHTKVP
FT                   LHFMNQETNPAVKLSSAVISHVVNELEIECLPSALPEFIEVDLAKIEAGQSVHAKDIPL
FT                   PAGVSLVAHVEAENPVVASATIPAGAVSESDAAAAEGETPAA"
FT   gene            complement(340229..341185)
FT                   /locus_tag="BC1003_0311"
FT   CDS_pept        complement(340229..341185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0311"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; KEGG:
FT                   bxe:Bxe_A4133 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56315"
FT                   /db_xref="GOA:E1T6I2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6I2"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADN56315.1"
FT                   /translation="MSSHDGLMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQV
FT                   EIQENVRGKDVFVLQSTCAPANDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRP
FT                   RSARVAISAKIVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPVLLGDLRKQN
FT                   YENLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMD
FT                   DMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLSGGAGERIAASALDELVVTDTIPLGE
FT                   EARSCAKIRSLTSAGLLAETFSRIRRGDSVMSLFAES"
FT   gene            complement(341232..341308)
FT                   /locus_tag="BC1003_R0004"
FT                   /note="tRNA-Gln1"
FT   tRNA            complement(341232..341308)
FT                   /locus_tag="BC1003_R0004"
FT                   /product="tRNA-Gln"
FT   gene            complement(341361..342242)
FT                   /locus_tag="BC1003_0312"
FT   CDS_pept        complement(341361..342242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0312"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; KEGG: bpy:Bphyt_0586
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56316"
FT                   /db_xref="GOA:E1T6I3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6I3"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADN56316.1"
FT                   /translation="MIETTNSLRDCLAPAKLNLFLHITGRRPDGYHTLQTVFQLLDWGD
FT                   TLHFTRRDDGLITRSTEIADVPPEHDLTVRAANLLKAHTGSPQGVDIEIEKRLPMGAGL
FT                   GGGSSDAATTLLALNRLWNLHLPRLELQELALKLGADVPFFVFGKNAFAQGVGEALDVV
FT                   QLPPRHFLVVTPRVHVPTAAIFSEKALTRDSKALTITDFPAELSCNTEWPESFGRNDMQ
FT                   QVVVGKYAEVAQVLRWFENIAPARMSGSGASVFAAFRSKAEAEAAQAKLPAEWNSAVAA
FT                   SLEVHPLFAFAS"
FT   gene            complement(342307..342939)
FT                   /locus_tag="BC1003_0313"
FT   CDS_pept        complement(342307..342939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0313"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="KEGG: bxe:Bxe_A4131 outer membrane lipoprotein LolB;
FT                   TIGRFAM: outer membrane lipoprotein LolB; PFAM: outer
FT                   membrane lipoprotein LolB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56317"
FT                   /db_xref="GOA:E1T6I4"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6I4"
FT                   /inference="protein motif:TFAM:TIGR00548"
FT                   /protein_id="ADN56317.1"
FT                   /translation="MRLSSLDISLRAPRRAALGLAAAAVLALSGCASVKPQGPSTSNAA
FT                   TAVTAQTSRAYQGRFAVQYNDQNGQQRNAYGNFSWQETGDTVTLQLRNPLGQTLAIVTS
FT                   SPASATLELPNRQPLTADNVSTLMQNALGFALPVEGLRYWLQPSPAPTSRAKTEKDPEQ
FT                   PSRLKEITQDGWTIDYLAYAEAPATGVKRVNLTRDEPPLDIKLVLDQ"
FT   sig_peptide     complement(342835..342939)
FT                   /locus_tag="BC1003_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.844 at
FT                   residue 35"
FT   gene            complement(342939..344780)
FT                   /locus_tag="BC1003_0314"
FT   CDS_pept        complement(342939..344780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0314"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: bpy:Bphyt_0588 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56318"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6I5"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0588"
FT                   /protein_id="ADN56318.1"
FT                   /translation="MNLSFVKLFLKRPASAFRVPHAVSARRSLGAAALALWAFAAVPAH
FT                   AQDPSPDADDTSVTLSDPLGPPSADEQKALPNVQLTSQIVFQVLAAEVALQRNQPAPAY
FT                   QTYLALARDTHDPRMAQRATEIALAAQSPSDALAAAQLWQQYAPNSERAAQLDASLLVL
FT                   SGKPDDAEPLLARELARVPADNRGNAILALQLLLSRGPNRVGGLHVLQDMLKNDMNRPE
FT                   AQLAIARQQLVADDAPGAHKSLQQALALKPDYLPAALMLSQMGPEERKEGIASLEKYVQ
FT                   QNPKSHDARLALAQMYLASDRLDDAQKQFEVMHKANASDLTPLMALALIKIQQKNFTDA
FT                   QGYLTQYAQQAEKTPGADPGQAYIYLAQVSLEQKNEAAAADWLSKISPSSQQYLSAQIT
FT                   RAQLLAKQGKPDDARRQLASLRPADPRDQALVARTDAAILFDAKRYPEAETRLQQATAA
FT                   FPDDPDLTYDYAMAAEKNGHFDTMEAQLRKLIQTQPDNPQAYNALGYSLADRNQRLAEA
FT                   DKLVEKASSLAPNDAFIMDSVGWVKYRMGDTTDAIRLLRKAYTIQPNAEIGAHLGEVLW
FT                   KAGDQDQARAAFREARKLEPDNETLVKTLQRLQVNDL"
FT   sig_peptide     complement(344640..344780)
FT                   /locus_tag="BC1003_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 47"
FT   gene            344868..345698
FT                   /locus_tag="BC1003_0315"
FT   CDS_pept        344868..345698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0315"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; KEGG:
FT                   bpy:Bphyt_0589 formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56319"
FT                   /db_xref="GOA:E1T6I6"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6I6"
FT                   /inference="protein motif:TFAM:TIGR00577"
FT                   /protein_id="ADN56319.1"
FT                   /translation="MPELPEVEVTRRGIEPYVAGRKVERVEVRTPALRWPIPADLAKTL
FT                   RGHVVRNVERRGKYLLFETDSGWFIVHLGMTGTLRVLRHVPHAPAAAKHDHVDWIFDDF
FT                   ILRFRDPRRFGAVLWHPREAGDVLGHPLLASLGVEPFSPAFSGALMHRLTRGRKVSVKQ
FT                   ALLAGEIVVGVGNIYASESLFRAGIRPTTAAGRVSLVRYGLLADAVRVTLAAAIEKGGS
FT                   TLRDFVGSNGESGYFQLDYFVYDRAGQPCRVCATPIRQIVQGQRSTYFCSTCQR"
FT   gene            345784..346881
FT                   /locus_tag="BC1003_0316"
FT   CDS_pept        345784..346881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0316"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="SMART: HhH-GPD family protein; manually curated;
FT                   KEGG: bxe:Bxe_A4128 A/G-specific DNA-adenine glycosylase;
FT                   TIGRFAM: A/G-specific adenine glycosylase; PFAM: HhH-GPD
FT                   family protein; iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56320"
FT                   /db_xref="GOA:E1T6I7"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6I7"
FT                   /inference="protein motif:TFAM:TIGR01084"
FT                   /protein_id="ADN56320.1"
FT                   /translation="MSSHRSPHMSPLAPHFAPRLIAWQREHGRHDLPWQNTRDPYRIWL
FT                   SEIMLQQTQVSTVIPYYAKFLARFPDVAALAAAPVDDVMALWAGLGYYTRARNLHRCAQ
FT                   TVVEQHGGAFPASVEQLAELPGIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEG
FT                   FPGEKKVENAMWTLAESLLPSNASDDEVSAYTQGLMDLGATLCVRGKPDCARCPFAADC
FT                   VANVTGRQRELPAARPKKTVPTRRTWMLVLRDGDAVMLEKRPPSGIWGGLWSLPEAADE
FT                   AALAARAEEFGSAGGVRRLAPLTHVFTHFRLDIEPRLAELDRGVGALAALGDGQTAWVA
FT                   LSDLDSFGVPAPVRKLLDSLQGSLI"
FT   gene            complement(346924..347559)
FT                   /locus_tag="BC1003_0317"
FT   CDS_pept        complement(346924..347559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0317"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="KEGG: bpy:Bphyt_0591 peptidase S16 lon domain
FT                   protein; PFAM: peptidase S16 lon domain protein; SMART:
FT                   peptidase S16 lon domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56321"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6I8"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /protein_id="ADN56321.1"
FT                   /translation="MSSTSTVLADVPLFPLHTVLFPDGILPLKIFEARYLDMARDCLRE
FT                   KTPFGVCLLKSGAEVARENEPSVPESIGCLAEIDQCDVETFGMLLIRARGTRRFRLLSH
FT                   RVESSGLLVGMAEPLGEDRPLEDNQQLAKFGACAEVLERIIATIRERDPESLPFAEPFR
FT                   LEDPSWVSNRLAEVLPIALRARQKLMEMQDAGARIEVVHRYMQQHQLL"
FT   gene            complement(347599..348492)
FT                   /locus_tag="BC1003_0318"
FT   CDS_pept        complement(347599..348492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56322"
FT                   /db_xref="GOA:E1T6I9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6I9"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4126"
FT                   /protein_id="ADN56322.1"
FT                   /translation="MRIILITGISGSGKSVALNALEDAGYYCVDNLPPRFLPELASYLA
FT                   EDGHDRLAVAIDARSSASLDDMPAMIRDLSRAHDVRVLFLNASTQSLIQRFSETRRRHP
FT                   LSGSTAHDADVGLLTSLAEAIERERELVAGLAEFGHQIDTSNLRANVLRQWVKRFIEQE
FT                   HAGLVLMFESFGFKRGVPLDADFVFDVRTLPNPYYDHELRPLTGLDKPVIDFLDALPVV
FT                   HEMIDDIQKFLAKWLPHFRDDNRSYLTVAIGCTGGQHRSVFIAETLAARLANAANVIVR
FT                   HRDAPVEAGASSKLVA"
FT   gene            complement(348610..349578)
FT                   /locus_tag="BC1003_0319"
FT   CDS_pept        complement(348610..349578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0319"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain-containing protein;
FT                   KEGG: bxe:Bxe_A4125 HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56323"
FT                   /db_xref="GOA:E1T6J0"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6J0"
FT                   /inference="protein motif:PFAM:PF07475"
FT                   /protein_id="ADN56323.1"
FT                   /translation="MDTSSINAQSIFDDNAATLKLSWLTGHEGWERGFSSESVANATSS
FT                   ADLVGHLNLIHPNRIQVLGDAEIDYYKRQTDEDRSRHMAELIALEPPFLVVAGGVAAPP
FT                   ELVLRCTRSSTPLFTTPMSAAAVIDSLRLYMSRILAPRATLHGVFMDILGMGVLLTGDS
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFVEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKLKLIVQLVRRPDGEFQRLPLESQTVDVLGLPISKVTIQVAAGRNLAVL
FT                   VEAAVRNTILQLRGIDTLRDFMDRQRLAMQDPDSQFPGKLI"
FT   gene            complement(349718..350233)
FT                   /locus_tag="BC1003_0320"
FT   CDS_pept        complement(349718..350233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0320"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="KEGG: bpy:Bphyt_0594 PTS IIA-like
FT                   nitrogen-regulatory protein PtsN; TIGRFAM: PTS IIA-like
FT                   nitrogen-regulatory protein PtsN; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56324"
FT                   /db_xref="GOA:E1T6J1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6J1"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ADN56324.1"
FT                   /translation="MERQSNAPARRTQATFSPVNMNRLAKFLPLENVVVGLSVTSKKRV
FT                   FEQAGLIFENQNGIARSTVTDNLFARERLGSTGLGEGVAIPHGRIKGLKQPLAAFVRLA
FT                   EPIPFESPDGQPVSLLIFLLVPEQATQQHLEILSEIAQLLSDREARERLHTEEDRESLH
FT                   RLLTQWQP"
FT   gene            complement(350494..350850)
FT                   /locus_tag="BC1003_0321"
FT   CDS_pept        complement(350494..350850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0321"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="KEGG: sigma 54 modulation protein/ribosomal protein
FT                   S30EA; TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56325"
FT                   /db_xref="GOA:E1T6J2"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6J2"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADN56325.1"
FT                   /translation="MNLQISGHHLEVTPALREYVISKLDRVLRHFDQVIDGSVVLSVDN
FT                   HKEKEKRQKVEINLHLKGKDIFVESCDSDLYAAIDLMIDKLDRQVIRHKDRLQGHQHEA
FT                   IKYQPAPQLDVPPQ"
FT   gene            complement(351022..352539)
FT                   /locus_tag="BC1003_0322"
FT   CDS_pept        complement(351022..352539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0322"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: bpy:Bphyt_0596 RNA polymerase factor sigma-54;
FT                   TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56326"
FT                   /db_xref="GOA:E1T6J3"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6J3"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADN56326.1"
FT                   /translation="MKASLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVATAISQNP
FT                   LLENEDDWIASPLRVAADGSLIAQAPGSAAPPDQMGGNGSSSSSSSSERSESGEPQSVD
FT                   EYNGLAGDGNGDASQWNLDDYGRSGNASDDDDLPPLQIHESSTSLRDHLMAQLRVTQAG
FT                   QRDRALVTFLIESLDDDGYLAATLEEVLADLPQELEVDLDELNAALALLHSFDPAGVGA
FT                   RSASECLKLQLLRLEPTPTRALALDIVAHYLELLAARDFTRLRKHLKASDDDLRAAHAL
FT                   IRSLEPFPGAAYGKAEADYVVPDIMVRKTAQGWQAELNPEVVPKLRINHLYANILRNNR
FT                   GDPGSGSLRQQLQEARWLIKNIQQRFETILRVAQAIVERQKSFFVHGEIAMRPLVLREI
FT                   ADTLGLHESTVSRVTTGKYMLTPFGTLEFKYFFGSHVSTDTGGAASSTAIRALIKQLIG
FT                   AENAKTPLSDSRIAELLAEQGFVVARRTVAKYREALRIPAVNLRKSL"
FT   gene            complement(352743..353528)
FT                   /locus_tag="BC1003_0323"
FT   CDS_pept        complement(352743..353528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0323"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bpy:Bphyt_0597 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56327"
FT                   /db_xref="GOA:E1T6J4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6J4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADN56327.1"
FT                   /translation="MSTSASLPNRKPAGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGE
FT                   VVGLLGPNGAGKTTSFYMIVGLVPLDAGDIDLDGKSISLLPIHKRASLGLSYLPQEASV
FT                   FRKLSVEENIRAVLQLQHEENGKRLSKDAITSRTEALLDELQIAHLRENPALSLSGGER
FT                   RRVEIARALATNPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITDHNVRETLG
FT                   ICDHAYIISDGSVLAAGAPSEIIENESVRRVYLGEHFRM"
FT   gene            complement(353525..354196)
FT                   /locus_tag="BC1003_0324"
FT   CDS_pept        complement(353525..354196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0324"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="KEGG: bpy:Bphyt_0598 lipopolysaccharide transport
FT                   periplasmic protein LptA; TIGRFAM: lipopolysaccharide
FT                   transport periplasmic protein LptA; PFAM: OstA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56328"
FT                   /db_xref="GOA:E1T6J5"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6J5"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ADN56328.1"
FT                   /translation="MNESFPRFDTGRSRTLSACRAALAALLVALPLAGFAPLAHADRAD
FT                   KDKPLNIEADNMTYDDLKQVNIFTGHVVATKGTIMIKADRVEVTQDPQGYQYATGTSSG
FT                   GNLSYFRQKREGLDEYIEGTAVRIDYDGKQDLTTLTTNATVKRLQGLSTVMDQVHGSVI
FT                   TYDGQKDFYTAKAGKDVAGPGNPTGRVRAMLSPRNGGAAPLNGASATLAPSTSIQGAPN
FT                   Q"
FT   sig_peptide     complement(354071..354196)
FT                   /locus_tag="BC1003_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.990 at
FT                   residue 42"
FT   gene            complement(354218..354829)
FT                   /locus_tag="BC1003_0325"
FT   CDS_pept        complement(354218..354829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0325"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   bpy:Bphyt_0599 protein of unknown function DUF1239"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56329"
FT                   /db_xref="GOA:E1T6J6"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6J6"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ADN56329.1"
FT                   /translation="MNNQFRFTSLIPLVAMAALAGITWWLLQATLPRQGDRPLRPKEHT
FT                   PDYFADKFSVSELDQSGATQYRLTAQSLIHYEDDELSDLVKPAMRAFQPGKPIVTATGD
FT                   TGRVNGDASIVDLYGNARIVRSAGNGDPQMQADSEHFRVLVNDDVIETEKPVKLQRGMS
FT                   VMTASGMNYNNVTRVMQLFGNVKGAIAASDAGGSSPRQPG"
FT   sig_peptide     complement(354767..354829)
FT                   /locus_tag="BC1003_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.917 at
FT                   residue 21"
FT   gene            complement(354826..355386)
FT                   /locus_tag="BC1003_0326"
FT   CDS_pept        complement(354826..355386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0326"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; hydrolase, HAD-superfamily,
FT                   subfamily IIIA; KEGG: bxe:Bxe_A4118 phosphatase YrbI; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56330"
FT                   /db_xref="GOA:E1T6J7"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6J7"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ADN56330.1"
FT                   /translation="MAVAPPTATERASRVKLMIFDVDGVLTDGGLLFTAEGDTMKGFNS
FT                   MDGHGMKLLRQAGIETAIITGRKSGIVAARAKEMHITHVYQGIENKPQAFAELLEATGM
FT                   SAEQCGYMGDDWVDLGVMLKVGFAAAPANSHPEVIARAHWVSEARGGHGAARELCDILL
FT                   RAQHKYEALLEAACSGEQRGLVG"
FT   gene            complement(355386..356420)
FT                   /locus_tag="BC1003_0327"
FT   CDS_pept        complement(355386..356420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0327"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   KpsF/GutQ family protein; KEGG: bpy:Bphyt_0601 KpsF/GutQ
FT                   family protein; PFAM: sugar isomerase (SIS); CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56331"
FT                   /db_xref="GOA:E1T6J8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6J8"
FT                   /inference="protein motif:TFAM:TIGR00393"
FT                   /protein_id="ADN56331.1"
FT                   /translation="MHSRPGAANRRLCYTSRMIAKINGDRALALARDVLDIEADAVRAL
FT                   RDQLDGAFVGAVDFILGCRGRVVVSGIGKSGHVARKLAATLASTGTPAFFVHPAEASHG
FT                   DLGMVTADDVFLALSNSGETEELVAILPLIKRLGAKLIAMTGRPSSSLAKLADVHLNSG
FT                   VAKEACPMNLAPTASTTAALALGDALAVAVLDARGFGRDDFARSHPGGALGRRLLTYVS
FT                   DVMRTGDQVPKVMPEATVRDALFQLTAKRMGMTAIVDSEDRVKGIFTDGDLRRVLERDG
FT                   DFRALSIAAVMTADPRTIGPDHLAVEAVELMERHRINQMLVVDEAGKLIGALNMHDLFS
FT                   KKVI"
FT   gene            356543..358546
FT                   /locus_tag="BC1003_0328"
FT   CDS_pept        356543..358546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0328"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-N domain
FT                   protein; TrkA-C domain protein; KEGG: bpy:Bphyt_0602
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56332"
FT                   /db_xref="GOA:E1T6J9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6J9"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADN56332.1"
FT                   /translation="MISPLEMTLFLLLASVAGVVIFRFLNLPPMLGYLSVGIVVGPNAL
FT                   GLVPDSVGAQNLAEFGVVFLMFSIGLEFSLAKLRSMRRLVFGLGLLQVLGTIVVAVSLG
FT                   FMFERWVHIKWQASIALGGALAMSSTAIVSKMLAERLEIETEHGRNIFGVLLFQDLAVV
FT                   PLLIIISALGGDSKDLVSSLGVAAIKIVVALSLLLIVGQRFMTRWFNVVARRRSQELFI
FT                   LNLLLVTLGAAFITDKFGLSLALGAFIAGMLIAETPYRHQVEEDIKPFRDVLLGLFFIT
FT                   TGMLLNPLVIWQHPFVVLGFLIGPTLLKVVMITGLSRLFGASPGVAMRTGIGLAQAGEF
FT                   GFVLLNLILDKHLVDATLLQAILAAMLLSMLAAPFLIQNADRIVLRLSSTEWMMQSLQM
FT                   TRIATQSLKQSGHVIICGYGRSGQNLARMLENEGLSYVALDLDPDRVQAAAAAGESVVF
FT                   GDAGRRESLLAAGIHRAAAIAITYANTPSALRVLHNIHELEPTLPVIVRTVDDADLEKL
FT                   LAAGATEVIPEIVEGSLMLASHTLVVMGVPMRRVVRRVEEMRDERYALLRGYFHGADDM
FT                   DDDDGHEQVRLQSVPVDESADAVGRTLADLGLYELGVEVTAIRRHGIRGVEPDPSTKLR
FT                   ASDIVVLRGLPEQLAQAEERLSKHRRAGAAAA"
FT   gene            358625..359191
FT                   /locus_tag="BC1003_0329"
FT   CDS_pept        358625..359191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0329"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0603 adenine
FT                   phosphoribosyltransferase; TIGRFAM: adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56333"
FT                   /db_xref="GOA:E1T6K0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6K0"
FT                   /inference="protein motif:TFAM:TIGR01090"
FT                   /protein_id="ADN56333.1"
FT                   /translation="MSNALASAPLDAADYIKSHIRTVADWPQPGVQFRDITPLLREPKS
FT                   LRVLIDLFVQRYIDAQLDYVAGLDARGFIIGPILAYELNLGFIPIRKQGKLPYKRASQS
FT                   YELEYGTATVEIHEDACKPGDRVVIMDDLIATGGTMMAGKILLERLGAVVVEGAAIIDL
FT                   PELGGSKLLAGGGLPLYTVTSFAGH"
FT   gene            359328..359942
FT                   /locus_tag="BC1003_0330"
FT   CDS_pept        359328..359942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0330"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56334"
FT                   /db_xref="GOA:E1T6K1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6K1"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADN56334.1"
FT                   /translation="MPNSALFLATSIAITMAPGPDNLQVLARGISQGRAAGLVAALGFA
FT                   AGITFHTTLAALGVAALLRSSPLAFHGIKLAGAAYLIWIGIKALRNQGLATAHERAPQP
FT                   LLSVFRQSVFGNLLNPKVTLFFVVFLPQFVQTDGAQSVTVQMLELGALFMLQTLVVFSL
FT                   FGVCAGMIGAWLRRRPRVGVWLDRLAGATFIALGIRVALRD"
FT   gene            360004..360879
FT                   /locus_tag="BC1003_0331"
FT   CDS_pept        360004..360879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0331"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bpy:Bphyt_0605 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56335"
FT                   /db_xref="GOA:E1T6K2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR031804"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6K2"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADN56335.1"
FT                   /translation="MSLPCLTAARRFDVGAHLPFWIDAEQVGWIRSGDVHLLERWPDVF
FT                   EIDGTRITLAPAFNTVDLRSAALASVIGALAAEGRIPGWRNETYAIRNAFDARPLAYIE
FT                   RAASRFFGTMTYAVHLNGVVEYAHGGAPGGAPRLWIARRSETKATDPGMLDNVVAGGIG
FT                   WGFSVETTIVKECWEEAGIPEEIAVRAVAGRTAHVLQSLPEGTQAEQIFIYDLVLPADF
FT                   VPRNQDGEVGEHRLARIDEVARWIEEGAMTVDASLATLDCLLRRRWIDEEACAGIETLF
FT                   APPLPAVRAP"
FT   gene            360947..361816
FT                   /locus_tag="BC1003_0332"
FT   CDS_pept        360947..361816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0332"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="KEGG: bpy:Bphyt_0606 formyltetrahydrofolate
FT                   deformylase; TIGRFAM: formyltetrahydrofolate deformylase;
FT                   PFAM: formyl transferase domain protein; amino acid-binding
FT                   ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56336"
FT                   /db_xref="GOA:E1T6K3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6K3"
FT                   /inference="protein motif:TFAM:TIGR00655"
FT                   /protein_id="ADN56336.1"
FT                   /translation="MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRT
FT                   GEFFMRVHFQQVGGDPGLEALRASFATLAEQFGMSWELHDASVKPRVVIMVSKIGHCLN
FT                   DLLFRYRTGQLNIEIPAIISNHKEFYQLAASYDIPFHHFPLLGGTPEAKAAQEARVLEV
FT                   IDEHQADLVVLARYMQILSPKLCEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIG
FT                   ATAHYVTTDLDEGPIIEQEVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLN
FT                   GSKTVVFR"
FT   gene            complement(361871..363136)
FT                   /locus_tag="BC1003_0333"
FT   CDS_pept        complement(361871..363136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56337"
FT                   /db_xref="GOA:E1T6K4"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6K4"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4111"
FT                   /protein_id="ADN56337.1"
FT                   /translation="MRGQLVRLHRWFGVATALFLFVAGLTGAIIAWDHELDAALNPSFF
FT                   KARTAGPALSGLELARRVEAADPRVQVTYLPLAAEPGHTLQMMVLPRTNPATREPYKLD
FT                   FNQIAVDPATGEVQGRREWGAFSLSRINLLPFVYKLHYTLHLPFTGGVDLGVWLMGVVG
FT                   IIWLFDSVIALWLSFPSVKSWRKSFAFRFGRGGYALTFDLHRSGGVWIWGLLLMVALTS
FT                   VSMNLAAPVVRPIVSMFSTLTPDPINNPEIARAPQPGDGVLSRERIVQIAEEAGKAQHI
FT                   AAPPGGIYYAEFVHAYGVGFFQTGNDHGDMGLGNPWMYWDAATGKLLGKQIPGRGTAGD
FT                   IFMQVQYPLHSGRILGFGGRILISAVGIAVAVLSATGLLIWLKKLNARRRAAHKADEAQ
FT                   KAPVTREPGRTPARPREEIAAE"
FT   gene            363457..365643
FT                   /locus_tag="BC1003_0334"
FT   CDS_pept        363457..365643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0334"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="KEGG: bcn:Bcen_2864 TonB-dependent siderophore
FT                   receptor; TIGRFAM: TonB-dependent siderophore receptor;
FT                   PFAM: TonB-dependent receptor; TonB-dependent receptor
FT                   plug"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56338"
FT                   /db_xref="GOA:E1T6K5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6K5"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ADN56338.1"
FT                   /translation="MNEHSGVTRPRKTRRMRRLNWAACLALTATQGALAQQVPAAPAAA
FT                   SASAPADGDDKALPTVKVTAAQDTAQHLKEDVGSGALGSRSQLDTPFSTTVVTSEELQD
FT                   RQPSKLGDVFATDASVSDNGNAYNAWATYLTVRGMQLDWQSGFKIDGMPFNSYGVTMPY
FT                   EQLEKVELLKGLTGFMYGFGAPGGVVNYVTKKPPVSTTPVRSVDVGYYTDGVWTEHADL
FT                   GGRVGPNGMFGYRLNATHEEGKTYNDGNVRRDSVSVALDARLTRDLKATFGALYQERHS
FT                   TGITGAISTAQYTGTSLPHTLSGGTGDLSGPDQHLNTNLQLYTAGLQYNLGEDWTLNAS
FT                   YSYSKSSRDRNESTYYLLNGAGDYTDSRFAGKEGHQLSLWQVSAEGRVKTGPLVHQLVL
FT                   GAAYQRQTNDYGANSFFGQIGTGNIYQPNTNTFYSASNYYTYRDSDITQKALFASDTIQ
FT                   LTQRWSVLGGVRYTNYEQHGYSTTGATTSTYSQNGVVTPTVAVMFKLAPTTTLYTSYVE
FT                   SLEAGTVVGDTYANRGELLKPLRSKQYEVGIKTEHSRWSATAALFRIERGAAYANSANV
FT                   YTQDGESIFQGIEMGGDVRLGSHWNVGGDLMWINTKYERGAANNGNRVAGAPQFVVAGH
FT                   ATYSVPYVPGLRIGADAKFTGNTNVRPSANLNAPGYMLVNLGASYATRIAGYDVTFRAA
FT                   IDNLLNRRYWEYQYADYVTPGDPRTLSLNARIDF"
FT   sig_peptide     363457..363564
FT                   /locus_tag="BC1003_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.963 at
FT                   residue 36"
FT   gene            complement(365709..366794)
FT                   /locus_tag="BC1003_0335"
FT   CDS_pept        complement(365709..366794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56339"
FT                   /db_xref="GOA:E1T6K6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6K6"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0608"
FT                   /protein_id="ADN56339.1"
FT                   /translation="MAKRNQASENGQVQDLRPRPVRLTSNMSLPKLSAVEIGSYVLMLL
FT                   GMWAVIQLRLLGALLAGLLVFQLVHTIAPRIERHMSSGRARWLAVVFLATVIVGALTGL
FT                   TLGIIEHFENDVPSVQKLLDQAMQLIDQARGRIPQFIASTLPVDTEQMKTKAAELMQTH
FT                   ANMLQQSGKTAARAFTHILIGMIIGAIIAVSAQKQMQRLPLSTAFVTRVTRFADAFRRI
FT                   VFAQVKISAINAVFTGIFLLVVLPIFHDQLPLSKTLVLITFIVGLLPVIGNLISNTIIV
FT                   AVALSVSFPAAVMSLAFLILIHKLEYFLNARIVGGQIEARAWELLVAMLVMEAAFGLPG
FT                   VIAAPIFYAYIKRELIYLRLV"
FT   gene            complement(366828..369701)
FT                   /locus_tag="BC1003_0336"
FT   CDS_pept        complement(366828..369701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0336"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="KEGG: bpy:Bphyt_0609 excinuclease ABC, A subunit;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56340"
FT                   /db_xref="GOA:E1T6K7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6K7"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADN56340.1"
FT                   /translation="MEQIRIRGARTHNLKNVNLDLPRHQLVVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLFARVGTPYCPDHEIPLEAQSVSQMVDAALALPEETRLMILAPVIADRKGEHV
FT                   ELFEEMQAQGFIRFRVRSGGGTANEGAAKIYEVDSLPKLKKNDKHTIDVVVDRLKVRPD
FT                   MKQRLAESFETALRLADGRAIALEMDTDKEHLFSSKFACPICSYSLQELEPRLFSFNNP
FT                   MGACPECDGLGQITFFDPKRVVAHPSLSLAAGAVKGWDRRNQFYFQMLQSLAAFYDFDI
FT                   DTAVEDLPEKVRKILLFGSGKQEIPFSYINERGRASVREHVFEGIIPNLERRYRETDSA
FT                   AVREELAKYQNNQPCPACAGTRLRREARFVRIGADGDARGIYEISGWPLRDALGYFQTL
FT                   RLEGSKREIADKVVKEIVARLMFLNNVGLDYLSLERSAETLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLIATLKHLRDLGNSVIVVEHDEDMIRMADYVVDMGPGA
FT                   GEHGGMVIAEGTPKEVERNAASMTGQYMSGARTIEYPDERRDPDDRRLRIVEAHGNNLR
FT                   HVTLDLPVGLLTCVTGVSGSGKSTLINDTLYQAVAHHLYGSSTEPAPYESIEGLEHFDK
FT                   VINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPAAKERGYDPGRFSFNVKGGRCESC
FT                   QGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLDVQYKGKNISEVLDMTVEHAYEFFKP
FT                   VPVVARKLKTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPTT
FT                   GLHFHDIALLLEVIHRLRDQGNTVVIIEHNLDVIKTADWVIDMGPEGGAGGGQIIAQGT
FT                   PEQIAKSKASFTGKYLAPLLKRAASKK"
FT   gene            370092..371249
FT                   /locus_tag="BC1003_0337"
FT   CDS_pept        370092..371249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0337"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0610 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56341"
FT                   /db_xref="GOA:E1T6K8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6K8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56341.1"
FT                   /translation="MSAPELRATVSLAAIFALRMLGLFMIMPVFSIYAKTIPGGENVLL
FT                   VGIALGAYGVTQSMLYIFYGWISDKVGRKPVIATGLLIFALGSFVAAGAHDMTWIIVGR
FT                   VIQGMGAVSSAVIAFIADLTAEEHRTKAMAMVGGSIGISFAVAIVGAPIVFHWVGMSGL
FT                   FTLVGVFSILAVGVVLWVVPDAPKPVHVRAPFAEVLHNVELLRLNFGVLVLHATQTALF
FT                   LVVPRILEAGGLPVASHWKVYLPVMGLSFVMMVPAIIAAEKRGQMKTVLLSAIALILFG
FT                   QLLLGVAPHTILSVAAILFVYFLGFNILEASQPSLVSKLAPGNRKGAAAGVYNTTQSIG
FT                   LALGGMIGGWLLKVDGQSAVFFTCSGLVLCWLIIAAKMKQPPRKA"
FT   gene            371442..371978
FT                   /locus_tag="BC1003_0338"
FT   CDS_pept        371442..371978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0338"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: bpy:Bphyt_0611 single-stranded DNA-binding
FT                   protein; TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56342"
FT                   /db_xref="GOA:E1T6K9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6K9"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADN56342.1"
FT                   /translation="MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASG
FT                   EMKEATEWHRVSFFGRLAEIVSEYLKKGSSVYLEGRIRTRKWQAQDGTDRYSTEIVAEQ
FT                   MQMLGGRGGSMGGGDEGGYSRGEPSERSGGGGGRAMSGGGSRGGSGGGGGGGGSSRPSA
FT                   PAGGGFDEMDDDIPF"
FT   gene            complement(372050..372850)
FT                   /locus_tag="BC1003_0339"
FT   CDS_pept        complement(372050..372850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56343"
FT                   /db_xref="GOA:E1T6L0"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6L0"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4081"
FT                   /protein_id="ADN56343.1"
FT                   /translation="MSEIGSALVVFVLLLAATGFGVWVRPLLPEEHKAHETVQLVQLVI
FT                   GMLVTFAALVLGLMTASAKSSFDTAANDLRTYAADIIELDMTLREYGGDTDTARKLLRV
FT                   YTAAAIASTWPQEPAPAGDYPRNIGTTVNSQKLENVRLGELLTSVGQQLRQLRAHDPLQ
FT                   QRALDDGLTQFRRVVDARWKIIEEAHSSISQPFFKTLTFWLCVIFLSFGLIAPRNALAL
FT                   VTISLGAVSIASAIYVIVDLDTPLTGPIMISSSPMRDALVHLER"
FT   gene            373151..374812
FT                   /locus_tag="BC1003_0340"
FT   CDS_pept        373151..374812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0340"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bpy:Bphyt_0620 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56344"
FT                   /db_xref="GOA:E1T6L1"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6L1"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADN56344.1"
FT                   /translation="MLKNLSIRSCLTLMIAFFAVALLLGAAAGLLSLRSSNASLQQMYT
FT                   VDTPAVADLEGSAGQLLRLRLALATYASLVDLNDQDGANAVLKRFAQYQKGSDERLAHY
FT                   VSRASTDDDEQRLIKDMQMKRDTFLHEGVEPALAALKAGDRPTFQQLQAHKLPSLYSAY
FT                   EKAMLALEQLQLDHGAQRYQSAQDLFYAICVTVAIGIVVSLVGSLIGRAVLVRAIVSPV
FT                   DATIAQFQRIANGDLTGRIVVTSNNEMGRLAAALRKMQESLIATVSSVRQGTESIDSGV
FT                   SEIAAGNTDLSQRTEEQAASLEQTAASIEELTSTVKQTADNAKEASSLAQGASTLAAQG
FT                   GELTEKVVGTMHEIVDDSRRIADIVGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   ASEVRSLAQRSAAAAKEIKALIEASTARVENGSQLVERSGSTMTEIVQAISRVSSIMGE
FT                   IAAAANEQSTGIDQVNLAVAQMDEVTQQNAALVEQAAAAASSLEEQARRLSAAVAVFRT
FT                   DGGSSAPHGVAGLRDRSVQGAGEPSVTNPADEWAAA"
FT   sig_peptide     373151..373267
FT                   /locus_tag="BC1003_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.722 at
FT                   residue 39"
FT   gene            complement(375307..376116)
FT                   /locus_tag="BC1003_0341"
FT   CDS_pept        complement(375307..376116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0341"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bpy:Bphyt_0621
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56345"
FT                   /db_xref="GOA:E1T6L2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6L2"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADN56345.1"
FT                   /translation="MSQERVFSLRNPWFTVSVGGTVAIAAVSILIGFVWLPSANSAFAN
FT                   RGLWATICGAAGVPSSWYSGANISGPAPSDVVVLPPLRRVRADAISIGRGATIATQNCS
FT                   MCHGVVGNVQITAPALAGQYADVVYKELRDYQQGVRQNAIMQPIVAARSDQDLHDLAAY
FT                   YASLPRSPAAEVAPTGSTPDATAVRLAMQGDPQRNIAPCAACHGQLDRKGSAPWLGGQS
FT                   SVYLAAQMRAFASGARHNDINEQMRNVTRKMTSAEIDSLAKYYAAMQ"
FT   gene            complement(376113..377738)
FT                   /locus_tag="BC1003_0342"
FT   CDS_pept        complement(376113..377738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0342"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   bxe:Bxe_A4078 putative cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56346"
FT                   /db_xref="GOA:E1T6L3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6L3"
FT                   /inference="protein motif:PFAM:PF00115"
FT                   /protein_id="ADN56346.1"
FT                   /translation="MFHAKRLVLAHFWLAFIAFIIALFLGAWQMLVRSPLAPWIGDPEL
FT                   YYRSVTAHGSVMAYVLPTLVSMGFGYAIVELALGQRLAGLKWAWAAFIMLTVGAVMAMV
FT                   PVALGKASVLYTFYPPMIGSPFYYLGVVLVVVGSWIWVALMHVNLRIWRRANPGKPVPL
FT                   AMFANVAGAYLWAWTAVGAALEILLQILPVAFGLKNTIDAGLSRVLFSWTLHAIVYFWL
FT                   IPAYIAYYTLVPRAIGGRLYSDSMARVSFILFLVFAMPIGIHHLFADPQVGSGFKFLHA
FT                   VFTGMVSVPTLLTVFTICASVEIAGRLRGGKGAFGWLTALPWQNPMMLVVAFSFVMLGL
FT                   GGAGGLINMSYQLNTTVHNTQWVTGHFHLIFGGAIVIMYFAIAYELWPQLTGRAIVSLK
FT                   LVRTQLWLWFIGMLVVTLPWHYVGLLGAPRRMAYYDYQMPGLEAQAFWVGMSAVGGLIL
FT                   VVSGALFIYILAKSQFGPAVAQQGFRFASPVHPVERVPAALNTFGLWVALMIGLTVVNY
FT                   SVPIFQLLKLPQTSVPAVVVGAQR"
FT   gene            complement(377725..378306)
FT                   /locus_tag="BC1003_0343"
FT   CDS_pept        complement(377725..378306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0343"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   bpy:Bphyt_0623 cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56347"
FT                   /db_xref="GOA:E1T6L4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6L4"
FT                   /inference="protein motif:PFAM:PF00116"
FT                   /protein_id="ADN56347.1"
FT                   /translation="MSTHSPDSQHPPGSGHAVAVRAERRWAIFVSALILLMLAVIVFSG
FT                   LHWAMMPPSRVETIDPSRLQLSGEFVEDNLGSAVEPDGSVVVRFIAQQYSFTPQCLLVP
FT                   ADTPITIRATSADVVHGLLITDTNINTMVVPGYVATLDTRFDAPGDHTMPCHEFCGFGH
FT                   QAMWAHVKVIDKAAFFEQARQSRRLSCVSR"
FT   gene            complement(378309..378485)
FT                   /locus_tag="BC1003_0344"
FT   CDS_pept        complement(378309..378485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56348"
FT                   /db_xref="GOA:E1T6L5"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6L5"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4076"
FT                   /protein_id="ADN56348.1"
FT                   /translation="MEANETRSARPSTEEELERVVAAGPHGAVAVAGVATLIVMAIWFA
FT                   FYFLVFLPRGVVH"
FT   gene            complement(378538..379881)
FT                   /locus_tag="BC1003_0345"
FT   CDS_pept        complement(378538..379881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0345"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="KEGG: bpy:Bphyt_0625 gluconate 2-dehydrogenase
FT                   (acceptor); PFAM: cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56349"
FT                   /db_xref="GOA:E1T6L6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6L6"
FT                   /inference="protein motif:PRIAM:1.1.99.3"
FT                   /protein_id="ADN56349.1"
FT                   /translation="MKSLLRSTRLLTRRRLPLLVAVALVTASALLARMHAPSPLLVAEA
FT                   RAAEKAQPVKSSASTDTRPDIVKRGEYLARAGDCVACHTAPRGKLFAGGLAMETPFGTL
FT                   YSPNITPDAQYGIGTWSEEAFFRMMRTGITPEGNLLYPAMPIAQYTKVTREDSDAIFAY
FT                   LKSVEPVREANRKHTLRFPYNQRKLLYGWRTLYFREGEFKPDPTRSVEWNRGAYLVEGL
FT                   GHCTMCHTKINMLGGSSQSEQFAGGLIPVQNWYAPSLTSDKDGGLGDWSIKDIVDLLQA
FT                   GISDRGAVYGPMAEVTYHSLQYMTDEDVRAMAVYLKTLPDNSGRKTGPSAATDTNLFAL
FT                   GEKIYGDKCALCHGAKGEGQLQHYPPLAGNQSIEMDSAVNPIRIVLNGGFPPGTKRNPE
FT                   PYGMPPFAQELNDTEAAAVVTYIRTAWGNHGKPVTAHEVNELRNAPLH"
FT   sig_peptide     complement(379753..379881)
FT                   /locus_tag="BC1003_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.390 at
FT                   residue 43"
FT   gene            complement(379878..380594)
FT                   /locus_tag="BC1003_0346"
FT   CDS_pept        complement(379878..380594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0346"
FT                   /product="putative periplasmic cytochrome c protein"
FT                   /note="KEGG: bpy:Bphyt_0626 putative periplasmic cytochrome
FT                   c protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56350"
FT                   /db_xref="GOA:E1T6L7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6L7"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0626"
FT                   /protein_id="ADN56350.1"
FT                   /translation="MHRRALGFAVVFVLHMLWSGTALAAGAVAGAMPSAMDERVRACTS
FT                   CHGVQGQGLNNDYFPRIAGKPAEYLFNQLTAFRDGGRTYPPMGYLVAFLPDEYLRKISQ
FT                   YFADLQPPYPNADQSDVTPAVLAAGQRLVQQGDPARKIPACIACHGERMTGQQPGIPGL
FT                   LGLHASYIAGQMGTWRSGTRHALAPDCMRSIAVKLTDKDITAVSTWLARQPRPSDPRPA
FT                   PASAKRLPLACGSQPQ"
FT   sig_peptide     complement(380520..380594)
FT                   /locus_tag="BC1003_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(381021..381908)
FT                   /locus_tag="BC1003_0347"
FT   CDS_pept        complement(381021..381908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0347"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A4073 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56351"
FT                   /db_xref="GOA:E1T6L8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6L8"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADN56351.1"
FT                   /translation="MSQRGFDLAQLRTFVAVADSGSVSAGAERVFLSQSSVSEQLKKLE
FT                   ERAGQPLFVRSKQGVSATPAGSRLLEHARRIIAMNEAAFEDLQGRLLDGELRIAVTDYY
FT                   RPHDVARILKTFSEQHPRLKLHVTVLPSAVIDSQAGDDASFDIGLSLRLVAGKPNAPAA
FT                   RGSVQGTVVRREKLLWVSAADASPRPTAPYQLVLLPASCQLQRFVVKLLDENKVPYVVS
FT                   HSASGVAGLQLALKAGLGISCLNESSIGAGVVACPPGIGLPPLPAVEFHLLPGRIGESE
FT                   QVSNARTALMRLFS"
FT   gene            382004..383404
FT                   /locus_tag="BC1003_0348"
FT   CDS_pept        382004..383404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0348"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0628 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56352"
FT                   /db_xref="GOA:E1T6L9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6L9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56352.1"
FT                   /translation="MENGLTASRLMAGSRPASHRWKVLGVGFAANASFSAAFSGIPMTA
FT                   VYLRSGYHLGNDGLGFVFGMLGLGIAVSELPWGLLTDRWGDRRVLLLGLLSTAAALAGL
FT                   AAFAAPFGSYVPHVATLALGLLLVGLLGGSVNGSSGRAVMAWFQEGERGLAMSIRQTAV
FT                   PAGGGLGALLLPVLAARFGFVSVYAVLALACAITAAFAWQWLHEPAQSDARETRVGAEG
FT                   EGPRAPRRMSAENVVSGAHAARVPDAARERHARTRSPLREIGIWRVALAAGALCVPQLA
FT                   VVTFGTVFLHDFGHADVLLISIAMAAVQVGAGIARVWSGRWTDRRGNRRAYMRGCSLLT
FT                   AVLFAALALATAVSGMQHAAVATITWLLASMTVLGGVIVSAWHGVAFTELATLAGTKRA
FT                   GTALAIGNTCVFLTLFLTPLAIPPLLSLGSWPLVWAVASVSALIALPVFPQPLAAERPC
FT                   VSQTCDAG"
FT   gene            383799..384159
FT                   /pseudo
FT                   /locus_tag="BC1003_0349"
FT   gene            384334..385023
FT                   /locus_tag="BC1003_0350"
FT   CDS_pept        384334..385023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0350"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bpy:Bphyt_0630 two component transcriptional
FT                   regulator, LuxR family; PFAM: response regulator receiver;
FT                   regulatory protein LuxR; SMART: response regulator
FT                   receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56353"
FT                   /db_xref="GOA:E1T6M0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1T6M0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN56353.1"
FT                   /translation="MGDTAEVSTPVRAIIADDHPLVLLAIENLMSGYPNVEVVGRAGDA
FT                   SELFAEVERTGCDLVVMDLYMPGGADGNGIEAVRQFRQRYPNVPLVVLTMETEATALQS
FT                   VISLGVQALISKRDRIDLIHVAVVTALAGECYLGPAVRAVIAEATAMQRLDFVRSVLSR
FT                   RELEVFTQYASGLGVTEIASRLGRSVKTISAQKCTAMRKLALHSDAELFRFAVEHGVVS
FT                   EARTEGR"
FT   gene            385142..385786
FT                   /locus_tag="BC1003_0351"
FT   CDS_pept        385142..385786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0351"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="manually curated; PFAM: regulatory protein LuxR;
FT                   response regulator receiver; KEGG: bpy:Bphyt_0631 two
FT                   component transcriptional regulator, LuxR family; SMART:
FT                   regulatory protein LuxR; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56354"
FT                   /db_xref="GOA:E1T716"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E1T716"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADN56354.1"
FT                   /translation="MANKIRVMVADDHDCVRVGVTRLLRARPDIEVVGQACDTHGLAEL
FT                   LEVCECDVIVTDIGMPGLDGGDNAVSFLRRVLRGHAHPPVVVLTMIGRANMLSGLLRLG
FT                   VSAIVDKRDTAAALIDAIEAAMAADVYLSEHVRIAMKGTQAVPQLRDGILSAREWEIFQ
FT                   LYARGLAVHEIADRLQRSGKTISTQKRSAMRKLGLNTDDDLIEYARQIGLT"
FT   gene            386024..386770
FT                   /locus_tag="BC1003_0352"
FT   CDS_pept        386024..386770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0352"
FT                   /product="major intrinsic protein"
FT                   /note="PFAM: major intrinsic protein; KEGG: bpy:Bphyt_0632
FT                   major intrinsic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56355"
FT                   /db_xref="GOA:E1T717"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:E1T717"
FT                   /inference="protein motif:PFAM:PF00230"
FT                   /protein_id="ADN56355.1"
FT                   /translation="MAVLGKRLLVEGVGTAWLVFIGCGSIVLNTGSAQQGYGILEVSLA
FT                   FGLALATASYWFGETSGAHFNPAVTVGFTAAHRFPVKDLLPYIAAQILGAVAAAALLVY
FT                   VANGRPGFELGASEFAANGFGDHSPSDYKLHSALVIEFVLSFAFVMVSLVAASRFKAEP
FT                   GGPMVVGGCLALIYLVSIPVTNGSVNPARSTAQALFVGDWALDQLWLFWAAPMSGGVVA
FT                   GFLFSLLGGTSDQSAAALADGHSEAV"
FT   gene            386779..391245
FT                   /locus_tag="BC1003_0353"
FT   CDS_pept        386779..391245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0353"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; extracellular solute-binding protein family 3; PAS
FT                   fold-4 domain protein; response regulator receiver; Hpt
FT                   domain protein; KEGG: bpy:Bphyt_0633 PAS/PAC sensor hybrid
FT                   histidine kinase; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; extracellular
FT                   solute-binding protein family 3; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56356"
FT                   /db_xref="GOA:E1T718"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1T718"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADN56356.1"
FT                   /translation="MALHLIFMRFKSAATARALGCVSMWLVALALFAAAQLTAVAKPFG
FT                   GSASGRSPTAFPQKIVVGVLVDNWLPFDALQDGQLRGLSVDYLRALVGPDVVLEAKAFP
FT                   DMPQLLTAACAGEIDLLLSVARIPERERCISYTAPYFQASTSAVVRRDGESYEGPAQVA
FT                   AASISVEKGFALERSLRERFPRARISAFTSTHAALAAVAHGDSDVYMGFTPAVQYALAT
FT                   EEFRSLRVAFEERGRSAELRFGVPRSRVALRDSLDRALASMTQTDETAIRVRWLSGNFG
FT                   AKPEPVTPRLELTEQEQIWLRSLPPLEVGFDSSWPPFSYIDSSGQPAGITADYLAYLSR
FT                   TLGVVFHRARQPDWPSTIEAFQRGQLAILTTGSSADPRLAKAQHTRAYESYPLVMVGRD
FT                   DEPAARSLSDFAARRVVVSSHVAGVDPLAFQRIPADHVAVAPSLDEALRMVASGEADVV
FT                   VENVAAVDVVLKRQYAGVLKILGTVGESDALDFAVRADLAPLAGLIDRALLAMPPAEKQ
FT                   RIRRNWVTGNAVGTGKWSVSAVRLLPVLIGVGVALLVTLRAYLLLQREVRRRKKTEREL
FT                   ALQLNFQETMMKMVPYPLVAQDLQGRYIAVNGAYEQACGHSREAVLGRTTMEVQTWGEV
FT                   NSEVLDNMRRDLLEGGDTAQVELQFERAPGDLRHGLFWTSICRGNDGQPVCSLGTMVDI
FT                   TDIRRAEMRARDTERRLFDVTRSLPAVVFQLRRTPEGAYSFPYIGGAPQLLLGAGQIRP
FT                   AGRDHADFERICSEDRSFVIAELERSARLETPLLIEFRMGPEQALKWTRAELVPRREAD
FT                   GSVVWSGYWVDASIEHARAEELARARDVAEAASRAKDDFFAMMSHEIRTPMNGVLGLVE
FT                   VLERTPLNADQGEMLGMIHESAGALLQILDDLLDYSKIEAGRLTIEAEPIDLRELVDNA
FT                   VGLLAGRAHEKGLKVRVDIAPDVAATLRGDSVRLRQVLFNLLGNAIKFTPEGKVEVSVS
FT                   VVEHTDAQQTIEMVVEDTGIGIAADVQAKLFEPFVQAESSTTRRFGGTGLGLTICRKLI
FT                   ELMNGSLTLDSELGRGTRMTVRLGLPVETPGYSVSGLRDKRCLVATNDARVGQALVHFG
FT                   QALGLELRCLPADAAQLRCTAALNGVDLLFVSEDVALPANVKRKLRVISLTEKAKPTGY
FT                   RVLKDNVRLSVNPISWRGLSAACAAAMTGLQSAPPSSGGAAGVPEGITTPPDRERAMAS
FT                   GRLILVAEDHPVNQELIRHQLALLGFACDVANDGAEALAALEHTSYGCLITDCHMPNLS
FT                   GYELTRRVREREREQGGSHRLPILGITANTAPEDLRQCREAGMDESLVKPTRLATLREY
FT                   LSRWFGTDSGWQSASAEISDVSETAGSATAAEPFVPVDLGHMTQLWGSESTVKALLDSF
FT                   VSSVREDIQSLAPLLENADMVRVREWLHRVVGAASVLQYPPLISALEEYRRGILRAPER
FT                   ARRDGLELIERCSAMLDGIEQQAALLA"
FT   gene            391692..392126
FT                   /locus_tag="BC1003_0354"
FT   CDS_pept        391692..392126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0354"
FT                   /product="CHRD domain containing protein"
FT                   /note="KEGG: bxe:Bxe_A4065 hypothetical protein; PFAM: CHRD
FT                   domain containing protein; SMART: CHRD domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56357"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:E1T719"
FT                   /inference="protein motif:PFAM:PF07452"
FT                   /protein_id="ADN56357.1"
FT                   /translation="MITLKKLNLAVALWAAMAGVAFADTVALKADLEPSSEVPPRVSHG
FT                   HGALSATFDTSTKSLQWTVSYEGLSGPVTAAHFHGPAPVGQNAKVQVPIEKNALASPMK
FT                   GSAALNEQQVTDLMAGQWYFNIHTAQNPMGEIRGQVLPAN"
FT   sig_peptide     391692..391763
FT                   /locus_tag="BC1003_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            392308..393273
FT                   /locus_tag="BC1003_0355"
FT   CDS_pept        392308..393273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0355"
FT                   /product="putative lipase/esterase"
FT                   /note="KEGG: bxe:Bxe_A4064 putative lipase/esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56358"
FT                   /db_xref="GOA:E1T720"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:E1T720"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4064"
FT                   /protein_id="ADN56358.1"
FT                   /translation="MSWQSALACWFLRRRFRPQTLKPHIDVSHARALTEKRVWSPEVPR
FT                   GWRLRELDGAGGKSLRGEWLERTGGEPASGTPALVLYCHGGGYYFCSPRTHRSIVFGLA
FT                   TRANAPVFSLDYRLAPEHRFPAALDDATAAYRQLIAEGVPPRSIVIAGDSAGGGLALST
FT                   LVALRDAGDPLPAGGLLFSPWTDLAASGASIVDNDGADPMFSGPAIARAAKVYLGDMPA
FT                   THPYASPVYADLRGLPPLFMMAGSTEVLLDDSRRVAAHARAAGVDCELEVWSKMPHVWP
FT                   IFAPFIPEANRALDRAAEFIRHATSRGAHAAQASSVTSMV"
FT   gene            complement(393243..394085)
FT                   /locus_tag="BC1003_0356"
FT   CDS_pept        complement(393243..394085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56359"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:E1T721"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0636"
FT                   /protein_id="ADN56359.1"
FT                   /translation="MEPGSLATQLLSEEDLGALRRAKHELESPALAMKLASIVGAPLEK
FT                   LISRMPAFANEKVTDATELALRKCLSIALRTLGRRDGASASLTLDKPSNLLHKFAVATT
FT                   GAAGGAFGLFALPVELPVTTTLMFRSICDIARSEGEDLKSIDTQLQCLTVLGMGGTSSA
FT                   DDDADFGYFIMRGALAQTVSKASSEVATKGFTTHGSAALMRLVNTIAARFSVQVSEQIA
FT                   AKSIPAIGAVLGAMVNTVFIDHFQQVAHGHFTVRRLERQYGEHAVKAAYQTIDVTLDA"
FT   gene            394226..395821
FT                   /locus_tag="BC1003_0357"
FT   CDS_pept        394226..395821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0357"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0637 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56360"
FT                   /db_xref="GOA:E1T722"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T722"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56360.1"
FT                   /translation="MAVHTAAHHSSGQVLPFRESLLSMLGISFVTMLVALDQTVVGTAL
FT                   PTIVAELKGFELYAWVATSYLLTSVITVPIFGRLGDYYGRKPFVIASIVVFTGASVLCG
FT                   VADNMLFLVLARGLQGIGGGMLVGTAFACIPDLFPDSVVRLRWQVLMSSAFGIANAVGP
FT                   SLGGFLTQYYGWRSVFYVNLPVGMLSLFFVWRFLPHLRHVEHEGKMRLDWPGAALIAVA
FT                   LGSLQLFVELLPKHGLSWGACALLVLSVASAYALWQWEKRCPTAILPVDMFRNRSLAAL
FT                   FTLAVLGGFTMFSLLFYAPLLFQGGFGMSPKEAGVVITPLVVFITIGSIANGRVVSRVR
FT                   NPNLMLYVGFTLLALACVGAVIATRSMPHWLLMSFMVLGGLGLGFVMPNLTIFAQQTAG
FT                   REHLGIATALLQSLRMIGGMIGTALTGTLVSHMYASGVRSALERDRASQWFGDLSDPQI
FT                   LINHEAQASLLGQLAHAGHNGAMLLETARETLVAAIHFGLAMAAIIAVVSVWQSRRVPP
FT                   IKLQRKLEPVIHAD"
FT   gene            395850..396341
FT                   /locus_tag="BC1003_0358"
FT   CDS_pept        395850..396341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0358"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: bpy:Bphyt_0638 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56361"
FT                   /db_xref="GOA:E1T723"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T723"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADN56361.1"
FT                   /translation="MEEQDRVAVMQQFGRTYRAFMSAFEAQVGHPLPRWRIMLALHEQG
FT                   GESSQKRLVEQLRVDPGALTRQLKALEGLGWIARSMDSRDNRVTNVRLTEAGLSATEAS
FT                   LPRRNAFLHDTMAALPDDALSALSGALKMLEARIGEVVAAANAEDTPVGTSAEDSRAGR
FT                   "
FT   gene            complement(396407..397699)
FT                   /locus_tag="BC1003_0359"
FT   CDS_pept        complement(396407..397699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0359"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bxe:Bxe_A4060 putative D-serine deaminase (d-serine
FT                   dehydratase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56362"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:E1T724"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADN56362.1"
FT                   /translation="MKVTNYQGATIDPYSKGLGMVPGASIQLTDAARLEWNLLNEDVSL
FT                   PAAVLYADRVEHNLKWMQAFVAEYGVKLAPHGKTTMAPQLFRRQLETGAWGITLATAHQ
FT                   VRAAYHGGVSRVLMANQLVGRRNMMMIAELLSDPDFEFFCLVDSVEGVEQLGRFFTSVK
FT                   KPLQVLLELGVPGGRTGVRDEAQQHAVLEAIGRYPGVLKLAGVELYEGVLKEEHEVREF
FT                   LQSAVAVTRTLIAQGRFERTPAILSGAGSAWYDVVAEEFVKASETGKVEVVLRPGCYLT
FT                   HDVGIYRKAQADIFARNPVAKKMGEGLLPALQLWAYVQSIPEPDRAIIGLGKRDSAFDA
FT                   GLPEPARHYRPGRDGEGHEAPREIAASEGWEIFGLMDQHAYMRIPAGADLKVGDMIAFD
FT                   ISHPCLTFDKWRQVLVVDPAYRVTEVIETYF"
FT   gene            397827..398717
FT                   /locus_tag="BC1003_0360"
FT   CDS_pept        397827..398717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0360"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: sugar isomerase (SIS); helix-turn-helix
FT                   protein RpiR; KEGG: bpy:Bphyt_0640 transcriptional
FT                   regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56363"
FT                   /db_xref="GOA:E1T725"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1T725"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ADN56363.1"
FT                   /translation="MNSSAEPLTFDIVARIAECAPELRSAERKVAALILENLTGASRAS
FT                   IGALAEQAQVSVATVTRFAKAVGCRDVRELKLRLAQAAAVGQRFLHAGTPRDASEPIAT
FT                   RVFDELQTALAHNHQLLRQAPLAQAAAALRGARMIYVFGMGGGSTALADEMRFRLVRLG
FT                   RPVATYQDGLLQRMVASTVSRDTVLIALSTTGRVPEMVENCKIARSYGATVIALTAPAS
FT                   PLARLADWVIPIVAFETDFIYKPSSSRYAMMMALDVLVTELAVSQGDESRELLRRMKHA
FT                   LDTHRGGGDRQPLGD"
FT   gene            398732..400213
FT                   /locus_tag="BC1003_0361"
FT   CDS_pept        398732..400213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0361"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="KEGG: bpy:Bphyt_0641 N-acyl-D-amino-acid deacylase;
FT                   PFAM: Amidohydrolase 3; D-aminoacylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56364"
FT                   /db_xref="GOA:E1T726"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1T726"
FT                   /inference="protein motif:PRIAM:3.5.1.81"
FT                   /protein_id="ADN56364.1"
FT                   /translation="MHSHPEAADTLIVGAQLYDGTGAPPVERDVAIRDGRIVAIGNLSN
FT                   WLAEDVIEAEGRALAPGFIDVHTHDDTHVIRSPQMLPKITQGVTTVIVGNCGISASPVA
FT                   LKGDPPDPMNLLGERDAFQYPTFADYVKAVNAARPAVNVGALIGHTALRNNQMDRLDRA
FT                   ATREEIEGMRAQLEEALANGALGLSSGLAYGSAFAAPTEEVMALAEPLAAAGALYTTHM
FT                   RTEFDAILDAMDEAYRVGRHARVPIVISHLKCAGPSNWGRSAEVLKSLEGARRMQPVGC
FT                   DCYPYNRSSSTLDLKQVTGDIDITITWSEPHPEMAGKLVKEIAAEWGVTQQEAGKRLQP
FT                   AGAVYHNMSEEDVRRILSHPATMVGSDGLPNDPLPHPRLWGAFPRVLGHYARDAGLLPL
FT                   EEAVRKMTSLSARRFGLAQRGEVHVGYHADLVLFDPAKVRDAATFEQPQQAADGIDAVW
FT                   VNGVLSYRNGEVTGERAGRFVARGAASQGDAHGAF"
FT   gene            400300..400686
FT                   /locus_tag="BC1003_0362"
FT   CDS_pept        400300..400686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0362"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bpy:Bphyt_0642
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56365"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E1T727"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADN56365.1"
FT                   /translation="MKRYGVEGGKGTGGQHMPFARAVEADGWLFVSGQTPMENGEVING
FT                   GIVEQSHKAIQNVFAILKEAGYGAEHVVRCGVWLDDPRDFASFNKVFREYFGDNPPARA
FT                   CVVSSMVIDCKVEVDCVAYKKPAA"
FT   gene            complement(400749..401573)
FT                   /locus_tag="BC1003_0363"
FT   CDS_pept        complement(400749..401573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0363"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="TIGRFAM: 7-cyano-7-deazaguanine reductase; KEGG:
FT                   bxe:Bxe_A4056 7-cyano-7-deazaguanine reductase; PFAM: GTP
FT                   cyclohydrolase I/Nitrile oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56366"
FT                   /db_xref="GOA:E1T728"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:E1T728"
FT                   /inference="protein motif:TFAM:TIGR03138"
FT                   /protein_id="ADN56366.1"
FT                   /translation="MTPEQSPLGKASTYTEQYDASLLFPIARSNAREAIGISAQLPFFG
FT                   TDIWNAYELSWLNARGKPQIAVATFFVPADSPNIVESKSFKLYLGSFAQTAFESIEAVR
FT                   DTIRRDVSASCGSTVSVYLTAPQDFGKLQMEEFEGTPLDRLDLDADVYTPDASLLKAAL
FT                   DEAPVEETVFSNLLKSNCPVTGQPDWGSVQIHYVGPQIDHAGLLRYIISYRNHTGFHEQ
FT                   CVEKIFIDVLKACRPVKLAVYARYTRRGGLDINPFRTNYNLPMPDNMRLARQ"
FT   gene            complement(401570..402472)
FT                   /locus_tag="BC1003_0364"
FT   CDS_pept        complement(401570..402472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0364"
FT                   /product="5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /note="KEGG: bpy:Bphyt_0644 5'-nucleotidase; PFAM:
FT                   5-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56367"
FT                   /db_xref="GOA:E1T729"
FT                   /db_xref="InterPro:IPR010394"
FT                   /db_xref="UniProtKB/TrEMBL:E1T729"
FT                   /inference="protein motif:PRIAM:3.1.3.5"
FT                   /protein_id="ADN56367.1"
FT                   /translation="MALSLVDKLVVAISSRALFDFEEENRVYEEGDLQAYEALQRARLN
FT                   VPAKPGVAFPLIRKLLALNAGGHQVEVVILSRSDPISGLRAFHSCREHGLTIERGVFTR
FT                   GRAPFAYLKPLNASLFLSANQDDVRDALAAGFPAARVLPESAKMASKYPDEIRIAFDGD
FT                   AVLFSDEAERVFQKDGLRAFVGHEMHNKDLPLADGPLKPLLEALHRLQKLADQAAPMHI
FT                   RTALVTARSAPAHERAIRTLMAWNIEIDEAMFLGGLDKSAFLREFEPDFFFDDQIGHCE
FT                   SARVVTATGHVLSGIVNAS"
FT   gene            complement(402530..404053)
FT                   /locus_tag="BC1003_0365"
FT   CDS_pept        complement(402530..404053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0365"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="KEGG: bxe:Bxe_A4054 threonine dehydratase; TIGRFAM:
FT                   threonine dehydratase, biosynthetic; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   Threonine dehydratase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56368"
FT                   /db_xref="GOA:E1T730"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:E1T730"
FT                   /inference="protein motif:TFAM:TIGR01124"
FT                   /protein_id="ADN56368.1"
FT                   /translation="MASHDYLKKTLTARVYDVARETELERAPHLSARLRNPVYLKREDN
FT                   QPVFSFKLRGAYNKMAHMPADALARGVITASAGNHAQGVALSAARMGVKAIIVVPVTTP
FT                   QVKVDAVRAHGGPTVEVVQFGESYSDAYGHAVKLQEERGLTFVHPFDDPYVIAGQGTVA
FT                   MEILSQHQGPIHAIFVPIGGGGLAAGVAAYVKAVRPEIKVIGVQTDDSCAMAASLKAGE
FT                   RVTLNEVGLFSDGTAVKLVGEETFRLCSEYLDDVLLVNTDALCAAIKDVFQDTRSVLEP
FT                   AGSLAVAGAKQYAEREGIENQTLIAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIP
FT                   EERGSFKRFCELVGTRSVTEFNYRIAQAESAHIFVGVQIRNRSESAQIAGAFEAHGFAT
FT                   VDLTFDELSKQHIRYMVGGRSPLAHDERLFRFEFPERPGALMKFLSSMAPDWNISLFHY
FT                   RNQGADYSSILVGIQVPPTDNAEFDRFLATLGYPHWEETQNPVYRLFLG"
FT   gene            complement(404177..404548)
FT                   /locus_tag="BC1003_0366"
FT   CDS_pept        complement(404177..404548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctu:Ctu_21350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56369"
FT                   /db_xref="UniProtKB/TrEMBL:E1T731"
FT                   /inference="similar to AA sequence:KEGG:Ctu_21350"
FT                   /protein_id="ADN56369.1"
FT                   /translation="MASKQPAASAALRATFRLFANGERVLAQNVDGKLIDIGALETKAG
FT                   RHTVRLDVDPLELQPSHSVEAALRAVSSQLSFDYLDGLFTSEGPVDFHGDLFALPHVEW
FT                   QLDEPLPRELTDGKPPHIF"
FT   gene            complement(404595..404771)
FT                   /locus_tag="BC1003_0367"
FT   CDS_pept        complement(404595..404771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56370"
FT                   /db_xref="UniProtKB/TrEMBL:E1T732"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A2182"
FT                   /protein_id="ADN56370.1"
FT                   /translation="MTSESARPTPPRQNPNDPTAGDRTLSDEQKQSAKNEPAPPAPGRG
FT                   ESLPDPKEVGEAG"
FT   gene            complement(404827..405033)
FT                   /locus_tag="BC1003_0368"
FT   CDS_pept        complement(404827..405033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0368"
FT                   /product="MARCKS-like protein"
FT                   /note="KEGG: xla:398155 MARCKS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56371"
FT                   /db_xref="UniProtKB/TrEMBL:E1T733"
FT                   /inference="similar to AA sequence:KEGG:398155"
FT                   /protein_id="ADN56371.1"
FT                   /translation="MSDSDSKNGGHIEQQPVPGHTENIPTDGSNERANERRLEDAAPTA
FT                   SPDTKPGTPPGTQSEADRTRSPD"
FT   gene            complement(405117..405623)
FT                   /locus_tag="BC1003_0369"
FT   CDS_pept        complement(405117..405623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_3521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56372"
FT                   /db_xref="GOA:E1T734"
FT                   /db_xref="UniProtKB/TrEMBL:E1T734"
FT                   /inference="similar to AA sequence:KEGG:Aave_3521"
FT                   /protein_id="ADN56372.1"
FT                   /translation="MALDVRPLEDIVLPGLVAGVLSTLALGACARLVGKRAAAPVSAVS
FT                   HWVWPQEVNQTARPRPRHLVTGLAIHHLMSVGWAAVNAYTLAAIEESVEPCRASRAAHG
FT                   RRFALASALTAVAAFSDYVIVPKRFTPGFEFHLRVPHIAAVYVAFGAGLVAPFVVEDLC
FT                   GPRRR"
FT   gene            405622..407100
FT                   /locus_tag="BC1003_0370"
FT   CDS_pept        405622..407100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0370"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="KEGG: azo:azo1826 NADH dehydrogenase (ubiquinone);
FT                   manually curated; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56373"
FT                   /db_xref="GOA:E1T735"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T735"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADN56373.1"
FT                   /translation="MVIFLAGATGMIGARVANALVAAGHSVVCGVRDPAAAGKHLPGCR
FT                   LVALDFAGLRDVASVVPLLAGVDVVINAVGIFSDATGHEFRRLHTDAPVTLFKAAVAAG
FT                   VRRIVQISALGADAAAQSPYHRSKLAADEALLALPVSSLIVQPSLVFAPEGRSTRFFAA
FT                   WATLPLVPLPGAGAQRIQPVHIDDVVALIVAGALAASVRDAPGTEAALPRRVAAVGREP
FT                   MTLKEYLAVLRSVAGAPRGGFLPVPMPLVRLATRLGALLPGSLMSADALAMLERGNVAP
FT                   TDRFERLLGRAPRALREMPVDSEGFGTRAKLMWLLPLLRASIAAVWIWTAIVSAGLYPR
FT                   ASSLDLLARVGAPAALGPLLLYGAAFVDLVFGVLSLAWPRRLGSRARLWGLQIALIVLY
FT                   TALISWRLPEFWLHPYGPLSKNLPMLALLILLIQFEEGSGRRSAPLATAAPGPDSTTAA
FT                   APSRTLPTTPPSTPPTTPPTTPPTTPPTTPPARQ"
FT   gene            407109..407573
FT                   /locus_tag="BC1003_0371"
FT   CDS_pept        407109..407573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0371"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: eba:ebA6860 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56374"
FT                   /db_xref="GOA:E1T736"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:E1T736"
FT                   /inference="similar to AA sequence:KEGG:ebA6860"
FT                   /protein_id="ADN56374.1"
FT                   /translation="MTYLVIKWLHVLSSTILFGTGIGSAFYMLLTSLGRDPGTVARVTK
FT                   LVVLADWLFTTPTAIVQPVTGLYLVHLANMQLGSRWLAWSIGLYVLAIACWLPVVILQM
FT                   RLAASARVSADTGQPLSAAYWRMLSIWAALGAVAFFAFLGIFWLMVTKVA"
FT   gene            408053..412147
FT                   /locus_tag="BC1003_0372"
FT   CDS_pept        408053..412147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0372"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; KEGG: bpy:Bphyt_0646 FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56375"
FT                   /db_xref="GOA:E1T737"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1T737"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADN56375.1"
FT                   /translation="MNAPQVFDPHGAAAAVAADPEARLREIPYNYTSFSDREIVIRLLG
FT                   QAAWDALAELRAERRTGRSARMLYEVLGDIWVVRRNPYLQDDLLDNPKRRAMLIEALHH
FT                   RLSEIEKRRRADLTEHGDEAGVDRAARVETLVQAARRAVDEFESEFQKTYDLRRRATRV
FT                   LGRVTQKDNIKFDGLSRVSHVTDATDWRVEYPFVVLTPDTEAEIAGMIKACFELGLTVI
FT                   PRGGGTGYTGGAVPLTPFSAVINTEKLEQLGAVEMTELPGVDRKVPTIFSGAGVVTRRV
FT                   TEAAEQAGFVFAVDPTSLDASCVGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPEGNWL
FT                   EVTRLGHNLGKIHDVEVARFELKWFDGNYAPGEKLLRTETLDIKGRVFRKEGLGKDVTD
FT                   KFLAGLPGVQKEGCDGLITSARWVLHKMPAHTRTVCLEFFGQAREAIPSIVEIKDYLFE
FT                   TSKQGGAILAGLEHLDERYLRAVGYATKSKRNAFPKMVLIGDIVGNDADAVAQATSEVV
FT                   RMANGKSGEGFVAVSAEARKRFWLDRSRTAAIAKHTNAFKINEDVVIPLDRMGEYTDGI
FT                   ERINIELSIKNKLQLVDALEAFFRGGKLPLGKSDDANEIPSAELLEDRVQQALDLLKRV
FT                   RTRWEFLRDRLDLSLREAQHYLVGLGYEALAEKFADRADAQPDATVFHVTQDRTIRVSW
FT                   KQEIRAELRQIFNGGEFKPILDEAQAIHKHVLRGRVFVALHMHAGDGNVHTNLPVNSDN
FT                   YEMLQDAHTAVARIMKLARSLDGVISGEHGIGITKLEFLTDDEIGEFRKYKQRVDPHGR
FT                   FNAGKLLEGADLRNAYTPSFGLMGYESLIMQQSDIGAISESIKDCLRCGKCKPVCATHV
FT                   PRANLLYSPRNKILATSLLVEAFLYEEQTRRGVSIKHWDEFGDVADHCTVCHKCVTPCP
FT                   VKIDFGDVTMNMRNLLRKMGKKKFNPGNAAGMFFLNATNPQTINLARTAMMGIGYKAQR
FT                   LGNEVLKKFVKKQTAHPPATVGKPPVTEQVIHFMNKKMPGNLPKKTARALLDIEDNKIV
FT                   PIIRNPKTTTADTEAVFYFPGCGSERLFSQVGLATQAMLWEAGVQTVLPPGYLCCGYPQ
FT                   RGSGQFDKAEQIVTDNRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFDKIFPGCR
FT                   IIDIHEFLLEKGMKLDGVTGTRYMYHDPCHTPIKTMDPVKLVNSLMGSEKDGYKIEKND
FT                   RCCGESGTLAVTRPDVSTQVRFRKEEEIRKGAAKLRGIPLVAEAGANAINPANASAGTA
FT                   GAANGSVLKAGDGPQPKGATDVKILTSCPSCLQGLSRYNEDAGIEADYIVVEMARHVLG
FT                   EDWMVDYVQRANNGGIERVLV"
FT   gene            412182..412610
FT                   /locus_tag="BC1003_0373"
FT   CDS_pept        412182..412610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0373"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   bxe:Bxe_A4052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56376"
FT                   /db_xref="GOA:E1T738"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:E1T738"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADN56376.1"
FT                   /translation="MDCVFCREEGGDVLWQDDTLRVVLADEHDYPGFCRVIWNEHVAEF
FT                   SDLDAAGRDRVMKVVYAVECAMRRVLQPAKVNLASLGNQVPHVHWHVIPRFSNDAHFPL
FT                   PIWAPRQRTVSEAMLSSRRAQATLLREAVRHEIGQALA"
FT   gene            412690..413103
FT                   /locus_tag="BC1003_0374"
FT   CDS_pept        412690..413103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0374"
FT                   /product="protein of unknown function DUF971"
FT                   /note="KEGG: protein of unknown function DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56377"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:E1T739"
FT                   /inference="similar to AA sequence:KEGG:BC1002_0368"
FT                   /protein_id="ADN56377.1"
FT                   /translation="MSGLTPDTPVPSGVVVHSKSRVLELQYASGESYRLPFELLRVYSP
FT                   SAEVQGHGPGQETLQTGKRDVTITMIEGVGNYAIQPTFSDGHNTGIYSWDLLYDLARRQ
FT                   DELWRAYLDKLAAAGVDRDAPMPQAGAAHGHRH"
FT   gene            413172..413903
FT                   /locus_tag="BC1003_0375"
FT   CDS_pept        413172..413903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0375"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0649 ubiquinone/menaquinone
FT                   biosynthesis methyltransferase; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferase;
FT                   PFAM: UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56378"
FT                   /db_xref="GOA:E1T740"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1T740"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ADN56378.1"
FT                   /translation="MSKTHFGFQSVDEQEKARKVAGVFHSVAANYDLMNDLMSGGLHRA
FT                   WKMFTIAQANVRPGYKVLDIAGGTGDLSKAFAKQAGETGEVWHTDINESMLRVGRDRLL
FT                   DKGVITPALLCDAEQIPFPDNYFDVVTVAFGLRNMTHKDVALAEMRRVLKPAGRLLVLE
FT                   FSKVWDPLKKAYDVYSFKVLPWLGERFAKDADSYRYLAESIRMHPDQETLKTMMEQAGL
FT                   DGVKYYNLSAGVVALHVGTKY"
FT   gene            413942..414934
FT                   /locus_tag="BC1003_0376"
FT   CDS_pept        413942..414934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0376"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: bxe:Bxe_A4049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56379"
FT                   /db_xref="GOA:E1T741"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E1T741"
FT                   /inference="protein motif:PFAM:PF04280"
FT                   /protein_id="ADN56379.1"
FT                   /translation="MSDSLSLSPRKVKQSLARRIGLIAMVGLIAAGSLASLDAEARRMG
FT                   GGRSIGRQSNTVQQQSAPSQPSPTNPAMQQRAQPAPAPVPAPAPQPNRSRWLGPIAGLA
FT                   AGLGIAALLSHFGLGGAFAGAMANIIVIALLAMIGIWLIRRFMGRKRDASQPAYAGQSP
FT                   SLNSGATGYTQEPRYTAPPAGSYLEPQGNPLTTPSVGATPSVPAGFDSEAFLRNAKVYF
FT                   VRLQAAWDVGNIEDIREFTTPEMFAEVRVDLASRGSESNQTDVVQLNADLLGVEERANE
FT                   YFASVRFSGLIREALGAPAEPFVEVWNLSKANRAGEGWLLAGIQQVAQH"
FT   sig_peptide     413942..414049
FT                   /locus_tag="BC1003_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.691 at
FT                   residue 36"
FT   gene            415231..415875
FT                   /locus_tag="BC1003_0377"
FT   CDS_pept        415231..415875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0377"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   sterol-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56380"
FT                   /db_xref="GOA:E1T742"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:E1T742"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADN56380.1"
FT                   /translation="MTLAAKPFVAAVNHLLARESWARERLAPYAGKTARLSSPPLVLTL
FT                   LVQPDGYLGTVGETDTQQFDVTLSVPADAFPAFVQGGQAAVMKHVKIEGDAEFATVIAK
FT                   LAEHLRWEPEEDLAKLIGDGPAWRIGSFVRTLGEHVQRTGRNLLDTASEYLLDENPQLV
FT                   RRAALADFNAELAQARDTLARVEKRLQRLEQKVEARGAIAPGGAATSRGTR"
FT   gene            415891..417468
FT                   /locus_tag="BC1003_0378"
FT   CDS_pept        415891..417468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0378"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="KEGG: bxe:Bxe_A4047 putative ubiquinone biosynthesis
FT                   protein UbiB; TIGRFAM: 2-polyprenylphenol 6-hydroxylase;
FT                   PFAM: ABC-1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56381"
FT                   /db_xref="GOA:E1T743"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1T743"
FT                   /inference="protein motif:TFAM:TIGR01982"
FT                   /protein_id="ADN56381.1"
FT                   /translation="MRFLRFLKIFFTVIRFGLDEMMLGRVNDRRVRMLLRITTIGRKFE
FT                   APPGVRLRLALESLGPIFVKFGQVLSTRRDLLPVDIANELAKLQDQVPPFDSAVAIGLV
FT                   EKSLGAPVDVLFDDFERVPVASASIAQVHFATVKAGQHAGKAVAVKVLRPNMLPVIDSD
FT                   LALLRDIAVWAERLWADGKRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDL
FT                   LLVPEMYWEFCTPTVLVMERMVGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGF
FT                   FHADMHPGNIQVSLDPAHFGRYIALDFGIIGALSDFDKNYLAQNFLAFFKRDYHRVATL
FT                   HLESGWVPPTTRVEELESAIRAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQL
FT                   VLLQKTMLNVEGLGRSLDPELDLWKTAKPYLERWMNEQIGLRGWYERLKIEAPQWSKTL
FT                   PQLPRLIHHVLAERHDHGRVGNDDMIRQILLEQKRTNRLLQGLLLFGVAVGVGAALARV
FT                   FLALAYGA"
FT   gene            417493..418116
FT                   /locus_tag="BC1003_0379"
FT   CDS_pept        417493..418116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0379"
FT                   /product="thiopurine S-methyltransferase"
FT                   /note="PFAM: thiopurine S-methyltransferase; KEGG:
FT                   bxe:Bxe_A4046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56382"
FT                   /db_xref="GOA:E1T744"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1T744"
FT                   /inference="protein motif:PFAM:PF05724"
FT                   /protein_id="ADN56382.1"
FT                   /translation="MSDPTQSPVPEFESRDPNSPAFWDERFERHFTPWDQAGVPSAFEA
FT                   FARRHVGEAVLIPGCGSAYEAAWLAARGSPVRAIDFSHAAVAAARAQLGEQHAQLVEQA
FT                   DFFAYEPPFAPAWIYERAFLCALPPARRGDYARRMAELLLAGGLLAGFFFLGATPKGPP
FT                   FGMERTELESLLTPHFELIEDEPVSDSIPVFAGRERWLTWRRRA"
FT   gene            418325..418699
FT                   /locus_tag="BC1003_0380"
FT   CDS_pept        418325..418699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0380"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="KEGG: bpy:Bphyt_0654 regulatory protein, FmdB
FT                   family; TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56383"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:E1T745"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ADN56383.1"
FT                   /translation="MPIYAYRCESCGFGKDVLQKMSDPQLTQCPECGKDTFRKQVTAAG
FT                   FQLKGSGWYVTDFRGGNSSAGASANGASNGASKGADSASTGNGNGAAQTDTAAASSSAA
FT                   TPAAPAAAPAAAAASGSGSV"
FT   gene            418772..419425
FT                   /locus_tag="BC1003_0381"
FT   CDS_pept        418772..419425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0381"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   bpy:Bphyt_0655 protein of unknown function DUF502"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56384"
FT                   /db_xref="GOA:E1T746"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:E1T746"
FT                   /inference="protein motif:PFAM:PF04367"
FT                   /protein_id="ADN56384.1"
FT                   /translation="MTTKKTTLKSVFLTGLLVLVPLAITLWVLGLIIGTMDQTLLLLPS
FT                   AWQPERAFGFRLPGLGAVLTLAFIFVVGLLTQNFVGQKLVKWWELVVAHIPVVGPIYTS
FT                   VKQVSDTLLSSSGNAFRKALLIEYPRRGCYTIAFLTGIPGGDVINHLKEDHVSVYVPTT
FT                   PNPTSGFFLMVPKSEVIELDMTVDAALKYIVSMGVVAPSAPPAPVRRTTVEPPL"
FT   sig_peptide     418772..418843
FT                   /locus_tag="BC1003_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.435 at
FT                   residue 24"
FT   gene            419490..421289
FT                   /locus_tag="BC1003_0382"
FT   CDS_pept        419490..421289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0382"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="KEGG: bxe:Bxe_A4043 aspartyl-tRNA synthetase;
FT                   TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type; GAD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56385"
FT                   /db_xref="GOA:E1T747"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:E1T747"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ADN56385.1"
FT                   /translation="MSMRSEYCGLVTEELLGQTVSLCGWVSRRRDHGGVIFIDLRDREG
FT                   LVQVVCDPDRAEMFKAAEGVRNEFCLQIKGVVRSRPEGTTNAALKSGKIEVLCHELIVL
FT                   NASITPPFQLDDDNLSETTRLTHRVLDLRRPQMQHNLRLRYRVAIEVRKYLDTLGFIDI
FT                   ETPMLTKSTPEGARDYLVPSRTNPGQFFALPQSPQLFKQLLMVANFDRYYQITKCFRDE
FT                   DLRADRQPEFTQIDCETSFLSEQEIRDLFEAMIRHVFKETIGVELDAKFPVMEYSEAMR
FT                   RFGSDKPDLRVKLEFTDLTDVVKDVEFKVFSTPANSKDGRVAAIRVPKGGELSRGDIDS
FT                   YTEFVRIYGAKGLAWIKVNEVAKGRDGLQSPIVKNLHDEAVKAIIERTGAQDGDIIFFA
FT                   ADRAKVVNDSLGALRLKIGHSEFGKANGLVESGWKPLWVVDFPMFEYDEEDNRYVAAHH
FT                   PFTSPKDEHLEYLESDPARCLAKAYDMVLNGWEIGGGSVRIHREEVQSKVFRALKINAE
FT                   EAQAKFGFLLDALQYGAPPHGGIAFGLDRIVTMMAGADSIRDVIAFPKTQRAQDLLTQA
FT                   PSEVDERQLRELHIRLRTPEPKA"
FT   gene            421445..421966
FT                   /locus_tag="BC1003_0383"
FT   CDS_pept        421445..421966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0383"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bxe:Bxe_A4042 dATP
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56386"
FT                   /db_xref="GOA:E1T748"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E1T748"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADN56386.1"
FT                   /translation="MHCASVAPAFHAMPKPPKIPQSVLVVIHTPSLDVLLIERADMPGF
FT                   WQSVTGSKDSIDEPLAETAMREVAEETGIVIGGALVPQSALFDWQYSIEYEIYPQFLHR
FT                   YAEGVIHNTEHWFSVEVPERLEVTLAPREHTAFLWLPYEEAAARCFSSSNADAILQLPK
FT                   RLLMRSESRR"
FT   gene            421963..423222
FT                   /locus_tag="BC1003_0384"
FT   CDS_pept        421963..423222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0384"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: bpy:Bphyt_0658 phospholipase
FT                   D/transphosphatidylase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56387"
FT                   /db_xref="GOA:E1T749"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:E1T749"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADN56387.1"
FT                   /translation="MSVGGARRFARLRQSLLGRRYWQRYRFTSGNEVKLLRSGDEFFAA
FT                   LVERVDAAVRDVVLETYIFCYDEAGQMVNAALLRAAARGVRVRVITDGVGTARLPMFDE
FT                   WAGKGIEHRIYNPHIFGRFGFSRTHRKLAVIDDQFAYCGGINIVDDYENNGETLPFRRW
FT                   DFAVELQGPVVNDVRQAFEVQWRRIRVGHRPIDQLEPDLTPKTTASLGSLRRRRRRRNE
FT                   ELWAGGEPCVAFVARDNLINRRAIEKAYLTAIGQARSEVLLANPYFMPGRKLRRALVYA
FT                   ARRGVLVKLIIGRKEFKALDYAVPFLYRALLRAGVQIAEYEKTLLHGKVAVVDSNWATV
FT                   GSSNLDALSLMLNNEANVVLVNDPSIDALREALLAAFKDARRIDEAHYDARPAGERLLN
FT                   WLAYTTYRLAMKLLTVGGYD"
FT   gene            423474..424073
FT                   /locus_tag="BC1003_0385"
FT   CDS_pept        423474..424073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0385"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_A4039
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56388"
FT                   /db_xref="GOA:E1T750"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1T750"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADN56388.1"
FT                   /translation="MRKGEQTRAAILDAALDLASRDGLEGLTIGLLAERMQMSKSGVFA
FT                   HFGSREDLQVEVVREYHRRFEDEVFFPSLREPRGLPRLRAMISRWIEKRIQEVTTGCIY
FT                   ISGAVEYDDRADNPVREQLVSSVTMWRAALTRAISQAMDEGHLRADTDPQLMLFELYSF
FT                   TLGLHHDARFLHLPDAVRLTWAALEKLIVSYQSEGR"
FT   gene            424206..425993
FT                   /locus_tag="BC1003_0386"
FT   CDS_pept        424206..425993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0386"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: bxe:Bxe_A4038 putative acyl-CoA
FT                   dehydrogenase oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56389"
FT                   /db_xref="GOA:E1T751"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E1T751"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADN56389.1"
FT                   /translation="MGQYAAPLRDMQFVLHELLNVEAEIKQMPKHADLDAETINAVLEE
FT                   AGKFCSEVLFPLNHSGDQEGCTYVGDGVVTTPKGFKEAYQQYVEAGWPALGCDPQFGGQ
FT                   GLPAFVNNALYEMLNSANQAWTMYPGLSHGAYECLHAHGTPELQQRYLPKLVSGVWTGT
FT                   MCLTEPHCGTDLGILRTKAEPNSDGSYSISGTKIFISSGEHDLAENIVHLVLARLPDAP
FT                   KGTKGISLFIVPKFIPNDAGEPGERNGVKCGSIEHKMGIHGNATCVINLDNAKGWMVGE
FT                   PNKGLNAMFVMMNAARLGVGMQSLGLTEVAYQNSLTYAKERLQMRSLTGPKAPDKAADP
FT                   IIVHPDVRRMLLTQKAYAEGARAFSYWSALHIDKELSHADEAVRKEAADLVALLTPILK
FT                   AFLSDNAFEGTNHAMQIYGGHGFIAEWGMEQYVRDARINMIYEGTNAIQALDLLGRKIL
FT                   GDMGAKMKKFGKLVTEFVEAEGIKPEMQEFVNPLADIGEKVQKLTMEIGMKAMQNPDEV
FT                   GAAAVPYLRTVGHLVFSYFWARMARIALDKEASGDPFYKAKLATARFYFAKLLPETAMT
FT                   IRQARAGSKPLMDVEEALF"
FT   gene            426109..428544
FT                   /locus_tag="BC1003_0387"
FT   CDS_pept        426109..428544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0387"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   Enoyl-CoA hydratase/isomerase; KEGG: bpy:Bphyt_0662
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56390"
FT                   /db_xref="GOA:E1T752"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T752"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADN56390.1"
FT                   /translation="MSNLIIRKVAVLGAGVMGAQIAAHLINAKVPVLLFDLPAKEGPKN
FT                   AIALKAIDNLKKLSPAPFGVKDDAQYIQPANYDDDIDKLAECDLVIEAIAERMDWKHDL
FT                   YKKVSPHIAPNAIFATNTSGLSITELSQGFADDLKARFCGVHFFNPPRYMHLVELIPTA
FT                   ATRPEILDQLETFLTSVVGKGVVRAKDTPNFIANRVGIFSILAVMTEAAKFGLRFDEVD
FT                   DLTGARLGRAKSATFRTADVVGLDTMAHVIKTMQDNLKDDPFFPVYETPAVLAELVKKG
FT                   ALGQKAGGGFYRKEGKAIKVLDPKTGEYVEGGAKADELVGRILKRPPAERLKLLRESEH
FT                   PQAQFLWAIFRDVFHYIGVHLESIADNARDVDLAIRWGFGWNEGPFEGWQTAGWKQIAE
FT                   WVQEDIAAGKALANVPLPSWVLEGPVAEAGGVHTNQGSWSPASQTFVPRSSLGVYERQV
FT                   FRAPLVGETSADPKTYGKTLFETDAVRAWVDDRAGENDVLIVSFKSKMNTIGPSVIDGL
FT                   VQAIELAEKDYKGLVVWQPTSLKLGTPGGPFSAGANLEEAMPAFMMGGAKGIEPFVKKF
FT                   QQGMLRVKYASVPVVSAVSGIALGGGCELLLHSAKRVAHIESYIGLVEVGVGLVPAGGG
FT                   LKEAALRAAEAATQVGATNDLLKFLQKSFENAAMAKVSASALDARAMGYLKPSDTIVFN
FT                   VFELLDVAKKEARALAGAGYRPPLRVTQVPVAGRSAISTIKASLVNMRDGRFISEHDFL
FT                   IASRIAGAVCGGDVEAGSLVDEEWLLQLERRAFVDLLGTQKTQERIMGMLQTGKPVRN"
FT   gene            428575..429774
FT                   /locus_tag="BC1003_0388"
FT   CDS_pept        428575..429774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0388"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="KEGG: bpy:Bphyt_0663 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56391"
FT                   /db_xref="GOA:E1T753"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E1T753"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADN56391.1"
FT                   /translation="MSKQLQDAYIVAASRTPIGKAPRGVFKNTRPDELLVHAIRSAVAQ
FT                   VPGLDTKVIEDAIVGCAIPEAEQGLNVARMGALLAGLPQSVGGVTVNRFCASGLTALAM
FT                   AADRIRVGESDALIAGGCESMSMVPMMGNKPSLSPHIFDRNEDIGIAYGMGLTAEKVAE
FT                   RWKISREAQDAFSVESHRRAIAAQQAGEFNDEIAAYTVTERFPDLATGEVRVNTREVSL
FT                   DEGPRADTSLEGLAKLRTVFANKGSVTAGNSSQTSDGAGALIVVSEKVLKQFNLTPLAR
FT                   FVSFAVRGVPPEIMGIGPKEAIPAALKAAGLKQDDLDWIELNEAFAAQSLAVIQDLGLD
FT                   PSKINPLGGAIALGHPLGATGAIRASTVVHGLRRRNYKYGMVTMCVGTGMGAAGIIERL
FT                   "
FT   gene            429980..430750
FT                   /locus_tag="BC1003_0389"
FT   CDS_pept        429980..430750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0389"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bxe:Bxe_A4035 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56392"
FT                   /db_xref="GOA:E1T754"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E1T754"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADN56392.1"
FT                   /translation="MTTDILVERANGVLTLAFNRPDKKNAITAAMYQTMADTLVGAQDD
FT                   ASVRAILIRGSAKIFSAGNDLEDFMKSPPMGENAPVFQFLRAISSAEKPVVASVAGPAV
FT                   GIGTTLLLHCDLVYAADSASFSLPFAQLGLCPEAASSLLLQRVAGYQAAAEKLLLGEAF
FT                   DATEALRMGFVNRLLPAAEVDAFAASQAAKLAALPASSLRATKSLMKRASREELQTQMA
FT                   EEAVHFGKMLVAPEAREAFKAFFEKRKPDFRQFD"
FT   gene            complement(430821..431663)
FT                   /locus_tag="BC1003_0390"
FT   CDS_pept        complement(430821..431663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0390"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="KEGG: bpy:Bphyt_0665 formate dehydrogenase family
FT                   accessory protein FdhD; TIGRFAM: formate dehydrogenase
FT                   family accessory protein FdhD; PFAM: formate dehydrogenase
FT                   subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56393"
FT                   /db_xref="GOA:E1T755"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E1T755"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ADN56393.1"
FT                   /translation="MESISLDDLQTGQPGAVEREVHRHRGAAVETVIDHIGQEWPVALV
FT                   FNGISHAVMMCTPCDLEAFAVGFAISEGIVERGSDIQDIEVELHDNGDLPHAEVHLQVV
FT                   QQAFVALKEKRRALAGRTGCGVCGIESIDLLDLQPERVPDTGFLQRLAPDAIARAAREL
FT                   PAHQALTRLTGGLHAAAWCDAAGAIRYTFEDVGRHNALDKLIGQLVLDRVDTREGFVFL
FT                   SSRASYELVRKAARVDVPMVATISAPSSLAIAIARKAGVRLVSFCRETSYVDYDTAQP"
FT   gene            431770..432246
FT                   /locus_tag="BC1003_0391"
FT   CDS_pept        431770..432246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0391"
FT                   /product="Conserved hypothetical protein CHP02664, nitrate
FT                   reductase-associated"
FT                   /note="PFAM: Conserved hypothetical protein CHP02664,
FT                   nitrate reductase-associated; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56394"
FT                   /db_xref="InterPro:IPR013481"
FT                   /db_xref="UniProtKB/TrEMBL:E1T756"
FT                   /inference="protein motif:PFAM:PF09655"
FT                   /protein_id="ADN56394.1"
FT                   /translation="MGLNEAPLLFDFEVESSENFTYIPMSVRFNLDRFGLRISLAQWQM
FT                   LPLEDRKLLARFPVAEDAEIEPNFDHALFEMLRTHANVEPEWFTPEEAPAWRNTDSVPD
FT                   SVERQAKLAGLAAPSAARWAELDPFQRYVLAKLSRKQEINHDFIPAMKEFGAAG"
FT   gene            432771..435881
FT                   /locus_tag="BC1003_0392"
FT   CDS_pept        432771..435881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0392"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein; KEGG:
FT                   bpy:Bphyt_0667 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56395"
FT                   /db_xref="GOA:E1T757"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1T757"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADN56395.1"
FT                   /translation="MTPFISKRLLINIAVVAVALGANAFVAGLQIAGQHEADARMLHST
FT                   RVRQSLDAYQSALDGGLAALARFEASGRAAPVDAATTMSTTLASLESALRDELAAEPAM
FT                   LATLAQLGTDRDALQRDIDDALLARDAQDPAASRAWAAASYMHVGLGLQRVEAGVAALR
FT                   AAENRALDLALAASSKQRRHATVLLILTMLAGSMLLLLTFGARESSARKKLHSVRALGR
FT                   NDERFRSLFDDHPVPMYIFDRETLRFLAVNSAAIQQYGYSESEFLDMTIRAIRPNSEIA
FT                   RLESHLQRSDSAQPGRTMAGIWHHRRKDGSLISADISYHALNFMGRAAFFVLADDVTEQ
FT                   INAEAEAQRSNQMLETVIDNIPQRIFWKDLESRYLGCNMAFARDAGLAYPEQVVGKSDA
FT                   DMPWRAFAELLNAHDREVVETGVPKMSFEVDVVIDGVHRTTVTSKLPFTDGEGRVIGVL
FT                   GSYTDITERKRADLALRLQSRALDASVNAILITAPSPAGNLIEYVNPAFMRITGYDPAE
FT                   VIGHDCRVLQRDDREQEGVALIREALAANREVSAVVRNYRKDGALFWNQLFIAPVPNAE
FT                   GVITHHIGVINDVTDLMRYQEQLEYQANYDSLTRLPNRNLLRDRLQHALIVAQRQHKGV
FT                   AVVFMDLDGFKNVNDSLGHSVGDRLLGVVAERLARCTRTSDTVARHGGDEFVIVMTDTV
FT                   DEQSLIAWMERVRASVSEPVWLDGTELYVGCSMGASLFPQDGDDAETLMKKADLAMYRA
FT                   KDMGRNTFQFYQPEMNASAGARLNLERRLRRALRDNQFLLHYQPQVDIHTGQIVGTEAL
FT                   VRWHDPEGGLVPPSSFIPVAEESGLIGPLSEWVLREACRQNKAWQNLGLPPARVSVNLS
FT                   ARVFQQRDIARLVMQVLDETGLEPQYLELELTESAIMRNAEEAVSMLNELSALGIGLAI
FT                   DDFGTGYSSLSYLKRFPVDRLKIDRSFVSDIGISGDDETITSAIIALAHSLKLQVIAEG
FT                   VETSAQLDFLKERACDEMQGFYFAKPLSTDAISELMKGGTAREAALA"
FT   gene            complement(436128..436742)
FT                   /locus_tag="BC1003_0393"
FT   CDS_pept        complement(436128..436742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0393"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bpy:Bphyt_0668 glutathione S-transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56396"
FT                   /db_xref="GOA:E1T758"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E1T758"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADN56396.1"
FT                   /translation="MKLIGMLDSPYVRRVAICMKMLNLDFEHAPISVFSTYDQFAAINP
FT                   VVKAPTLVAANGKTVMDSTVILHYLASLAGPEQRLFPSRPDDCLRAARLTGLALAACDK
FT                   TVQIVYERNLRPADKQHEPWMERVRGQLLAAYNELEQEAAAAPLPTRGEDFGAAEVTLA
FT                   VAWNFTQMMLPQIVSASAHPHLQAFSAAAEQLPVFVSTPAV"
FT   gene            436912..437832
FT                   /locus_tag="BC1003_0394"
FT   CDS_pept        436912..437832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0394"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_A4030 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56397"
FT                   /db_xref="GOA:E1T759"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T759"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN56397.1"
FT                   /translation="MKTIPPLTALRCFEAVARLGGVTQAARELHVTHSAVSQQIRVLEE
FT                   TLGVALFVREARGLRPTEEGRFYALEVRAALRDITQATRRVLARPHESELVIATLPSFA
FT                   QHWLVPRLPGFRQAHPYYRVRLVTSLQLEDLRHGGSDIGIRMGQGHWPDVAQQKLFDDE
FT                   MIVVAAPHFALAPDGRFPATAEEVIECPLLSSPDAPWADWCVAAQVAQPAAARVVLSAN
FT                   DSNVVIGAALLGQGVALERRSLVAHALARGELVQITTVRVPYRYPYWLVWQQRETLSAQ
FT                   QVHFAQWLKAEVDAYLRANAALTDQ"
FT   gene            complement(437872..438267)
FT                   /locus_tag="BC1003_0395"
FT   CDS_pept        complement(437872..438267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0395"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56398"
FT                   /db_xref="GOA:E1T760"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E1T760"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADN56398.1"
FT                   /translation="MTDLLQLPQKPCALRVMPQPADANIHGDVFGGWIMAQVDIAGSIP
FT                   ASRRANGRVATIAVNSFLFKQPVFVGDLLSFYADIVKTGNTSITVSVEVYAQRMSLAQD
FT                   IVKVTEATLTYVATDSDRRPRALPALD"
FT   gene            438468..440378
FT                   /locus_tag="BC1003_0396"
FT   CDS_pept        438468..440378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0396"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bpy:Bphyt_0672 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56399"
FT                   /db_xref="GOA:E1T761"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E1T761"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADN56399.1"
FT                   /translation="MRRSLPSEPSPISTQPRNDWQTIVSLLPYLATYKWRVVFALSCLI
FT                   GAKIANLGVPIVMKRIVDSLASVQHLTALGRTHDSPGIVLLGGVGLLVVAYAVVRLSTS
FT                   LFTELREILFSKVTESAVRQLALKVFRHLHGLSLRFHLERQTGGMSRDIERGTRGITQL
FT                   ISYSLYSILPTLVEVGLVLGFFVVKYEAYYAVVTFVALAVYIVFTVKVTEWRTHFRRTM
FT                   NDLDSKANSRAIDSLLNYETVKYFGNEEWEASRYDENLKRYRTAAIKSQRSLSALNFGQ
FT                   QAIIGAGLVFILWRATEGVMAGRLTLGDLVLINTFMLQLYIPLNFLGVVYRELKQSLTD
FT                   MDRMFTLLGAAQEVPDVPDAPALQVSGAQVRFEHVNFSYEPARQILHDVSFTIPAGTTT
FT                   AVVGHSGSGKSTLARLMFRFYDLDRATGGAITIDGQDIRDVAQASLRASIGIVPQDTVL
FT                   FNDSIYYNIAYGRPSATREEVIAAARAAHIHEFIEGLPKGYDTPVGERGLKLSGGEKQR
FT                   VAIARTILKNPPILLFDEATSALDSRSERAIQHELDQIARERTTLIIAHRLSTVVHAQQ
FT                   IIVMDKGRIVERGTHAELLRANGLFAQMWALQQQRAAEASQAVDSAGAAVVPDSADVPA
FT                   R"
FT   gene            complement(440407..441114)
FT                   /locus_tag="BC1003_0397"
FT   CDS_pept        complement(440407..441114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0397"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: bxe:Bxe_A4026
FT                   putative nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56400"
FT                   /db_xref="GOA:E1T762"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1T762"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADN56400.1"
FT                   /translation="MSLKKAMIFAAGRGERMRPLTDTRPKPLLEAGGKPLIVWQIERLA
FT                   RAGFQTIVINHAWLGEQIEAALGDGSRWNVELRYSPEHEALETAGGIVQALPLLENEGS
FT                   SEVFVAVSGDVYADFDYASLQGRAETLKSLPEPGMHLVMVPNPPFHPDGDFALTGNVLS
FT                   LDAGARFTFGNIGLYDTRMFRDLPRGTRRALTPYYRETIARGLASGELYEGLWENVGTP
FT                   AQLEELDRRLRAG"
FT   gene            complement(441124..442245)
FT                   /locus_tag="BC1003_0398"
FT   CDS_pept        complement(441124..442245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0398"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bpy:Bphyt_0674 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56401"
FT                   /db_xref="GOA:E1T763"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1T763"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADN56401.1"
FT                   /translation="MTLPPSQDFTSPHGDSRLAQLTAWLQSHAQRYALDLGTLAPASSD
FT                   ASFRRYFRLAGKAAQGENLGTLIAVDAPPPEKCREFVQVAGLLEAAGVHVPRILEVDFD
FT                   AGLMLVTDLGTASYLGALTAAQQNDDSRRARTLMRDALDALIRWQLASREDVLPPFDEP
FT                   FLRREMELMPEWFIGRHLTREVDESMRGVLDRTFALLIASARAQPQVFMLRDFMPRNLM
FT                   VMETASTTAGEANAAKQANPGVLDFQDAVYGPITYDVASLLRDAFLSWDEEFELDCFVH
FT                   YWERARKAGLPVDADFGEFYRQIEWMGLQRHIKVLGLFCRINYRDSKPHYMNDLPRFIG
FT                   YARKVAERYAPLRPFAKLLDDLEGRANEVGYTF"
FT   gene            442466..444832
FT                   /locus_tag="BC1003_0399"
FT   CDS_pept        442466..444832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0399"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="KEGG: bpy:Bphyt_0675 organic solvent tolerance
FT                   protein; manually curated; PFAM: Organic solvent tolerance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56402"
FT                   /db_xref="GOA:E1T764"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:E1T764"
FT                   /inference="protein motif:PFAM:PF04453"
FT                   /protein_id="ADN56402.1"
FT                   /translation="MPPRQLSQTNPSCAAMPRKRRLVAALIAVPGLVPALAHAQLVGEA
FT                   AQPQPIDPPWGMRLAPQLEDHVLQPGQKPATFVLGDSTNGTTDQDMAVKGAAEVRRNTV
FT                   VIKADALHYDQDTDMADAYGQVHVNNNGTTFAGPEAHLRVDSSEGFMTAPKYHFNVTGG
FT                   SGSAERVDLLDNERSVFTKGTYTACACADNPAWYIKGSEFDFDTGADEGVAYNSVLFFQ
FT                   GLPVFASPWLSFPLSGERRSGLLPPTFSLSSTNGFELSVPYYFNIAPNRDLTFTPRLIS
FT                   KRGVQLQTSFRYLSPTYSGSITGEFLPNDRLTKTNRYALYIQHNQNFGNGFGGYIYYNK
FT                   VSDNTYPEDLSSSVNQFMNGTQLLYQQEAGLTYNNGPWSVLAREQHWQTLAPSIAPYGR
FT                   EPQLNVKYTKYNVGGFDFGTEADYTNFRITTADMTEGQRVMFNPYISYPVVGPGYFVTP
FT                   KVQWHFASYNLRNISNDVPVGTPKNFTESIPTLTFDTGLIFDRSVRLFGEDYIQTLEPR
FT                   LYYVYTPYRNQASAPLFDTAESDFGLAEIFTPNTFVGNDRIADANRLTAAITTRFINPA
FT                   TGDERARFVIAQQYYFQDQRVTLLPNQTSTQATHSDLIVGASVKLGAGFASETAFQYNA
FT                   DNNQLVKTSVGFGFSPASGKVLNVAYRYTRANTTLDNQPINQVLISGQWPLAHRVFGVG
FT                   RFNYDLGGHRIVDGLVGLQYDADCWTLGAGIQRYANGLNTSGQHQSSTRFLAQLTFKGL
FT                   SSVDNGLIAAFRSSVAGYTPLPPPPPPESRFINYE"
FT   gene            444855..446261
FT                   /locus_tag="BC1003_0400"
FT   CDS_pept        444855..446261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0400"
FT                   /product="SurA domain protein"
FT                   /note="PFAM: SurA domain; PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase; KEGG: bxe:Bxe_A4023 putative
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56403"
FT                   /db_xref="GOA:E1T765"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E1T765"
FT                   /inference="protein motif:PFAM:PF09312"
FT                   /protein_id="ADN56403.1"
FT                   /translation="MRKDGPGVPDIIGVSVAIMKKLRLATLAAGLAAVASFVSVAPVQA
FT                   QALAGNRGQTVDTIAAVVNNGVITRRELDERVGLIARRLNQQNAPVPPADQLRQQVLNQ
FT                   MVLERIQLQKAKEVGINIDDAAVQKTLERLAQANNMSLDTYRARIEAQGVPWATFTSDA
FT                   RTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPNAGATSDLHMQHIFLKAPLNAPQT
FT                   DIEAAQKKAEALLAEAKGGANFEKLAKSNSQAPDAGKGGDMGYASPSKLPPEFVKAASS
FT                   LRPGQVNPEVIRTNDGFEIVRLVDRRTGQGTSSDAPKLMQTHVRHILLRVGDGMSEPQA
FT                   RQKLLEIKREIAAGGDFAKFAHTYSQDGSSSQGGDLGWISPGETVPEFERAMNTLQDGQ
FT                   ISDPVRSEYGYHLIQVLERREAQGSIAQQMDLARQAIGQRKAEQAYADWLRELRDTAYV
FT                   EVKPDLSSIQ"
FT   gene            446267..447277
FT                   /locus_tag="BC1003_0401"
FT   CDS_pept        446267..447277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0401"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; KEGG: bpy:Bphyt_0677
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; PFAM:
FT                   Pyridoxal phosphate biosynthetic protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56404"
FT                   /db_xref="GOA:E1T766"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:E1T766"
FT                   /inference="protein motif:TFAM:TIGR00557"
FT                   /protein_id="ADN56404.1"
FT                   /translation="MNSAALSASLPLQIAITTGEPAGVGPELTVQALAGAATHWPGAHF
FT                   TVLGDAALLAERARAVGVDLNALVADGKRIQVQHRPLGAPAVAGTLNAANGRYVLDLLD
FT                   SAIDGAMAGTFDAIVTAPLQKSTINDAGVPFTGHTEYLAERTHTPRVVMMLAGTGKRPL
FT                   RVALATTHLPLKDVSAALSIEGLVQTLRIVDHDLRHHFGLPAPRILVTGLNPHAGENGY
FT                   LGREEIDVISPALKLANGEGIDARGPYPADTLFQPRYLDEADCVLAMFHDQGLPVLKYA
FT                   TFGEGINVTLGLPIIRTSVDHGTALDLAGTGRADAGSLIAAIDTAVSMAQHRRAG"
FT   gene            447431..448261
FT                   /locus_tag="BC1003_0402"
FT   CDS_pept        447431..448261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0402"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   bpy:Bphyt_0678 dimethyladenosine transferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56405"
FT                   /db_xref="GOA:E1T767"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1T767"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADN56405.1"
FT                   /translation="MSTSRQQQGRHQGHIARKRFGQNFLVDMGVIDSIVDVIRPQRGER
FT                   MVEIGPGLGALTEPLIERLATPEAPLHAVELDRDLIGRLKNRFGALLELHAGDALAFDF
FT                   GSLAAPGDAPSLRIVGNLPYNISSPLLFHLTSFAHRVIDQHFMLQNEVVERMVAEPGTK
FT                   AFSRLSVMLQYRYVIDKQLDVPPEAFQPPPKVDSAIVRMIPFAPHELAPVDERVLGEVV
FT                   TAAFSQRRKMLRNTLAGLRGTVDFDAIGFDLQRRAEDVPVAEYVRVAQLVAAKA"
FT   gene            complement(448294..449229)
FT                   /locus_tag="BC1003_0403"
FT   CDS_pept        complement(448294..449229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0403"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bxe:Bxe_A4020 DMT family permease"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56406"
FT                   /db_xref="GOA:E1T768"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E1T768"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADN56406.1"
FT                   /translation="MSTTALPARRAPDGFAVLLMVGLCAIWGFQQVAIKTTNAALPPLF
FT                   QAGLRSTIAALLVWGWARSRGTPLFRDDGTLGAGLLAGILFAAEFVCIFLGLTLTSASR
FT                   MAVFLYTAPCFTALGLHWFVEGERMRPLQWLGIVVAFAGMTLAFADGFLHGAAARGSSL
FT                   TGVAGDALGVLAGIAWAATTVVVRATRLAHSSASKTLFYQLTVSAVVLLALALALGDAH
FT                   VDAVTPLVVASLAYQAVVVAFVSYLLWFWLLTRYVASRLSVFSFLTPLFGVTFGVLLLG
FT                   ESFSLRFLMAAALVLTGIALVNAPGKRTAS"
FT   gene            449571..450683
FT                   /locus_tag="BC1003_0404"
FT   CDS_pept        449571..450683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0404"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_A4019
FT                   OmpC family outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56407"
FT                   /db_xref="GOA:E1T769"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:E1T769"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ADN56407.1"
FT                   /translation="MKTLSKGAAAVALMSLGCPAAHAQSSVTLYGVVDESVRYLTHANK
FT                   AGDSSLGLGTGGMTQSRWGLKGVEDLGGGWSTFFKLENRIYINSGQSDPTLPFFNEAQI
FT                   GVRSNSYGQVILGRQYNVMIEGITVAGYGSNPWIPYDFSFQPEVTMTGGIWTSNQVQYQ
FT                   AKYDGISFAAGYAFGGNAGNSYGSQIGAAAAYAPAGGPFTVGGAYEESKDSVNGASAKA
FT                   WTFGGSYTWDKTRFSLGYIVNRADAGFSSFANGPFTAPVLAALKYTDFSRRRMFMGGIT
FT                   QQVGNAWHFAANVWRTLQDGKTAAKDGSAWQYQLVADYALSKRTDVYVEGDYSLYRGDL
FT                   IGAQLQGVNAVGLAQKGSQIGLMAGLRHQF"
FT   sig_peptide     449571..449642
FT                   /locus_tag="BC1003_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            450798..451184
FT                   /locus_tag="BC1003_0405"
FT   CDS_pept        450798..451184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0405"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="TIGRFAM: lactoylglutathione lyase; KEGG:
FT                   bpy:Bphyt_0681 lactoylglutathione lyase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56408"
FT                   /db_xref="GOA:E1T770"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E1T770"
FT                   /inference="protein motif:TFAM:TIGR00068"
FT                   /protein_id="ADN56408.1"
FT                   /translation="MRLLHTMLRVGDLDRSIAFYTELLGMKLLRREDYPEGKFTLAFVG
FT                   YTDERDGTVIELTHNWDTPSYDLGTGFGHLAVEVEDAYAACEKIKAQGGTVVREAGPMK
FT                   HGTTVIAFVTDPDGYKIEFIQKKK"
FT   gene            complement(451295..452182)
FT                   /locus_tag="BC1003_0406"
FT   CDS_pept        complement(451295..452182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0406"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   bxe:Bxe_A4016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56409"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:E1T771"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ADN56409.1"
FT                   /translation="MQKSPTPQPAAALDNRQLDLPLFAEPGSTSSSPSPSAPSASTQGE
FT                   QPAVPLAPDGSKLRSLTIGSRTLHYALKRSARRSIGFAIDSTGLTITAPRWVTLADIET
FT                   AITEKQRWIFAKLIEWQTRVEQRALPKVDWKDGAQVPYLGQPVRVKLGSPQGTLAFSAQ
FT                   DCALQVPLPLQADPQQIKDRVQGWLQGEAKRLFGERLAIYAEKLGVNYRAYALSSAATR
FT                   WGSCSSDGKIRLNWRLIHFPLSIIDYVVAHELAHLREMNHSPRFWQTVESIFPEFREAR
FT                   QTLKSHPPELLPTL"
FT   gene            complement(452227..452985)
FT                   /locus_tag="BC1003_0407"
FT   CDS_pept        complement(452227..452985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0407"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: bxe:Bxe_A4015 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56410"
FT                   /db_xref="GOA:E1T772"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E1T772"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADN56410.1"
FT                   /translation="MRFIRSLLLLIYFVLFTVPYAIACFIAFPFMRADKRYWMAAGWCR
FT                   VTLMVARWLNGIRYTIQGMENLPDGPAVLLSKHQSAWETLAFPALMPRPLCYVFKRELL
FT                   YVPFFGWALGLLKMVHIDRKEGKYAFESVIRQGKARMAEGAWVIMFPEGTRTPTGKQGK
FT                   YKTGGARFAVATGAPVVPIAHNAGRVWPRNSFLKYAGIVTVSIGKPIQTTGLTPDEVNT
FT                   RVEQWIEAEMRRIDPAAYRAAESGSAAAPI"
FT   sig_peptide     complement(452914..452985)
FT                   /locus_tag="BC1003_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.799 at
FT                   residue 24"
FT   gene            complement(453026..453580)
FT                   /locus_tag="BC1003_0408"
FT   CDS_pept        complement(453026..453580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0408"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="KEGG: bxe:Bxe_A4014 D,D-heptose 1,7-bisphosphate
FT                   phosphatase; TIGRFAM: histidinol-phosphate phosphatase
FT                   family protein; hydrolase, HAD-superfamily, subfamily IIIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56411"
FT                   /db_xref="GOA:E1T773"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1T773"
FT                   /inference="protein motif:TFAM:TIGR01656"
FT                   /protein_id="ADN56411.1"
FT                   /translation="MPTKKVVILDRDGVINVDSDAFIKSPDEWVALPGSLEAIARLSQA
FT                   GYRVAIATNQSGIGRGLFDMNALNAMHLKMHRMAAAVGGRIDAVFFCPHTAEDHCECRK
FT                   PKPGMLKMINERFEVDPENTPVVGDAMRDLQAGAALGHPVHLVLTGKGRKTLAAGGLPE
FT                   GTVVHDDLRAFVLDFLADAQE"
FT   gene            complement(453591..455693)
FT                   /locus_tag="BC1003_0409"
FT   CDS_pept        complement(453591..455693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0409"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, beta subunit; KEGG:
FT                   bpy:Bphyt_0686 glycyl-tRNA synthetase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56412"
FT                   /db_xref="GOA:E1T774"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:E1T774"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ADN56412.1"
FT                   /translation="MTQPHQATLLVELLTEELPPKALARLGDAFAEGIAERLAARDLIE
FT                   GELSFERYATPRRLAVTVKNVRAVAPERHVREKVLPVSVALDKDGQPTAPLAKKLAALG
FT                   FPDFSVSDLERAQDGKAEAFFLRYAAPGATLAEGLQAALDETLTKLPIPKVMTYQRPDG
FT                   SNVQFVRPAHRLTALHGERVVPVSALGIDADDTTLGHRFLSEGFVQIQHADAYVDTLMH
FT                   KGRVVPNFADRKETIRTHLLAHADGDQVVMPESLLDEVTSLVEWPVAYSCRFEDEFLQV
FT                   PQECLILTMQTNQKYFALTDANGKLRSRFLIVSNIETATPGDIIEGNERVVRPRLADAK
FT                   FFFEQDKKKPLAERVPLLANVVYHNKLGSALQRVERLEGLAGAIAALIGADVALAKRAA
FT                   RLAKADLITDMVGEFPELQGTMGTYYARHDGEPEEVALACSEHYQPRFSGDALPATATG
FT                   TVVALADKLETLVGIWGIGLQPTGEKDPFALRRHALGVLRILVEKQLAVDFVELLRTAH
FT                   AQFAALPNVTDSTQAIYEFSMDRLRGLLRERGHAPGEIDAVLALEPTRLDDIVARLVAV
FT                   REFAALPEAGSLAAANKRISNILKKSDSATVSGGVQPALFVEAAEKALHAQLEQVAPRV
FT                   QSQLAARDYTGALTALAALREPVDTFFNDVMVNAEDPALRANRLALLGALHQQLNCVAD
FT                   ISRLAA"
FT   gene            complement(455709..456716)
FT                   /locus_tag="BC1003_0410"
FT   CDS_pept        complement(455709..456716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0410"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   KEGG: glycyl-tRNA synthetase, alpha subunit; PFAM:
FT                   glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56413"
FT                   /db_xref="GOA:E1T775"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:E1T775"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ADN56413.1"
FT                   /translation="MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVG
FT                   PEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDL
FT                   QQNDVRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLE
FT                   RLAMYLQKVENVYDLVWTEWEEQGPNGPEMRRLTYGDVYHQNEVEQSTYNFEHANVDLL
FT                   FTFFNSYEAEAKRMIEAQIALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALS
FT                   RLVAQAYYDSREKLGFPMLGNPVHGVPGLTTDEQDAAKPAWAPPLKVERKIDPD"
FT   gene            complement(456860..458470)
FT                   /locus_tag="BC1003_0411"
FT   CDS_pept        complement(456860..458470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0411"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /EC_number="1.4.1.13"
FT                   /note="KEGG: bxe:Bxe_A4011 glutamate synthase (NADPH);
FT                   PFAM: ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56414"
FT                   /db_xref="GOA:E1T776"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:E1T776"
FT                   /inference="protein motif:PRIAM:1.4.1.13"
FT                   /protein_id="ADN56414.1"
FT                   /translation="MFSRRYLAMWCAVALLALCAALAAAHHVSWWWLVVPLALVALGLF
FT                   DLTQQRHAILRNYPLWGHLRFLFEFIRPEIRQYFVEGDTDEKPFSRAQRSIVYQRAKND
FT                   VDSRPYGTELDVKAVAHEWISHSLAPTTLDSHDFRIVVGAERAQPYSMSIFNVSAMSFG
FT                   SLSANAIMALNLGAKKGNFAHDTGEGSMSKYHREHGGDIIWEIASGYFGCRNDDGTFSA
FT                   EKFAKQAAEPQVKMIEVKLSQGAKPGHGGVLPAAKITPEIAETRGVPMGRDCISPATHS
FT                   EFSTPRGLLEFVERLRTLSGGKPTGFKLCIGHPWEFFGIAKAMLETGILPDFIVVDGAE
FT                   GGTGAAPLEFTDHVGVPLQEGLLLVHNTLVGIGLRQRIRIGASGKMITAFDITKTLAIG
FT                   ADWVNAARGFMFAVGCIQAQTCHTGRCPTGVATQDPVRQRALVVPDKADRVFNFHHNTL
FT                   HALKEIVQAAGLKHPAELRAHHIVRRVSSHEVQLMSELLKYLEPNDLLNGNYRYSLYEK
FT                   WWPVARSDSFSPKVELAVA"
FT   sig_peptide     complement(458393..458470)
FT                   /locus_tag="BC1003_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.715 at
FT                   residue 26"
FT   gene            complement(458662..459819)
FT                   /locus_tag="BC1003_0412"
FT   CDS_pept        complement(458662..459819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0412"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   KEGG: bpy:Bphyt_0689 tRNA-specific 2-thiouridylase MnmA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56415"
FT                   /db_xref="GOA:E1T777"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E1T777"
FT                   /inference="protein motif:TFAM:TIGR00420"
FT                   /protein_id="ADN56415.1"
FT                   /translation="MSKQKVVVGMSGGVDSSVTAWLLKEQGYDVVGLFMKNWEDDDDSE
FT                   YCSTRQDWIDVVSVADLIGIDVEAVNFASEYKDRVFAEFLREYSAGRTPNPDVLCNAEI
FT                   KFKAFLDHAMSLGAETIATGHYARVRENNGRFELLKAFDHTKDQSYFLHRLNQAQLSKT
FT                   LFPLGEIPKTKVREIAEQIALPNAKKKDSTGICFIGERPFRDFLNRYLPTKPGPMKTTD
FT                   GKVVGEHIGLAFYTFGQRKGIGLGGSKDGSGEPWFVAGKDIASNTLFVAQGHDHPWLLS
FT                   HTLTAGNVSWVAGEPPPEGFACGAKTRYRQADARCTFRSASGATTNGEDLFELTFDEAQ
FT                   WAVTPGQSAVLYDGDVCLGGGIIEHAATAQPAARTPQKAALLGGR"
FT   gene            complement(459907..460386)
FT                   /locus_tag="BC1003_0413"
FT   CDS_pept        complement(459907..460386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0413"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56416"
FT                   /db_xref="GOA:E1T778"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR033713"
FT                   /db_xref="UniProtKB/TrEMBL:E1T778"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADN56416.1"
FT                   /translation="MKPETWLPHVTVAAIVERDGRFLIVEEHTAAGLRLNQPAGHLEAG
FT                   ETLLEAVIRETLEETAHPFTPEALVGMYMTHFERPESAGVTYLRFTYCGAGGEPEAARA
FT                   LDPDIVRTLWMSAEELRACPHRHRTPLVMQCIDDYLAGRRFPLDFVHTHSVGPKR"
FT   gene            460842..461984
FT                   /locus_tag="BC1003_0414"
FT   CDS_pept        460842..461984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0414"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: bxe:Bxe_A4008 putative NAD(P)
FT                   transhydrogenase, alpha subunit; PFAM: alanine
FT                   dehydrogenase/PNT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56417"
FT                   /db_xref="GOA:E1T779"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T779"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADN56417.1"
FT                   /translation="MHIGVPAETRAHETRVAATPETVKKYVASGHRVTIQSGAGAGASF
FT                   PDDALAAAGAEIVDAATAFGAELVLKVQAPTEAELPLLKRGAVLIGMLDPFNVENAQKL
FT                   AAAGVTAFALEAAPRTTRAQSLDVLSSQANIAGYKAVLLAATLYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGSVIEASDVRPAVKEQIESLGAKFLDVPYETDEERE
FT                   AAQGVGGYARPMPQSWLTRQSALVHERAKQADVVISTALIPGRAAPTLLSVETVQAMKP
FT                   GSVLVDLAAGRGAEYEGRRGGNCPLTEADKVVVRHGVTIVGYTNLASMVPADASSLYAR
FT                   NLLDFLKLIVTKEGALNIDLADDIVAATLLTRDGEVARKA"
FT   gene            462010..462348
FT                   /locus_tag="BC1003_0415"
FT   CDS_pept        462010..462348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0415"
FT                   /product="putative NAD(P) transhydrogenase subunit alpha"
FT                   /note="KEGG: bxe:Bxe_A4007 putative NAD(P) transhydrogenase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56418"
FT                   /db_xref="GOA:E1T780"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:E1T780"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A4007"
FT                   /protein_id="ADN56418.1"
FT                   /translation="MEVLNHTVINLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLATGLTLGTPGKFFGTLAVALAAVNVFGGFLVTRRMLEMFRKKEPKKLIADK
FT                   SQSGKENA"
FT   gene            462348..463802
FT                   /locus_tag="BC1003_0416"
FT   CDS_pept        462348..463802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0416"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: bpy:Bphyt_0693 NAD(P)(+) transhydrogenase
FT                   (AB-specific); PFAM: NAD(P) transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56419"
FT                   /db_xref="GOA:E1T781"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:E1T781"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADN56419.1"
FT                   /translation="MSLNVVTLLYLVASVCFIQALKGLSNPKTARIGNTFGMVGMAIAI
FT                   LTTIALIAKQANALGSNLALGLGLLLVALIVGGAIGAFVAARVEMTKMPELVAAMHSLI
FT                   GLAAVCIAYAVVSEPAAFGLIDPENPVPGFLPYGNRVELFIGTFVGAITFSGSVIAFGK
FT                   LSGKYKFRLFQGAPVVYAGQHLINLMLAVAMLGFGIIFFFTQSWLPFIIMTAIAFVLGV
FT                   LIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNPMLIIAGSLVGSSGAILSYIMCRA
FT                   MNRSFFNVILGGFGNDAGAAAAGGTAEQRPVKSGSADDASFMLGNAETVVIVPGYGLAV
FT                   ARAQHALKELTDKLVEKGIEVKYAIHPVAGRMPGHMNVLLAEAEVPYDMVFEMDDINGE
FT                   FGQVDVVLVLGANDVVNPAAKNDPKSPIAGMPIIEAYKARTVIVNKRSMAAGYAGLDND
FT                   LFYMDKTMMVFGDAKKVIEDMVKAVE"
FT   gene            complement(463873..464613)
FT                   /locus_tag="BC1003_0417"
FT   CDS_pept        complement(463873..464613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0417"
FT                   /product="helix-turn-helix type 11 domain protein"
FT                   /note="KEGG: bpy:Bphyt_0694 helix-turn-helix type 11 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56420"
FT                   /db_xref="GOA:E1T782"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T782"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0694"
FT                   /protein_id="ADN56420.1"
FT                   /translation="MWRYHRGSVPVLFHETPTMTRRADRLFQIAELLRGRRLTTAQQLA
FT                   DWLDISLRTVYRDVRDLQLSGVPIEGEAGIGYRLSRSASLPPLTFTADELAALAAGARM
FT                   LESWGGAGFASGARGALAKIASAMPADKRASLERLAIFAPSFHIRGDFSDQLDTLHRAI
FT                   DTRHVVSFAYTDANGAASERRVWPLALAYWGARWTLGAWCELRGDFRNFGLEKIQQLAV
FT                   REPYPDQEGRRLADLLRHVNARPR"
FT   gene            complement(464743..465126)
FT                   /locus_tag="BC1003_0418"
FT   CDS_pept        complement(464743..465126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0418"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bpy:Bphyt_0695
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56421"
FT                   /db_xref="GOA:E1T783"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E1T783"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADN56421.1"
FT                   /translation="MSASSKVVAWFEIPSVDFDRAVRFYEAALDVKLNRQEIGGQPIAV
FT                   FGYEEPATGGAIVHNPSIKPNGDGVIVYLNAQPTVEAALARIEEAGGKTDGPVIKLPQE
FT                   IGYIAFFTDSEGNRLGLHSRTNG"
FT   gene            complement(465447..466736)
FT                   /locus_tag="BC1003_0419"
FT   CDS_pept        complement(465447..466736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0419"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="KEGG: bxe:Bxe_A4003 hypothetical protein; PFAM: RNA
FT                   methylase; THUMP domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56422"
FT                   /db_xref="GOA:E1T784"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1T784"
FT                   /inference="protein motif:PRIAM:2.1.1.52"
FT                   /protein_id="ADN56422.1"
FT                   /translation="MSFDFFLPCPRGLEASLASELAEIAAKHLHGAPFTAGSQVPGGVH
FT                   FRGGWAAGMAANLHSRIASRVLLKIAHRPYRSEQEIYALAVEQRWEQWFSANETLRVDV
FT                   TAIKSPLRSLEFTTLRVKDAICDRLREVSGARPSIDTGMPDVRVFAFLTATDCTLYLDT
FT                   SGDPLFKRGWRLDKGAAPLRENLAAGILRLTGWNAGTPLYDPMCGSGTFLAEAAQVALN
FT                   IAPGAERRFGFEKLKQYDSKTWQTLKAAALDAKHAARSSRADLQIFGSDISGDMLEKAR
FT                   ANFNRAGLPSIPLKQVDARGMTPPTTEPGILVANPPYGERIEVRGRNARGEIREGRNRD
FT                   SREDDGFRRAQEETPDSEFFQSLGDALKQRFTGWHAFILTSDRKLPGQLRLRESTKTPL
FT                   FNGALECRLFRFDLIAGSVRQRPQGETPAG"
FT   gene            complement(466864..467649)
FT                   /locus_tag="BC1003_0420"
FT   CDS_pept        complement(466864..467649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0420"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   bxe:Bxe_A4001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56423"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:E1T785"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ADN56423.1"
FT                   /translation="MMFDRLPRLPRGSVRGAVLAGALATAFALAACSSPNSRFYTLGDV
FT                   SAGAPAAAPSVRTAAAPAWLIAVAPIDVPPQVAKNQLVVQTGPTQVKVLEEERWASLPG
FT                   DELRRALSTSLTQQLNTIDVYGAAYSDTTPVYRVSMNVQRFESWPGSHALIDAVWSVRA
FT                   VRSTAVMTCRSVVSEPVGSGYDSLVDGHRRALQRISAQVAGAVQAMAAAAVASSATSAS
FT                   NPASAPSTAASASAANKRVVRVSVPACPSEVAAGSVAVR"
FT   sig_peptide     complement(467554..467649)
FT                   /locus_tag="BC1003_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.466 at
FT                   residue 32"
FT   gene            complement(467646..469304)
FT                   /locus_tag="BC1003_0421"
FT   CDS_pept        complement(467646..469304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0421"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bpy:Bphyt_0709 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56424"
FT                   /db_xref="GOA:E1T786"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E1T786"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADN56424.1"
FT                   /translation="MTSPQGPTPASDAPRNDSNGPKLPPQLPDPDIEPRSRWLPSLVWL
FT                   IPLIAALIGIALVIKSVTEKGPTITISFVSAEGLEPGKTKVKYKDVDVGAVKSIRLSKD
FT                   LSHVLVQVQLTKEGEDFAVKDSRFWVVRPRVGASGVSGLTTLLSGAYIGADAGHSPDSE
FT                   KNFVGLETPPPVTGDQKGHQFILHGDSLGSIDIGSPIFYRRVQVGQVVGFSLDKDGTGV
FT                   TMQVFVSAPFDQYVGTNSRWWHASGVDLRLDSSGFKLNTQSLATVIVGGLSFQSPPGQG
FT                   VGAQAPNNMTFRLGSDEADAMREPDGVPLRVVMNFNQSLRGLSVGAPVDFRGIVLGQVT
FT                   NIGIDYDPKTRSFTMPVTMNLYPDRLGKRFRETAPAPGSLAGQNMLQQLVKHGLRGQLR
FT                   TGNLITSQLYVALDIFPKAPPATVDVASDPLELPTIPNTLDELQLQVADIAKKLDKVPF
FT                   DQIGNNLNSALKNADQLFKRLDSEVVPQARDTLAAAKQTFGSAEATLQQDSPLQSDVHQ
FT                   ALQELTRTLQSLNALSDYLERHPESLLRGKAGDKP"
FT   gene            complement(469297..469947)
FT                   /locus_tag="BC1003_0422"
FT   CDS_pept        complement(469297..469947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0422"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   bpy:Bphyt_0708 paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56425"
FT                   /db_xref="GOA:E1T787"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:E1T787"
FT                   /inference="protein motif:PFAM:PF04403"
FT                   /protein_id="ADN56425.1"
FT                   /translation="MKYVTAKRAGLLACHACGRVEPRIRSVTPQHCGRCGARLHSRNPD
FT                   SLMRTWALLIAAALLYIPANLLPVMHTSSLVGSEDDTIMSGVVYFWTSGDWPLAVIVFI
FT                   ASIMVPMLKLTVLALLTITVQRHSRWRPQQRTTLYRMVERIGRWSMLDVFVVTLTVALV
FT                   RFKSLAVITAGPGAIAFGSVVILTMMASMQFDPRLIWDDVDGSTQKPQDLEHD"
FT   gene            complement(469944..470741)
FT                   /locus_tag="BC1003_0423"
FT   CDS_pept        complement(469944..470741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0423"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   bxe:Bxe_A3998 putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56426"
FT                   /db_xref="GOA:E1T788"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:E1T788"
FT                   /inference="protein motif:PFAM:PF04403"
FT                   /protein_id="ADN56426.1"
FT                   /translation="MEHDNLIACHECDTLFRKPRLVGRRVARCPRCGATLYSGVSRRLD
FT                   GISAMTLAALITFVIAQGFPIVELETNGITSQTTLFGALVALWNENMQIVAVMVFCSTI
FT                   LFPLTELVALLYVLVPLRSGYVPAGFNRVLRAIQFVRPWGMIEVFMLGVLITIVKMVSL
FT                   ARVIPEAALFAFGALTLMFAVVVTFDPRILWDLADELGARNQRPLPRTSADSAAAALNS
FT                   LTGPPAAPLLQPDEDTGGASGAGGPGDANPGTAPAPHQGRPAQ"
FT   gene            471120..471680
FT                   /locus_tag="BC1003_0424"
FT   CDS_pept        471120..471680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0424"
FT                   /product="putative cytochrome b-561 membrane protein"
FT                   /note="KEGG: bxe:Bxe_A3997 putative cytochrome b-561
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56427"
FT                   /db_xref="GOA:E1T789"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:E1T789"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3997"
FT                   /protein_id="ADN56427.1"
FT                   /translation="MAHNPSFGGSESYTRTAIAFHWLIALLIVCGFALGWVMTDIPGFT
FT                   PTKLRYFSWHKWIGVTVFALAVLRIMWRATHGAPAMPRRMPAWQRGAAHLAHLLLYVLM
FT                   IAIPLSGYLYSSAANVPVVYLGLIPLPRLIAPDPHLKELLKNVHIVLNYTLLVLVGMHV
FT                   AAALKHQWLDRDGLLSRMLPFLK"
FT   gene            471689..472252
FT                   /locus_tag="BC1003_0425"
FT   CDS_pept        471689..472252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0425"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: bxe:Bxe_A3996
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56428"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E1T790"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADN56428.1"
FT                   /translation="MKVSFYRYMLAAFAAASLSAAGAAWAQVDTAKSSVTATSKQMNVP
FT                   VEGKFGKFTAQLRFDPAKPAEGSAQLNIDVSSYDLGDETYNDQVRGKEWFDAKTYPSAS
FT                   FVSSAIAPAGGNQYKVTGKLTIKGKSQTVVVPVTVAQQGSTQTFDGSLPIKRSQFDIGT
FT                   GEWKDTSVVADEVVIKFHIVAARK"
FT   sig_peptide     471689..471769
FT                   /locus_tag="BC1003_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            472318..472884
FT                   /locus_tag="BC1003_0426"
FT   CDS_pept        472318..472884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0426"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: bpy:Bphyt_0704 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56429"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E1T791"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADN56429.1"
FT                   /translation="MLIAAGALASCVSLGAFAADTYQLDPTHTYPSFEADHFGGLSVWR
FT                   GKFTKSSGTVTLDRAAKTGTVEVTVDAASVSTGNTKLDDHLKEAEFFDVAKFPTATYKG
FT                   TSIRFDGDKPAEVVGSLTLHGVTKPLNLKIESFKCMPHPMLKREVCGVEASAQFNRADY
FT                   GMDFGSKYGFSMETKLHIQAEGIKQ"
FT   sig_peptide     472318..472374
FT                   /locus_tag="BC1003_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            473395..474672
FT                   /locus_tag="BC1003_0427"
FT   CDS_pept        473395..474672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0427"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0703 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56430"
FT                   /db_xref="GOA:E1T7P3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7P3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56430.1"
FT                   /translation="MNATTAASLAGSRKNSWRAVIAASIGNALEWFDLVVYGFFAVVIA
FT                   KLFFPAGNDTVSLLLTLGTFGVSFFMRPLGAVVIGAYADRAGRKAALTLSILLMMGGTF
FT                   IIAVLPTYQSIGLAAPVILVLARLMQGFSAGGEFGSATAFLAEHVPGRRGFFASWQVAS
FT                   QGLTTLLAAGFGVLLTGGLTPDQMASWGWRVPFFFGLLIGPVAWYIRTKLDETPEFLAA
FT                   ETTTTPLRDTFSSQKLRLVIAIGTVVLGTVSTYLVLFMPTFGVKQLGLAPSVAFSAIAL
FT                   TGLIQMVFAPLVGHLSDRHGRTTIMLIAGLLLLVLIYPAFVYLVAHPTFGTLIALQVVL
FT                   GFLMTGYFAALPGLLSEMFPVQTRTTGMSLAYNIAVTVFGGFGPFIIAWLISFTGSKAA
FT                   PSYYLIFAALLSVAALVAARRKLGFR"
FT   gene            474981..476570
FT                   /locus_tag="BC1003_0428"
FT   CDS_pept        474981..476570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0428"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: xac:XAC2436 XamI DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56431"
FT                   /db_xref="GOA:E1T7P4"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7P4"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ADN56431.1"
FT                   /translation="MTNIHTEQELIAVALALIGSRTRLSSAERECCKKIRSSRSNELVE
FT                   ATRRDIIDGNDPLGSAFARIRPAETRRENGATYTPWQIVDSMVTWASNEATSPARIVDA
FT                   GAGSGRFLLAAAKSFPEAELVGIESDPLAALMLRANFACVGLMHRLNLIVGEYRTARLE
FT                   RIDGATLFIGNPPYVRHHRLTEADKTWFSKTAAAYGVKASKLAGLHIHFFLRTLQLAQA
FT                   GDFGVFITSAEWLDVNYGATLRQLLAGALGGAGLHVLDPEVMPFADATTTGAITCFRVG
FT                   RRPDNLKVRSVSTLGQLNGLTAGNDVPWHNVETADRWSIIVKPGPSKPAGYIELGELCR
FT                   VHRGQVTGSNDVWIAGPHTAHLPDVVLTPTVTKARDLLNAGHSLTADHKLRRVVDLPAD
FT                   LAELDDELLPRIQEFLAWAKGQGADQSYIAQHRRAWWSVGLKKPAPIICTYMARRAPAF
FT                   VRNLCDARHINIAHGLYPREELTDQALDAIAAWLRTNVGVASGRTYAGGLTKFEPKEIE
FT                   RLAIPPLEDLVR"
FT   gene            476567..477571
FT                   /locus_tag="BC1003_0429"
FT   CDS_pept        476567..477571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0429"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.4"
FT                   /note="KEGG: xal:XALc_2635 hypothetical xami restricion
FT                   enzyme protein; PFAM: Restriction endonuclease, type II,
FT                   XamI"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56432"
FT                   /db_xref="GOA:E1T7P5"
FT                   /db_xref="InterPro:IPR019072"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7P5"
FT                   /inference="protein motif:PRIAM:3.1.21.4"
FT                   /protein_id="ADN56432.1"
FT                   /translation="MNGQGELFVKGKYPAPYMYMHNQSKKNTPALWSRDELAAQAQVAL
FT                   DEFVARRLAEPGGLYLSHVKARRKSIFQLFKALADIELHGMTIGAARSILLDDELSDAL
FT                   RYLSGPPVSEDDLGVLVTRSIGGISKGAIKRSESLALDILSLVRKLADPSRFPWIGQNR
FT                   RPSFGEIRTAVRSTTALQASQSLQTERRGYGKVVERRLENRLVELGFARTPAPHRALIN
FT                   DPIDYPTYPNFYGECTVHGRKVDLFIALPTGRMIALEAKDSSSALNSVKRLNNDTAAKA
FT                   KHFAVEGGKNIINVALLSGVFKPEHLIRAQEAGLHIVWAHSVDDFIDWVKSQV"
FT   gene            477590..477763
FT                   /locus_tag="BC1003_0430"
FT   CDS_pept        477590..477763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56433"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7P6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADN56433.1"
FT                   /translation="MVVPQANIRSPKCGVHGEILSIKVLVFPRVTLAQLGDSIFTSCAL
FT                   GRLLICHRGRAL"
FT   gene            complement(477882..478832)
FT                   /locus_tag="BC1003_0431"
FT   CDS_pept        complement(477882..478832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0431"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="KEGG: bxe:Bxe_A3993 preprotein translocase subunit
FT                   SecF; TIGRFAM: protein-export membrane protein SecF;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56434"
FT                   /db_xref="GOA:E1T7P7"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7P7"
FT                   /inference="protein motif:TFAM:TIGR00966"
FT                   /protein_id="ADN56434.1"
FT                   /translation="MEFFRFRKDIPFMQRALIFNAISLLTFLAAVFFLLHRGLHLSVEF
FT                   TGGTVIEVQYPGAAPLDPVRGTLNRLGYADAQVQNFGTSRDVLIRLPLKQGLTSAQQSD
FT                   QVMSALKTDTPQVQLQRVEFVGPQVGKELATDGLLALACVVVGIVIYLSFRFEWKYAVA
FT                   GVIANLHDVVIILGFFAFFQWEFSLSVLAAVLAVLGYSVNESVVIFDRIRETFRRERKM
FT                   TVIEVINHAITSTMSRTIITHGCTQMMVLSMFLFGGPTLHYFALALTVGILFGIYSSVF
FT                   VAAALAMWFGVKREDLVKDKKERVDPNDPNAGAQV"
FT   gene            complement(478851..480911)
FT                   /locus_tag="BC1003_0432"
FT   CDS_pept        complement(478851..480911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0432"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="KEGG: bxe:Bxe_A3992 preprotein translocase subunit
FT                   SecD; TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56435"
FT                   /db_xref="GOA:E1T7P8"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7P8"
FT                   /inference="protein motif:TFAM:TIGR01129"
FT                   /protein_id="ADN56435.1"
FT                   /translation="MNRYPLWKYAVMLVALVIGLVYTLPNLFGEAPAVQVSSGKATVKL
FT                   DSTTLSAVEATLAANQIKPEDVTFDNTSANANIRVRLVDTDTQLRVKDLLQKSLNNDPS
FT                   DPQYVVALNLQSASPRWLTALHALPMYLGLDLRGGVHFLLQVDMAGALNKKLDSDASDA
FT                   RTLLRDNNIRDGGVNRVNQTVVINFADQATADAAAKQLSRSIGELQWASQNGPDGSVQL
FT                   VGTFTPTVQKAVQDAALKQNITTLHNRVNELGVAEPVIQQQGADRIVVELPGVQDTAKA
FT                   KDIIGRTATLEARLADPVNTHPNPSDPVPPGDELFTQGNQTPVLLRKQIIFTGDRIIDA
FT                   SAGFDEHQRPSVNIRLDSAGGRAVRSVSRDNIGKPMAMVLFEKGKGEVLTVATIQSELG
FT                   DRFQITGQPTPQAAADLALLLRAGSLAAPMDIIEERTIGPSLGADNIKKGFHSVVWGFA
FT                   AIAVFMVAYYMLFGVISMIGLSVNLLLLIAVLSMLQATLTLPGIAAIALALGMAIDANV
FT                   LINERVREELRNGAPPQLAIQNGYAHAWATILDSNVTTLIAGVALLAFGSGPVRGFAIV
FT                   HCIGILTSMFSAVFFSRGIVNLWYGGKKKLKTLAIGQVWRPETAPAGSAAYLGNNDDAT
FT                   DTAQAMRAASAAAGKQKAPAAAAQSRAGKPTVRRRNAPGTPGTPQKPGSSR"
FT   gene            complement(481027..481356)
FT                   /locus_tag="BC1003_0433"
FT   CDS_pept        complement(481027..481356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0433"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="KEGG: bxe:Bxe_A3991 preprotein translocase subunit
FT                   YajC; TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56436"
FT                   /db_xref="GOA:E1T7P9"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7P9"
FT                   /inference="protein motif:TFAM:TIGR00739"
FT                   /protein_id="ADN56436.1"
FT                   /translation="MSFISNAFAQGTAAGGVESNLMSFLPLILMFGVLYFIMIRPQMKR
FT                   QKEHRNMLAAMAKGDEVVTNGGIVGKVTKVGEAYVGVEISEGTEITVQKASITTILPKG
FT                   TIKSL"
FT   gene            complement(481555..482730)
FT                   /locus_tag="BC1003_0434"
FT   CDS_pept        complement(481555..482730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0434"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: queuine tRNA-ribosyltransferase;
FT                   tRNA-guanine transglycosylase, various specificities; KEGG:
FT                   bpy:Bphyt_0699 queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56437"
FT                   /db_xref="GOA:E1T7Q0"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7Q0"
FT                   /inference="protein motif:TFAM:TIGR00430"
FT                   /protein_id="ADN56437.1"
FT                   /translation="MTTGHPSPQPADGLQFELLGTDGLARRGRVTLNHGVVETPIFMPV
FT                   GTYGTVKAVQPRELEEMHAQIILGNTFHLWLRPGLETIAAHGGLHGFMGWKKPILTDSG
FT                   GFQVFSLGELRKITEDGVTFASPINGDKLFLSPEVSMQIQKVLNSDIVMQFDECTPYAT
FT                   NNVPTSRQEAADSMRMSMRWAQRSIDEFRRLGNPNALFGIVQGGMFEDLRDESLAGLAE
FT                   KDFHGLAIGGLSVGEPKEDMMRVLNHIGPKLPANKPHYLMGVGTPEDLVAGVAAGVDMF
FT                   DCVMPTRNARNGWLFTRFGDIKIRNATHKNSLRPLDEQCGCYTCRNFTRGYLHHLHRVG
FT                   EILGAQLNTIHNLHYYLELMQEMRDAIDAKMFEPFRKRFHENRARGIDEAP"
FT   gene            complement(482842..483900)
FT                   /locus_tag="BC1003_0435"
FT   CDS_pept        complement(482842..483900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0435"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="KEGG: bxe:Bxe_A3989 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase; TIGRFAM:
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56438"
FT                   /db_xref="GOA:E1T7Q1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7Q1"
FT                   /inference="protein motif:TFAM:TIGR00113"
FT                   /protein_id="ADN56438.1"
FT                   /translation="MLTLSDFDFDLPPELIAQVALPERSASRLLEVDNAPDADRAARLT
FT                   DRRFSELPECINAGDLLVFNDTKVLKARFLGQKASGGKIEVLVERLVGERTALAQIRAS
FT                   KSPQPGTTIRLADAFDVTVGERVEPFYTLHFPADCLTLIEQYGRLPLPPYIEHDPDSTD
FT                   ETRYQTVYAQNPGAVAAPTAGLHFDDALFERLDARGVQRATLTLHVGAGTFQPVRVENL
FT                   AEHKMHSEWYHLPQSLADKIAATRARGNRVIAVGTTSMRALEAAARDAEAAGRPLAAAS
FT                   TETDIFITPGYRFRVVDRLVTNFHLPKSTLLMLVSAFAGVETIRAAYRHAIEQRYRFFS
FT                   YGDAMLLTRRDG"
FT   gene            484071..486338
FT                   /locus_tag="BC1003_0436"
FT   CDS_pept        484071..486338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0436"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   DEAD/DEAH box helicase domain protein; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; helicase domain protein; KEGG:
FT                   bpy:Bphyt_0697 ATP-dependent DNA helicase RecG; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56439"
FT                   /db_xref="GOA:E1T7Q2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7Q2"
FT                   /inference="protein motif:TFAM:TIGR00643"
FT                   /protein_id="ADN56439.1"
FT                   /translation="MPLSDRRLPSATDEVSAEPAARVAHGGESAQSAASSGDEVAALSA
FT                   GKPAAERKAKPTVKPAAKSTTKPTVKTADKLAKLGLTRDIDLVLHLPMRYEDETSLTPI
FT                   GHLLPGGIAQTEGVVFDNEIAYRPRRQLLVKLRDDAGDELVLRFLNFYGSQVKQMAIGA
FT                   RLRVRGDVRGGFFGMEMVHPAVRVVDEDTPLPQALTPVYPSTAGVSQAYLRKAIDNALS
FT                   RTSLPELLPEAVARQWLEPLGVPSLMDAVRTLHHPGAQSDETALIDGTHPAWVRIKFEE
FT                   LLAQQMSLKRAHEERRTRAAPAMPRRKLGDESALVARLLAALPFSLTRAQERVGGEIAL
FT                   DLTQPHPMQRLLQGDVGSGKTIVAALAAAQAIDAGYQAALMAPTEILAEQHARKLRGWL
FT                   EPLGVSVAWLAGSLKTKEKRAAIEAAALGTAQLVIGTHAIIQDTVEFARLGLVIVDEQH
FT                   RFGVEQRLALRAKARNAADGARDFQPHQLMMSATPIPRTLAMTYYADLDVSTIDELPPG
FT                   RTPILTKLVSDARREEVIGRVREAALTGRQVYWVCPLIEESETLQLQTAVETYETLVAA
FT                   LPELNVGLVHGRLAPAEKAAVMDAFTRNEVQLLVATTVIEVGVDVPNASLMVIEHAERF
FT                   GLAQLHQLRGRVGRGSAASVCVLLYTGPLSMTARARLQTMRETTDGFEIARRDLEIRGP
FT                   GEFLGARQSGAAMLRFADLENDQWLIEPAREAAAVLLEQYPHVVTQHLTRWLSAREHYL
FT                   KA"
FT   gene            486532..487491
FT                   /locus_tag="BC1003_0437"
FT   CDS_pept        486532..487491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0437"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_0711 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56440"
FT                   /db_xref="GOA:E1T7Q3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7Q3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN56440.1"
FT                   /translation="MTLTELKYIVAVARERHFGRAAEACFVSQPTLSVAIKKLEDELNV
FT                   QIFERGTSEVSVTPIGEQIVTQAQRVLEQTLAIKEIAKQGKDPLVGPLRLGVIYTIGPY
FT                   LLPTLVKQMIKRVPQMPLMLQENYTLKLIELLKQGEIDVAIMALPFPETGLMLRPLYDE
FT                   PFVVALPSGHAWENRPKIDADDLKQETMLLLGSGHCFRDHVLGVCPELMRFSQNADGIQ
FT                   KTFEGSSLETIRHMVASGVGITVLPRMSVHEVKPHAGGIDSGLLSYVPFDEPVPDRRVV
FT                   LAWRKSFTRMPAIDAICDAISACDLPGVKKLDLPVAVN"
FT   gene            487695..487832
FT                   /locus_tag="BC1003_0438"
FT   CDS_pept        487695..487832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ame:726691 cuticular protein CPF2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56441"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7Q4"
FT                   /inference="similar to AA sequence:KEGG:726691"
FT                   /protein_id="ADN56441.1"
FT                   /translation="MTKSNLPQTASFAAEPAAAQTGLAAAMLGVRTVALSLLVDRALSA
FT                   "
FT   sig_peptide     487695..487754
FT                   /locus_tag="BC1003_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.721 at
FT                   residue 20"
FT   gene            487936..489390
FT                   /locus_tag="BC1003_0439"
FT   CDS_pept        487936..489390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0439"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: bxe:Bxe_A3986 catalase; PFAM: Catalase related
FT                   subgroup; Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56442"
FT                   /db_xref="GOA:E1T7Q5"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7Q5"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADN56442.1"
FT                   /translation="MSERKLTNAAGAPVADNQNSMTAGVRGPVVLQDVWLLEKLAHFDR
FT                   EVIPERRVHAKGSGAFGTLKVTHDISRYTKAKVFAEVGKETPLFMRFSTVAGERGAADA
FT                   ERDVRGFSIKFYTEEGNWDVVGNNTPVFFIRDPLKFPDFIHTQKRDPYTNLRSNIAAWD
FT                   FWTRHPESMHQVTILMSDRGIPKNYRQMHGFGSHTYSFINANNERFWVKFHFKSLQGIE
FT                   NFTDAEAAQVVAQDRESAQRDLVGNIDAGNFPKWRFAIQVMPEAEAAAYRFNPFDITKV
FT                   WSQKDYPLIDVGTIELNRNAANYFADVEQAAFTPANVVPGIGFSPDRLLQGRLFSYGDT
FT                   QRYRLGINHHQIPVNASRVPNPHSFHRDGAMRTDGNLGGNVNYEPNRFGDFAQDANAAE
FT                   PPLAAGAVDRYDHRADDDYYTQPGMLFALFDAAQRERLYGNIARHINGVPQEIVARAVE
FT                   HFRRIDPAYAEGVIAAMAELAEGGKK"
FT   gene            489454..489627
FT                   /locus_tag="BC1003_0440"
FT   CDS_pept        489454..489627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56443"
FT                   /db_xref="GOA:E1T7Q6"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7Q6"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3985"
FT                   /protein_id="ADN56443.1"
FT                   /translation="MIDMMKATIGRTSAGHRAQQQHALKLRRAVGLAIVTSGFALIAAQ
FT                   AVQHALQHMVGG"
FT   gene            489825..490313
FT                   /locus_tag="BC1003_0441"
FT   CDS_pept        489825..490313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0441"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   bpy:Bphyt_0714 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56444"
FT                   /db_xref="GOA:E1T7Q7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7Q7"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADN56444.1"
FT                   /translation="MAKKEAVQHVNIGISDKDRKKIAEGLSRLLADTYTLYLKTHNFHW
FT                   NVTGPMFNTLHLMFETQYNELALAVDSIAERIRALGVHAPGSYKDFAKLSSIPEADGVP
FT                   SAEEMIRQLVEGQEAVVRTARAIFPSTEAANDEPTADLLTQRMQTHEKTAWMLRSMLA"
FT   gene            490565..491428
FT                   /locus_tag="BC1003_0442"
FT   CDS_pept        490565..491428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0442"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="KEGG: bpy:Bphyt_0715 4-hydroxybenzoate polyprenyl
FT                   transferase; TIGRFAM: 4-hydroxybenzoate polyprenyl
FT                   transferase; PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56445"
FT                   /db_xref="GOA:E1T7Q8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7Q8"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ADN56445.1"
FT                   /translation="MFARLPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGHPSWPLLA
FT                   IFTVGTVLMRSAGCAINDYADRDFDRYVKRTENRPITSGKIKAWEAVALAAGLSLLAFL
FT                   LILPLNTLTKELSVAALFVAGSYPFTKRFFAIPQAYLGIAFGFGIPMAFAAIQNQVPML
FT                   AWVMLLANVFWSVAYDTEYAMVDRDDDIKIGIRTSALTFGRFDVAAIMLCYAVTLGIYV
FT                   GIGVLLGFGAMYWLGWAVAAGCAVYHYTLIRHRERMPCFKAFLHNNWLGGALFVGIAAH
FT                   YAVASF"
FT   gene            complement(491581..492396)
FT                   /locus_tag="BC1003_0443"
FT   CDS_pept        complement(491581..492396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0443"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="TIGRFAM: pyrroline-5-carboxylate reductase; KEGG:
FT                   bpy:Bphyt_0716 pyrroline-5-carboxylate reductase; PFAM:
FT                   NADP oxidoreductase coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56446"
FT                   /db_xref="GOA:E1T7Q9"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7Q9"
FT                   /inference="protein motif:TFAM:TIGR00112"
FT                   /protein_id="ADN56446.1"
FT                   /translation="MKIAFIGGGNMAAALIGGLIKRGVAPADLYAIDPNEDARKRNEEQ
FT                   FGIKTGAAADAALADYDAVVLAVKPQILKSVAAALAAHLKASQLVISIVAGIRMDDMSR
FT                   WLNGHARVVRVMPNTPALIGMGVAGLTATASVDEAGRALASQVLGAVGETVWFDDEAKI
FT                   DAVTAISGSGPAYVFYFIEALQEAARQLGMDEAQGRALAVATFTGAAQLAANSDEPPSV
FT                   LRERVTSKGGTTAAALASFDASGVKDAIVRGALAADARAKEMGEEFGRQ"
FT   gene            complement(492524..493222)
FT                   /locus_tag="BC1003_0444"
FT   CDS_pept        complement(492524..493222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0444"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bxe:Bxe_A3981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56447"
FT                   /db_xref="GOA:E1T7R0"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7R0"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADN56447.1"
FT                   /translation="MPDLIHNLEAVQQRIATAAHVAGRDARSIALLAVSKTFPAEDVRA
FT                   AHAAGQRAFGENYVQEALTKIEALGDLRTSLEWHFIGPLQSNKTRPVAEHFDWVHSVDR
FT                   LKIAQRLSEQRPEHLPPLNVCLQVNISGEASKSGVSAEEALQVAKEIAALPRLRLRGLM
FT                   AIPEPAGNIDQQRVPHRRLRELFERLRDDGLPLDTLSMGMSSDLEAAVLEGATIVRVGT
FT                   AIFGARDYSH"
FT   gene            complement(493269..494495)
FT                   /locus_tag="BC1003_0445"
FT   CDS_pept        complement(493269..494495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0445"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: bpy:Bphyt_0718
FT                   glycolate oxidase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56448"
FT                   /db_xref="GOA:E1T7R1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7R1"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADN56448.1"
FT                   /translation="MQTNLADFIRNTPDGDEADAILRNCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQMVEGAQVTRSTQVHLDRCLTCRNCESTCPSGVQYGKLVEIGRKITEQ
FT                   KVTRPLGQRLTRRLLASFVPNSALFTPTMRLGQHFRALLPRKLRDKVPARQRPLAWPNA
FT                   KHDRKMLMLAGCVQPSMMPNINTATARVLDALGIETVVAPDAGCCGAIRLHLGYNHEAL
FT                   DDMRANIDAWWPHVEAGVEAIVMNASGCGATVKEYAHLLRHDPAYAEKAHRIVELTRDI
FT                   AEILPDFEEELVALTRRRAIHTVAFHPPCTLQHGQQVRGSVEHLLTKLGVEVRLPADNH
FT                   LCCGSAGTYSLTQPKLSYALRDQKLERLHAQEPQVIVSANVGCISHLQSGTSTPVAHWI
FT                   ELVEHMLSV"
FT   gene            complement(494503..495591)
FT                   /locus_tag="BC1003_0446"
FT   CDS_pept        complement(494503..495591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0446"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bxe:Bxe_A3979 glycolate oxidase FAD binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56449"
FT                   /db_xref="GOA:E1T7R2"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7R2"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADN56449.1"
FT                   /translation="MEEDDIVAMWSERVRSASAEGRALRVRGGGTKDWYGQTLEGEILD
FT                   TRAYRGIIAYDPAELVITARAGTPLLEIEAALAEHNQMLAFEPPHFGPQATFGGCVAAG
FT                   IAGPRRPSAGAARDFVLGAVIMNGQGQTLHFGGQVVKNVAGYDVSRLMAGSLGTLGLIL
FT                   ELSLKVLPQPQAEATLKFDMNGTDAVRKLNEWGGRPLPITASAWRHGTLAVRLAGAESA
FT                   VKSARSSLGGEVVDAVEAERFWAGLREQTDSFFAAIPPKAALWRLALPSITEPLQLPGA
FT                   QLMEWGGAQRWWITDTDAQTVRISAKQAGGHATIFRTGLGYDRGAGVFTPLPAPLMKIH
FT                   RGLKTAFDPARIFNRGRLYPDF"
FT   gene            complement(495727..497220)
FT                   /locus_tag="BC1003_0447"
FT   CDS_pept        complement(495727..497220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0447"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="KEGG: bpy:Bphyt_0720 FAD linked oxidase domain
FT                   protein; PFAM: FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56450"
FT                   /db_xref="GOA:E1T7R3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7R3"
FT                   /inference="protein motif:PRIAM:1.1.2.4"
FT                   /protein_id="ADN56450.1"
FT                   /translation="MNAPAELTAEVLAERQREVVQALMAVLPNHCLLYRDEDTVAYDCD
FT                   GLAAYRRLPLAVALPETESQVQRIVQICHRLGVPIVPRGAGTGLSGGAMPIRHGVVVSL
FT                   ARFRKIIEVDSYARTATVQPGVRNLSISEAAAPYGLYYAPDPSSQIACTIGGNVSENSG
FT                   GVHCLKYGLTVHNVLRVRAVTMEGEIVEFGSLGPDAPGLDLLAVLIGSEGMFAIVTEVT
FT                   VKLIPKPQTAQVIMASFDDVVKGGDAVAGIIAAGIIPAGLEMMDKPATRAVEEFVHAGY
FT                   DLDAAAILLCESDGTPEEVADEIVRMTAVLREHGATRIQISRTENERLRFWSGRKNAFP
FT                   AAGRISPDYYCMDGTVPRRSIGPLLSRIEAMEKKYGLRCINVFHAGDGNMHPLILFNGN
FT                   DQDEWHRAEAFGSDILEACVELGGTVTGEHGVGIEKINSMCVQFSPEERDAFHAVKRAF
FT                   DPPGLLNPDKGIPTRARCAEYGKMHVRGGLLPHPELPRF"
FT   gene            complement(497388..498803)
FT                   /locus_tag="BC1003_0448"
FT   CDS_pept        complement(497388..498803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0448"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bxe:Bxe_A3977 putative FAD-binding oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56451"
FT                   /db_xref="GOA:E1T7R4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7R4"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADN56451.1"
FT                   /translation="MNNLVTPAPLRRPFPAELLSALTEAFGERVSVAQAVREHHGRDES
FT                   PFDPQLPDAVVFARNTEDVQTVVRLCGQYNVPIIPYGNGSSLEGHLLAVQGGVSIDLSE
FT                   MNRVLSINAEDLTVTVEPGISRKQLNEALRDTGLFFPIDPGADASIGGMSATRASGTNA
FT                   VRYGTMRENVLGLAVVLADGRVIKTGTRARKSSAGYDLTRLFVGSEGTLGVITEITLRL
FT                   YPQPEAVSAAVCAFPSMGDAVRAVIETIQIGVPIARVEFVDALAIRSINRHSNLTLREA
FT                   PTLFFEFHGTEAGVQEQAQLVQELAGQNGGEGFEWATRPEDRSRLWNARHNAYFAMLQL
FT                   KPGCRAVTTDVCVPISRLAQCVVETEQDLRDSPLPCPIVGHVGDGNFHVAILIDPNKPE
FT                   ELAEAERLNHRIVQRALSMDGTCTGEHGVGLHKMGFLLEEHGDVAVDTMRSIKHALDPR
FT                   NLMNPGKIFSWAA"
FT   gene            499446..500000
FT                   /locus_tag="BC1003_0449"
FT   CDS_pept        499446..500000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0449"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; KEGG:
FT                   ATP/cobalamin adenosyltransferase; PFAM: cobalamin
FT                   adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56452"
FT                   /db_xref="GOA:E1T7R5"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7R5"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ADN56452.1"
FT                   /translation="MGNRLSKIATRTGDDGTTGLGDGRRVRKDSARIAAIGDVDELNSN
FT                   LGVLLCQTLPQDVRAALLAIQHDLFDLGGELCIPGHTMITERHLAQLDGWLAEYNAALP
FT                   PLKEFILPGGSRAASLAHVCRTVCRRAERAIVALGEQEALNAAPRQYVNRLSDLLFVLA
FT                   RVLNRADGGTDVLWQHDRNRA"
FT   gene            500119..501324
FT                   /locus_tag="BC1003_0450"
FT   CDS_pept        500119..501324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0450"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; globin; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: bam:Bamb_0627 globin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56453"
FT                   /db_xref="GOA:E1T7R6"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7R6"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADN56453.1"
FT                   /translation="MTALTADQIARVKATVPVLAEHGTTITRHFYKRMFAHHPELKNLF
FT                   NQTHQQSGNQPETLARAVYAYAANIDNLGALGPAVSRIANKHASLNIRPEHYPIVGRHL
FT                   LGAIVDVLGDAVDQPTLDAWQVAYGQLANIFVGTEAKLYEGAAWSGFRPFKVARKQVES
FT                   DEITSFYLTPADGAAACGFEPGQYVSVTRFVDKLGVDQPRQYSLSDAPHGKWLRISVKR
FT                   EDGREDAAPGHVSNLLHADVEEGTVVHVSAPMGDFTLERKKSTPVVLMSGGVGVTPMIS
FT                   MLSTLLADGSERSVSFVHACRNGRVHAFREWLNETVAAHPNVKRVVFYEAVEAADRQGV
FT                   DYDFEGRLDVTKIADRVIVPDADYYICGPVPFMRAQRDALTTLGVEPARIHTEVFGSGA
FT                   VE"
FT   gene            complement(501460..502533)
FT                   /locus_tag="BC1003_0451"
FT   CDS_pept        complement(501460..502533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0451"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; KEGG: bpy:Bphyt_0725
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56454"
FT                   /db_xref="GOA:E1T7R7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7R7"
FT                   /inference="protein motif:TFAM:TIGR00034"
FT                   /protein_id="ADN56454.1"
FT                   /translation="MPPHNTDDVRIRELKELTPPAHLIREFACDEAVSDLIYNSRTAMH
FT                   RILHGMDDRLIVIIGPCSIHDTKAAMEYARRLVEQRKRFAGELEVVMRVYFEKPRTTVG
FT                   WKGLINDPHMDNSFKINEGLRTARELLLRINELGLPAGTEYLDMISPQYIADLISWGAI
FT                   GARTTESQVHRELASGLSCPVGFKNGTDGNVKIAVDAIKAASQPHHFLSVTKGGHSAIV
FT                   STAGNEDCHIILRGGKAPNYDADSVNAACSDIGKAGLAARLMIDASHANSSKKHENQIP
FT                   VCADIGRQIASGDERIVGVMVESHLVAGRQDLQEGCALTYGQSVTDACIGWDDSVAVLE
FT                   GLADAVKQRRVARGSGN"
FT   gene            complement(502894..504360)
FT                   /locus_tag="BC1003_0452"
FT   CDS_pept        complement(502894..504360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0452"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   peptidase U62 modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56455"
FT                   /db_xref="GOA:E1T7R8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7R8"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ADN56455.1"
FT                   /translation="MNIIEPGIRNLATAKDILLAPYGLDESLLTRTLAEIFTHRVDYAD
FT                   LYFQATRSEAWSLEEGIVKSGSFSIDQGVGVRAVSGDRTAFAYSDDLSPEAIRQAAIAT
FT                   RAIAKAGGGKQKIKVASSLTGIAGRDLYLPADPLHSLDATAKVKLLERIEHMARGRDRR
FT                   IQQVMAGLAGEYDVVLVARSDGGFAADIRPLVRVSVTVIAEQNGRREVGSGGGGGRFDY
FT                   SYFTDEVLSRYVDDAVHAALVNLEARPAPAGAMTVVLGPGWPGVLLHEAIGHGLEGDFN
FT                   RKGSSAFAGRIGEQVAAKGVTVVDDGTLPNRRGSLNIDDEGNPTQCTTLIEDGILKGYI
FT                   QDTLNARLMKMPVTGNARRESYAALPMPRMTNTYMLNGDKDPQEIIESVKNGLYAVNFG
FT                   GGQVDITNGKFVFSASEAYMIENGKVTYPVKGATLIGSGPESLKFVSMIGNDMKLDSGV
FT                   GVCGKEGQSVPVGVGQPTLRIDRMTVGGTA"
FT   gene            complement(504449..505345)
FT                   /locus_tag="BC1003_0453"
FT   CDS_pept        complement(504449..505345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0453"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bpy:Bphyt_0727 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56456"
FT                   /db_xref="GOA:E1T7R9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7R9"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADN56456.1"
FT                   /translation="MSETHVSSSSLPASSTAAPHAAQSEPAAGAQGTFRVAALQMVSTP
FT                   EPERNLAEAERLMAEAAADGAQLVLLPEYFCFMGFKDTDKLAVREAYGDGPIQRFLADA
FT                   ARRHKLWVIGGTLPIAAPEPSRVLNTTLVFDPQGNEAARYDKIHLFNFEKGEESFDEAR
FT                   TICPGGEVRTFQSPFGRVGLSVCYDLRFPELYRRMGDCALMVVPSAFTYTTGRAHWEML
FT                   LRARAVENQCYVLAAAQGGKHENGRRTWGHSMLIDPWGEIVAVRDEGAGVVAGTLERAR
FT                   IDEVRQSLPAWRHRVLG"
FT   sig_peptide     complement(505271..505345)
FT                   /locus_tag="BC1003_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.553 at
FT                   residue 25"
FT   gene            complement(505561..509757)
FT                   /locus_tag="BC1003_0454"
FT   CDS_pept        complement(505561..509757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56457"
FT                   /db_xref="GOA:E1T7S0"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7S0"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3970"
FT                   /protein_id="ADN56457.1"
FT                   /translation="MSERNESADPQETGQARPVSGGDHVVLRRTLHVVLALALVLYFIA
FT                   AGLFLGLRYGVLPRADAFRPRIEATVSDKLHAQFSIGKLAPHWSGFQPGLDITNLVIRD
FT                   RDGKPALTIPHATATLSWRSLWQFRPVLSSLIVDQPDVLIARGSDGVLSVAGVPVPTRH
FT                   SGNDTLSTWLMRQQAIVVRGGVLRWRDAQRDAPELALRDIRIAILNDGYDHRLALQAPP
FT                   DGHLLRGPLDFRTHFRHAPLAAIGKPVNWKGQAYVSTGPVDLPTLARYIKFPIETFAGR
FT                   IDNAIWVDFADGRMTSASGQMSGADVALRVRPTQPKLLLPVASFGWRVEGQQGDYKLQL
FT                   NDLRAELGQPPLDDGTPLTRTLAFRTLDGHYRMASQQHGQLISVAGDRVDLGILAEFSR
FT                   ALPLPRRLLNNLVRYNPRGLVANYVIEVERAKPESGEPGGDRHGTGAEPIERYRFKGDL
FT                   QGISVAAQEPPPGLTARNHPRAGIPGIENLWGSVDADQHRGTATLDTSNVAITLPGVFD
FT                   DPRLLLDRLHGRADWTISPKAPGENHPAFTVKLADFGVSNADVAATASADYSNPGHGRG
FT                   SLDLTADFERAQVSRIVRYLPTSISEKLRIYLGHGLQAGMSRGAKIEVHGDLTKFPYSR
FT                   DPEAGIFHIVAPFKGGKFDPTPYPPRKMRNGTPNVWPPLDGIDGVFEIRQNVLRFDIDR
FT                   ARYKRVALRSVNGRIDDLGTRESSLVIKGDGLGPLADMLDYVNESSLGIMARHQTEKVR
FT                   AEGPASLALKLTVPRTPKPHIGVEGALGFQNNRLSVENVPPLSQLKGKVRFTERSAQTE
FT                   RLTARFLGGDMRASGGLRQDGTYALDVDGHIAVDAARGLDLHGPAAQVLTRMSGSAPYA
FT                   LSVHGAKGKLPQVTANSDLTGLALDFPAPFNKPVGEPMPLRLAAGPSTVAGESGLERAE
FT                   LNFGPIAARYLLHYEPKTPPTVVRGAIGVNRPADLPSEGVIAAVDVDAFDADAWRALIT
FT                   QLRSNEAPAAPAAAAAPAPPNPTVAQFLPSRFALHIGTLTLLKRHWESVIVGASHTDGK
FT                   WQANIASNQVSGHVSWLPGVNKASPGTLQARFARVVIPSVADKDLLGQAMSAPAQNMPS
FT                   IDLVVSELIVRDRNIGRLEVGAHNFNEDGVPVWQLDKLDITNPSATLTATANWRTSTEL
FT                   GNAADETTPRRTVFDFKLDIKDAGGLLERFGQPRTLKAGSGTLSGKMVWRGGPTAIDYP
FT                   TLNGNLAVDLRHGQILKVDPGVAKLLGVLSLQSLARFATLNFRDVIGEGLPFEHVTGTA
FT                   QVRNGIGRTENFEMVTAPARAEMKGSVDLAQETQDLHVQIVPTVSAGAAVVAAAVVNPL
FT                   LGLGALVADLAFSKSVSHAFAREYAITGSWSKPHIERVKSDRGKMDAPASTAGAN"
FT   gene            509952..512762
FT                   /locus_tag="BC1003_0455"
FT   CDS_pept        509952..512762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0455"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="KEGG: bxe:Bxe_A3969 glutamate-ammonia-ligase
FT                   adenylyltransferase; PFAM: glutamate-ammonia ligase
FT                   adenylyltransferase; GlnD PII-uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56458"
FT                   /db_xref="GOA:E1T7S1"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7S1"
FT                   /inference="protein motif:PRIAM:2.7.7.42"
FT                   /protein_id="ADN56458.1"
FT                   /translation="MTHATLLSSSYSHYAARAVAARPQLAAQVAELACAALTRERIDAR
FT                   FDALCAQAAGGPDAALTEDGLKRALRQLRTEVFCAVMERDLAGQADVAEVTGAMTDLAE
FT                   TAIQRALAVLSAELEVLFGEPRGPQGERLTLGVVGMGKLGGRELNVSSDIDLIFIYEDD
FT                   GETAGGQRAPIATQDFFTRLGKRLIGALAEVTADGYVFRVDMRLRPNGDSGPLVCSLGM
FT                   LEEYFYVQGREWERYAWIKGRLVSEGTSESAQRLHKQLGAIVTPFVYRRYLDYGVISAI
FT                   RALHLQIRQEAQRRASMRPDKADDIKLGRGGIREIEFSAQVFQLIRGGQDAGFRVRPTL
FT                   AVLRHAAAHGLIDTSVCEKLSQAYRFLRELEHRLQYRNDAQTHAIPVDREERAALARAM
FT                   GCDDYPMLLARLDAHREFVEQQFDQIFADKVSGRDGCGAPEDGAAVWVWSSALADDSAE
FT                   DALRARLVELGVAEPADLLARLRGVWQSSRYAGLAERSRQRFDTVAQRALEAVRTLEPP
FT                   ERRGDTLARLFDLLEAVGRRGAYLALLNEYPQALHRVLSVLGASRWAAGYLIRHPQLLD
FT                   ELLDDEALDTPFDWPEFKRTLRLRLAAADGVEQQMDLLRHAHQAEVFRILLIDLAGKLS
FT                   VEHVSDRLSELADAVLDVTLEAVWNQLPKRHRDAPRFAVIAYGKLGGKELGYASDLDVI
FT                   FLYDDPDDAASDIYSTYTRRLITWLTTATGAGTLFDIDLRLRPNGESGLLVTDLDAFRR
FT                   YQLREGDAANTAWVWEHQALTRARYCAGDAQIGAQFEAIREQVLTTPRDAAQLAREIVE
FT                   MRERVEAGHPNHTTLFDLKHDRGGMVDIEFAVQYWVLLHAARDPELIRNTGNIALLREV
FT                   SRLGLMSEAEAETVGAAYRTYRKLQHKLRLDGMEKARVEPALVAAERDAVLGLWERVFG
FT                   NQPGAA"
FT   gene            complement(512759..514429)
FT                   /locus_tag="BC1003_0456"
FT   CDS_pept        complement(512759..514429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0456"
FT                   /product="DNA repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC domain
FT                   protein; KEGG: bpy:Bphyt_0730 DNA repair protein RecN;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56459"
FT                   /db_xref="GOA:E1T7S2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7S2"
FT                   /inference="protein motif:TFAM:TIGR00634"
FT                   /protein_id="ADN56459.1"
FT                   /translation="MLRHLSIRDFVIVAALDLEFDSGFTVFSGETGAGKSILIDALALA
FT                   LGARADASVVRTGESRADITAEFDTHALVDQWLDEQALSASAADGQHGGTVMLRRVVDA
FT                   NGRSRAFINGTAATLAQLREVGEMLVDIHGQHAHQLLMRPDAQRELFDTHAGLTELSAS
FT                   VTRAWRTWREKVQAVEHAQTRDRELQLERERLAWQLAELDKLAPQPGEWEEVNAEHRRL
FT                   SHSANLIDGVQGALNALSESDEAMITHLASIVSKVRDLAEIDPALNDVLAALEPAEIQL
FT                   QEAAYSLSHYAQKLELDPDRLAQVEKRLDALHSAARKFRLQPETLPEEHETRRAQLAAL
FT                   DAAADLDSLHAAEARAREDFLAEAKKLSKARAKAGKALGAAVTTGMQELSMKGGSFEVA
FT                   LVPLPEGGAHGLEQVEFRVAGHAGVPLRPLAKVASGGELARISLALAVIASAASPTPTL
FT                   IFDEVDTGIGGGVAEVVGRLLHQLGEARQVLCVTHLPQVAARGDHHFQVAKTGNGKGGT
FT                   VSSVVPLDKASRVEEVARMLGGLEITPTTRKHAKEMLAA"
FT   gene            complement(514555..515457)
FT                   /locus_tag="BC1003_0457"
FT   CDS_pept        complement(514555..515457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0457"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: bxe:Bxe_A3967
FT                   NAD(+)/NADH kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56460"
FT                   /db_xref="GOA:E1T7S3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7S3"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /protein_id="ADN56460.1"
FT                   /translation="MQVTSQFKTVALVGRNNTPGIREPLTTLASCIARRGFEVVFEVDT
FT                   AAEIGVTDYPALRPAEIGARADVAIVLGGDGTMLGIGRQLAPYRTPLIGINHGRLGFIT
FT                   DIPISHMSEIVPQMLAGNFEREERVLLEARIMRQGNPIYHALAFNDVVVNRSGFSGMAE
FT                   LRVSVDGRFMYNQRSDGLIVATPTGSTAYALSSQGPILHPQLQGIVLVPIAPHALSNRP
FT                   IVLPDDSKVSIQIVSGREVNVNFDMQSFTSLELNDAIEVRRSRHTVPMLHPVGYSYYAT
FT                   LRKKLHWNEYPSHEEDAKL"
FT   gene            515776..516795
FT                   /locus_tag="BC1003_0458"
FT   CDS_pept        515776..516795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0458"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="KEGG: bxe:Bxe_A3966 heat-inducible transcription
FT                   repressor; TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Winged helix-turn-helix transcription
FT                   repressor, HrcA-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56461"
FT                   /db_xref="GOA:E1T7S4"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7S4"
FT                   /inference="protein motif:TFAM:TIGR00331"
FT                   /protein_id="ADN56461.1"
FT                   /translation="MLDPRAQTLLKTLIERYIAEGQPVGSRTLSRYSGLELSPATIRNV
FT                   MSDLEDLGLVVSPHTSAGRIPTPRGYRLFVDTMLTVESAADEEAVARTVKTTLQAGEPQ
FT                   KIVAAAATVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSDKRILLIIVTPEGDVQNRMMA
FT                   TQRDFSPSELVEASNYINAHFAGLSFDEVRRRLREEIDQLRGDMTTLMHAAVTASTEEP
FT                   DTGETVLISGERKLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAAGVQIFIGG
FT                   ESNLVPIEEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRVIPIVDITARLLSLTLSQQ"
FT   gene            516964..518046
FT                   /locus_tag="BC1003_0459"
FT   CDS_pept        516964..518046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0459"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="TIGRFAM: ferrochelatase; KEGG: bxe:Bxe_A3965
FT                   ferrochelatase; PFAM: ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56462"
FT                   /db_xref="GOA:E1T7S5"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7S5"
FT                   /inference="protein motif:TFAM:TIGR00109"
FT                   /protein_id="ADN56462.1"
FT                   /translation="MRFDLERPSQNATSHRVAVLLINLGTPDAPTPRAVRRYLAQFLSD
FT                   PRVVEIPALAWQIILRLLILPFRGRASAKKYAAVWLPEGSPLRVYTEKQVEGLRHLLQL
FT                   NDYTVLVDYAMRYGTPGIPAMLNQLKLAGAERVLLVPMYPQYSSSTTATAFDDAFAALK
FT                   RMRNQPEIRTVRQYADHPAYISALAAQVHHYWHLHGQPDFAAGDKLVLSFHGVPKRTLD
FT                   LGDPYHDQCQATGALLMQALGLTPVECRITFQSRFGKAEWLQPYTAPTLKELGAAGVRR
FT                   ADVFCPGFTADCLETIEEIGMEVRDEFLHAGGKEFHRIPCVNASQAWIAALGEIVAQNL
FT                   QGWPVQAVAVPHIPAHNTAA"
FT   gene            518055..518462
FT                   /locus_tag="BC1003_0460"
FT   CDS_pept        518055..518462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0460"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: RNA-binding S4 domain protein; PFAM:
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56463"
FT                   /db_xref="GOA:E1T7S6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7S6"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADN56463.1"
FT                   /translation="MNYRISTEPGAKLRIDKWLWAARFFKTRSLAADAVEKGRVRIGGA
FT                   NVKPAKDVRVGDLVEIEIERLVWQVQVLGVCDVRGPATVAQTLYAETDESREKRQAEHE
FT                   RRKTYREPAETLHGRPTKRDRRIIDRFSGGD"
FT   gene            complement(518434..518595)
FT                   /locus_tag="BC1003_0461"
FT   CDS_pept        complement(518434..518595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56464"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7S7"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0735"
FT                   /protein_id="ADN56464.1"
FT                   /translation="MKLTFAISVVALVLVAGTTTICMSGAVNDHTTEYGGVNATMEQLF
FT                   NPHLKICR"
FT   sig_peptide     complement(518521..518595)
FT                   /locus_tag="BC1003_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.574 at
FT                   residue 25"
FT   gene            518969..519553
FT                   /locus_tag="BC1003_0462"
FT   CDS_pept        518969..519553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0462"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: bxe:Bxe_A3963 putative
FT                   heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56465"
FT                   /db_xref="GOA:E1T7S8"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7S8"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADN56465.1"
FT                   /translation="MENTQENPTSQNPTPAEEAARPAAEAATPEQEAAASVATDAPATG
FT                   AEAALAEAQAKIAELQESFLRAKAETENVRRRAQEDVAKAHKFAIENFAEHLLPVVDSL
FT                   EAAVAHSSDDLAKVREGVELTLRQLTGALEKGRVVALNPVGEKFDPHRHQAISMVPADQ
FT                   EPNTVVAVLQKGFVIADRVLRPALVTVAAPK"
FT   gene            519618..520058
FT                   /locus_tag="BC1003_0463"
FT   CDS_pept        519618..520058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0463"
FT                   /product="putative thioredoxin protein"
FT                   /note="KEGG: bxe:Bxe_A3962 putative thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56466"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7S9"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3962"
FT                   /protein_id="ADN56466.1"
FT                   /translation="MANVPVDATAFSVFDMKELDADSFDAGLAEAGDVLAVVFFWGLDC
FT                   FNCEIAKKAMLAQPEAIRALGLRWFHSNVYEHRELGRRFMLHGVPTWFFFHRGKRLGRA
FT                   TGWHGLAQFQAAVAAARDKIRAGGPQVGSAASGTSKGGAPHD"
FT   gene            520212..522176
FT                   /locus_tag="BC1003_0464"
FT   CDS_pept        520212..522176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0464"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: bxe:Bxe_A3961 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56467"
FT                   /db_xref="GOA:E1T7T0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7T0"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADN56467.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMEGNSVKVIENSEGARTTPSIIAYMED
FT                   GEILVGAPAKRQSVTNPKNTLYAVKRLIGRRFEEKEVQKDIGLMPYKIMKADNGDAWIE
FT                   VREQKLAPPQISAEVLRKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAFGLDKNEKGDRKIAVYDLGGGTFDISIIEIADVDGEKQFEVLST
FT                   NGDTFLGGEDFDQRIIDYIISEFKKEQGVDLSKDVLALQRLKESAEKAKIELSSSQQTE
FT                   INLPYITADASGPKHLNLKITRAKLEALVEELIERTIEPCRMAIKDAGVKVGEIDDVIL
FT                   VGGMTRMPKVQEKVKEFFGKDPRRDVNPDEAVAVGAAIQGQVLSGDRKDVLLLDVTPLS
FT                   LGIETLGGVMTKMINKNTTIPTKHSQVYSTADDNQSAVTIKVYQGEREMAAGNKLLGEF
FT                   NLEGIPPAPRGTPQIEVSFDIDANGILHVGAKDKATGKENRITIKANSGLSEAEIEKMV
FT                   KDAEANAEEDHKLRELADARNQGDALVHSTKKALTEYGDKLEAGEKEKIESALKDLEDT
FT                   LKSGSSDKAAIEAKIEAVATASQKMGEKMYADMQAAQGAQAAAAGAAGASAGSGASAGG
FT                   ASQQQDDVVDAEFKEVKKD"
FT   gene            522447..523583
FT                   /locus_tag="BC1003_0465"
FT   CDS_pept        522447..523583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0465"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: chaperone
FT                   DnaJ domain protein; DnaJ central domain protein; heat
FT                   shock protein DnaJ domain protein; KEGG: bpy:Bphyt_0738
FT                   chaperone protein DnaJ; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56468"
FT                   /db_xref="GOA:E1T7T1"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7T1"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADN56468.1"
FT                   /translation="MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEE
FT                   HFKEVKEAYEMLSDSQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFGDIFGDIFGQA
FT                   AGGAARGGRAGPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGT
FT                   KPETCPTCSGSGAVRMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGAGKVKETKTLEVK
FT                   IPAGIDDGMRIRSAGNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFTTA
FT                   ALGGEIEVPTLAGRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKL
FT                   TESQRDLLKQFEKALVEGGARHSPQSKSWFDRVKSFFD"
FT   gene            523609..525504
FT                   /locus_tag="BC1003_0466"
FT   CDS_pept        523609..525504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0466"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="KEGG: bpy:Bphyt_0739 para-aminobenzoate synthase,
FT                   subunit I; TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Chorismate binding-like; aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56469"
FT                   /db_xref="GOA:E1T7T2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7T2"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ADN56469.1"
FT                   /translation="MTADERGAVFALLDDCDASAARRSSRLYTGFVHEHVCADAAQLEA
FT                   VCEAAQADARSGLFAVVLADYEFGRHLLGGAFAPSIKTQHGNATLRFLLFERCEKLSRD
FT                   EVDAWLVQQDGGLAEPSAAGTANVRESVEPQEFNAAIGAIHAALRAGDSYQVNYTYRLS
FT                   FDVFGTPAALYRRLRARQPVRYGALIALPGGAWVLSCSPELFVEKQGATLRARPMKGTA
FT                   PRCADPAADRAAAEFLRSDPKNRAENVMIVDLLRNDLSRVAQTGTVKVPALFSVEPYAS
FT                   VWQMTSTVQAALRPGTSFAAILRALFPCGSITGAPKHRTMQLIDAIESTPRGLYTGAIG
FT                   WLDAAAEPGQAGAGEQACGDFCMSVAIRTLTLEPSVQSGLLRGTMGIGAGIVLDSVAED
FT                   EYAECRLKARFLTGAEPGFELFETMYATQEAGVRHLSRHLSRLSASAATFGFAFDEQAV
FT                   RAQIAEKCASLPPLTPHRMRLALGKSGATQVTAAVLTPLAESSVGVLLATEHGFATLQA
FT                   GDPLLRHKTTRRAEYDRGWREAEARGAFDMLFFNERGELTEGGRSNVFVKLDGHWWTPP
FT                   LDSGVLPGVMRGVLLEEDTSLQAAEKVLTQADVLNAQALMICNALRGAMPARLVH"
FT   gene            complement(525736..526551)
FT                   /locus_tag="BC1003_0467"
FT   CDS_pept        complement(525736..526551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0467"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; KEGG: bpy:Bphyt_0741
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; PFAM:
FT                   Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56470"
FT                   /db_xref="GOA:E1T7T3"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7T3"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ADN56470.1"
FT                   /translation="MTYLQETSRNAITVPKLQAMRDAGEKIAMLTCYDASFAALLDRAG
FT                   VDVLLIGDSLGNVLQGQTTTLPVSLADIAYHTASVARARPAALIVADLPFGTYGTREEA
FT                   YRSSVELMRAGAQMVKLEGGEWLADTVRFLVERSIPVCAHVGLTPQSVHAFGGFKVQGK
FT                   TEQGASQLLRDALAMQAAGAQLIVMEAIPTLLASEVTKQLRIPTIGIGAGLDCSGQVLV
FT                   LHDMLGIFPGKRPRFVKDFMHGQPSILAAVEAYVRAVKDGTFPGPEHTF"
FT   gene            complement(526585..527265)
FT                   /locus_tag="BC1003_0468"
FT   CDS_pept        complement(526585..527265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0468"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: bxe:Bxe_A3957
FT                   putative deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56471"
FT                   /db_xref="GOA:E1T7T4"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7T4"
FT                   /inference="protein motif:PFAM:PF01712"
FT                   /protein_id="ADN56471.1"
FT                   /translation="MNSPPLTVTAPQLRPPFGYLAIEGPIGVGKTSLARRLAQRWSMQE
FT                   LFERPQDNPFLERFYRDTARYALPAQLHFALQRAQQAQEVSAAHMEGTPLIADFMTQKN
FT                   DIFARLTLQEDEWHLYRALAARLEVSAPAPDFVVYLQASPEVLFSRIQKRAVPMELQIS
FT                   DAYLHALCDAYNQFFYHYDRTPVLTVNAEHLNPLDSDADLALLAERIETMRGRKEFFVK
FT                   GTSL"
FT   gene            complement(527262..527795)
FT                   /locus_tag="BC1003_0469"
FT   CDS_pept        complement(527262..527795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0469"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56472"
FT                   /db_xref="GOA:E1T7T5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7T5"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADN56472.1"
FT                   /translation="MTVAYLGLGANLGDARQTLKDAVVCLAQQHTITVLAKSSLYRTAP
FT                   IDAGGDDYFNCVVKIDTTLPVRHLLALCHKIEHQFGRERPFRNAPRTLDLDILLYGDQS
FT                   IDEADLIVPHPRLVERAFALVPLVEIDAALVIPRHGRADALLDGVRAQRIEKIKGPCQC
FT                   PTLNALNAGKGRCE"
FT   gene            complement(527845..529443)
FT                   /locus_tag="BC1003_0470"
FT   CDS_pept        complement(527845..529443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0470"
FT                   /product="poly(A) polymerase"
FT                   /note="KEGG: bxe:Bxe_A3955 poly(A) polymerase; TIGRFAM:
FT                   poly(A) polymerase; PFAM: Polynucleotide
FT                   adenylyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56473"
FT                   /db_xref="GOA:E1T7T6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7T6"
FT                   /inference="protein motif:TFAM:TIGR01942"
FT                   /protein_id="ADN56473.1"
FT                   /translation="MIKKLIRKLFGQDTASAEDTLPAEADADEAGSAPARNAAGAAGAG
FT                   RARRKPARGGAPAKAVRDPDVPVIIPHDVHGIDPALISRNAIRVTEGLQQAGHRAFIVG
FT                   GAVRDLLLGIKPKDFDVATDATPEQVQKLFRRARIIGRRFQIVHVQFGQEIIETSTFRA
FT                   LVDPPAADAAPPRRLKRDELDRRTHAVDASGRVLRDNVWGEQHEDATRRDFTINAMYYD
FT                   PATETVLDYHNGMADVRARLLRMIGDPATRYREDPVRMLRVVRFAAKLDFEIDAATREP
FT                   IASMADLINNVPAARLFDEMLKLMLSGHALACLKRLRQEGLHHGLLPLLDVVLEQPTGE
FT                   KFITLALNNTDARVRAGKPVSPGFLFATLLWHDVQQRWQKFEANGEYPVPALHRAMDEV
FT                   LDMQTEKLAIHKRFSSDMREIWGLQLRLEKRSGRSALKLLEHQRFRAGYDFLLLRCESG
FT                   ELDESVGAWWTEFIEGDAAAREALLTQGGKDRSPRKRRRRGGGARNRKSGDGMEGGTPA
FT                   ERADTEAGHDSPHED"
FT   gene            complement(529440..530126)
FT                   /locus_tag="BC1003_0471"
FT   CDS_pept        complement(529440..530126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0471"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); KEGG: bxe:Bxe_A3954 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56474"
FT                   /db_xref="GOA:E1T7T7"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7T7"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ADN56474.1"
FT                   /translation="MANLALFDLDHTLIPTDSDHEWGRFMVKHGMVDAENFARENDRFY
FT                   ADYKAGKLDIHAYLIAMLTPLAKYTRAQLADFHAQYMHEVITPAILPAAVELVKRHREA
FT                   GDLCCVVTATNEFITRPIASAFGVDTLIACEAETVDGQPHSAYTGRPTGTPSYKEGKIV
FT                   RTEAWLASLGKNWSDFEHSYFYSDSHNDIPLLEKVTDPIATNPDDTLRAHAEAKGWRIL
FT                   ELFQPT"
FT   gene            complement(530119..530862)
FT                   /locus_tag="BC1003_0472"
FT   CDS_pept        complement(530119..530862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0472"
FT                   /product="DnaA regulatory inactivator Hda"
FT                   /note="KEGG: bxe:Bxe_A3953 DnaA regulatory inactivator Hda;
FT                   TIGRFAM: DnaA regulatory inactivator Hda; PFAM: Chromosomal
FT                   replication initiator DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56475"
FT                   /db_xref="GOA:E1T7T8"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7T8"
FT                   /inference="protein motif:TFAM:TIGR03420"
FT                   /protein_id="ADN56475.1"
FT                   /translation="MLRQLTLDLGTPPPSTFDNFFAGANAELVTRLRELDSALAAGPLA
FT                   DRTFYVWGEAGSGRTHLLQALVHEAPPGHARFAGPQSSLAAFGFDPRVALYAIDDCDAL
FT                   SAAQQIAVFNLFNEVRAHPTSALVATGNAPPIGMTVREDLRTRLGWGLVFHLAPLPDEA
FT                   KAAVLKRAARERGIMLADDVPAYLLTHFRRDMPSLMALLDALDRFSLEQKRAVTLPLLR
FT                   TMLASPAQEAPAASSAASSKIDPHG"
FT   gene            complement(530933..532009)
FT                   /locus_tag="BC1003_0473"
FT   CDS_pept        complement(530933..532009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0473"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bpy:Bphyt_0747 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56476"
FT                   /db_xref="GOA:E1T7T9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7T9"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADN56476.1"
FT                   /translation="MQQNAPILTPVQRRAFIWLAIALGVGILLWLLSPVLTPFLLGAIL
FT                   AYILQPGVAWMVRRRVPRALAALLMMLLFTLLMTLLALLVFAVIQKEGPQLRQQVPLLF
FT                   THVNAWLQPKLALLGLADSLDFASVRDLVMGQLEGSAQTVARYAWTSIVTSSNVMMAVV
FT                   GNLIMVPLVLFYLLYDWNRMLLRVQSVVPRRWLDKTLQLARDMDQMLSQYLRGQLLVMG
FT                   VLAVFYAAALSIAGFEIALPVGIFTGLAVFIPYVGFATGLALALLAALLQFGNWYGFGA
FT                   VALIYGVGQIVESFFLTPRLVGERIGLHPLAVIFALLAFGQLFGFFGVLLALPVSAILS
FT                   VAVRELRQSYLQSTLYNN"
FT   gene            532158..533225
FT                   /locus_tag="BC1003_0474"
FT   CDS_pept        532158..533225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0474"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; KEGG: bpy:Bphyt_0748
FT                   phosphoribosylaminoimidazole synthetase; PFAM: AIR synthase
FT                   related protein domain protein; AIR synthase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56477"
FT                   /db_xref="GOA:E1T7U0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7U0"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADN56477.1"
FT                   /translation="MNQPKSAPNSTDSAQGLSYRDAGVDIDAGDALVDAIKPFAKKTMR
FT                   DGVLGGIGGFGALFEVPKRYKEPVLVSGTDGVGTKLRLAFQLNRHDTVGQDLVAMSVND
FT                   ILVQGAEPLFFLDYFACGKLDVGTAATVVKGIAQGCELAGCALIGGETAEMPGMYPDGE
FT                   YDLAGFAVGAVEKSKIIDGSTIAPGDVVLGLASSGIHSNGFSLVRKIIERAQPDLNADF
FT                   DGRSLADALMAPTHIYVKPLLALMQQIAVKGMAHITGGGLVENIPRVLREGLTAELDHR
FT                   GWPLPPLFSWLQKHGGVADAEMHRVFNCGIGMAVVVSAADADAAIGLLSAAGEQVWKIG
FT                   VIRESAAGEAQTVVV"
FT   gene            complement(533420..534379)
FT                   /locus_tag="BC1003_0475"
FT   CDS_pept        complement(533420..534379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0475"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="TIGRFAM: tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; KEGG: bxe:Bxe_A3935 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; PFAM: tRNA
FT                   isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56478"
FT                   /db_xref="GOA:E1T7U1"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7U1"
FT                   /inference="protein motif:TFAM:TIGR00174"
FT                   /protein_id="ADN56478.1"
FT                   /translation="MLMSTRKSTPVPCLLGPTASGKTAAALALAARHPVEIVSVDSALV
FT                   YREMDIGTAKPSAGERAVAPHHLIDIVDPADAYSAAQFRADALRLTAEISARGRLPLLV
FT                   GGTMLYYKALTQGLNDLPAADATVRAQLDADAARDGWPALHARLAAVDPATAARLAPND
FT                   SQRIQRALEVFLLTGEPMSALLAAPARSDEAAAQWQFVPIALEPSERSVLHARIEQRFD
FT                   AMLANGFVDEVVKLRARGDLSPDMPSMRCVGYRQVWEYLDGAVDYSTMRDKGVFATRQL
FT                   CKRQLTWLRGMNERVVVDCCDPQATARVLEVVERLIGA"
FT   sig_peptide     complement(534302..534379)
FT                   /locus_tag="BC1003_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.731) with cleavage site probability 0.642 at
FT                   residue 26"
FT   gene            complement(534417..536489)
FT                   /locus_tag="BC1003_0476"
FT   CDS_pept        complement(534417..536489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0476"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="KEGG: bpy:Bphyt_0750 DNA mismatch repair protein;
FT                   TIGRFAM: DNA mismatch repair protein MutL; PFAM: MutL
FT                   dimerisation; DNA mismatch repair protein domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56479"
FT                   /db_xref="GOA:E1T7U2"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7U2"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ADN56479.1"
FT                   /translation="MSEFSETAARADAPPTAAAAPVPRPLRAIQPLPDQLISQIAAGEV
FT                   VERPASVVKELLENALDAGARTLRILLDEGGVKRISITDDGCGIPENELTLALMRHATS
FT                   KIRSLAELEAVATLGFRGEALASIASVAQMTITSRTAEAPHAMRVDAQTGVLSPAAGAQ
FT                   GTTIEVRELYFNTPARRKFLKSEQTELGHCLEQIRRAALARPDVAISVLHNGKAVEHWN
FT                   ASEPPVRVAKILGETFATAHLPLDESAGPLAIYGCAGLPTASRGRSDQQYFFVNGRFVR
FT                   DKLLTHAVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVHPSKIEVRFRDSRSIHQFVF
FT                   HAVQRALARHAGASPETTAGGHAAHLQASAGGAVSFGASPVGGVGSGAAGAMNTGNGAG
FT                   SAGGFAHNPSAGPATGGFNASQSQPGNTWMRQSRMTQGTLPVAQPLAFYDALFGRKDTQ
FT                   AGTSQAATLFEARDSAAEVSSPYNPSAPYAPPAFNPADDQPLGFALGQIHGIYVLAQNA
FT                   HGLVIVDMHAAHERILYEQFKNALADRSIAVQPLLIPQTMQADAVEIGTVEEERATLDA
FT                   LGFDLAVLSPTTLAIRAVPALLKDADLQALARAVLSDLHAYGGSRVLTERQHELLGTLA
FT                   CHHAVRANRRLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLADLDRLFMRGQ"
FT   gene            536684..537349
FT                   /locus_tag="BC1003_0477"
FT   CDS_pept        536684..537349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0477"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   bxe:Bxe_A3933 DedA family transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56480"
FT                   /db_xref="GOA:E1T7U3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7U3"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADN56480.1"
FT                   /translation="MDTLLHLANLVLHIDKFLGEFIHVYGAWVYAVLFLIVFCETGLVI
FT                   LPFLPGDSLLFIGGAFCASGQMSLGLLILLLVVAATTGNTVNYMIGRAIGPKVFNSRIP
FT                   MLERFLDRRALQRTHDFYEKHGGKTIVLARFIPIVRTFAPFVAGASAMTVSRFQLFNIA
FT                   GALFWVLLLVLLGYFFGNIPFIRQYLNVIVLVGIGAAIVPVVLGALWKMMRKNASKPG"
FT   gene            complement(537465..537845)
FT                   /locus_tag="BC1003_0478"
FT   CDS_pept        complement(537465..537845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56481"
FT                   /db_xref="GOA:E1T7U4"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7U4"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0753"
FT                   /protein_id="ADN56481.1"
FT                   /translation="MDMTNFLFDLVSNFALLAIVLIACHVCNRLIPGVALNGPRVFAAL
FT                   ACAAVLLDAALTFLVFADARTRYGQFSTPSAFVVRSAAYALTVVVAFAWNSVRRRNQSA
FT                   NASPHAGLVIPTSPYSKSHLPM"
FT   gene            complement(538184..538259)
FT                   /locus_tag="BC1003_R0005"
FT                   /note="tRNA-Lys1"
FT   tRNA            complement(538184..538259)
FT                   /locus_tag="BC1003_R0005"
FT                   /product="tRNA-Lys"
FT   gene            complement(538598..539347)
FT                   /locus_tag="BC1003_0479"
FT   CDS_pept        complement(538598..539347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0479"
FT                   /product="tol-pal system protein YbgF"
FT                   /note="TIGRFAM: tol-pal system protein YbgF; KEGG:
FT                   bpy:Bphyt_0757 tol-pal system protein YbgF"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56482"
FT                   /db_xref="GOA:E1T7U5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7U5"
FT                   /inference="protein motif:TFAM:TIGR02795"
FT                   /protein_id="ADN56482.1"
FT                   /translation="MTHRFPWPRFAAAACVAGTVLVAVPAHAGIFDDDQARQAILDLRA
FT                   KTDSLSSQLSAAQRTILDQSNRLDQLNQQVATLRGQNEDMGNQLATLQKQQKDYYTDLD
FT                   TRLKKFEPQQQTVDGVQGEVQPGETDAFNAASQQFRNGDFKSAAASFRSFIAKFPNSPY
FT                   QPTAQYWLGNAQYALRDYKGSTATWQGVVKNYPQHPRAPEALLAIANNQIEQGQKAAAK
FT                   KTLEQIVAQYGGSNVAQSAQSKLSQIK"
FT   sig_peptide     complement(539261..539347)
FT                   /locus_tag="BC1003_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(539367..539876)
FT                   /locus_tag="BC1003_0480"
FT   CDS_pept        complement(539367..539876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0480"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /note="KEGG: bxe:Bxe_A3921 OmpA/MotB family outer membrane
FT                   protein; TIGRFAM: peptidoglycan-associated lipoprotein;
FT                   PFAM: OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56483"
FT                   /db_xref="GOA:E1T7U6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7U6"
FT                   /inference="protein motif:TFAM:TIGR02802"
FT                   /protein_id="ADN56483.1"
FT                   /translation="MMSKLRFAFAVLMVGALAACHSGVKLDENANKGGAVSTQPNPNDV
FT                   AQVNVDPLNDPNSPLAKRSIYFDFDSYSVKDDYQSLLQQHAQYLKSHPQRHVLIQGNTD
FT                   ERGTSEYNLALGQKRAEAVRRSLSLMGVTDSQMEAVSLGKEKPQATGHDESSWAQNRRA
FT                   DLVYQQ"
FT   sig_peptide     complement(539808..539876)
FT                   /locus_tag="BC1003_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.548 at
FT                   residue 23"
FT   gene            complement(539908..541200)
FT                   /locus_tag="BC1003_0481"
FT   CDS_pept        complement(539908..541200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0481"
FT                   /product="Tol-Pal system beta propeller repeat protein
FT                   TolB"
FT                   /note="KEGG: bxe:Bxe_A3920 translocation protein TolB;
FT                   TIGRFAM: Tol-Pal system beta propeller repeat protein TolB;
FT                   PFAM: TolB domain-containing protein; WD40-like beta
FT                   Propeller containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56484"
FT                   /db_xref="GOA:E1T7U7"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7U7"
FT                   /inference="protein motif:TFAM:TIGR02800"
FT                   /protein_id="ADN56484.1"
FT                   /translation="MSLMTKLGLRTLVASCLIAVGGAANAQLNVLVTGVGSTQFPIATA
FT                   NFANEANSPQQVSTIVRQDLQRSGKFTNIDAGSAPVPETASVDLGSWKAKGANAFVAGS
FT                   VNRLPNGQYEVRFKLYDTVKGESLGGLVLVSPESGLRMSAHKVADYIYAKLMGGRGVFA
FT                   TRLSYVIKTGNRYQLQISDSDGQDAHIALSSPEPIISPAWSPDGTKVAYVSFEKKKPIV
FT                   YIHDLPTGRRIVVADQKGNNSAPAWSPDGRTLAVALSRTGNTQIFAVNADGSGLRRLTQ
FT                   GSSIDTEPTFSPDGQTIYFTSDRGGQPQIYKMSAQGESAGAAQRVTFTGSYNTSPRVSP
FT                   DGKQLAYISRVGGGFKLYIQDLQGGTATGLTDTTHDESPSFAANGQYILYATQVNGRGV
FT                   LAAVSTDGRTRQVLSVQGGSVREPSWGPFMQ"
FT   sig_peptide     complement(541120..541200)
FT                   /locus_tag="BC1003_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.984 at
FT                   residue 27"
FT   gene            complement(541338..542351)
FT                   /locus_tag="BC1003_0482"
FT   CDS_pept        complement(541338..542351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0482"
FT                   /product="protein TolA"
FT                   /note="KEGG: bxe:Bxe_A3919 TonB protein; TIGRFAM: protein
FT                   TolA; TonB family protein; PFAM: Tol-Pal system TolA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56485"
FT                   /db_xref="GOA:E1T7U8"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7U8"
FT                   /inference="protein motif:TFAM:TIGR02794"
FT                   /protein_id="ADN56485.1"
FT                   /translation="MIRKNTEYPLQPPRERGTGRAFVFALVMHALLGFFLYHGIQWQNS
FT                   TPEGAEAELWTEVPDSAIPRPVTPPPVPVAPAPPVRDEQADIALQEKKRKQQEAAREAQ
FT                   LAEQQRQEKLRAQQEAEARRQQELAAEQAAKAAAAKQKQLQQQQAEKLRQQQLAEQKKQ
FT                   QLKEQQEEQQKQAEAQKQAEAEAQKKAEAQKAAKAKAQAEAAAQAKKLDAERRARLAQM
FT                   QGMAGPPGSAGNGLGKSGTGSGSGGTAASPGYADKVRRVVRPNITWGGETEGLETVIAV
FT                   RCSPTGTLLSATIAHSSGNSAWDDAALRAVQRSDPMPQDIDGKTPASFRITLRPAG"
FT   gene            complement(542348..542794)
FT                   /locus_tag="BC1003_0483"
FT   CDS_pept        complement(542348..542794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0483"
FT                   /product="protein TolR"
FT                   /note="KEGG: protein TolR; TIGRFAM: protein TolR; PFAM:
FT                   Biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56486"
FT                   /db_xref="GOA:E1T7U9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7U9"
FT                   /inference="protein motif:TFAM:TIGR02801"
FT                   /protein_id="ADN56486.1"
FT                   /translation="MAGSRSSSMRGGRSRRAMSDINVVPYIDVMLVLLVIFMVTAPLVA
FT                   PSIVNLPTVGGAAPQQQTPPVIVNIRADGNMSVKYKDDSGAQQQEDMTKAGLNGFIADR
FT                   AQSHPDQPVVIAADKTVKYEAVMNVMSELKAQGVKRVGLLVKSQ"
FT   gene            complement(542805..543482)
FT                   /locus_tag="BC1003_0484"
FT   CDS_pept        complement(542805..543482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0484"
FT                   /product="protein TolQ"
FT                   /note="KEGG: protein TolQ; TIGRFAM: protein TolQ; PFAM:
FT                   MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56487"
FT                   /db_xref="GOA:E1T7V0"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7V0"
FT                   /inference="protein motif:TFAM:TIGR02796"
FT                   /protein_id="ADN56487.1"
FT                   /translation="MNTTQDLSIVSLVLNASLLAQAVMALLLLLSLLSWTFIFRKWFAI
FT                   RRARAQTERFERDFWSGGDLQALYQSAANNRHTIGALERIFESGMREFLKGKEKRLNDP
FT                   GAILDGARRAMRAAFQREMDVLEANLAFLASVGSVSPYIGLFGTVWGIMNAFRGLANVQ
FT                   QATLANVAPGIAEALTATAIGLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQR
FT                   QAH"
FT   sig_peptide     complement(543414..543482)
FT                   /locus_tag="BC1003_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.490 at
FT                   residue 23"
FT   gene            complement(543640..544116)
FT                   /locus_tag="BC1003_0485"
FT   CDS_pept        complement(543640..544116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0485"
FT                   /product="tol-pal system-associated acyl-CoA thioesterase"
FT                   /note="KEGG: bxe:Bxe_A3916 4-hydroxybenzoyl-CoA
FT                   thioesterase; TIGRFAM: tol-pal system-associated acyl-CoA
FT                   thioesterase; PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56488"
FT                   /db_xref="GOA:E1T7V1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7V1"
FT                   /inference="protein motif:TFAM:TIGR02799"
FT                   /protein_id="ADN56488.1"
FT                   /translation="MRRMNMTTSQPGTEIGHTWDIRVYYEDTDAGGIVFYANYLKFFER
FT                   ARTEWLRACGIEQNRLADETGAIFIVRSTAVDYRAPARLDDIVKVVSRIERLGKASVDF
FT                   AQEAWRGGTLLATGSIRIGCVARTGLRPAPIPPPVLAALRRGPGASGGVSTNPG"
FT   gene            complement(544175..544921)
FT                   /locus_tag="BC1003_0486"
FT   CDS_pept        complement(544175..544921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0486"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56489"
FT                   /db_xref="GOA:E1T7V2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7V2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN56489.1"
FT                   /translation="MIVFVTGASAGFGAAIARAFVKGGHRVVATARRKDRLQALADELG
FT                   DALLPYELDVRDRAAVEAVPAALPAEFAAIDVLVNNAGLALGVEPAHKASLDEWQTMIA
FT                   TNCTGLVQVTHALLPGMVERNRGHIFNLGSVAGHWPYPGGNVYGATKAFVRQFSLNLRA
FT                   DLAGTALRVTDIEPGLCGGTEFSNVRYRGDDEKAGKVYENVQPLTAEDIADSIYWIATR
FT                   PAHVNINTIELMPVAQSFAGLSVHRG"
FT   gene            545435..546682
FT                   /locus_tag="BC1003_0487"
FT   CDS_pept        545435..546682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0487"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="KEGG: bpy:Bphyt_0765 serine
FT                   hydroxymethyltransferase; PFAM: glycine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56490"
FT                   /db_xref="GOA:E1T7V3"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7V3"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADN56490.1"
FT                   /translation="MFDRAQSTIANVDPELWKVIEQENRRQEEHIELIASENYTSPAVM
FT                   AAQGSQLTNKYAEGYPGKRYYGGCEYVDVAEQLAIDRVKQLFGAEAANVQPNSGSQANQ
FT                   GVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNEAEDIDYDAAEKLA
FT                   QEHKPKLIVAGASAFALRIDFERLSKIAKSVGAYFMVDMAHYAGLIAAGVYPNPVPHAD
FT                   FVTTTTHKSLRGPRGGVILMKAEFEKQINSAIFPGIQGGPLMHVIAGKAVAFKEALSPE
FT                   FKVYQQQVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKKITGKAAEAALGAAHI
FT                   TVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGVKEAEQVANLIADVLENPEDAATIER
FT                   VRGQVAELTQRFPVYR"
FT   gene            546689..547171
FT                   /locus_tag="BC1003_0488"
FT   CDS_pept        546689..547171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0488"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: bxe:Bxe_A3913
FT                   transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56491"
FT                   /db_xref="GOA:E1T7V4"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7V4"
FT                   /inference="protein motif:PFAM:PF03477"
FT                   /protein_id="ADN56491.1"
FT                   /translation="MHCPFCRHADTQVVDSRVSEDGATIRRRRRCPACDKRFTTYERVE
FT                   LALPAVVKKDGSRTEFDRRKIVASMQLALRKRPVAADAIDAAVARIEYQLLGSGEREVR
FT                   SERLGELVMNELRALDTIAYVRFASVYRRFEDVSEFEDVIEEFRRASSPPKPSRKR"
FT   gene            547376..547936
FT                   /locus_tag="BC1003_0489"
FT   CDS_pept        547376..547936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56492"
FT                   /db_xref="GOA:E1T7V5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7V5"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0767"
FT                   /protein_id="ADN56492.1"
FT                   /translation="MKPHAIASPPCGAFTLVETLVVIALLAVILVMATPSFVAWRVRDQ
FT                   VDARAKALVSTLAYARSEALRRGARVTVCRADAARHCLPAGQPCGNAISDWSCGWAVLA
FT                   DRGGTSTLLRAHGSLAAVSIVGVQTNLTFTPPAGQLIGTFRSFEIAPRTPSKATQGDKW
FT                   RRCIRIAAGGRTRIVEGACGAAS"
FT   gene            547933..548457
FT                   /locus_tag="BC1003_0490"
FT   CDS_pept        547933..548457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56493"
FT                   /db_xref="GOA:E1T7V6"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7V6"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0768"
FT                   /protein_id="ADN56493.1"
FT                   /translation="MSELIRRSARFAQARGSLMLGQARLCGKDRMPRVWPHRFRARRGG
FT                   SSLIEVMLAVAVMAASALGLIAGQLWTAREARAMSMREHAAWIADSVVEAACAPSSSDS
FT                   ALNAWRTRAATLLPQGDASVTGTAGVAVARVTWTALRNMPRADDMMDKPEPCGGVDAPA
FT                   GSSCVALAFVK"
FT   gene            548454..549266
FT                   /locus_tag="BC1003_0491"
FT   CDS_pept        548454..549266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56494"
FT                   /db_xref="GOA:E1T7V7"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7V7"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3911"
FT                   /protein_id="ADN56494.1"
FT                   /translation="MMLPARDGRGHTLIEFVIAVALGLMVTAGVVSLYSTQRTAFDNAN
FT                   NALRMRDAGLAALTVIGQQLQMAGFVPTGVAQYRAPAPLFGCSGGHPAGTDDSRLTCET
FT                   LTGKSDGVAVRYVGDSVSTWPSSTGQTTDCLGQAVTGTSAALGDRGVPVVNRFYAKPSS
FT                   STGEPELYCEGNGKTGSAQPLVEGVERLRIRYWLAGAASAVDASAVPADQWSMVVAVDL
FT                   CVLVRGAPQRQHSRYTDCDGVAGVATDSRPRQAFWRRVALRNYAEGGL"
FT   gene            549470..549913
FT                   /locus_tag="BC1003_0492"
FT   CDS_pept        549470..549913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56495"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7V8"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3910"
FT                   /protein_id="ADN56495.1"
FT                   /translation="MLLATSAAWFEASLAAARSAVNVREYLQAFHAADSALTLCTRNAI
FT                   ASTATGVIAAQAAAREPTQWKLEAVFEGAATTPVGQWPGSLRPPQCLIEEWRLAGRQDA
FT                   RAYLLTARGFGNNRDSQVWLQMQLVVDGDKVERHWRRVAARPF"
FT   gene            549923..550354
FT                   /locus_tag="BC1003_0493"
FT   CDS_pept        549923..550354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56496"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7V9"
FT                   /inference="similar to AA sequence:KEGG:BC1002_0536"
FT                   /protein_id="ADN56496.1"
FT                   /translation="MRRPHLCAFTLLELVITLAIVAVLAVFAVPSYRNQIARTHRVDAA
FT                   SALMRAAQFVEGAASTGTIALPPGFDRAPQSGTAVYHLRVLPADDTNGGYSIEAAPDDA
FT                   GPMRDDPCGVFTLDATGLRSNRNGANGSAPLAAECWGTG"
FT   sig_peptide     549923..550009
FT                   /locus_tag="BC1003_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.858 at
FT                   residue 29"
FT   gene            complement(550386..550850)
FT                   /locus_tag="BC1003_0494"
FT   CDS_pept        complement(550386..550850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56497"
FT                   /db_xref="InterPro:IPR021751"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7W0"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0772"
FT                   /protein_id="ADN56497.1"
FT                   /translation="MSQSYSNTAYRNKRQPARDLSAPQLRALRKELLLVRADVERMEFA
FT                   QATMELREAVTHFSWLKFIVPGFGGLRMGSGAKTSFLNAGTIGALLKQYPLISSLASLV
FT                   LAKPLRATVAAGAKPALKWGSLAFAAWEAYRVWQQIKGASRATVDSPDQG"
FT   gene            complement(550989..551375)
FT                   /locus_tag="BC1003_0495"
FT   CDS_pept        complement(550989..551375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0495"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: bxe:Bxe_A3907 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56498"
FT                   /db_xref="GOA:E1T7W1"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7W1"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3907"
FT                   /protein_id="ADN56498.1"
FT                   /translation="MTIDTQSQREQHSPLRRIISSVSAILQTRLELIGIELAEEKDRLL
FT                   GVLFLGLAAMMLTTMALIALTALVAIAFWDTYRWQALAGITLVYAIAGLVCALKARSGL
FT                   RNAPMVFEATIAEFEKDRDVFRRP"
FT   gene            complement(551513..551815)
FT                   /locus_tag="BC1003_0496"
FT   CDS_pept        complement(551513..551815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0496"
FT                   /product="protein of unknown function DUF883 ElaB"
FT                   /note="PFAM: protein of unknown function DUF883 ElaB; KEGG:
FT                   bpy:Bphyt_0774 protein of unknown function DUF883 ElaB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56499"
FT                   /db_xref="GOA:E1T7W2"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7W2"
FT                   /inference="protein motif:PFAM:PF05957"
FT                   /protein_id="ADN56499.1"
FT                   /translation="MSEVNKERLMSDIKTVLADAEDLLKQAASATGERASELRETALSR
FT                   LKQAREKAADVQVVVVEKGKKAARATDDYVHEHPWASIGIAAGAGVLLGLLINRK"
FT   gene            552155..552793
FT                   /locus_tag="BC1003_0497"
FT   CDS_pept        552155..552793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0497"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="KEGG: bxe:Bxe_A3905 1-Cys peroxiredoxin; PFAM: alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56500"
FT                   /db_xref="GOA:E1T7W3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7W3"
FT                   /inference="protein motif:PRIAM:1.11.1.7"
FT                   /protein_id="ADN56500.1"
FT                   /translation="MSLRLGDIAPDFEQESSIGRIKFHEWLGDSWGVLFSHPADFTPVC
FT                   TTELGLTAKLAEEFEKRNVKTIALSVDSAESHKEWIKDINETQAANVGFPILADGDRKV
FT                   SELYDMIHPNANETLTVRSLFVIDPKKKVRLIITYPASTGRNFDEVLRVIDSLQLTDSH
FT                   SVATPGNWKQGDDVVIVPSLKDEEVIKQKFPKGYKALRPYLRMTPQPNK"
FT   gene            complement(552925..554115)
FT                   /locus_tag="BC1003_0498"
FT   CDS_pept        complement(552925..554115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0498"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: bpy:Bphyt_0776 acyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56501"
FT                   /db_xref="GOA:E1T7W4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7W4"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADN56501.1"
FT                   /translation="MAEAAQFHWEDPLLLDQQLTEDERMVRDAAAAYAQDKLQPRVLEA
FT                   FRHEKTDIEIFREMGELGLLGPTIPEQYGGPGLNYVAYGLIAREVERVDSGYRSMMSVQ
FT                   SSLVMVPIYEFGSEAQKQKYLPKLATGEWIGCFGLTEPNHGSDPGSMVTRAKKVDGGYS
FT                   LSGSKMWITNSPIADVFVVWAKLEENGKDTIRGFILERGWKGLSAPTIHSKVGLRASIT
FT                   GEIVLDEVFVPEENRFPEVSGLRGPFTCLNSARYGIAWGALGAAEACWHTARQYVLDRK
FT                   QFGRPLAANQLIQKKLADMQTEITLGLQGVLRLGRMKDEGTAAVEITSIMKRNSCGKAL
FT                   DIARLARDMLGGNGISDEFGIARHLVNLEVVNTYEGTHDIHALILGRAQTGIQAFF"
FT   gene            554209..554994
FT                   /locus_tag="BC1003_0499"
FT   CDS_pept        554209..554994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0499"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: bxe:Bxe_A3903 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56502"
FT                   /db_xref="GOA:E1T7W5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7W5"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADN56502.1"
FT                   /translation="MTPAATSTEPLDERKFVVALARGLDLLRAFRPGETMLGNRDFVER
FT                   TGLPKATVNRLAYTLTVLGYLRLDESVGKYALDAGVLSLGFALLSGTDTLELARPHMRT
FT                   FAREVGAAVSLGCRDGLDMIYLDTIRSETALTLGLAPGSKLSMLTSSMGRAYLAVQPAD
FT                   VRDALLAELKKAAGKGATALVADAMKEIAGFAKERCCYSFRAWHDDVNAVAVPFREPRE
FT                   KRWLVLSCSGPASSMGEDVFREKVAPRLKALARRLGDAG"
FT   gene            complement(555167..556000)
FT                   /locus_tag="BC1003_0500"
FT   CDS_pept        complement(555167..556000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0500"
FT                   /product="EAL domain protein"
FT                   /note="PFAM: EAL domain protein; KEGG: bpy:Bphyt_0778
FT                   putative diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56503"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1T7W6"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADN56503.1"
FT                   /translation="MIPPTIPHLVARASEHPFLGKHLAMARGTHADVVVARFAELELTS
FT                   AYEPIFDISVHALAQSLSSDVENVDRFGDELGFQAVTQRLDAAPFDLFEAFDRIADDQE
FT                   LVALDRMSRALHAINFFGAQRHGLLFLRVHERLLKSVKYDHGRHFSSVLMSFGLNPSRI
FT                   VIELPAAAVAHKTFLGYLTKSYQRYGFKVAGNLSNAGQILSVSDTARLDFLKMDAASAL
FT                   RDATVKPLVGYASRLRIPLIFNRVMDATQFEALQQYDVRFVQGPLFNAHYHDRAA"
FT   gene            556251..557615
FT                   /locus_tag="BC1003_0501"
FT   CDS_pept        556251..557615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0501"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0779 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56504"
FT                   /db_xref="GOA:E1T8B3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8B3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56504.1"
FT                   /translation="MHAEPASANANVIEVERVLAETRHPAFQFMLLALCGLCLVIDGFD
FT                   AQAMGYVAPSVIGEWHVSKAALGPVFSASLLGMLLGALGLSVLADRIGRRPVLIGATFF
FT                   FALSMLATPFVSTIPALIALRFVTGLGLGCIMPNAMALVGEFSTPAHRVKRMMLVSCGF
FT                   TVGAALGGFISAALIPAYGWRAVFWVGGVVPLLLAVAMLALLPESLQFLVLKGRSDRAL
FT                   RWLARFDPHLRIDADTRVVVREKGNDGAPVAELFRAGRAPVTLILWAISFMNLIDLYFL
FT                   SNWLPTVMRDAGYSPSTAVIVGTVLQTGGVVGTLLLGWFIERFGFVRVLFVCFAGAALA
FT                   VGTIGTVAHVLPWLLLVVFAGGFCVVGGQPAVNALAGHFYPTTLRSTGIGWSLGIGRIG
FT                   SVIGPLVGGQLIALNWSNESLFHAAAVPVLCSALLVVALAAATRPRSRPSEPQTA"
FT   gene            557646..558992
FT                   /locus_tag="BC1003_0502"
FT   CDS_pept        557646..558992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0502"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /note="TIGRFAM: homogentisate 1,2-dioxygenase; KEGG:
FT                   bxe:Bxe_A3900 homogentisate 1,2-dioxygenase; PFAM:
FT                   homogentisate 12-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56505"
FT                   /db_xref="GOA:E1T8B4"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8B4"
FT                   /inference="protein motif:TFAM:TIGR01015"
FT                   /protein_id="ADN56505.1"
FT                   /translation="MHTPTREPNTLSSRLEIEPGYQSGFANEFATEALPGALPEGRNSP
FT                   QRVAYGLYAEQLSGTAFTAPRGHNRRSWLYRIRPAAVHKPFTRLPSERIVANFADVPPT
FT                   SPDQLRWDPLPMPTEPTDFVDGWVTMAGNGAAESMSGCAIHVYAANRSMSGRFFYNADG
FT                   ELLIVPQQGRLEIATELGRLDVQPFEIAVIPRGVRFAVNLPDGEARGYICENFGALLRL
FT                   PDLGPIGSNGLANPRDFLTPHAAYEDREGNFELVAKMNGNLWRADIGHSPLDVVAWHGN
FT                   YAPYKYDLRRFNTIGSISFDHPDPSIFLVLQSQSDTPGVDAIDFVIFPPRWLAAEDTFR
FT                   PPWFHRNVASEFMGLVHGVYDAKAEGFMPGGASLHNCMSGHGPDAETFEKASRSDTSKP
FT                   NKVGDTMAFMFETRTLIKPTRFALETAQLQAHYYECWQGLKKHFNPEQR"
FT   gene            558989..560290
FT                   /locus_tag="BC1003_0503"
FT   CDS_pept        558989..560290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0503"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="TIGRFAM: fumarylacetoacetase; KEGG:
FT                   fumarylacetoacetase; PFAM: Domain of unknown function
FT                   DUF1969; fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56506"
FT                   /db_xref="GOA:E1T8B5"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8B5"
FT                   /inference="protein motif:TFAM:TIGR01266"
FT                   /protein_id="ADN56506.1"
FT                   /translation="MSAVSSLQATLDPLRKSWVESANQPGHDFPIQNLPFGIFSDTGNA
FT                   ARRAGVAIGDEIVDLAALQAAGLLKVPSGADVFARDSLNDFISLGRDVWRSVRIQLSDL
FT                   LARDTATLRDDAAQRAKVLVRAAHARLHLPVQIPGYTDFYSSKEHATNVGCMFRDAKNA
FT                   LLPNWSEMPIGYNGRASSVVVSGTPVRRPNGQLKLPDQERPVFGACRKLDIELETGFVI
FT                   GSGNALGEPIACADAEAHIFGMVLLNDWSARDIQQWEYVPLGPFNAKSFATTISPWIVT
FT                   LDALEPFRVAQPVQEPQPLAYLRHDGQHAFDINLEVKLRPQGASQATTIARTNFRHMYW
FT                   TMAQQLAHHTVSGCNTRVGDLMGSGTISGPTEDSCGSLLELTWNGKKPLELKEGGTRSF
FT                   IEDGDELTLAGWCQGDGYRVGFGACVGEIVAAHK"
FT   gene            complement(560367..561533)
FT                   /locus_tag="BC1003_0504"
FT   CDS_pept        complement(560367..561533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0504"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0784 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56507"
FT                   /db_xref="GOA:E1T8B6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8B6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56507.1"
FT                   /translation="MPLPLLALAVAAFGIGTTEFVIMGLLPNVARDLSVSIPAAGMLVS
FT                   AYALGVTIGAPIVAIAVANMPRKKALMSLIGVFIVGNLLCALAPGYAVLMAARIVTAFC
FT                   HGAFFGIGSVVAAGLVAPNRRAQAIALMFTGLTLANVLGVPLGTALGQAAGWRATFWAV
FT                   TGIGIAAAAALAVCLPAKIEMQKASLVREFSVLKNPQVLMVLGISVLASASLFSTFTYI
FT                   TPILEDVTGFTPHAVTLVLLLFGLGLTVGSTLGGKLADWRLMPSLVAFLFAIVVILTIF
FT                   AGTMHAEIPAMVTIFAWGVLAFAIVPPLQMLIVDRASHAPNLASTLNQGAFNLGNAMGA
FT                   WLGGMAIDAGAPLTMLPWVGVATSIGALALTLWSVSIDRRAQRMAVAG"
FT   gene            complement(561731..562555)
FT                   /locus_tag="BC1003_0505"
FT   CDS_pept        complement(561731..562555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0505"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bpy:Bphyt_0785 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56508"
FT                   /db_xref="GOA:E1T8B7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8B7"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADN56508.1"
FT                   /translation="MIDTRNFNQHVRIEANHDNGVATIVLERPERRNAVDRHVADALTA
FT                   AFQCFEAEPAWRAAVLFGAGGTFCAGADLSALADEARRNQISADGSGSGPMGPTRMHFA
FT                   KPVIAAITGYAVAGGLELAAMCDLRVVEEDAVLGVFCRRVGIPLIDGGTIRLPRLIGLS
FT                   RALDLILTGRAVSAQEALDFGLANRVVRTGEARASAERLAAELAAFPQAALLADRRSAL
FT                   ENSPLEDLAEALRREGAGGYQAVFEEGFAGAERFARGAGRHGKALGPQDGRG"
FT   gene            562651..563265
FT                   /locus_tag="BC1003_0506"
FT   CDS_pept        562651..563265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56509"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8B8"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0786"
FT                   /protein_id="ADN56509.1"
FT                   /translation="MLLSQSTRSVSALLTRWRTAASLSSLPLSLSNLSSADARACVETV
FT                   WIVPLDRHSWYDHVRLKRVFVADGTRHQVVLVDVRKLLACADRDNTDYVLKPVAEWHAG
FT                   KVRGIREFLDPDNPRIPQMPYVTITTRRAPGMLGWLGLQREGVVAFRNGQHRARYLAEA
FT                   GARWFPVEVHERESALLRELCGAADDARTAIRCITSGGGGG"
FT   sig_peptide     562651..562761
FT                   /locus_tag="BC1003_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.818 at
FT                   residue 37"
FT   gene            complement(563354..564352)
FT                   /locus_tag="BC1003_0507"
FT   CDS_pept        complement(563354..564352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0507"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: bxe:Bxe_A3894 putative D-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56510"
FT                   /db_xref="GOA:E1T8B9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8B9"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADN56510.1"
FT                   /translation="MRMILFSSRQYDVETFTEANAAHRYELHFQESHLDSETAVLAHGY
FT                   DVVCPFVNDRVDAAVLERLHAGGTRMIALRSAGFNHVDLAAAERLGIAVARVPAYSPHA
FT                   VAEHAVGLILALNRRIPRAVARTREGDFSLHGLLGFDLHGKTVGVVGTGMIGRVFARIM
FT                   AGFGMRVLAHDPGTPADDLLALGARYVALNTLLAESDIVSLHCPLVPATYHLIDAAALA
FT                   RMKRGAMLINTGRGGLVESNALVGALKDGQLGHLGLDVYEEEGGLFFEDHSNLPLQDDV
FT                   LARLLMFPNVIVTAHQAFFTREAMNEIAQTTLANVAAWQAGTPRNAVRANS"
FT   gene            565186..566868
FT                   /locus_tag="BC1003_0508"
FT   CDS_pept        565186..566868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0508"
FT                   /product="YidE/YbjL duplication"
FT                   /note="KEGG: bxe:Bxe_A3892 aspartate/alanine exchanger
FT                   family protein; TIGRFAM: YidE/YbjL duplication; PFAM:
FT                   YidE/YbjL duplication domain-containing protein; TrkA-C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56511"
FT                   /db_xref="GOA:E1T8C0"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR022457"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8C0"
FT                   /inference="protein motif:TFAM:TIGR01625"
FT                   /protein_id="ADN56511.1"
FT                   /translation="MDWLHHVFQKSPEMALFLSLAAGYFIGQINFGKFQLGGVGGSLLA
FT                   AVVISQAGVTIDNGVKSVMFAVFIYAVGYDSGPGFFNSLNRKTLREIAMAVFLAVTALI
FT                   TVVVCAKLFHLNKGLAAGLAGGALTQSAIIGTAGDAIARLGLPAEEVKALQSDVAIAYA
FT                   VTYVFGSLGAIIVCVNILPKFMGQSLRDASIEAERELMSGGSSRGPGQLPALPELIGRA
FT                   YRIDVSAGKSVKQVETLHRDLLAIERVKRGGHVLDPAPDLILEPDDVVLVVGRREAVVE
FT                   FGSNGSEVADIGDVGVVMQTREAVFTRKGMNHTTIAAAREIVDRDMRHGVYIQSVSRAG
FT                   QPLPLLPETKLEHGDVITFYGSPKDTQRAVQAAGYELPYTNKTDFIYMGVGLVLGLLIG
FT                   LIVVDVGGIPLTLGSGGGCLLAGLLFGWMRGKHPMYGVMPTAASQLLKDFGLAAFVAVV
FT                   GLNSGLQAVVTVKQSGMTIFLLGVFVTLFPLILTMLFGRYVLRYNNAAILAGALTGSRS
FT                   ANPAFGGVLDKAESAVPTVPFAITYAIANVALTLLGPLVVGLV"
FT   gene            566962..568626
FT                   /locus_tag="BC1003_0509"
FT   CDS_pept        566962..568626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0509"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   bpy:Bphyt_0790 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56512"
FT                   /db_xref="GOA:E1T8C1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022518"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8C1"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADN56512.1"
FT                   /translation="MAKEKGDSKRGDMAQAGFEALSPFELKDELIKAAGGGVVERPANV
FT                   AMLNAGRGNPNFLATIPRHGFWQLGLFAMRESERSFAYMPEGVGGFPRRDGLEERFDLF
FT                   LRENKGVPGIDFLRGAVSYVRDQLGLSAGDFLYEMCEGILASNYPVPDRMLKLSEIIVG
FT                   QYLRREMIGAHPFVGEFDVFAVEGGTAAMTYIFNTMRENHLIKAGDTIALGMPIFTPYI
FT                   EIPRLNDYQLNVVNLEADVANGWQYSKGELDKLRDPKVKAFFLVNPSNPPSVKIDDESL
FT                   RYIADIVKERPELILLTDDVYGTFADDFVSLFALAPKNTILVYSYSKYFGATGWRLGTI
FT                   ATHRDNVLDRLIAELPKDVKKQLHERYESITTEPEKLKFIDRLVADSRTVALNHTAGLS
FT                   TPQQVQMVLFSLFSLMDTPDAYKNALKRLIRKRKQALYEEVGISFADDDPNQVDYYTIL
FT                   DVEFLGERAYGREFVDWLLKNTEPSELLFRLAREARVVLLPGRGFGTQHPSGRVSLANL
FT                   NESDYRQIGRAMRRLIEEYVERFNAATGKKLDKNAVK"
FT   gene            568805..570028
FT                   /locus_tag="BC1003_0510"
FT   CDS_pept        568805..570028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0510"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: bpy:Bphyt_0791
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56513"
FT                   /db_xref="GOA:E1T8C2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8C2"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADN56513.1"
FT                   /translation="MPTSSSKLTSAVVPCPAVESLDAILPEEPLLMMGAGPVPIPAAVA
FT                   KANTIVINHLGATMVKVISQVKTMARYVFQTHSKWVLGVAGPGSAAMEMAISNLAWEGT
FT                   RMLSIKNGFFSGRMAEMGHRVGARVSTLEVADRSVASLDEIAEVIRRERPEIVTVVQGE
FT                   TSNTVWNYQLKDIAALAKAAGALVIVDAVCTLSTMPLAMDAWGIDAVITGGQKGLSSIP
FT                   GVSLIAFSDAAWERVKGRTAPNAHWCLDASLAENFWHNAGYHYTAPVSGVLALHEALRL
FT                   VCAETLEKRFARHQKCSAALQDGVTALGLQLYAPKECRLNSVVGIEVPAGLSPGDVCAH
FT                   ISRQHQVEISGSFGLPIVRIGQMGEQCREHNLFRTVHALGRTMVDLGVKVDLPAGVAAL
FT                   ERALSEGK"
FT   gene            complement(570222..573008)
FT                   /locus_tag="BC1003_0511"
FT   CDS_pept        complement(570222..573008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0511"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="TIGRFAM: type VI secretion ATPase, ClpV1 family;
FT                   PFAM: ATPase AAA-2 domain protein; AAA ATPase central
FT                   domain protein; Clp domain protein; Clp ATPase-like; KEGG:
FT                   rme:Rmet_0618 ATPase AAA-2; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56514"
FT                   /db_xref="GOA:E1T8C3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8C3"
FT                   /inference="protein motif:TFAM:TIGR03345"
FT                   /protein_id="ADN56514.1"
FT                   /translation="MTHRDLSPYLRRLNDHCARALADAASLCATRAHRDIEVEHWLIKL
FT                   LELGDGDIVAIMRRYTLDVDGVWNGLLSAIDRLPHDLRGKPGLSSRLGQLLEAAWLRAS
FT                   LEAQTPLIRSAHLLAALADMPQLLRAPDAWALLSLSSVQIERLTPELNWTSVEAPASSP
FT                   CTQEPDNVPNAHDTADSALPDEPDSDPFPAVARAGGLAKPVSEALDRFTIDVTQKAREG
FT                   AIDPVFGRDVEIRQMIDILARRRKNNPILIGEPGVGKTALVEGLALKIAEGDVPAAIRD
FT                   VRLLTLDLGLLQAGAGVKGEFEQRLKNVIAAVQQSPTPILLFIDEAHTLIGAGNSAGGG
FT                   DAANLLKPALARGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDENACLMLRG
FT                   LKERYARHHGVHITDAAVSAAVRLSRRYLSGRQLPDKAVDLIDTAAARVRMSMDATPVA
FT                   IAARHAELAALRVEREALIEDQGATSVDLGERLRGIDARLSALAHEVEELDADYAGQKA
FT                   AITSLTELRTKWRDAPDDSARHDLEPAIRAAHARLARDANGALIHAEVDEAVIARVIAD
FT                   WTGVPVGSLLEDELTTLLELETRLAGSVVGQQDALAALGKTLRAAKAGLKSDEAPLGVF
FT                   LLVGPSGVGKTETARALADLMFGGERALITINLSEYQEAHTVSQLKGSPPGYVGYGRGG
FT                   VLTEAVRQRPYSVVLLDEVEKAHRDVLNLFYQVFDRGFMRDGEGRVIDFRNTVIGMTSN
FT                   LGSEQIMAAVEAASESSSEDAAADTNQAPAHHAEPTSAMLMETIRPLLVEHFQPALLAR
FT                   FQTVVYRPLTAEALAQIVQMKLDKVARRIEKRFAVPLVCDHALIAELVRACLLPDSGAR
FT                   NIDSLLDQQILPVLSRELLERVASHELPSRIRLGYSDETGISVDFDSDCAAEYEAAA"
FT   gene            complement(573308..573793)
FT                   /locus_tag="BC1003_0512"
FT   CDS_pept        complement(573308..573793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0512"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="KEGG: bgl:bglu_2g11090 hemolysin-coregulated
FT                   protein; TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56515"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8C4"
FT                   /inference="protein motif:TFAM:TIGR03344"
FT                   /protein_id="ADN56515.1"
FT                   /translation="MAIPAYMWIKDDGGADIKGSVTVQGREGSVEVVALQHGVSIPTDS
FT                   NTGKLTGTRVHLPITFTKETDASSPYLYKAVTSGQTLKSIEIKWYKIDDAGKEKEYFNT
FT                   KLDNVKVVAVNPKMHDIKNPEFEKHNHLEDVQLRYEKITWSYKDGNIIHTDTWNERS"
FT   gene            complement(573807..575669)
FT                   /locus_tag="BC1003_0513"
FT   CDS_pept        complement(573807..575669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0513"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: reu:Reut_B5262
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56516"
FT                   /db_xref="GOA:E1T8C5"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8C5"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADN56516.1"
FT                   /translation="MEPRLTGYPSGYPYRTLFVWVALLALIWLALSSPMSAGWNAVFAA
FT                   LVIFCAFVAVVLATRRVHARREATRHVLDAADTALGSLPAELKHNTPLVIAVGDNSGEL
FT                   DRLFGSALVRMTDSVIWVRNDDPARLMYLADALKRWRDGQGPDAIAHLLAVDEATGTLT
FT                   LQAALRRWCSAIGEAGRAVGYALPVCIALYARETGPAKEDAPWFGVSGAEGMQPDALVD
FT                   LIAGRLAQYTHMASPEIAEERELRARRAARLDAIVRWASQTIVPAFTHAPRGALRLAAL
FT                   GVTAVGGRPAADSLFGQFVTGITDLPLASADGRARRASAAHAQAVRAVQADPSQSQTPQ
FT                   PQTPLPPTLSSYPLPDPLIRGIEPQPVRRALPRALAHAFVWLTACFSAAAAASAWQNRA
FT                   LVERIVADMARYRAIAPAEDAARVDALKAVKRDRDELERYASLGVPPRLGLGLYRGAPL
FT                   QQPVNALIASYQPPPPASVPPPTIELDSMSLFRSGSAVLNPGSNRVLIGALEMIKAHPD
FT                   KRVLVAGHTDSVGTPASNLKLSEARAASVRDWLADASGIALTRFAIQGYGDTRPKAPNS
FT                   TEAGRAANRRVEITLVPDCRDTFEESRNGNSRSIPQGHTACSLE"
FT   gene            complement(575669..576340)
FT                   /locus_tag="BC1003_0514"
FT   CDS_pept        complement(575669..576340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0514"
FT                   /product="type IV / VI secretion system protein, DotU
FT                   family"
FT                   /note="KEGG: rme:Rmet_0621 hypothetical protein; TIGRFAM:
FT                   type IV / VI secretion system protein, DotU family; PFAM:
FT                   Type IV / VI secretion system, DotU"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56517"
FT                   /db_xref="GOA:E1T8C6"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8C6"
FT                   /inference="protein motif:TFAM:TIGR03349"
FT                   /protein_id="ADN56517.1"
FT                   /translation="MTYASTSRAATLPPSLLPVALRDTALTVALLAADPAPQSFSAFRD
FT                   KCKQQVRRLREEMQSAGHPQGVIEDAAYAQCALLDETALSNLRGDDRDAWQRLPLQVDE
FT                   FQSNDAGHELIARIERRLAEPQPVLPLLAIFCAVLDLGFTGKFAFAGREARAALVKALS
FT                   ERLGRAQDTSSSIVIKAPGSTRWTERLTPLTWVVGACVVAAVVYVALDQWLNASVARIA
FT                   H"
FT   gene            complement(576337..577683)
FT                   /locus_tag="BC1003_0515"
FT   CDS_pept        complement(576337..577683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0515"
FT                   /product="type VI secretion protein, VC_A0114 family"
FT                   /note="KEGG: reu:Reut_B5264 hypothetical protein; TIGRFAM:
FT                   type VI secretion protein, VC_A0114 family; PFAM: protein
FT                   of unknown function DUF876"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56518"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8C7"
FT                   /inference="protein motif:TFAM:TIGR03353"
FT                   /protein_id="ADN56518.1"
FT                   /translation="MKITRPLWAQGIFMTPQHFQQQALWERYADERTARIGSPDPWGVS
FT                   RVAFDTQALSIDRLQLASLGLRLPDGTLFDTESADRLPSPRDLSEVPAHTEAVVVLAAL
FT                   PLVDPQGGNCVEAGEKPARPRRYTREFLQVADLNGEGKEEISVERHALALLFDFEEPGG
FT                   YVTCPIGRIVRNAQGRFEIDAAFVPPCLVLSASSQWTSRMNRLSEILSAKSASLAVRRR
FT                   ERSDQIADYAVADVSLFWLLHSVNSTWPDLARLCQAPDQHPERLYSVLARLAGSLLTFS
FT                   TTETLRAIPPYAHGAPEPVFAELESLIRTLLDTVIPSRVVPIALERIRDTAWLGKINDE
FT                   RLVEGADYYLSVRSALPAHALLEQLPRLCKAGAPDEVEQIVNSALSGIPLRTMSRLPAA
FT                   IPVRIENQYFALDGAHPAFKRMVDARACQFYVPASMPDVSLELYAVLPT"
FT   gene            complement(577814..579367)
FT                   /locus_tag="BC1003_0516"
FT   CDS_pept        complement(577814..579367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0516"
FT                   /product="type VI secretion protein, EvpB/VC_A0108 family"
FT                   /note="KEGG: rme:Rmet_0624 hypothetical protein; TIGRFAM:
FT                   type VI secretion protein, EvpB/VC_A0108 family; PFAM:
FT                   protein of unknown function DUF877"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56519"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8C8"
FT                   /inference="protein motif:TFAM:TIGR03355"
FT                   /protein_id="ADN56519.1"
FT                   /translation="MAKNETALQDSAATTTDTVVLDAPGKSVYESLCEKINLTPVKQTR
FT                   PFDSFQNADSLSESSLDERVAQAMSVFLKMINESSQQVDRLDKSLLDFHIAHLDRQISR
FT                   QLDAIMHNETFQQIESAWRGLKFLVDRTDFRKNVRIEVLDVSKEQLRQDFEDTPEVIQS
FT                   GLYLHTYIQEYDTPGGEPIGSIISNYEFDRSPQDIALLRNIAKVSAAAHMPFIGSVSPK
FT                   FFGKDSMEEVASIRDIGNYFDRAEYLKWKSFRESDDARYIGLTLPRFLARLPYGPDTTP
FT                   VRAFNYEEAVKGPDHTRYLWANASFAFAANMVRSFIKNGWCVQIRGPQAGGLVEDLPIH
FT                   LYDLGTGNQAKIPSEVLIPETREFEFSNLGFIPLSYYKNHDFACFFSAHSAQKPAVYDT
FT                   KEATANSRVNARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELELNTWVKSLVTEMT
FT                   DPGDDLQASHPLREAKVIVEDIEDNPGFFRVKLFIVPHFQIEGMDINLSLVSQMPKAKN
FT                   "
FT   gene            complement(579394..579903)
FT                   /locus_tag="BC1003_0517"
FT   CDS_pept        complement(579394..579903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0517"
FT                   /product="type VI secretion protein, VC_A0107 family"
FT                   /note="KEGG: reu:Reut_B5266 hypothetical protein; TIGRFAM:
FT                   type VI secretion protein, VC_A0107 family; PFAM:
FT                   Uncharacterised conserved protein UCP028301"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56520"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8C9"
FT                   /inference="protein motif:TFAM:TIGR03358"
FT                   /protein_id="ADN56520.1"
FT                   /translation="MANSFQNEVPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQ
FT                   DTRALAERARIDINKNNFNSVLADYSPKAKIAVENTLAGDGSELPVSLEFKSMDDFRPD
FT                   VVAGKVPELRALMAARNLLRDLKSNLLDNATFRRELEKILKDPALSDRLRSDLQQIGES
FT                   APATQQ"
FT   gene            580158..580508
FT                   /locus_tag="BC1003_0518"
FT   CDS_pept        580158..580508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5267 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56521"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8D0"
FT                   /inference="similar to AA sequence:KEGG:Reut_B5267"
FT                   /protein_id="ADN56521.1"
FT                   /translation="MAGLNKHVGGSGPIPRAVTGRQSYFLDVTGPANGCEISVVSFSAV
FT                   ERIGEPYRVIVEIAHPGSLSRDDYLGRDATLNFRRAAAARHAPGHWPGQGANAAVGGAQ
FT                   LRFYRTAAGRTV"
FT   gene            580612..582213
FT                   /locus_tag="BC1003_0519"
FT   CDS_pept        580612..582213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0519"
FT                   /product="type VI secretion-associated protein, VC_A0119
FT                   family"
FT                   /note="KEGG: reu:Reut_B5272 ImpA, N-terminal; TIGRFAM: type
FT                   VI secretion-associated protein, VC_A0119 family; PFAM:
FT                   ImpA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56522"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8D1"
FT                   /inference="protein motif:TFAM:TIGR03362"
FT                   /protein_id="ADN56522.1"
FT                   /translation="MLTNLLSALFGARTPSDLARSTQGQWDDWLRPISDSAPTGADPGY
FT                   DDDFLAIKEEVARLSDIDDTLIVETAERLLKHSAKDVRLAVYYVYGRMRRDGAEGVACG
FT                   FELLSALIDRFGEALLPARAGTRKAALEWLAGSTFADRLERVQGLSDSLLERTLSALAL
FT                   IVERTAQWPEAARPELDALFRRFESRVETPQPAPSVGNDIPSSATPSSATLAASTLAAP
FT                   TEVASTRELLDRARQMAQFLRDQPHGYLAAYRLMRCVRWDTLTEVPPHEASGKTRLVAP
FT                   RAELRSHLKRLLLQKQWPELLDRVEAAFAEGANHFWLDLQYYAFSAQEQAGGEYAQVRD
FT                   LVATDCALMLERLPGLDQLLFSDGSPFADDATLEWIARYATVRDVERGEAVAPVSSSSA
FT                   HTDWAETEAHASDLAAQQGLEAAFAWLQGLPAQSGDHGERERFLRQLVMARVAERADRA
FT                   DTALHLLSTLERSAQRFELGAWEPSLAFEAKHHLLRLLKVRMNRKDADKPALSARIELL
FT                   TGELTAIDPARAVTLA"
FT   gene            582363..582974
FT                   /locus_tag="BC1003_0520"
FT   CDS_pept        582363..582974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0520"
FT                   /product="type VI secretion lipoprotein, VC_A0113 family"
FT                   /note="TIGRFAM: type VI secretion lipoprotein, VC_A0113
FT                   family; KEGG: bvi:Bcep1808_4444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56523"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8D2"
FT                   /inference="protein motif:TFAM:TIGR03352"
FT                   /protein_id="ADN56523.1"
FT                   /translation="MMQQLRTGAIVLTMLALGGCGVGQTVKDSTVDAAKWAFTTQVKTM
FT                   NIDLTSRSSLNASGDGQSLSTVIRIYQLKTPQTFQQLDYQQLQANDLEALKADLLATKD
FT                   VVLRPDASASISEPMNGDAQYVGVVAFFRNAGSDATWKLVIPKKQWKKTDPVKIEAREN
FT                   TLNLVGATEDTIRRNAPQQSLPNPPQPKPPASTGHASPAG"
FT   gene            complement(583043..584254)
FT                   /locus_tag="BC1003_0521"
FT   CDS_pept        complement(583043..584254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0521"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A3887 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56524"
FT                   /db_xref="GOA:E1T8D3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023008"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8D3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56524.1"
FT                   /translation="MSTDSAPPRSEFATTMQIIPVVFFTFLCYLTIGIPLAVLPGYVHD
FT                   DLGFSAVLAGAAISVQYLATLASRPLAGRSADTLGPKRTVSIGLLGCGASGVLLLLAVL
FT                   CGRWPAASLALLVCSRLVLGFGESLCGTGAILWGIGRVGTSNNARVISWNGIATYGALA
FT                   VGAPLGVAIERTVGFAALGILVMLLAALGFYLARTIAPVPVVHGERMSYRSVFTRVLPH
FT                   GIGLALGSAGFGSIATFITLFYAAKQWPNAALSLTVFGTLFIGARLLFANTIKTYGGFR
FT                   VAIASFSFECVGLLMLWLAPEPHVALAGAALTGFGFALVFPALGVEAVGLVPPASRGAA
FT                   LSAYSVFLDLSLGITGPLAGYIAGEFGYGSVFLFAAIAAAAAVGLSCFLYLRDAKVGKM
FT                   PAAL"
FT   gene            584650..586203
FT                   /locus_tag="BC1003_0522"
FT   CDS_pept        584650..586203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0522"
FT                   /product="xanthine dehydrogenase, small subunit"
FT                   /note="KEGG: bxe:Bxe_A3886 putative xanthine dehydrogenase;
FT                   TIGRFAM: xanthine dehydrogenase, small subunit; PFAM:
FT                   molybdopterin dehydrogenase FAD-binding; [2Fe-2S]-binding
FT                   domain-containing protein; ferredoxin; CO dehydrogenase
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56525"
FT                   /db_xref="GOA:E1T8D4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014307"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8D4"
FT                   /inference="protein motif:TFAM:TIGR02963"
FT                   /protein_id="ADN56525.1"
FT                   /translation="MTEPIRFYHRNEIREIKDAPVTRTVLQYLREDARCTGTKEGCAEG
FT                   DCGACTVVIGERNEAGGVDFKAVNACIQLMPTLDGKALFTVEDLRQPDGSLHPVQQALV
FT                   ECHGSQCGFCTPGFVMSMWSLYEKHGHEQSCANRTVPSREAISNALTGNLCRCTGYRPI
FT                   VDAAVRMFEAPAPKAPLNVDALGAALATLQRDHTFHYEHGGQRFDAPRTVEALAQIKQA
FT                   EPAARILAGSTDIGLWVTKQMRELGNVVYVGQIAELQKLETRGDWIEIGAGVTVEMAYA
FT                   EIAKQYPEVTEMWQRFASLPIRNAGTLGGNIANGSPIGDSMPGLIALGARVIVRGGASE
FT                   REMPLEDLYLAYQKKDMAEHEFVVGVKVPARTGARAQLRFRTYKLSKRFDSDISAVCAA
FT                   FSFIADGTLIREPRIAFGGMAATPKRATQAEAVLRDAQWHEATVQAAMLALANDYTPLS
FT                   DMRATSNYRLEAAKNTLYRFWLETRPHNPLPRSALDVRAVAAACTPAGAQCEANAAAGA
FT                   "
FT   gene            586240..588606
FT                   /locus_tag="BC1003_0523"
FT   CDS_pept        586240..588606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0523"
FT                   /product="xanthine dehydrogenase, molybdopterin binding
FT                   subunit"
FT                   /EC_number="1.17.1.4"
FT                   /note="TIGRFAM: xanthine dehydrogenase, molybdopterin
FT                   binding subunit; KEGG: bxe:Bxe_A3885 xanthine
FT                   dehydrogenase, molybdenum binding subunit apoprotein /
FT                   xanthine oxidase; PFAM: aldehyde oxidase and xanthine
FT                   dehydrogenase molybdopterin binding; aldehyde oxidase and
FT                   xanthine dehydrogenase a/b hammerhead"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56526"
FT                   /db_xref="GOA:E1T8D5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8D5"
FT                   /inference="protein motif:TFAM:TIGR02965"
FT                   /protein_id="ADN56526.1"
FT                   /translation="MNQHAEPFLKDAQALDDFTQVHVSRPHESAHLHVSGRATYTDDIP
FT                   TVAGTLHAALGLSSKAHARIVSMSFEQVRATPGVVAVFTARDIPGANDVAPIVHGDDPI
FT                   LADGLVQYVGQPVFIVVANSHEAARLAARRAEIVYEELPAILTAQQARAANQSVLPPMK
FT                   LARGEAGTKIARAAHREAGEMLLGGQEQFYLEGQISYAVPKDDEGMHVYCSTQHPTEMQ
FT                   HLVAHALGIASHNVLIECRRMGGGFGGKESQSGLFACCAALAAWKLQCPVKLRPDRDDD
FT                   MMITGKRHDFHYTYEVGYDDKGVIEGVAVDMTSRCGFSADLSGPVMTRALCHFDNAYWL
FT                   SDVSIGGFCGKTNTQSNTAFRGFGGPQGAFAIEYIMDNVARSLGEDALDVRRRNLYGKT
FT                   ERNQTPYGQTVEDNVIHELIDELEATSQYRARRAAINEFNANNEVLKKGLALTPVKFGI
FT                   AFNVTHFNQAGALVHIYTDGSVLVNHGGTEMGQGLNTKVAQVVAHELGVGFERIRVSAT
FT                   DTSKVANTSATAASTGSDLNGKAAQDAARQLRERLAAFAAERFGAGVVTAAQVRFAHDR
FT                   VIVGDAVVPFEEVVAKAYLARIQLWSDGFYATPKLYWDQAKLQGRPFYYYSYGAAVSEV
FT                   VIDTLTGEMRVLRADALHDVGASLNPALDVGQVEGAFIQGMGWLTTEELWWNAGGKLMT
FT                   HAPSTYKIPTVNDTPPEFNVRLFKNRNAQDSIHRSKATGEPPLLLPFSVFFAIRDAISA
FT                   VGAHKLNPPLNAPATSEEILKAVGAVRAAASAAQA"
FT   gene            588621..589205
FT                   /locus_tag="BC1003_0524"
FT   CDS_pept        588621..589205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0524"
FT                   /product="xanthine dehydrogenase accessory protein XdhC"
FT                   /note="TIGRFAM: xanthine dehydrogenase accessory protein
FT                   XdhC; KEGG: bxe:Bxe_A3884 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56527"
FT                   /db_xref="GOA:E1T8D6"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8D6"
FT                   /inference="protein motif:TFAM:TIGR02964"
FT                   /protein_id="ADN56527.1"
FT                   /translation="MEDRYPTRTGRRSAVRAPRPAPLHIVLFGAGHVGHALIALLGTLP
FT                   CVVQWVDERDELFPDETPANVQVEATDTPEAIVDSAPPGAWFLVMTHNHALDFSLALRI
FT                   MRRRDFTYFGMIGSKTKRVKFERRLLERGIEPERLEQMTCPIGIAGIVDKAPAAIAVAV
FT                   CAELLQVREQREITSRVAALQQERQRPAISV"
FT   gene            complement(589284..590237)
FT                   /locus_tag="BC1003_0525"
FT   CDS_pept        complement(589284..590237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0525"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A3883 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56528"
FT                   /db_xref="GOA:E1T8D7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8D7"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADN56528.1"
FT                   /translation="MDDTAASLDIWLVRVLRTLLVERSVTQTALRLNQTQPAISTALRK
FT                   LRETLNDPILVRGKSGMVPTEYGESLLASAQRVLREVDFVATPHGDFDPGRSRRTFRVA
FT                   APDYLNDFFMPTVIAQFREAAPHARLEIDSLSPMLDHSAALDAGELDLVIGNWPKPDAR
FT                   FERSDLFSDTVVCMMRANHPLAHAPLTREAYLAAPHLAPTPYSGGRGGAIDIGFARAKA
FT                   QRRIVATLPYFGLVPQTLLQSDLIFTTTRRFAMHYASILPLAVVEAPIPFPRIKCYQMW
FT                   HPQPDRPSDLGWLRALMSEVSDGLIAQKAPRAKRVR"
FT   gene            complement(590497..591141)
FT                   /locus_tag="BC1003_0526"
FT   CDS_pept        complement(590497..591141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0526"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bxe:Bxe_A3882
FT                   putative isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56529"
FT                   /db_xref="GOA:E1T8D8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8D8"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADN56529.1"
FT                   /translation="MTVGIDAAQPLWFYDFVSPFTYLLLEQHDKWPGFDFVFTPVVLND
FT                   LYRHWGQRPAYSVPAKRTFMYRHALFRAEQLGIPYKMPPAHPFDSMKPLLLATAAQADV
FT                   VCVREIFRFIWREGRDPSSDEAFAELCERVGMPDGPELIKSEEVKAQLQRNTADAIGLG
FT                   VYGVPTFRLNDQLFWGEDALPMVLYCARTPNWLESSEVRRISALPRGVADI"
FT   gene            complement(591242..592849)
FT                   /locus_tag="BC1003_0527"
FT   CDS_pept        complement(591242..592849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56530"
FT                   /db_xref="GOA:E1T8D9"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8D9"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0798"
FT                   /protein_id="ADN56530.1"
FT                   /translation="MKPAAGRKPATRPTRLVARFVAISWRDLAVSFGPILLIAVAAIWV
FT                   AVRLIQPAPPSTLTISAGPQGSTFWNAAQKYKEILARNRITLNVLPSEGSLQNLQRLSD
FT                   PNSNVDVAFVQDGIAPGAASNGLMSLGSVSYVPLAIFYHGPTVTRLSEFKGQRLAVGAE
FT                   GSGTRQLALALLKANGIEPGGATRLLPLSGDDAAQALVSGKVDAAFLAGDSAQPAVMGK
FT                   LYRTPNVQFYDFTQADAYTRRFPYLTQLELPMGAFDLGKNLPSMPIHMVAPTAELVARN
FT                   SLHPALSDLLIEAAREVHGKANIMQRAGEFPAPLAHDFPISDDAARYYKSGKSFLYRLL
FT                   PFWLASLADRLLVVVVPLVVLLIPALRLVPSLYAWRVKSRIYRWYGALIAIERSALSDH
FT                   SAAERASLRQRLDAIEDSVNGLKMPLAYADQFYVLREHIGFVRARLTQSRDTRRDGWRD
FT                   TSGDDADEESAAAGAGAGVSAAGGTDEARPAVRADHAGERNRTPSAAPNEAAEIGELGE
FT                   TGDEPRDEAPVQRRRPSD"
FT   gene            593367..593720
FT                   /locus_tag="BC1003_0528"
FT   CDS_pept        593367..593720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0528"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: bpy:Bphyt_0799
FT                   transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56531"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8E0"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADN56531.1"
FT                   /translation="MKSVGFLKTLGSVVAMVVACNVYAQASDATATGTTAAPAATAKAS
FT                   KKANSQLGRKVRAAISKVQGLDVSNIAVRARGGAVTLTGSVPDQGQIDAAGEAAKGVAG
FT                   VTSVSNKLTVMQQ"
FT   sig_peptide     593367..593447
FT                   /locus_tag="BC1003_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.799 at
FT                   residue 27"
FT   gene            complement(593929..594693)
FT                   /locus_tag="BC1003_0529"
FT   CDS_pept        complement(593929..594693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0529"
FT                   /product="arsenical resistance protein ArsH"
FT                   /note="KEGG: bpy:Bphyt_0210 arsenical resistance protein
FT                   ArsH; TIGRFAM: arsenical resistance protein ArsH; PFAM:
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56532"
FT                   /db_xref="GOA:E1T8E1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8E1"
FT                   /inference="protein motif:TFAM:TIGR02690"
FT                   /protein_id="ADN56532.1"
FT                   /translation="MQMDLPNVSALHLDTPDLAKLEPRAHSQHPPRILLLYGSLRPTSY
FT                   SRLLTLEAERILRQLGAETRVFDPHGLPLADSVSPEHPKVAELRALSLWSEGQVWCSPE
FT                   RHGALTGVFKNQIDWLPLDSGSIRPTQGRTLAVMQVSGGSQSFNAVNALRILGRWMRMV
FT                   TIPNQSSVAKAFQEFDENGRMKPSSYYDRVVDVMEELYKFTLLIRDRSDYLTDRYSERK
FT                   ERMPANVTSLADAAMSHERGAQLADTDESEVE"
FT   gene            complement(594706..595533)
FT                   /locus_tag="BC1003_0530"
FT   CDS_pept        complement(594706..595533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0530"
FT                   /product="arsenate reductase"
FT                   /note="KEGG: bgl:bglu_4p0840 As reductase; TIGRFAM:
FT                   arsenate reductase; PFAM: arsenate reductase and related;
FT                   GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56533"
FT                   /db_xref="GOA:E1T8E2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8E2"
FT                   /inference="protein motif:TFAM:TIGR00014"
FT                   /protein_id="ADN56533.1"
FT                   /translation="MSVTIYHNPDCGTSRNVLALLREAGENPQVIEYLRNPPDRATLER
FT                   LIADSGMAVRDVLRKKGTPYEELGLGNCALSDAQLIDAMLAHPVLINRPIVVTPRGTRL
FT                   CRPSDAVAGLLANPPQREILKDEGVPFIVARRIAGDHAGLAQALRDARLPTDDLNEAGR
FT                   SFFTFSTLAGSHVGYGGFEQCGRDALVRSLVVLPEHRGKGIGQNMLAVLLREAFDAGAR
FT                   TAWLLTLNERAFFEKSGFKPVGRDAAPASILATRQAAGLCPSSAVLLSRTITL"
FT   gene            complement(595543..596652)
FT                   /locus_tag="BC1003_0531"
FT   CDS_pept        complement(595543..596652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0531"
FT                   /product="arsenical-resistance protein"
FT                   /note="KEGG: bpy:Bphyt_0208 arsenical-resistance protein;
FT                   TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56534"
FT                   /db_xref="GOA:E1T8E3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8E3"
FT                   /inference="protein motif:TFAM:TIGR00832"
FT                   /protein_id="ADN56534.1"
FT                   /translation="MTRGDDARIAAPPASSPDRTASDSRTPRIGFFERYLTVWVALCIV
FT                   TGIVLGHWLPAVFQTIGRTELAHVNVPVGVLIWVMVIPMLIKIDFGAMAQVKAHWRGIG
FT                   VTLFVNWLIKPFSMALLGWIFVRHVFAAWLPAAQLDSYVAGLILLAAAPCTAMVFVWSQ
FT                   LCKGDPYFTLSQVALNDAIMVVAFAPIVALLLGLSAITVPWDTLLTSVGVYIVIPVVIA
FT                   QIMRRRLLRSGAAQFERTVARLGPYSIGALLTTLVLLFAFQGQAIIGEPLVIAMLAVPI
FT                   LIQVFLNSGLAYLLNRKLGVAHCVAGPSSLIGASNFFELAVATAISLFGFESGAALATV
FT                   VGVLIEVPVMLLVVGVVNRSQHWYETRTR"
FT   gene            complement(596649..596981)
FT                   /locus_tag="BC1003_0532"
FT   CDS_pept        complement(596649..596981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0532"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: bpy:Bphyt_0205 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56535"
FT                   /db_xref="GOA:E1T8E4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8E4"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADN56535.1"
FT                   /translation="MDSNLVVRALGALAHESRLAIFRALVVAGPEGLPAGEIAQQLGLS
FT                   PSSLSFHLKDLSHAGLVTGQQQGRFIYYSANFDAMNGLIGFLTENCCAGGTCDAVAAPQ
FT                   CRGAAT"
FT   gene            597368..597616
FT                   /locus_tag="BC1003_0533"
FT   CDS_pept        597368..597616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56536"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8E5"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3879"
FT                   /protein_id="ADN56536.1"
FT                   /translation="MQTTALRYTDLPIDDRAAFELVCARHGFAPAHFDISIHADPVDAA
FT                   HERLVTVRRGGWAQSYYDSHGQWVRQFEADLTCRFFK"
FT   gene            complement(597641..598429)
FT                   /locus_tag="BC1003_0534"
FT   CDS_pept        complement(597641..598429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0534"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bxe:Bxe_A3878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56537"
FT                   /db_xref="GOA:E1T8E6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8E6"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADN56537.1"
FT                   /translation="MALPHIDLLYSVSGLFVGFLVGLTGVGGGSLMTPILVLLFNVHPA
FT                   TAVGTDLLYAAATKATGTLVHGLKGSVDWQVTLRLAAGSVPAATVTLLLLHRYGMDTPG
FT                   ASRLIQLVLGAALLVTAVALVFRPQLAALGAHRRRAPTQGRTLLLTMLTGAMLGVLVSL
FT                   TSVGAGAIGVTVLLLLYPMLPTTRIVGSDIAHAVPLTLLAGAGHWLLGSVDWSMLLSLL
FT                   LGSLPGIAVGSMLSARAPDALLRNLLAATLTLVGLRLVVA"
FT   gene            complement(598629..599297)
FT                   /locus_tag="BC1003_0535"
FT   CDS_pept        complement(598629..599297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0535"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bxe:Bxe_A3877 LysE family amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56538"
FT                   /db_xref="GOA:E1T8E7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8E7"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADN56538.1"
FT                   /translation="MSMTSLFFTAAGVGLAIAAPVGPMGMLCIRRTLTGGPRAGLAIGL
FT                   GIASGDAFYGLIAALGLVSISQFMLAYDRPLHLLAGLFLLYLGLRTLWQKAPADTANGE
FT                   LNGNGSSNSSNGKLAQVGRAGALRAYASSLLLTLTNPQTVIMFAALFTTLAPRGAFSSA
FT                   IALTTVGGVFCGSIAWWCFLVTVVSLARHAIGSKLRLAIDRLVGIMLAAFGVVEIRRAL
FT                   "
FT   sig_peptide     complement(599241..599297)
FT                   /locus_tag="BC1003_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.960 at
FT                   residue 19"
FT   gene            599566..600459
FT                   /locus_tag="BC1003_0536"
FT   CDS_pept        599566..600459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0536"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_0805 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56539"
FT                   /db_xref="GOA:E1T8E8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8E8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN56539.1"
FT                   /translation="MWQIDQVTLRLFIAVCEEGTIARAAEREFIAPSAVSKRLADLEAL
FT                   VEVALLSRSQRGVRATAAGEALLRHARLIMRGHERMQAELSQYAAGARGHVRVLANVSS
FT                   MVEFLPEALSEFLKANPQIRVDVEERVSAEIVRGLEEGVADLGICRDVVPMGSLDALPY
FT                   RADHLALIVPRGHPLAGEASVGFEQTLAYDHLGLSSNASVNALMQRIAAEKGRELNYRT
FT                   YVSTFDAAYRFIQAGLAVAILPGEALPRHAADEYGIVAVPLREAWAERRFVICVRDRGA
FT                   LTLAASHLLAHLLASV"
FT   gene            600687..601682
FT                   /locus_tag="BC1003_0537"
FT   CDS_pept        600687..601682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0537"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   bpy:Bphyt_0806 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56540"
FT                   /db_xref="GOA:E1T8E9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8E9"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADN56540.1"
FT                   /translation="MSDTRERVVVTEVGMRDGLQSIARVMPTGFKRRWIDAAYAAGVRH
FT                   MEVASFVPARLLPQMADADEVIAHALTYDDLIVTALVPNLKGAQRALEAGVHRIVAPIS
FT                   VSTAHSLANVRKTPAEMIDAFADMRAAIDSAARHASNPRAGHVELIAGLSTVFGCTLQG
FT                   AVPYDDVAAIARAAVNAGADVIALGDTTGEATPRQVGEIIELVRDVAGDRLRALHLHDT
FT                   RGLGLANTLIALQHGIREFDASLAGLGGCPHAPGATGNVNTEDLVFMLDSMGYDTGIDL
FT                   TRLLASREVLADALPGEPLYGYLARAGVPKQFAHAQHAGASISFRSQVLQ"
FT   gene            601679..602938
FT                   /locus_tag="BC1003_0538"
FT   CDS_pept        601679..602938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0538"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bpy:Bphyt_0807 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56541"
FT                   /db_xref="GOA:E1T8F0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8F0"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ADN56541.1"
FT                   /translation="MNASTSAVTAAAGSDASQNALPLAGIRVIELSHMVMGPTCGMILG
FT                   DLGAEVIKVEPPRGDGTRRLLGTGAGFFRTFNRNKKSVALDLDSDAGLAALHALVDSAD
FT                   VFVENFKPGRMASLGLDYASLRERNPKLIYVSHKGFLNGPYEQRLALDEVVQMMAGLAY
FT                   MTGPVGRPLRAGSSVNDIMGGMFGAIGVLAALHERHASGRGKEVQSALFENCVLLSAQH
FT                   MQQYAATGVAPAPMPERISAWAVYDVFTLANDEQMFIAATGDGQWRALCGILGRADLLA
FT                   DARLATNNDRVLARSWLLQTLGETLRQFEGAALAPQFERDHIPFASIVKPEELFDDPHL
FT                   NASGGLAHLTLDDGSETAMPLLPISIDGARLQPRQPIAKIGEHTADVLRGLGYDDAQIA
FT                   SIVSATSPTDGSGQTPRAAA"
FT   gene            603021..604502
FT                   /locus_tag="BC1003_0539"
FT   CDS_pept        603021..604502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0539"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0808 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56542"
FT                   /db_xref="GOA:E1T8F1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8F1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN56542.1"
FT                   /translation="MKSSNQAVYATALGDAGALGLPAGSGASADSRAEEIALGGARISA
FT                   RLDRLPATRSIWKLVMLLSLGLFFELYDLMFSGYIAPGLVKSGILSATTRGLFGTSGVA
FT                   SFIAALFAGLFVGTAVCGFLADRFGRRAIFTWSLLWYTAANIVMAFQDTALGLNVWRFI
FT                   AGIGIGVEIVTIGTYISELVPKHLRGRASACSQAVGFCAVPIVAFLSYLLVPHQYFGLE
FT                   GWRLVVLTGVVGAVFVWWIRLGLPESPRWLAQKGRIDEADAIMTRLEARVEREYGRALP
FT                   EPALPEPVRARAVFRDLLAPPYRKRTLMLIIFHVFQTMGYYGFANWIPTLLIKQGITVT
FT                   TSLMYASIIAIAAPLGPLLGLLIADRFERKTVIICMAAVNVVCGLLFSQARETVLLVSL
FT                   GVCLVLAGNIISYSYHAYQAELFPTSIRARAVGFVYSWSRLSAIFSAFVIAACLREFGV
FT                   TGVFAFICSAMVIVMLAIGTLGPKTRDVALEDISK"
FT   gene            604991..606076
FT                   /locus_tag="BC1003_0540"
FT   CDS_pept        604991..606076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0540"
FT                   /product="glycosyl transferase group 1"
FT                   /note="KEGG: bxe:Bxe_A3874 putative glycosyltransferase;
FT                   manually curated; PFAM: glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56543"
FT                   /db_xref="GOA:E1T8F2"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8F2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN56543.1"
FT                   /translation="MRILQLVHAPRLSGAEVLVKGLAIHHQRAGHDVCMTSLLPQQDDF
FT                   ADIRAELNAAGVMCRFPGVRHGRVGKLLHLYRVVREFRPDFIIAHATLAALYVRLLPVQ
FT                   TPIAWVMHSGVNDFENGALKRAERLLSRRASAVIGVSQQNIDDYMREIGKHPSMVVIPN
FT                   GVDASLFAANEASPSRDSAVPPKQIVQLGRYIEGKSQLDTVRAFQRVLQVEPDARLLLC
FT                   GVVEELDYHRAVVELVRQLGLESKVSVCGPRSDVAAVLRSSRVFAMPSRFEAQSIGFLE
FT                   ALASGIPVVANRIPSFGFASNFAGVSLVDTTDAQAYGHALVNALNTPRAHRQLAGYTLH
FT                   DTADRYMSIVRKFAQPLRVSA"
FT   gene            complement(606138..608519)
FT                   /locus_tag="BC1003_0541"
FT   CDS_pept        complement(606138..608519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0541"
FT                   /product="Ricin B lectin"
FT                   /note="KEGG: bxe:Bxe_A3873 hypothetical protein; PFAM:
FT                   Ricin B lectin; SMART: Ricin B lectin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56544"
FT                   /db_xref="GOA:E1T8F3"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8F3"
FT                   /inference="protein motif:PFAM:PF00652"
FT                   /protein_id="ADN56544.1"
FT                   /translation="MRLSAKRLARSACVALIALLSLTLFPAAARAANCNAGTLVTVVAH
FT                   LDDDLLFIDPAISERLDAGWCITTVHLIGGANGANFSYVLTREQASRLAYARMAGVPDV
FT                   WDESNVEVAGKLVHQMVLKAKPQVRLLELRLPGGGVRGGREPLSLLWEQRATLSTYPMN
FT                   TDGSARMKYDRGALSATLKSILSEASQIYTLNPDTVPFIEHPDHIFAARITRHVAQTLH
FT                   KSVPIVYHVTYPTGGWPGNLPAAEVQRKRDIVASYFSIDGSESSHVFGEFQWDGNWIAR
FT                   RYAFADRSDRRAPDFEARPVKLFNVATNRCVSANGIGEAPTLAACNGSPAQQWRWEPVT
FT                   AYPGNARNAALVSVATSQCIAERDGFLRAESCDQWDIAQRWTPWDFGLVYTPMRHCLGE
FT                   NRGKLTMRGCTSLTTRYRWATTQRIQANDLRLATAMYGDVTGTGATSAVYVQRQHDGPG
FT                   FGVYAASLEKKQAPALWYSASVPFNPRATTPSCAGDTLCFDSARFLLGDFDGDGKADLM
FT                   VVTARENGTAFWLLRSAGDRFEAPRLWLQTSPAFKPELTQQYVAADFTGTNRASVLIAQ
FT                   KRADRGLDLWIASSNGVTGAAPTRAAEATGLAQNTMLLPFGKAGSRSSLIALETVQQRV
FT                   SVSMIANDAGRMTIGERRMLPADFAPGFVKAAIAAAHGDHPDSLMLLTPRLAGTDAGAL
FT                   IDIASLDIANPTAVPVQVASLQGMPWSDVFPAYVQDKHGAALVVFRRMDATLGDFYFTG
FT                   GAPALSRYPLTGNLAVGTPLDLGEMPGLFSETVRIDRLTQ"
FT   sig_peptide     complement(608424..608519)
FT                   /locus_tag="BC1003_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.885 at
FT                   residue 32"
FT   gene            complement(608648..609100)
FT                   /locus_tag="BC1003_0542"
FT   CDS_pept        complement(608648..609100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0542"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bxe:Bxe_A3872 putative
FT                   GDP-mannose mannosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56545"
FT                   /db_xref="GOA:E1T8F4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR033715"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8F4"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADN56545.1"
FT                   /translation="MLTQLDFLDVVRLTPLVSIDLIVSDADGRILIGHRRNRPAQGTWF
FT                   VPGGRILKDETLDAAFSRIADAELGVPRLARSSARFEGVFEHHYSDNFAGESGVSTHYI
FT                   VLAYALSLADTQRLGRPDQHNGYLWLTPAELLVRDDVHDNTKAYFR"
FT   gene            complement(609249..611318)
FT                   /locus_tag="BC1003_0543"
FT   CDS_pept        complement(609249..611318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0815 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56546"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8F5"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0815"
FT                   /protein_id="ADN56546.1"
FT                   /translation="MSISSKDRGLRSLMIQRAMHAPISRAALMAAALAFSATRGEAASA
FT                   AAGASAVRADTKAQSQGQRPSLSCVAPSSQTRAASSGDPVEADTPGDGTRLFAASRPFS
FT                   LVFTTRAPQSDTLNWQIRDTWNVVRASGSFNVAAGAISSTLSCTSTVAGYFAVSASLQA
FT                   ARGQLESRGTRPAGIATFGVLPDTAAALPAVRFPYQDLHRFGGQGTAYLAPGQHCCDGD
FT                   GYRPVYTALGLTWANDNRNWYMEEPDKSGTFDPATKQLAPYLQRGDIMRLIQLDGIPKW
FT                   ASPTSTQTHSYAPTSLAQMKEYMAKVGTESNRVRSTYFPTQRDNYYQVTWEPDADGGLP
FT                   WRDSDANFIAMYKAVWEGIHRTDPHAVVMGLTYSSVQGNVKWMRRLGPLGIGRYMDGMS
FT                   VHGYYDIGTTPSHPPERMADPRNEGTVPGALAASMRALRHEMRQYLRPGAPLFVTETGI
FT                   SYDIGQSYGKSYPNADVLYAQAAVVARTHLILLGEGADMTYVFYLADMPDAAPGYGLFF
FT                   ELEHPKGAYGPTRISPKPAALAVAAMTRIVDGTNTLGPLKGLPNGIYAYAFRRLGGGKV
FT                   VTALWTHDNDKWSSKSGFNAGQSAEYRLRVDARGTSGEVTALDMMGNASIIPYRDGVAN
FT                   LTLSPAPIYVVSNNAEVFKDAVTTPEGYVVRDKAEPTPQAASGPARHATGTIAR"
FT   gene            611822..611947
FT                   /locus_tag="BC1003_0544"
FT   CDS_pept        611822..611947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56547"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8F6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADN56547.1"
FT                   /translation="MQCAVANEIGFGFALTFAQRQFNDMWNRQLIQCNTVKAEYP"
FT   gene            612107..613090
FT                   /locus_tag="BC1003_0545"
FT   CDS_pept        612107..613090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0545"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bpy:Bphyt_0816 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56548"
FT                   /db_xref="GOA:E1T8F7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8F7"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN56548.1"
FT                   /translation="MTCASLESAMLRWGHAPNKGMRRIAILMFNDCSLQGAGVVAEVFQ
FT                   AANELASSAPGGCSYEVCFLSADGGMVTSSSALRVWTDGLDARHYNGFDALYVAGGKGA
FT                   IAAAKDERLIAWLRRVRHNTGMIRPIAEGRALLDAAYVPDAMERHELREASKAPRQTEQ
FT                   AADAGDRLESMRSALAMIKRDLGAATARTVAERLLADSCSNLAPLLSDDGALTPGDKVR
FT                   AAARWLQENCQQSISIADAAQFAAMSERNFLRRFKMEMGITPSSFLLHERLAVTCSLLT
FT                   ESELPVDKIARRTGMGNGDRLAKVFRKRMRISPTEFRIQSRRMVGQ"
FT   gene            613184..614719
FT                   /locus_tag="BC1003_0546"
FT   CDS_pept        613184..614719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0546"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; KEGG:
FT                   bxe:Bxe_A3867 mannose-1-phosphate guanylyltransferase
FT                   (GDP); PFAM: mannose-6-phosphate isomerase type II;
FT                   Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56549"
FT                   /db_xref="GOA:E1T8F8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8F8"
FT                   /inference="protein motif:TFAM:TIGR01479"
FT                   /protein_id="ADN56549.1"
FT                   /translation="MLNQGAGNNTSPHAGDDADGARCTRIVPVILAGGSGTRLWPVSRE
FT                   NYPKQLIDVVGSDSLLQATARRMNGFPAGWQVDAAPIIVCGEEHRFVIAEQLHENGVEA
FT                   RLVVEPARRDTAPALTLAALHACAQGEDGILVVMPADHSIADLDALQAALQNAAHYAQR
FT                   GSIATLGVPPTRPDTGFGYIRIGAALGDGAHAIDGFVEKPAEEIAAQYVAAGTYWWNSG
FT                   IFILRASVWLDTLKRLQPEMHSACERAFRDGRSEGSYFRPLVDAFLSSPADSIDYAVME
FT                   RLTEAADESREANGAAPAGVVVRLEAGWSDLGSWDAVWAAMEKDANGNAGRGRVTFEGA
FT                   VSSYAHSEGRLVACVGTTNVVVVETADAVLVVDRSHVQDVKGLVSRIKAQHAPEADAHR
FT                   KVHRPWGFYDSIDHGERFQVKRIVVTPGAQLSLQLHHHRAEHWVVVRGTALVTRGDEQF
FT                   LLSENESTYIPLGTRHRLENPGKVPLEIIEIQSGTYLGEDDIVRFNDNYGRCS"
FT   gene            614736..616157
FT                   /locus_tag="BC1003_0547"
FT   CDS_pept        614736..616157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0547"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; KEGG: bxe:Bxe_A3866
FT                   undecaprenyl-phosphate galactosephosphotransferase; PFAM:
FT                   sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56550"
FT                   /db_xref="GOA:E1T8F9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8F9"
FT                   /inference="protein motif:TFAM:TIGR03023"
FT                   /protein_id="ADN56550.1"
FT                   /translation="MSDGNGQYEVSKMRRFQDLLARMFDVALVLAGAAVASQIRFDDLA
FT                   QAGFYWALVMFAAAFALAIFPAFGVYESWRGRSKLALAGQVSLAWLIVQGSALVLMYSL
FT                   HRSDAVSRLWFSYWTAVTGGLLISYRLITHAVLARARGAGMNLHQVAIVGSGSQCDALI
FT                   RRIESAPTTGFRAAAVYNTSPQDSPVTSAGVPVFDSVDALADYIRTNDVHELWLMLSLA
FT                   EEPLICSLVGEFRDDLVNIRFMPDVRSLALFEGSGVIELLGVPAINLVASPLSASSMLK
FT                   KEIFDRLFAAAALICLAPLLLAIAIAVKVSSRGPVLFKQKRKGADGRVFTIYKFRSMRL
FT                   HTEEKGLLKQATRNDPRVTRVGAFLRRTSLDELPQFFNVLRGDMSVVGPRPHALEHDDL
FT                   YQKVVAGYINRYRIKPGITGWAQINGFRGETDRIEKMERRVEHDLYYLGHWSFALDMRI
FT                   IGATIVAGLVHRNAY"
FT   gene            616227..617366
FT                   /locus_tag="BC1003_0548"
FT   CDS_pept        616227..617366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0548"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; Soluble ligand
FT                   binding domain; KEGG: bxe:Bxe_A3865 putative polysaccharide
FT                   export protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56551"
FT                   /db_xref="GOA:E1T8G0"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8G0"
FT                   /inference="protein motif:PFAM:PF02563"
FT                   /protein_id="ADN56551.1"
FT                   /translation="MSSLGTRTGSLTVFAIAALLAGCAAAPGQRMETPATLQETGGDFS
FT                   TEPSQQQTVPITDINLSLLRKMHTEQAAAPLPPATLALFGKPGPYRVGPGDVLQIVVWD
FT                   HPELAAALGQPAQNAKSSDAASGFLIDEKGDVQFPYAGTVHVAGKDVGTIQKELYNRLS
FT                   KVYQKPEVTVRVASFRNAQVFVDGEVRTPGAQSLNDITMTLTSAISQSGGFSPNADRSR
FT                   VELIRNGVTYQLNMDDLLKRGHNPSNIYLQAGDAIRVASREDSGVYVMGEVNKPATVTP
FT                   MRNGSLTLSQAISDSGSFDQATASTRQLFVIRNSTSESPQIYHLDASSPVSMILANQFE
FT                   LQPKDVVYVGQGGLVRFNRILNLLLPAINAAVTGVVVAK"
FT   sig_peptide     616227..616304
FT                   /locus_tag="BC1003_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.738 at
FT                   residue 26"
FT   gene            617419..619653
FT                   /locus_tag="BC1003_0549"
FT   CDS_pept        617419..619653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0549"
FT                   /product="exopolysaccharide transport protein family"
FT                   /EC_number="2.7.10.2"
FT                   /note="TIGRFAM: exopolysaccharide transport protein family;
FT                   capsular exopolysaccharide family; KEGG: bpy:Bphyt_0820
FT                   exopolysaccharide transport protein family; PFAM:
FT                   lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56552"
FT                   /db_xref="GOA:E1T8G1"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005700"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8G1"
FT                   /inference="protein motif:TFAM:TIGR01005"
FT                   /protein_id="ADN56552.1"
FT                   /translation="MAINFENRYTDVSGPDELHLSDYLRTIVRGWRTIATVTLIALALG
FT                   CAYAFLAPPTYRADVLFHVEDKTANANANGKDSLPPLTGMFDTKPSTAAEIELLKSRLV
FT                   TEETVKKLHLDITATPRYMPLIGGLIAGLVNGQWGFKLPQFINLSGYAWGNESISVSRF
FT                   DTSKDMYDTTFTLIAGNDRSYVLRDRNGVAILSGHVGETVETDTADGPIALRVDALTGA
FT                   PGAQFELQRASTLSTVDRLQKALVVQETTLQSGVIRASLEGSDSALTAAIVNSMAREFV
FT                   RQDVANRSTEAEHMLAFLDQQLPGLRKELDDAEQRYNKFRNTHGTVDLGEESRLLLQQI
FT                   VDNKTKLLDLQTQRAEMSQRFTANHPAVASLDAQIAALQGAQTNMNRSVSVMPDTEQTA
FT                   LRLLRDVHVNTELYTNLLNSAQQLRVAKAGQVGNVRVVDFAEAPDEPVRPKRVIAILIA
FT                   LGGGLVLGILLTFFKRAMYGGVERPDELEAVLGVPVFAVVPRSQTQLRLQENVMLRRRG
FT                   LHVLAQQAPEDIAVEGVRNLRTSLQLSLDHAANNVVMITGSRPDAGKSFLSVNLAALVA
FT                   SANKRVLIIDGDMRRGDVHSHFGIAHQPGLSDVLSGGDLGAMIQRDVLPGLDVLAKGTL
FT                   PSHPSELLMSSRFESMLEELKTRYDLVIIDTPPVLAVTDSTLIGKHAGTTLLVVRHGRH
FT                   PLNEIAETAKRLRNGGVGLRGVLLTDVPQEGAFLGSGYQGGYYGYDSIAG"
FT   gene            619710..620828
FT                   /locus_tag="BC1003_0550"
FT   CDS_pept        619710..620828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0550"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="KEGG: bpy:Bphyt_0821 GDP-mannose 4,6-dehydratase;
FT                   TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56553"
FT                   /db_xref="GOA:E1T8G2"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8G2"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ADN56553.1"
FT                   /translation="MKRKVALITGITGQDGSYLAELLLAKNYDVHGIKRRSSLFNTDRI
FT                   DHLYRDPHDPEQHLFLHHADLTDSTSILRVIQRVEPDEIYNLAAQSHVAVSFEEPEYTA
FT                   NADGLGALRILEAIRILGMQNKTRFYQASTSELYGLVQQVPQSETTPFYPRSPYAVAKM
FT                   FAYWTTVNYREAYGLYACNGILFNHESPVRGETFVTRKITRAIARIAVGMQKTLYLGNL
FT                   SALRDWGHARDYVEMQWRMLQQEQPEDFVIATGVQYSVRQFVQHAAAELGVTVRFEGSG
FT                   VDEIGIVEKVEGRETRMSPGDVIVRVDPRYFRPAEVETLLGDPSKAHAKLGWQPTTPFA
FT                   SLVKEMVRSDFQIARRDALVTLAGFTALEHHE"
FT   gene            620834..621790
FT                   /locus_tag="BC1003_0551"
FT   CDS_pept        620834..621790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0551"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bxe:Bxe_A3862 putative nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56554"
FT                   /db_xref="GOA:E1T8G3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8G3"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADN56554.1"
FT                   /translation="MNKQSRIFVAGHRGMVGSALVRQLVAAGYTNVVTRPRSELDLMDQ
FT                   AAVNRFFQAEKIDVVLLAAARVGGILANASRPGEFIYQNLVIETNVIHAAYRAQVERLV
FT                   FFGSSCIYPKQCPQPIREEYLLTSSLEPTNDAYAIAKIAGLKLCEAYNCEYNTQYVSLM
FT                   PTNLYGPNDNYDLNSSHVLPALLRKAHEAKLSGADSLTVWGSGTPRREFLHVDDLAAAT
FT                   LFVLENNVMEGLFNVGVGADLSIRELAECVCKVVGFRGELVFDTSKPDGTPRKLLDVSR
FT                   LAQMGWQARIGLEQGIASTYRQFVESYAGSATAAAMQ"
FT   gene            621816..622958
FT                   /locus_tag="BC1003_0552"
FT   CDS_pept        621816..622958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0552"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bxe:Bxe_A3861 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56555"
FT                   /db_xref="GOA:E1T8G4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8G4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN56555.1"
FT                   /translation="MSASVTIFHNVVWSRHKGVVFSALHNISASGAIRYSMVQIADTEH
FT                   DRLGFSEVDYSYHRYPMQKLFDGCYEDVPTIKMIVRLTWEVLKAKSDLIVLPGYHRPEY
FT                   WAMLAACIVTGKRRAVFCDSTGRDRPKKLITSIPKRVFFSLCDGYFGFGERSREYLLSL
FT                   GAKRDKIFVPCQAAALPGSFSPERALAERVAARTGNPPVFLYVGRLSEEKGVGTLIEAF
FT                   AGLRKRIPAARLRIVGTGPMGDALRAKVADLQLGDAVTFAGSLQDEPLTREYYRATCLV
FT                   LPSFSEPWGLVVNEALAHGCPAVVSESCGCVPELVIDGVSGYSFTAGDVPGLQRTLLKA
FT                   MEAFADASGTAHRCMDVIRRFDPPSAAANIARGCALMLSD"
FT   gene            623021..624352
FT                   /locus_tag="BC1003_0553"
FT   CDS_pept        623021..624352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0553"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bxe:Bxe_A3860 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56556"
FT                   /db_xref="GOA:E1T8G5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8G5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN56556.1"
FT                   /translation="MKILIYGLNYAPELTGTGKYTAEMAALLASRGHEVRVVCAPPYYP
FT                   EWRVSTGYAAWRYRREERDGVSVWRAPLWVPSRPGGLKRMIHLASFAATSLPVLAWQTF
FT                   WRPDAVLLIAPTLMCAPATLAIARLARASAWLHIQDYEVDAAFELGLLKGSRAARFARW
FT                   MESQLLRRFDAVSSITRQMSARASAKGVAPSKVVCLPNWVDVSTIYPLTRASEYREELK
FT                   LAEGQKVVLYSGNMGAKQGIETLAEAAASLATRADLTFVFCGNGAARDSLAKRCAALPN
FT                   CIFLPLQPTERLNELLNLADIHVLPQRGDAADLVMPSKLTGMFASGRATIAMARRGTAL
FT                   HEAVHARGVVVPPDNVKALVGAINALANDSERRFALGRAARDYAETALSPDTTVSAFEE
FT                   RVGMLCRAAGRRRWKPSTTYFDARPSAVAVTHAKPATTEDAAPE"
FT   gene            complement(624382..624867)
FT                   /locus_tag="BC1003_0554"
FT   CDS_pept        complement(624382..624867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56557"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8G6"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3859"
FT                   /protein_id="ADN56557.1"
FT                   /translation="MTTTLRHTAYCTLLFTAAYAAPTLAQNAAPARAPAMTATAPTGYG
FT                   APVPAPVDRRATQRKREQSLLGAPDAYDVGIAQNGNLDDARRTALLDEQRMTANGIAQG
FT                   GQQGAALKRKAPDGQLRVADAAARPRAAEKLLPEGAARATYSDPYATGKASVYRSPW"
FT   sig_peptide     complement(624790..624867)
FT                   /locus_tag="BC1003_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.827 at
FT                   residue 26"
FT   gene            625051..625665
FT                   /locus_tag="BC1003_0555"
FT   CDS_pept        625051..625665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56558"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8G7"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0826"
FT                   /protein_id="ADN56558.1"
FT                   /translation="MGKIADDPRLACEPRAAEGGSEPRVIDLSLAGKGNYSARRSALIE
FT                   LVWFVLEACVINNKLLPFSFVRVALLRLFGARIGSGCRFVHPLRVKAPWNLEVGDKCWF
FT                   GVDVWIYNQAPIRIGSNVCISQGTFLTAGSHDMSTTMDLRVAPIVIEDGVWITSKCVVQ
FT                   MGVTIGRSAVVTPMSVVHRSLEAGGVYGGNPCRFLRKRFLP"
FT   gene            625837..627570
FT                   /locus_tag="BC1003_0556"
FT   CDS_pept        625837..627570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0556"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; GMC oxidoreductase;
FT                   KEGG: bxe:Bxe_A3857 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56559"
FT                   /db_xref="GOA:E1T8G8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8G8"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADN56559.1"
FT                   /translation="MYIDTRNVEQNTVIETTVCIIGGGVAGITLAREMSKAGVDTCLLE
FT                   SGGFVPDEDTRDLYRGENAGLPYRFADGSRSRYFGGSSNCWGGWCRPLDPWDFEKRDWI
FT                   AHSGWPFGLDELAPYYARTHELLKLGPQNFDPAYWEREIGRSDVRRIPLGSGDMRDTIA
FT                   QFSPPLRFGKVYREELGRSTRVRVFLHANVLNIDADPQGTTITRVQVGTLSGRRMSVKA
FT                   RIFVLATGGIENARLLLASNNVHAAGLGNANDLVGRYFMDHPRMMCGKVRFRPGVARNK
FT                   LYDIKYHYQNAAVSAHGTKISSQFAPKQEMMEREKLLNSRVWLYSRWYGEGSAGSEALI
FT                   RCKEALMHKDQPGRSLKADIATMAAHPLHTIGYGLTRLLQWPALITDVTLQAIVEAVPD
FT                   PDSRVTLSADKRDRFGMPRVKVEWRLGEQVKRTFDRTFAGLAKELQLARVADVELDAPL
FT                   EGRAWPEKLEGTWHHMGTTRMHDSPREGVVDRNCKVHGISNLYVGGSSVFPTVGANFPT
FT                   ITIAALALRLAGHLARQLDVPHITGSTRVEAVYSPVVPAQSPVDTLPIAASTLTPLMKE
FT                   Q"
FT   gene            complement(627656..628873)
FT                   /locus_tag="BC1003_0557"
FT   CDS_pept        complement(627656..628873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0557"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bpy:Bphyt_0828 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56560"
FT                   /db_xref="GOA:E1T8G9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8G9"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN56560.1"
FT                   /translation="MKILHVLASVDPRAGGPVEGVRRSGVAMQNAGHDIEVATCDSPDD
FT                   AYLATFPFPVHAFGPTSNRYSYSAHLSPWLARHAKRFDAVIVHGLWQYHGFATWKALHD
FT                   SDVPYYVYAHGMLDPWFKQAYPLKHLKKWLYWPWAEYRVLRGARAVIFTTEEERTRARQ
FT                   SFWLYQARERIVPFGTTVPEVDAASVREAFLQAVPAARDKRVVLFLGRVHAKKGCDLLI
FT                   DAFARVAQRDPALHLVIAGPDETGWVASLRSQAQAAGISHRLSLPGMLQGDLKWGAFHA
FT                   SDVFALPSHQENFGVAVAEALGCGLPALISDKVNVWREIEEDGAGLVVPDTVEGTEQSL
FT                   VRWLELDATAREAMRVQAARTFNARFRVETMVSALTALLETKGDQPAELKSNTLAALHE
FT                   AAQPGR"
FT   gene            complement(628870..630312)
FT                   /locus_tag="BC1003_0558"
FT   CDS_pept        complement(628870..630312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56561"
FT                   /db_xref="GOA:E1T8H0"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8H0"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0829"
FT                   /protein_id="ADN56561.1"
FT                   /translation="MRHQYATPWIWIFLLPLALDYKATNATTGHFAQFIFVVPAVAAGL
FT                   ALLLIAPRFHERSGLRSIVAASMFLCVFGSVVPQLIQDNDSGNYLRVLLPFVLFLLGYL
FT                   VACRPWSEQRIAQFEKALFAGNVISLIFTFVYGIATGGGLEDVRFRIISVTLLGLQGVL
FT                   LHEFVVAKRYTPYSVGVFAVTVIVELLSVTRSLLVGTVLLFLIAMALSAPSIRQIWRAV
FT                   ARGVVVAAVLAGVAGIAILAVPNVAEHWSQRIFFSEATVSGKDPTTITRLAEMRDQYDQ
FT                   VTATPETLLFGAGYGHYYRYSPDYLPDLAGQFSKQDFYAINEWAAGHNFWVYQFFAGGL
FT                   VFGIAMPLATLGALALCFFSYRYWRKVVPTAPMLPVLGRAIMLFAALPATSIGGNPLGP
FT                   RFSGLVFGVGLGLMIATFTRLQRALPARADQMRAARPMRPGAMPDLPGRIQPGMGRADL
FT                   ASTLGTSHTARLPGSNRADIAR"
FT   gene            630596..631744
FT                   /locus_tag="BC1003_0559"
FT   CDS_pept        630596..631744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0559"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bxe:Bxe_A3854
FT                   putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56562"
FT                   /db_xref="GOA:E1T8H1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8H1"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADN56562.1"
FT                   /translation="MKLFGGTGPAKAGRAIELDFVRGIAIIAVMGFHFHAVHTTNVVIQ
FT                   IIEYPLKNFGREGVNLFFTLSGFLVGGLLLRQYAETGHVDARRFIVRRMFRIWPAYYVL
FT                   ILFHVLAGRHPWNTFLFQNLTHLQNYLGTSITQTWSLAVEEHFYLALPALLLVFSRWRL
FT                   GAWTIVGVLSGICAVTLIARCFAVAGGNLEGAFAYTQYRIDSLLIGVILSAIYWMKPGV
FT                   YHQIARRKWLLIGSVLLLCAWLVFATKNIALDESVGYTIQALGFAALIVLVLEYSGSLR
FT                   KTWMYRGIAWVGLYSYGIYLWHSLALAPGDMLIRKATSLGLAPTVIWLIALTAQFAIAI
FT                   AIGYVTTRAIEYPFLLMRNALFPEKRSSSVREEVPVAGGQLS"
FT   gene            complement(631824..633026)
FT                   /locus_tag="BC1003_0560"
FT   CDS_pept        complement(631824..633026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0560"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bpy:Bphyt_0831 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56563"
FT                   /db_xref="GOA:E1T8H2"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8H2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN56563.1"
FT                   /translation="MPTHLIEPEFVLIVEPNLTGHRWRYAEWIMQACADAGYPCILVTE
FT                   SANEDHRLARRITAADRPDQQIAFVDAEESRTHRLRERNQYWRFHHYFERAYRLLSRAQ
FT                   SIRLVVVPYADYFFNGLPFLGSPFGKTPWIGITMRSTFHHHKVGIKAPDRPVVNAIKAG
FT                   LFRRAIRTPGLRTLLSIDPTLPEWVTLNASKGSAKVAYVADPFPDERAEDPALARERLG
FT                   LDPEQRYLLVYGAITERKGIYELVHAMTRLEYGPTLIVAGEQDASIRHFMRNHVRSLKH
FT                   APVVLDSFISNDMERDLFSACDAVWLGYKGHYGMSGVLVQAYRFGKPVIATEDGLIGWF
FT                   SRRCELGPILSDLSSASIGKAITEAMTSWPHAHPTAGSRDNLLSQNTLGEFKQTLLQQM
FT                   A"
FT   gene            633391..634644
FT                   /locus_tag="BC1003_0561"
FT   CDS_pept        633391..634644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0561"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bxe:Bxe_A3847 PST family polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56564"
FT                   /db_xref="GOA:E1T8H3"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8H3"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADN56564.1"
FT                   /translation="MRAIRLPAFSIASSFGASAATWVLLQQFAVRGLVAIKFLAIGRML
FT                   GPEAIGSVSVALLAVAIAEALSDTGLAQAVIQGEHAPTHSQLGAVWTTLTARGVLISLL
FT                   LVALAPLLSSQFHLDGSLVLIQLAAVLPLLRGLASPAYYVVQRERRFQHIAGVEVAAAF
FT                   VDCAAGLVLAYLGAGAASVLIGLVAGETLKSTLTWATMKPRPPVRAVWSGIGQYVNFSR
FT                   WIWASSVINLLLNQFDKVVVGKLLGPTQLGGYQMSSRLAQMLLADAAIAMSQYLFPTFA
FT                   AHHRRSAQAASRLIRIYLLVAAIGLAVFVEVLRLIAQPLFSLILGAAWLPAVPLFRILV
FT                   INMAIGALIAVLVSYLRAIGDARATVHASAIQVVVLLVSAPLAVRWWGVTGIAWSMTLG
FT                   LGCAAAWMLYRTLTARTA"
FT   sig_peptide     633391..633450
FT                   /locus_tag="BC1003_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.932 at
FT                   residue 20"
FT   gene            634644..635726
FT                   /locus_tag="BC1003_0562"
FT   CDS_pept        634644..635726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0562"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bxe:Bxe_A3846 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56565"
FT                   /db_xref="GOA:E1T8H4"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8H4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN56565.1"
FT                   /translation="MRVFHLVLAPRLSGAEVLAKDLALDQCAEGMAVCVASLLPAHADF
FT                   AELADQLQRRGVQCWFPTKRHHALGKLWNLFVAVRRFRPDVIFAHATIPSFYARALPLG
FT                   APVVYVMHSATNDFERPLFRRVEHILSGRASVVIGVSQQGVRDYIQAIGVHPSMTVVPN
FT                   GVDLARFAFTDGGQRVGSVPQIVQIGRYASVKNQLLTVQAFSEVLERVGDAKLTLYGVV
FT                   EDPDYQREVVALATRLNIAERVLVAGPRSDVASVLSESSVFVMPSRSEGHSVAFLEALA
FT                   SGVPIVASRIPAFAFANGFPGVQLVDTDDTSGYAEAIVTALGQQRVQRSLTGLTLRDTA
FT                   ERYRAIARQLCPAVSARQTL"
FT   gene            complement(635806..636891)
FT                   /locus_tag="BC1003_0563"
FT   CDS_pept        complement(635806..636891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56566"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8H5"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0834"
FT                   /protein_id="ADN56566.1"
FT                   /translation="MNTDTVDNWECESCGAPLADRTTPCPSCRARSVPSFGALVPTLTV
FT                   RLDDSRPMRTHRVRMRRVWSPSHALANPYATIDESSAGPSAQQRLRVPLALAASALVVA
FT                   STVYVGFIYNGDSADENEPVGVSGAIRQQKIVPPATAPILSPAASSAQSAVVASAAAPR
FT                   AEPAPAPRPSSTASAATLPAASPLLARRGAPAVSVTSSVSPATPASSNAVTLSAQAKRD
FT                   PGTPLPLTAEDKARADLSRHLRAARASLQKNNLVATKARVAAAIAVQPQSREAQNLRAA
FT                   VNAREQQRDAFLNLARGCGNIARWDCVASNASSALELDSSSKEARHLVTLAMHESALAI
FT                   AETVTPEPEPAPDTRDINAHH"
FT   gene            complement(636986..637630)
FT                   /locus_tag="BC1003_0564"
FT   CDS_pept        complement(636986..637630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56567"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8H6"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3844"
FT                   /protein_id="ADN56567.1"
FT                   /translation="MGYKTYTLITLMVASNAALAWQPLVYPIRSQSAYQRNIDSAMCYA
FT                   TANKQTKVNIAREPQTPPPKPAGTKTSSTGAPSRPPLPPSTFSAAPAGPALPDGMAAAA
FT                   PGSAPAAKPGTATAGNAASATPAAPASAAPASGTPTATANAAHGASAALPASAAVAEKA
FT                   ASGPAATASASDTSQPGTAALPPLPAPEPPMTRYWAAYGACMQARGYVVAQ"
FT   sig_peptide     complement(637568..637630)
FT                   /locus_tag="BC1003_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.970 at
FT                   residue 21"
FT   gene            638616..640898
FT                   /locus_tag="BC1003_0565"
FT   CDS_pept        638616..640898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0565"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: bxe:Bxe_B0820 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56568"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8H7"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B0820"
FT                   /protein_id="ADN56568.1"
FT                   /translation="MVRHSKLIGIAATTALASFAAQNAHAQASTITVGGQQYKLCAQEN
FT                   GKCSFLGTASVVFGVVPPDAPSTMLTSPATFSNGVGCYLGAVSQTDPAYGYDKACWMRA
FT                   VAASAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPSPTPTPTPAPA
FT                   PSPSPSAAISCSAPTQTAGGTANGVISADTPTTDGLRVFPNNTAFKIAITTNAPGADTV
FT                   VWSVADANGAIKTQGSFAVNSGVQTSTLSCKSTWAGYGALTATLRSAGGTLPRSGTRPT
FT                   GIATFGVLPDLNSALGTVTYAHQDQHRFGMQGFNGNIAALRALGISWTIDDRQVSAMEP
FT                   NGPYTYTPSVNDLDPFYKANPDQLRIVRLDGLPAWDSKTGQYNDSYYAPVNMTEFKDFM
FT                   ARVGTDTSLIRAANYPNQQKNYYQVTWEPSLGWADSDANFVAMYKAAYEGIHSTDPNAI
FT                   VMGTGNPFAANCDTCTTGYLKKFGALGLWNYIDAVSTHGYWNAGTYPAHPPELQDSDPD
FT                   PANQANALDNQMTQLRSVMQAGKPNMKLFFTEAGASYDPGLSYGPTVPSQNQLFAHAAV
FT                   GVRAHIIVLGGGAQVTTLFYGPDYPGEVGYGSFFDLSNAQGAFGASNLSPKPEAMAFAT
FT                   MTRVLDGTNTLGRVKGTPSGTFAYAFQQLGNGKVVTAAWTHSNAQWPTSGGVYSQTYST
FT                   SYTLQVDGAGTSGSVTRIDGYGNVSSIPYSNGAVTLTLTEVPQYIVSNNATVAKNNSTV
FT                   PLGYTGQ"
FT   sig_peptide     638616..638696
FT                   /locus_tag="BC1003_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.987 at
FT                   residue 27"
FT   gene            complement(640971..641603)
FT                   /locus_tag="BC1003_0566"
FT   CDS_pept        complement(640971..641603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0566"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   bpr:GBP346_A1452 negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56569"
FT                   /db_xref="GOA:E1T8H8"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8H8"
FT                   /inference="protein motif:PFAM:PF04299"
FT                   /protein_id="ADN56569.1"
FT                   /translation="MYLPADFTEARTDQLHALIAQHPFGTLITHGASGLDANHIPFDLA
FT                   TNEGEFGVLHAHVARNNPLWQDLANGAEVLVVFHAGDAYISPTWYPSKHETHRQVPTWN
FT                   YVVVHAHGRITIRDDEKYVRGVVARLTRTHEAALPQPWKMGDAPREYIDAMLKAIVGVE
FT                   IVITRLIGKRKLGQNKDARDIRGAGEALRARENPIGDQMLACAAQKQ"
FT   gene            complement(641923..643482)
FT                   /locus_tag="BC1003_0567"
FT   CDS_pept        complement(641923..643482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_3736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56570"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8H9"
FT                   /inference="similar to AA sequence:KEGG:Bphy_3736"
FT                   /protein_id="ADN56570.1"
FT                   /translation="MLKRRQFIGALTALGGSVVLSACGGGGSEETGATTSSGAQKTSAT
FT                   AKIGSANGAAMPPASSLIDGTGATWTLSGGVAYRNGARAGNNYNVVLALCFNGNIYVQN
FT                   TSNQFYQWTGSTWQASSDPRLGTTSPDGTTMPSASSIIDKTGAVWTLTNGVISRNGAVV
FT                   GNNYNVSLVLWYGGKIYCRNTSGQFYANAEVASQWLPCSDPRTPVAATAGSFFGINGHF
FT                   DYTYTPAQVVSILKGLGCTSYRVGCSGDAAQLNAVVKLAQAFQSAGMTLLVLVNLGLRD
FT                   SSGRLLAGESAAYNACYGTAFTIANTLKQYGVTFYECGNELTRDSAIIIDSTNAGTKAL
FT                   DFNNANWPIMRGAMRGMIDGVKAAQPGAKCGINFCVADVGASDALWDGMQPDGSGGYPK
FT                   VRWDITTWHNYEVYGNIFDIGTDGAGPGIDLPTYCKARYGVPFFITEWNTGPEQTQTYR
FT                   ASYITSQLGSFYAARKTHNIQSVMYYVLDSGNNTYGIMTNGTALNPPYGAFSNFTSSHA
FT                   DT"
FT   sig_peptide     complement(643414..643482)
FT                   /locus_tag="BC1003_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.681 at
FT                   residue 23"
FT   gene            644334..645452
FT                   /locus_tag="BC1003_0568"
FT   CDS_pept        644334..645452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_1086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADN56571"
FT                   /db_xref="GOA:E1T8I0"
FT                   /db_xref="UniProtKB/TrEMBL:E1T8I0"
FT                   /inference="similar to AA sequence:KEGG:Patl_1086"
FT                   /protein_id="ADN56571.1"
FT                   /translation="MSQIIEEPRAVRGNNEDKGSRPRVLMCPFTNPTNRYIEIQKDLYR
FT                   SVGYDVAPLSIKGLLKGGFADLFRPENVLVFHWLEYRPFSRQKGTARLSVLGCLIFAFY
FT                   CALILLARAKTVYFVHDQAVHDTVGFNRRLSVRIIAFVRRIADSRVVHAPDFQAPF