(data stored in ACNUC7421 zone)

EMBL: CP002218

ID   CP002218; SV 1; circular; genomic DNA; STD; PRO; 2966498 BP.
XX
AC   CP002218; ADJP01000000-ADJP01000040;
XX
PR   Project:PRJNA37721;
XX
DT   24-SEP-2010 (Rel. 106, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Burkholderia sp. CCGE1003 chromosome 2, complete sequence.
XX
KW   GSC:MIGS:2.1.
XX
OS   Burkholderia sp. CCGE1003
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia.
XX
RN   [1]
RP   1-2966498
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Daligault H., Davenport K., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G.,
RA   Martinez-Romero E., Rogel M.A., Auchtung J., Tiedje J.M., Woyke T.;
RT   "Complete sequence of chromosome2 of Burkholderia sp. CCGE1003";
RL   Unpublished.
XX
RN   [2]
RP   1-2966498
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Daligault H., Davenport K., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G.,
RA   Martinez-Romero E., Rogel M.A., Auchtung J., Tiedje J.M., Woyke T.;
RT   ;
RL   Submitted (16-SEP-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; fceabc606c780a07df0639de60db82b7.
DR   BioSample; SAMN00008621.
DR   EnsemblGenomes-Gn; BC1003_R0070.
DR   EnsemblGenomes-Gn; BC1003_R0071.
DR   EnsemblGenomes-Gn; BC1003_R0072.
DR   EnsemblGenomes-Gn; BC1003_R0073.
DR   EnsemblGenomes-Gn; BC1003_R0074.
DR   EnsemblGenomes-Gn; BC1003_R0075.
DR   EnsemblGenomes-Gn; BC1003_R0076.
DR   EnsemblGenomes-Gn; BC1003_R0077.
DR   EnsemblGenomes-Gn; BC1003_R0078.
DR   EnsemblGenomes-Gn; BC1003_R0079.
DR   EnsemblGenomes-Gn; BC1003_R0080.
DR   EnsemblGenomes-Gn; BC1003_R0081.
DR   EnsemblGenomes-Gn; BC1003_R0082.
DR   EnsemblGenomes-Gn; BC1003_R0083.
DR   EnsemblGenomes-Gn; BC1003_R0084.
DR   EnsemblGenomes-Gn; BC1003_R0085.
DR   EnsemblGenomes-Gn; BC1003_R0086.
DR   EnsemblGenomes-Gn; EBG00001461273.
DR   EnsemblGenomes-Gn; EBG00001461274.
DR   EnsemblGenomes-Gn; EBG00001461275.
DR   EnsemblGenomes-Gn; EBG00001461276.
DR   EnsemblGenomes-Gn; EBG00001461277.
DR   EnsemblGenomes-Gn; EBG00001461278.
DR   EnsemblGenomes-Gn; EBG00001461279.
DR   EnsemblGenomes-Gn; EBG00001461280.
DR   EnsemblGenomes-Gn; EBG00001461281.
DR   EnsemblGenomes-Gn; EBG00001461282.
DR   EnsemblGenomes-Gn; EBG00001461283.
DR   EnsemblGenomes-Gn; EBG00001461284.
DR   EnsemblGenomes-Gn; EBG00001461285.
DR   EnsemblGenomes-Gn; EBG00001461286.
DR   EnsemblGenomes-Gn; EBG00001461287.
DR   EnsemblGenomes-Gn; EBG00001461288.
DR   EnsemblGenomes-Gn; EBG00001461289.
DR   EnsemblGenomes-Gn; EBG00001461290.
DR   EnsemblGenomes-Gn; EBG00001461291.
DR   EnsemblGenomes-Gn; EBG00001461292.
DR   EnsemblGenomes-Gn; EBG00001461293.
DR   EnsemblGenomes-Gn; EBG00001461294.
DR   EnsemblGenomes-Gn; EBG00001461295.
DR   EnsemblGenomes-Gn; EBG00001461296.
DR   EnsemblGenomes-Gn; EBG00001461297.
DR   EnsemblGenomes-Tr; BC1003_R0070-1.
DR   EnsemblGenomes-Tr; BC1003_R0071-1.
DR   EnsemblGenomes-Tr; BC1003_R0072-1.
DR   EnsemblGenomes-Tr; BC1003_R0073-1.
DR   EnsemblGenomes-Tr; BC1003_R0074-1.
DR   EnsemblGenomes-Tr; BC1003_R0075-1.
DR   EnsemblGenomes-Tr; BC1003_R0076-1.
DR   EnsemblGenomes-Tr; BC1003_R0077-1.
DR   EnsemblGenomes-Tr; BC1003_R0078-1.
DR   EnsemblGenomes-Tr; BC1003_R0079-1.
DR   EnsemblGenomes-Tr; BC1003_R0080-1.
DR   EnsemblGenomes-Tr; BC1003_R0081-1.
DR   EnsemblGenomes-Tr; BC1003_R0082-1.
DR   EnsemblGenomes-Tr; BC1003_R0083-1.
DR   EnsemblGenomes-Tr; BC1003_R0084-1.
DR   EnsemblGenomes-Tr; BC1003_R0085-1.
DR   EnsemblGenomes-Tr; BC1003_R0086-1.
DR   EnsemblGenomes-Tr; EBT00001615496.
DR   EnsemblGenomes-Tr; EBT00001615497.
DR   EnsemblGenomes-Tr; EBT00001615498.
DR   EnsemblGenomes-Tr; EBT00001615499.
DR   EnsemblGenomes-Tr; EBT00001615500.
DR   EnsemblGenomes-Tr; EBT00001615501.
DR   EnsemblGenomes-Tr; EBT00001615502.
DR   EnsemblGenomes-Tr; EBT00001615503.
DR   EnsemblGenomes-Tr; EBT00001615504.
DR   EnsemblGenomes-Tr; EBT00001615505.
DR   EnsemblGenomes-Tr; EBT00001615506.
DR   EnsemblGenomes-Tr; EBT00001615507.
DR   EnsemblGenomes-Tr; EBT00001615508.
DR   EnsemblGenomes-Tr; EBT00001615509.
DR   EnsemblGenomes-Tr; EBT00001615510.
DR   EnsemblGenomes-Tr; EBT00001615511.
DR   EnsemblGenomes-Tr; EBT00001615512.
DR   EnsemblGenomes-Tr; EBT00001615513.
DR   EnsemblGenomes-Tr; EBT00001615514.
DR   EnsemblGenomes-Tr; EBT00001615515.
DR   EnsemblGenomes-Tr; EBT00001615516.
DR   EnsemblGenomes-Tr; EBT00001615517.
DR   EnsemblGenomes-Tr; EBT00001615518.
DR   EnsemblGenomes-Tr; EBT00001615519.
DR   EnsemblGenomes-Tr; EBT00001615520.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002218.
DR   SILVA-SSU; CP002218.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085515
CC   Source DNA and organism available from James M. Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James M. Tiedje (tiedjej@msu.edu)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Burkholderia sp. CCGE1003
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Host, Rhizosphere, Rhizosphere-colonizing
CC   num_replicons       :: 2
CC   ref_biomaterial     :: Missing
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Facultative
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi03923
CC   Funding Program     :: DOE-CSP 2007
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2966498
FT                   /organism="Burkholderia sp. CCGE1003"
FT                   /chromosome="2"
FT                   /strain="CCGE1003"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:640512"
FT   gene            636..963
FT                   /pseudo
FT                   /locus_tag="BC1003_3529"
FT   gene            complement(1084..2013)
FT                   /locus_tag="BC1003_3530"
FT   CDS_pept        complement(1084..2013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3530"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: avn:Avin_25870 LysR family transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59473"
FT                   /db_xref="GOA:E1TH20"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH20"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN59473.1"
FT                   /translation="MAKNDRIDFADLRLFLAIVRCRSFRLAAIELGQTPSAVSHAMRRL
FT                   EDRLGAKLLNRTSRAVSPTEAGLDLASRLEEGFNQIGSALESFEAPGTARLGSLRLNVF
FT                   ADAAHLLIAPALPEFARLCPEVQLTVVVDNRPIDIVAEGYDAGIRYGHHVPEDMIAVPL
FT                   TGPQRWVMAASPAYLKKHGTPRHVSELADHNCLQLLLGDNSSYRWEVNVAGKKSPIRVP
FT                   GSITINDTATTISACKAGMGIAYLLEARIADELARRSLRVVLDEHACAEDPIHMYYSGR
FT                   RYNHPALLSLINIIRKQQSLAKISRSRE"
FT   gene            2142..2915
FT                   /locus_tag="BC1003_3531"
FT   CDS_pept        2142..2915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3531"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ara:Arad_9489 dehydrogenase/reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3531"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59474"
FT                   /db_xref="GOA:E1TH21"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH21"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59474.1"
FT                   /translation="MHGLEQIQIGDLKDTRVLVTGGSTGIGAAVVRAFATQGAHVVAHF
FT                   NESEAAAQALRAESPERIHLVQGDVSEPGEASRVVKEAAQLLGGLDGLINNAGAMLGRL
FT                   ASVGASGSHFERVVNLNARSVWEATSAAHPFLKESRGYVINTSSVAARTGGGAGAVLYA
FT                   ASKSFVSSLTRGHAKEFVNDGIRVNAVAPGLIQTPFHDKYTPPEIWASQTASVPMGREG
FT                   TPQECVGAFLFLASAAMSGYITGQIIEVNGGQLMP"
FT   gene            2929..3912
FT                   /locus_tag="BC1003_3532"
FT   CDS_pept        2929..3912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3532"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sme:SMc01702
FT                   putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59475"
FT                   /db_xref="GOA:E1TH22"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH22"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADN59475.1"
FT                   /translation="MKQRKFGHAEKSVSEIGFGAWAIGGSWGDVAESDAKAALHAALDS
FT                   GTTFIDTADVYGDGRSERIIAAVLKERPGPRPFVATKAGRRLDPHVAQGYTAANLNAFV
FT                   DRSLKNLEMERLDLVQLHCPPTEVYYRPEVFDAMDRMVAAGKISSYGVSVEKVEEGLKA
FT                   IEYPGVKSVQIIYNIFRQRPARFIQEARDRGVAVIVRVPLASGLLTGKMTRETTFAAND
FT                   HRLFNRNGEAFDKGETFAGVPYDVALEAVDEIRSLVPQNATMAQFALRWILMDDGVTTV
FT                   IPGAKNAAQAKANAEASELPPLTDSAMEVLRALYLQKIAPFVHQQW"
FT   gene            complement(4054..4371)
FT                   /locus_tag="BC1003_3533"
FT   CDS_pept        complement(4054..4371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_7213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59476"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH23"
FT                   /inference="similar to AA sequence:KEGG:Bphy_7213"
FT                   /protein_id="ADN59476.1"
FT                   /translation="MKALLNVVLVSCALAAPALSFAQTVDQPVTRAEVRADLVQFEMAG
FT                   YRPVASDAQYPTDIQTAEAKVSAEKSASYTTSVGGVSMHGSSQAGAPASVDGAGHIYVG
FT                   H"
FT   sig_peptide     complement(4303..4371)
FT                   /locus_tag="BC1003_3533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 23"
FT   gene            complement(4805..5827)
FT                   /locus_tag="BC1003_3534"
FT   CDS_pept        complement(4805..5827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3534"
FT                   /product="chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   bgl:bglu_1g30090 chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59477"
FT                   /db_xref="GOA:E1TH24"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH24"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADN59477.1"
FT                   /translation="MADANEIVDLTREVHRIAKGNVSDINDINRETTFLAINALIESAR
FT                   AGDAGRGFAVVANQVKVVSQRIGQLTTELGRELTALGDRMITQLEQQEAQRLTDLALNM
FT                   IEIIDRNLYERSCDVRWWATDSAIVDCLAHDTPEHRAFASERLGVILDSYTVYLDLWVI
FT                   DMAGNVVATGRPGQFAAAGQENVADKPWFKAAAKSASGAEYAAAELESVTALGGAAVAT
FT                   YAAAIREGGANRGRPLGVLAVFFNWAPQASTVVKGVRLSAEEWTRTRCLLVDARKRVIA
FT                   SSDDKGMLQEVLPLKVGDPKAGAYRPDADTLVAYALTPGYETYEGMGWYGVIVRKRPGR
FT                   "
FT   gene            complement(6189..7430)
FT                   /locus_tag="BC1003_3535"
FT   CDS_pept        complement(6189..7430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3535"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: bja:bll5494 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59478"
FT                   /db_xref="GOA:E1TH25"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH25"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADN59478.1"
FT                   /translation="MESILLSNASLLDVERAELREGHHVLVENGLIREVSDRPLKSAAA
FT                   REIDLRGKTLMPGLIDLHVHVVAVQLNLSQQVNMPNVLVTLRSVPIMRAMLRRGFTTVR
FT                   DAGGAGYPHKQAVESGLAIGPRLFVAGRALSQTGGHGDMRARSDYMGSSAPCGCCVRVG
FT                   ALARVADGVDEVRRAAREELQMGADHLKIMASGGVASPTDPVGAFGYAEEEVRAIVEEA
FT                   RARHTYVMAHAYTAEAIARVVRWGVRTIEHGNLVDGPTASLMAEMGAYVVPTLVTYEAL
FT                   AKEGAQYGLGEESVAKIADVREAGLRSLEIYNDAGVKMGFGSDLLGPSQRLQSDEFRIR
FT                   AEVLGNAATLSSATTTAAEVLGLPDKLGRIAPGAFADMLVVDGDPLRDITCLLGQGERI
FT                   PLVMKGGEIYFNEM"
FT   gene            complement(7576..8070)
FT                   /locus_tag="BC1003_3536"
FT   CDS_pept        complement(7576..8070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3536"
FT                   /product="GAF domain protein"
FT                   /note="PFAM: GAF domain protein; KEGG: bja:bll5495
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59479"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH26"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ADN59479.1"
FT                   /translation="MNALAASTLHPFVVLAGAQANGDQPATLFRALDTVLADTLGHTLF
FT                   TILRYDDATGESARIYSNRPNEYPVAATKPLSGGNWVETVLTRGEAFIGATPDDLRAVF
FT                   ADHELIASLGCESVLNVPVRWDGRTLASLNLLHSRAWYRDEHVPFAQALAQFTLPALLD
FT                   G"
FT   gene            complement(8067..9431)
FT                   /locus_tag="BC1003_3537"
FT   CDS_pept        complement(8067..9431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3537"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:bll5496 metabolite transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3537"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59480"
FT                   /db_xref="GOA:E1TH27"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH27"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59480.1"
FT                   /translation="MSNVSARIERLPFGRFHGHLLLMGGLGYAFDAMDAAAVAFVLPVL
FT                   RHDWSLSSVQTGVLGSGNFIGFFFGALLAGTLGDLIGRRRVMMSALLIYCAASVVSAMT
FT                   DSWPTFLAARIVAGMGTGAESAIIAPYLAEFVAKRYRGIFTGALAGFFSFGFVAAALLG
FT                   YFIVPAFDAGWRVVLLITAVPILMLLWWRRSLPESPRWLESRGRTDEATRVLDAIEASF
FT                   TARGIALPAPEPVEARAAPALEAGTLISNLRALWTGRQARITTMTWLMWLSITFSYYAF
FT                   FTWIPGLLVQHGMSITRSFGYSVAMYAAQVPGYFSASWFNERIGRQATIATYMLFGCAC
FT                   ALGMAFAHTNGQIMAAGIGLSFFMNGTYAGVYAYTAEVFPTAVRTTGAGTASAIGRIGA
FT                   IVSPILVGYLYPNFGFAGVFGVTTVVLLLGAIAVVVMGVPTRGRSLEDIAAGEAA"
FT   gene            9579..10559
FT                   /locus_tag="BC1003_3538"
FT   CDS_pept        9579..10559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3538"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bja:blr5497 transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59481"
FT                   /db_xref="GOA:E1TH28"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH28"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN59481.1"
FT                   /translation="MSFRSLDLNLLKVFEALMTEGAVTRAATKLSLTQPAVSNALSRLR
FT                   EAFDDPLFVRNGAGVAPTQRAMALWGPVGDSLSRIRAALDEETFAPEHAEASFSLSMSD
FT                   YVAGLVMPRLIGRFSKGAPRLQWHAVPNTLLDAPALLEGNRVDCVIGVYVNETLPPAHI
FT                   RSRSLWTVDYACLMRRGHPLAAPGRLTTKRFLNASHVDISLAGQTQPSFDSFLASRGLK
FT                   RNLVTTVNHYTVACEILCASDLIAVLPSDLCARGGGNGALVSVRAPLEAPDRVVSLLWH
FT                   QRNETAPAHRWLRDQLVDMFAAPGLDKRDMGATNGVAPNGRRRDS"
FT   gene            complement(10643..11326)
FT                   /locus_tag="BC1003_3539"
FT   CDS_pept        complement(10643..11326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3539"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bpy:Bphyt_6337 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59482"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH29"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59482.1"
FT                   /translation="MKKVAMVSGASRGIGREIAAELARRGYRLSLGLRDTRAYDGVADA
FT                   LLHHYEARDPEAARAWVNATLARFGRIDVLVSNAGICRMIDFDTGTDALLTETFEINVN
FT                   APFRLVQAALPHLRRAGAGRFIQLASLSGKRVKNLNVGYQMSKHAMLALTHAVRRAGWD
FT                   DGVRATAVCPGFVNTDMAAGIADIEPMAMTQPQDLAHLVVNTIELPNTTSVAELLVNCR
FT                   YEETL"
FT   gene            complement(11357..12697)
FT                   /locus_tag="BC1003_3540"
FT   CDS_pept        complement(11357..12697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3540"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bpy:Bphyt_6338 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59483"
FT                   /db_xref="GOA:E1TH30"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1TH30"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADN59483.1"
FT                   /translation="MGPKVDTVADDIKLPERADVVVIGGGIIGVSTALALHEKGLSVAL
FT                   CEKGHIAGEQSSRNWGWVRVTRRDPREVLLSIESLKIWRTLDQKLGIDTGFNQCGILYV
FT                   SNDDAVLERHRDWLKRAREIAGDHAFDTREVDAGEISGLLPGATQTFKGGIFTPGDARA
FT                   EPQKAAPAIANALRRKGVSILTPCAVRGIETSGGRASAVVTEHGTIRCDAVVVAGGAWT
FT                   RYFCGNLGVELPQLLTRASVLRTEPLEGGPSCSTNNEEFAFRKRADGGYTVAYGLRTHA
FT                   DLTPDSFRLFFKYIEALKSQMGSLQIHIGKRFFDELKRPRRWSLSESTVFEHVRTLDPD
FT                   PMVAYVDKGLKAFTETFPQFSGARIAQRWAGYIDVTPDAIPVISHVARVPGMFIGTGFS
FT                   GHGFGIGPGAGRLMADLVNGDAPLVDPHAFRLSRFSDGSKITIDAGF"
FT   gene            complement(12721..13518)
FT                   /locus_tag="BC1003_3541"
FT   CDS_pept        complement(12721..13518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3541"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: bpy:Bphyt_6339 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3541"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59484"
FT                   /db_xref="GOA:E1THI0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1THI0"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADN59484.1"
FT                   /translation="MNAFLQNFLDWPLLVESLPALIGTGLVNTLILSVISTALGIVAGM
FT                   ALALCAVSHTRWLTWPVRVFVDIFRGLPAALVILVVGQGLAPVGLLVFGPNPYPLAIVA
FT                   LALVSSAYIAEIFRSGIQSVGRGQMSACQALGMTYWSGMRHVIVPQGVRRILPALANQF
FT                   ISIVKDSSLVYFLGLLTSQRDLFTIGQNAAVNTANLSPLVAAGAVYLLITVPLTHAINH
FT                   LDRWTNRFINPVARQQKASRAARLVRHEEALQSRTAAVAERRP"
FT   gene            complement(13573..14385)
FT                   /locus_tag="BC1003_3542"
FT   CDS_pept        complement(13573..14385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3542"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: bpy:Bphyt_6340 extracellular solute-binding
FT                   protein family 3; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3542"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59485"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E1THI1"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADN59485.1"
FT                   /translation="MRLLRLARQLAVAASFLVGATTAAHAADDVGTLTPGKIVAGVDAN
FT                   NKPYSYIDNGKMTGFDVELVRAIAAKLGLTADFRAQDFAGLLPSVANKQVDLAAGSISI
FT                   TKERLKMVDFSEGYLTGLLSVGTLPDSPIGAEVASVKGKRIGVVQGTIEDTYSQSYLPG
FT                   AQIVRFPNINAGFLALRNKYIDGYFIDKTLLEGLQGKYPDLKLADRLDISASNLPAGFP
FT                   IRKGNVKLEAAINKAIGELVADGTWLKLYQQFNPGYPKPDPMPPYAMK"
FT   sig_peptide     complement(14305..14385)
FT                   /locus_tag="BC1003_3542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(14419..14604)
FT                   /pseudo
FT                   /locus_tag="BC1003_3543"
FT   gene            complement(14699..16024)
FT                   /locus_tag="BC1003_3544"
FT   CDS_pept        complement(14699..16024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3544"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bpy:Bphyt_6342 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59486"
FT                   /db_xref="GOA:E1THI2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1THI2"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADN59486.1"
FT                   /translation="MRPDALLFHETFRCTPYWWDAAPPEVAPEPVPAKVDLAIVGSGYC
FT                   GLSAGAEAAKRGARVAILDAAEIGAGASTRSGGMVSSGQKLALTDAIRGVSAERLTRLM
FT                   QESMASFDYMKQIVADESLDADLRITGRFFGAYTPAHFNVLRRQGQLLREKTGVTVHLI
FT                   DRDAQRGIIGSDYYYGGILIDEYGGLHTAKYHRALRHLARRRGATLHSHAAVKRIEPTG
FT                   NTGFRVHTARGVLDAERVLVATNGYTGALLPFFSRRVLPVASYQIATEPLPEGLMHVLN
FT                   PGHRMVSDSKRNLFYARPSPDGTRMIFGSRPAIREIDEREAARRLYAQLVQLWPALRDV
FT                   RVTHAWKGFVAMTGDRLAHIGQHDGVHYALGCNGNGVALMSYLGHRIGKHMVGVDQDVG
FT                   AFGEGAFPLSGAGMASMLAVPVGSALYRIGDMWHGRVRAALS"
FT   gene            16175..17077
FT                   /locus_tag="BC1003_3545"
FT   CDS_pept        16175..17077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3545"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_6343 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3545"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59487"
FT                   /db_xref="GOA:E1THI3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:E1THI3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN59487.1"
FT                   /translation="MNLRQVEAFRLVMLRGSMTAAAEELGTSQPSISRLIAELEAATGL
FT                   TLFVRNGGRIHATDAGSAFYREVERSFVGLEKLQHSAREILELGSGRLRIVAAPVLALS
FT                   FLPAVIARFADAHPRVAVSLEMRSESTIQRWVSSGHCDLGFATTTPDAFGVTSAELYEL
FT                   AGLCALPACHALAARTRIRGADLRGERLILPSYADDTRAALDRALRPAGADQVPAIETP
FT                   YGATICALVMRGAGVGIVNPLVTVDADPTRIVFRPFAPEIWFRGFTLYPQTPRGNPVVG
FT                   AFLELVDEEMAALRRGAQV"
FT   gene            17074..17217
FT                   /pseudo
FT                   /locus_tag="BC1003_3546"
FT   gene            complement(17221..18165)
FT                   /locus_tag="BC1003_3547"
FT   CDS_pept        complement(17221..18165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3547"
FT                   /product="amidohydrolase 2"
FT                   /note="KEGG: bch:Bcen2424_5389 amidohydrolase 2; manually
FT                   curated; PFAM: amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59488"
FT                   /db_xref="GOA:E1THI4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1THI4"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADN59488.1"
FT                   /translation="MSIKDLSRRGFLELACASVAAAALPRAATAGQTWSSGSERPSFSL
FT                   PENAVDCHMHIYDDRFPVAPGTRLRPPNATVEQYRQLQERLGMRRNVVVTPSTYGTDNR
FT                   CTVEALKRFGNDARGIAVVDTSVTGQELQALNSAGVRGIRFNLSYPGATTLEMLAPLAE
FT                   RIASLQWHVELVVQGERLPQLERHLAALPCPLVIDHIAHVPQPGGASSEVLRTAQRLVE
FT                   KGNTWITLSGPYVDSKTGAPRYEDVAPVASAFIAMAPERMLWGTDWPHPTQTTGKPDDA
FT                   SLVDLIASWIERPEWQQMIFVTNPTKLYGFDAA"
FT   sig_peptide     complement(18073..18165)
FT                   /locus_tag="BC1003_3547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.974 at
FT                   residue 31"
FT   gene            complement(18162..19478)
FT                   /locus_tag="BC1003_3548"
FT   CDS_pept        complement(18162..19478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3548"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_6035 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59489"
FT                   /db_xref="GOA:E1THI5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1THI5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59489.1"
FT                   /translation="MSIASNATLEHQTMRKVIWRLLPFLMICYLMAFIDRGNVGMASLQ
FT                   MNHDIGMSAKVFGFGASLFFVSYFICEVPSNLALEKYGARVWIARIMITWGLVSAATAL
FT                   VHNATTFYILRFLLGAAEAGFAPGVLLYLSYWVPKAYRARVVATFMVSIPAASFIGSPI
FT                   SALLLQMDGLAGLRGWHWLFILEGLPTVLLGIACLFMLTDKPAKATWLNEDERTWLLGA
FT                   LAAESAQPKKVAAMPLTRLFRNRYVLCLALVDTCASAAGSTLSVWQPQLLKSYGLSVLQ
FT                   TGMLNAVPYALASILMIFWGRHSDRTKEHRWHTVVPMLMIGGGLFATSLSGSLLPTVCM
FT                   LCSVLIGAYAFKGPFWALASDMLSNSTIAAGLATVNAIANLLGGGLMVNVYGWVKEATG
FT                   SYSLALMPLGILTLVSVATLLILTRKGQSGRVVGKTEAA"
FT   gene            complement(19493..20731)
FT                   /locus_tag="BC1003_3549"
FT   CDS_pept        complement(19493..20731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3549"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_5391 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59490"
FT                   /db_xref="GOA:E1THI6"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1THI6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59490.1"
FT                   /translation="MTTAVKQPGWIGRLFPALNEAPLRRYLSGQVASVLGSWTQNVTLN
FT                   LLVYHLSGSAAILALLNFLLYGPQLVVAPVAGSRIGAENARRVTLCVLTASLVMTGSLI
FT                   TLSALNVLNVPLILAHALAIGISSAIEVPARQVLLLTSLRDASLTSNAVAMNTMVYNVG
FT                   RMVGPTIAGFVYPSLGPRASFAIYALALCFMAICVRSIRLSSDVRASRPESSLRDAVGY
FT                   VMSDAFSARYLPILACIGLFAASYQTLVPLLADRAFHDAARFTGVFFACAGAGSLSSAV
FT                   LLSSALGPRASARFIAWAPWTAILALMVLATTNAVTASMPAFYALGFSLTFAATSTNAT
FT                   IQRRCPEHVRGGLVGMYGMAYNGTMPFGYLLVGTVSEALGVRHTFAAMAAVLALGIVSI
FT                   VAWQRFKLQREGA"
FT   gene            complement(20728..22002)
FT                   /locus_tag="BC1003_3550"
FT   CDS_pept        complement(20728..22002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3550"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_6033 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59491"
FT                   /db_xref="GOA:E1THI7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1THI7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59491.1"
FT                   /translation="MKTSADLTAGAIGHEEEGKRYKDITRVEWRSLSLAGLGWTFESYD
FT                   SFLLSLLLPTLALQFGLTKAQLGLFTSITAAGQILGGILFGYVSDRLGRVRTAMLCIAI
FT                   YSLFSGLLAFAPNEHWFAAIRFCGALGMGGTWTAGAALIAETWHASRRGKGGALMQMGL
FT                   PIGAILAITISGIVSGINDGLAGGGWRVLFLIGALPFFILFFVARKTPESPIWLERKQA
FT                   QAQARKVAVDAKLNVRGLLTAFTFIFFLQYLYWGVFTWTPTFLVTVKHLDFVHSLKFVL
FT                   ALQFGAISGFLLFSAFVDRLGRRPMFMAYLLVGAAAVFGYILSSNALVLMVAIFFTGFS
FT                   VNGIFAGAGPFLAEIIGNTASRGFLMGLAYNGGRLGGFIAPLVIGTLATNAGGFVLGLS
FT                   TTIVAFIAAAIVVYFAPETRGKTLV"
FT   gene            complement(22002..23045)
FT                   /locus_tag="BC1003_3551"
FT   CDS_pept        complement(22002..23045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3551"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bph:Bphy_6032
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3551"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59492"
FT                   /db_xref="GOA:E1THI8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1THI8"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADN59492.1"
FT                   /translation="MQIVHAPHLPVREEWLALHREPILEPDLPIVDAHHHLWDRQSGRY
FT                   LTDEFAKDVGSGHRIVSSVYVQCRSMLRQHGPAAMKPVGEVEFANGIAAMFASGAYGPT
FT                   KACDAIVGGADLALGDAIAPVLEAMLHVTGGRLRGIRNPLAWHASPDVSSSPVTPPRDL
FT                   MSNPGFRQGVKTLAHYGLALDAWVYHTQLTQLYELASAAPDVTVVIDHFGGPLGVGPHA
FT                   NSREQVAAEWRQQLARLASLPNTRIKLGGAGLNVFGFAFASRATPPSSEELAAAWRPYF
FT                   ETCIELFGAKRCMFESNFPVDKGMFSYAVLWNAFKRLAHSMSADEKTALFSGTAAAAYR
FT                   LRLSGDE"
FT   gene            complement(23059..24210)
FT                   /locus_tag="BC1003_3552"
FT   CDS_pept        complement(23059..24210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3552"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bph:Bphy_6031
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59493"
FT                   /db_xref="GOA:E1THI9"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:E1THI9"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ADN59493.1"
FT                   /translation="MSVKKAHKKANLKTSLALGTVAVASISFAPGAARAQSSVTLYGIA
FT                   DVGIEYLNNTSAGGSQVREVSGNLSGSRWGLKGVEDMGGGLKALFNLEAGFNINDGTSS
FT                   QSTRGLGTNPTTTSRLFGRQAWVGLSYKGQQLTFGRQNALIYEQSVTFDPMGVSSRYSA
FT                   LSLDYALAARIDDSAKYTGKFGPVTAQAMYSTRYDTGYGAEVPGAPTTGRFFSGALTYS
FT                   SGPLAATAVYEQRNSNTLTTATSTERRVLAAATYNFGPVTAYAGYRYLRASNAFLPANP
FT                   IRVANGSDANAANLYWLGMQYLITRSFQLTAVGYYHDVHSTGADPWLAVVSADYFLSKR
FT                   TDLYATVGYAHNKDNSALGVNGYGTVAPGRNQTGVTIGMRQKF"
FT   sig_peptide     complement(24103..24210)
FT                   /locus_tag="BC1003_3552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 36"
FT   gene            complement(24254..25633)
FT                   /locus_tag="BC1003_3553"
FT   CDS_pept        complement(24254..25633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3553"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_6030 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59494"
FT                   /db_xref="GOA:E1THJ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1THJ0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59494.1"
FT                   /translation="MNLSQTMDKTRAARSTNATGGSTLASEDFDASERTLAKAFRRILP
FT                   FIFLCYVVSYLDRTNVGFAALTMNKDLGLTGEQFGLAAGLFSIGYFLFEIPSNLIMQRV
FT                   GARVWIARIMITWGVCSMLTAFVVGPKSFAAARFLLGIAEAGFTPGIYLYFTHWFPGKW
FT                   RAKVTAAFLVGIPVANMIGSPISGALLQLGGLHGLKSWQWLLLIEGLPAVLLGIACLFI
FT                   LADRPDKATWLSDEEKSTLARRLAAEQRDIGSKHGSKLRDAMTNWRVFVLAFVNFCGIV
FT                   GSVGVGLWMPQIIKQFGVTHSVVGWLASIPYLIGAFTMLWWARVANKSQKRVPYVAGAL
FT                   LVAAAALACSALTDVPLLKLIALCFTVSGILAFQATYWAIPSSFLTGRAAAGGLALIVS
FT                   VGNLGGFAGPSMIGALKQMSGGFTLPLLAVSAVLLIGALTIAWLGDPGANAGEAGAATT
FT                   K"
FT   gene            complement(25715..26641)
FT                   /locus_tag="BC1003_3554"
FT   CDS_pept        complement(25715..26641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3554"
FT                   /product="SMP-30/Gluconolaconase/LRE-like region-containing
FT                   protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like
FT                   region-containing protein; KEGG: bph:Bphy_6029
FT                   SMP-30/gluconolaconase/LRE domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59495"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:E1THJ1"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADN59495.1"
FT                   /translation="MFYLTSPEVREAQVFTRMPDKYRKPDARSDWARANRGGMTTDSFL
FT                   EGPVWDPRGHLYVTDIPYGRIFRISPSGEWDLVAQYDGEPNGMKLFDDAHLLITDYRNG
FT                   LMLLDIERGEVKPYLERRNSERFKGVNDLTFDSHGNLYFTDQGQSGLHDPTGRVYRLAP
FT                   DGKLDMLLGNCPSPNGLVLSTDEKVLYVGMTRGNCVWRVPLQADGSVSKVGQFFTSYGP
FT                   SGPDGLTIDAEGRLFIANPGLGRVWVLNRRAEPVEILTAQEGVSLTNLCFGGADMKTLF
FT                   MTESTNGLVLKADMTVPGPLPKRAKNN"
FT   gene            complement(26662..27609)
FT                   /locus_tag="BC1003_3555"
FT   CDS_pept        complement(26662..27609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3555"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: bph:Bphy_6028 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59496"
FT                   /db_xref="GOA:E1THJ2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1THJ2"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADN59496.1"
FT                   /translation="MDTNVRKPVVLVTAADLAPQALERLDAFEVVFAGKQPTEDDIVAL
FT                   CERTKPVAIIVRYGKINARIMDAAENLQVISKHGSGIDVIDQEAAAARGIAVRAAVGAN
FT                   AAAVAEHAWALILACAKSVPQLDLRMRAGHWDKSTHKSFELDGGTLGVVGLGSIGRRVA
FT                   TIGVAFGMKVLAFDPFAKEAPHGVTLASMEQIYAASDVLSLNCPLTDENRNMINRDTLS
FT                   RMKRGAILVNTARGGLIDEAALVEALASGQLRSAGVDSFAVEPMTHPHPFQSVPNLILS
FT                   PHVGGVSEAAYVNMGKGAAANVIAVIEESAHKLA"
FT   gene            complement(27609..28301)
FT                   /locus_tag="BC1003_3556"
FT   CDS_pept        complement(27609..28301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3556"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   bch:Bcen2424_5398 dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3556"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59497"
FT                   /db_xref="GOA:E1THJ3"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:E1THJ3"
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /protein_id="ADN59497.1"
FT                   /translation="MSIDTNQPIIRDIERVSPQLVEAAARFQAAILADVAGRRGTLHGR
FT                   VKPLSPKMKVAGPAITVEVRQGDNLAIHAALAVAKPGDVIVVDGKGDVSCALLGEIMAT
FT                   QAKVSGIAGIVIDAAVRDAHELANGDYPVFSAGLNPCGPTKSVAGLVNHPISAGGAAVN
FT                   PGDLIVGDADGVVVIPRADVARIVELAQKKLDMETARIAAIHKGDVRPGWLDKELRAAG
FT                   MLAEGEAL"
FT   gene            28467..29189
FT                   /locus_tag="BC1003_3557"
FT   CDS_pept        28467..29189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3557"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: bph:Bphy_6026 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59498"
FT                   /db_xref="GOA:E1THJ4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1THJ4"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADN59498.1"
FT                   /translation="MGNDGVVAVERALGLLDCFRLGKEKLSLAALATASGMHKTTVYRL
FT                   MNSLERMGYVVRSDDGMYGLGARVLYLGKLYEQSFHLSSVVEPVLFSLAAATKESASYY
FT                   VLDSNKRLCLFRAEPSEGLRETRLAGTSLPLDDTAIGQVIRYWGLREPIFSEPPQIPLF
FT                   TSGARDVHTAAFATPVFGADEEFMAALTLSGPASRLSVARETGELIAPQLQAASDLSRR
FT                   LGASAAFCERMYGAGERR"
FT   gene            complement(29201..29929)
FT                   /locus_tag="BC1003_3558"
FT   CDS_pept        complement(29201..29929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3558"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: rpc:RPC_2721 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; SMART: regulatory
FT                   protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3558"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59499"
FT                   /db_xref="GOA:E1THJ5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1THJ5"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADN59499.1"
FT                   /translation="MKPADKEAEPVDRSVAAVDRTLSLLEAFLGKPGGRSLSELEERTG
FT                   LFKSVILRYMLSLEARGFVHKEPSGAYRLGVKAAQLGRAFESSVELVSTLRPFVERLSE
FT                   RTGSSASVYVRDDDCRVCLLRAEPERDVRVSIRAGTRRPMDKSASSLAFRRFERETVQA
FT                   FEAAGVAGVASSAGVGDPLLASMAAPLFGIDDAFVGVLTLSGVIGHFNVDDKRVRSLLF
FT                   EEALAASALLGATLTEHGGN"
FT   gene            complement(29926..31158)
FT                   /locus_tag="BC1003_3559"
FT   CDS_pept        complement(29926..31158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3559"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: bpa:BPP2925 putative L-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59500"
FT                   /db_xref="GOA:E1THJ6"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:E1THJ6"
FT                   /inference="protein motif:PFAM:PF01070"
FT                   /protein_id="ADN59500.1"
FT                   /translation="MKAEQIKHSPAQPVPNALRRYLSLDDFEIAARRHLPRPIFGYISG
FT                   AAERNASLDDNQRAYSEYRFVTRVLRDVSRRTQATTLLGKTYRAPFGIAPMGISALSAY
FT                   RGDLVQAQAAREAAIPMIMSGSSLIPLETVAKEAPDTWFQAYLPGEPEKIRALIERVER
FT                   AGYDTLVVTVDTAVLANRENNIRTGFSTPLKPSIRLAWDGVTRPRWLVGTALRTLVKHG
FT                   MPHFENSYATRGAPIFSGRVVRDFGAKDHLNWTHVRQIRSQWKGKLVVKGIMAAEDALA
FT                   ARDHGVDGIIVSNHGGRQLDGTAAPLRVLPRIADAVGRDMAVMIDGGIRRGTDVLKALA
FT                   LGADFVFVGRPFNYAASVAGKAGVAHAIGILHAEVQRNLGLLGLNSIDELSPDVLIRLP
FT                   EGAAASGSASQ"
FT   gene            31409..32428
FT                   /locus_tag="BC1003_3560"
FT   CDS_pept        31409..32428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3560"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="KEGG: bac:BamMC406_3921 aliphatic sulfonate ABC
FT                   transporter periplasmic ligand-binding protein; TIGRFAM:
FT                   aliphatic sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59501"
FT                   /db_xref="GOA:E1THJ7"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:E1THJ7"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ADN59501.1"
FT                   /translation="MNKRDESIAPSPTDPDRRQLLRRAGAGVAGAALGGLLTPLAPFAT
FT                   SAARAQGTNNRLRIGFQKYGNFVVLKARGTLEKRLASQGVSVQWLEFPAGPQLLEGLNA
FT                   GAVDVGSVGETPPIFAQAGGVDFVYIGNEPLAPRGEAIVVAQDSPIRTVAQLRGKKVAL
FT                   NKGSNVHFLLVKALQQAGLAYTDIHPVYLTPADARAAFVQGSVDAWVIWDPYLAAIERQ
FT                   TNARTLANGDGLVRNIQYYVAARKFASAQPQALHALLDEVNDVDAWARENVAQVAALLS
FT                   PLVGLDQSILEVALKRTGYGVQPITEATLAYQQQIADAFSALKLIPGKLSLADARWKS"
FT   gene            32649..34127
FT                   /locus_tag="BC1003_3561"
FT   CDS_pept        32649..34127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3561"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_C0113 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3561"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59502"
FT                   /db_xref="GOA:E1THJ8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1THJ8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59502.1"
FT                   /translation="MSTIAIASAIADDSSQQSPAPTVIRSAQDVSRIVNAGAAKGSNAR
FT                   IVIAIALGGVFLDAYDLTSLAYGIKDIAKQFALTPVQVGFVSSAITFGAILGALFGGYL
FT                   TDRIGRYRVFMADMLFFVVAAIAAGLAPNAWVLGAARFLMGFGVGLDLPVAMAFLAEFS
FT                   RVAGKGNKAASVAAWCPAWYAATSTCYLLILGLYAILPQHQLGWLWRLTLAFGAVPAIA
FT                   IILVRSRYISESPVWAANQGDLEGAARILKRSYGVDATVERTSAPVAQPRRASWRNYGV
FT                   LFNATYRKRTILAAVIGSASSFGYNAIIFGLPVIITSFFAQGPLTTIVASLALNLLFAF
FT                   VGGLIGVRTAPTAGAWKMTVLGHSLQFASLIGLALIGKPSGGGLVIVAILLLGGYLFGQ
FT                   GFGPGSHSMTYASLSYPTSLRGIGVGFNQTLVRTASTISLFLFPVLAAALGTKVFWVIA
FT                   IAPLSSLLVLLAIRWEPSGYDIDAEDYRDARASA"
FT   gene            complement(34314..35075)
FT                   /locus_tag="BC1003_3562"
FT   CDS_pept        complement(34314..35075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3562"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rcu:RCOM_0266630 short-chain dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59503"
FT                   /db_xref="GOA:E1THJ9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1THJ9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59503.1"
FT                   /translation="MKLSGNTIFITGGTSGIGRALAEAFHQRGNKVIIAGRRKALLDEV
FT                   AKANPGIDVIELDIADGAQIQQVARELIGRYPTLNVLINNAGIMPFDNAGSALDDARAV
FT                   HLINTNLLGPVRMSAALVEHLKQQPESTIINNSSVLAYVPLAATALYSATKAAIHSYTM
FT                   SQRFMLRDTSVRVLEIAPPWVDTDLVHKSGDPRAMPLDAFIAETMDKLATATHEVLVSA
FT                   AKPLRDNVGPGEYAFFDQFNLSLKDNPIPVA"
FT   gene            complement(35119..35919)
FT                   /locus_tag="BC1003_3563"
FT   CDS_pept        complement(35119..35919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3563"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bcj:BCAM1433 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3563"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59504"
FT                   /db_xref="GOA:E1THK0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1THK0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59504.1"
FT                   /translation="MAQGHAGTAVITGASSGMGAIYAERLARRGYELILVARNRERLAA
FT                   LASRITTQTQRSVEILDADLGTQAGLSVVEAKLKQDATITLLVNNAGVGTHTPLVDSDV
FT                   DAMSRMVDLNVTSVMRLTYAAVPGFLSRGKGAVINISSVVAIAPEALNGVYGASKAFVL
FT                   AFSQSLQHELAGKGIRIQAVLPGATATDFWQTGGLPLENLDRSIVMSAEDMVDAALVGF
FT                   ERGELVTIPSLHDVAKWEAYENARRAMSPLLSTNVPAPRYTTIH"
FT   gene            complement(36079..37080)
FT                   /locus_tag="BC1003_3564"
FT   CDS_pept        complement(36079..37080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3564"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bcm:Bcenmc03_5075 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; ThiJ/PfpI domain-containing protein;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59505"
FT                   /db_xref="GOA:E1THK1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1THK1"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN59505.1"
FT                   /translation="MFSDTTARASMHRIGYFLTDDFQVMAIGTQTVFEIANIVAREPIY
FT                   HVTNYSLQGGEIRSSLGVSVITRPADSNATADTWMVSGVANPTGRTTNAEALRFISGAA
FT                   ARSRRTAGLCTGAFVLAEAGLLNGKRATTHWAFAEALQARWPLIQVEADRIFIVDGAIW
FT                   TSAGLTAAMDLALGLVEKDLGADFAIRVARAMVMPHRRSGGQSQHSEMLALAPKSDRIQ
FT                   KALEHARLNLSKPLRVDDLAKAAHLSSRQFTRIFLSETGISPAKAIERLRLEEARNLIE
FT                   RGRHSLETIARETGFRDRRHLREVFTRAYQMTPQSLRRESRNVTGDDHRIDE"
FT   gene            37316..37765
FT                   /locus_tag="BC1003_3565"
FT   CDS_pept        37316..37765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3565"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: rcu:RCOM_0013880
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59506"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:E1THK2"
FT                   /inference="similar to AA sequence:KEGG:RCOM_0013880"
FT                   /protein_id="ADN59506.1"
FT                   /translation="MSPPNDDEIIERALIMLLRPTPLLSTLPLERTAKKQMRRARLPAP
FT                   RADHWAEWTPPPARIVVQEVLSANTLSIYWSDSQTGHYAEQIWRLGLAREDGFCALSGR
FT                   PIRPGDDVFSPRRSMTFIPANWRRMILASDVIARFASTRLERAAA"
FT   gene            37908..39557
FT                   /locus_tag="BC1003_3566"
FT   CDS_pept        37908..39557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3566"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; cyclic nucleotide-binding; KEGG:
FT                   bcm:Bcenmc03_5081 cyclic nucleotide-regulated FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59507"
FT                   /db_xref="GOA:E1THK3"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1THK3"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADN59507.1"
FT                   /translation="MTSSTWLAPATDRHEQKYPQLTDAEIARLRQYGVVRSWTSERIFE
FT                   VGAPGFGMCVVLRGMIRVTSRDAFGRLAVVSENGPGHFVAEVGQLSGGRCIVDGDAVGD
FT                   VSAIHIPPDRLRALLIAEAELGERIMRALILRRVALIERGNGIVIVSQPHNARLHALQS
FT                   FLRRNNVPHAVIGASSEDDETARYVAKWVRDDSDYPLVLHPDGTILRAPDEAELANALG
FT                   WLPDFDPEHVYDVAIVGAGPAGLAAAVYAASEGLKVSVLDHSAPGGQAGASARIENFFG
FT                   FPTGISGHALTARAYVQAQKFGADVAIPAQAEHLDCGITPFALRLSSAVTIRSRTIVIA
FT                   SGAAYRRPDIQGLERFEGRGTYYWASPVEAKLCAGQDVLLVGGGNSAGQAAVYLASRAR
FT                   RVRMLVRGKSLKASMSQYLIDRIAALDNVEVTYGTQITALRGTTTLEEVELLSGTQRSV
FT                   VSAEHVFLFTGASPNTSWLGGCGVAVDKNGFVLTGEAAGPGLQEHETSVRGVFCAGDVR
FT                   STSTKRVAAAVGDGAAVVAQIHRHLERSVAQA"
FT   gene            39847..41697
FT                   /locus_tag="BC1003_3567"
FT   CDS_pept        39847..41697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3567"
FT                   /product="peptidase C11 clostripain"
FT                   /note="PFAM: peptidase C11 clostripain; KEGG:
FT                   bgl:bglu_1p0890 peptidase C11, clostripain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59508"
FT                   /db_xref="InterPro:IPR005077"
FT                   /db_xref="UniProtKB/TrEMBL:E1THK4"
FT                   /inference="protein motif:PFAM:PF03415"
FT                   /protein_id="ADN59508.1"
FT                   /translation="MRFHCLWRAGMALALSAALASCGGDIQSSSPGPAANNTTLMVYIV
FT                   GSDLESEGGEASGNIADMLKAQLPAGSHVVIETGGAAAAGADDSHVKDWKDVQRHVIGQ
FT                   SGKLETVAHLGEIDMADSTALSDFIGWAHDTYPAAHYRLVLWNHGSGWSGYGYDENFSN
FT                   DHFTLPTLTTALAVANARSGVHFDLIGFDACLMAAVEASDAISPYADYLLASEELEPGS
FT                   GWDYTQVVRTLATDAVSYGKGIIDSYVERHSDTPTATLSLVDLSKVGAVRTALTSFTNA
FT                   IAPIASDPQSWPALGAARRLAPSFGMNGARQHDEVDIAGFADLTARAGIALDASKALAS
FT                   AARAAVVYVKNGEAFPDAAGLSVYFPTASSLSSYLQTAYAQTHFDPAYIAFTGSYVAAV
FT                   NALPHAISIDTSASVPGYLVAQIAADDAVASVDATLVSAVAADGTLTVAGTMPVIIPET
FT                   VDDMLPRMTQRVPLSGNWLTLNGYPVIIGELARTGITNSGDTLYGIPLDVDGTAEYLVA
FT                   SRDAAGTWTLLGMTEDTSVNPFSPRLEPLPGPDAQIRTLAASYNITTQSFGDLSAASPA
FT                   FSGGALTLAMTALPAGTYREGVLVTNLVQQAQMSSLVARP"
FT   gene            41763..43547
FT                   /locus_tag="BC1003_3568"
FT   CDS_pept        41763..43547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3568"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: TAP domain protein; alpha/beta hydrolase fold;
FT                   KEGG: TAP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59509"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1THK5"
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /protein_id="ADN59509.1"
FT                   /translation="MKRLFPIALLIAVLAALALSGCGGDLQENDPLASYKSQHIAWQPC
FT                   SATQTAGLDTLDVAALGADLSCGELAVPEDYDHPSAGDIRIGVMRVSALVPSQRLGAIV
FT                   FNPGGPGGDGYSLGAQIASVARLANPSSGGYRAVYDLARKYDFVGFSPRGVGFSTRLEC
FT                   TLGKPLVHTNYLPADMSNENINNALANMKVVADACRDVPFARFVNTDATARDMDVLRAA
FT                   LGEAKLNFIGYSYGTLLGAWYASLFPQRAGRMLLDSVVDYDVPMPLQSQAVAEQTAYDD
FT                   ILSLYALTMADQVAIPNTIEGIRGLVTATPDWAKSYFAGLMYQVAPHRGKIGLVVPLMA
FT                   AETAVIQVAASHPSVEQYRAALTQYLYSPMDTTIDGAAREAALGTVDTYQAYLTNHYVV
FT                   DNASDLPWVNFTVRCSDAPVPSSPAYWIARAVAIVKVAPIHDSSDINNPCMFWGPVTVQ
FT                   KPALANAARTASPLLLLQSEYDVLTPLPGALATFNDMPHASMIQVQGEYTHGLFPYGTS
FT                   CVDASVANYFLSGATPARNTSCAGIAIQGVPQATLSAATAVAHSATDDAPLFTDPVAAK
FT                   RLLERIHDTVGQAQPAAF"
FT   sig_peptide     41763..41834
FT                   /locus_tag="BC1003_3568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.547 at
FT                   residue 24"
FT   gene            complement(43735..44514)
FT                   /locus_tag="BC1003_3569"
FT   CDS_pept        complement(43735..44514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_4461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59510"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:E1THK6"
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_4461"
FT                   /protein_id="ADN59510.1"
FT                   /translation="MMRRWLAQPLNVHRAPPWATEYERTASVQWQEGVARICNVRHFVY
FT                   RTRDDFTPAWYDASYDLDALCSVDLVMSRWAGESVAHVFVSFGFADGRYLAVSIETRRR
FT                   SDQRYSALGGFWRNYGLIYVVADERDLLGVRTDVRRERVCLYRVQMPDEAKRALFAGYL
FT                   QRVEALNRRPEFYNTLFNNCTTNVLGHARAIAPHLRYDWRILLSGHADDYAYRMGLLDS
FT                   STPFECLKARSLIRRPADAQIDEAYSRAIRERLFSIS"
FT   gene            complement(44511..45080)
FT                   /locus_tag="BC1003_3570"
FT   CDS_pept        complement(44511..45080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_2g13270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59511"
FT                   /db_xref="GOA:E1THK7"
FT                   /db_xref="UniProtKB/TrEMBL:E1THK7"
FT                   /inference="similar to AA sequence:KEGG:bglu_2g13270"
FT                   /protein_id="ADN59511.1"
FT                   /translation="MEKFTHVRIVMGMIVSLGLTHMLKGLSSAIQHPGKTRIYPVHMAW
FT                   VASMVLYILHFWWWEFSLREIAQWTFGIYLYLLFYAFIIYLLCSMLFPDSLKEYDGYED
FT                   YFMSRRAWFFGLLFAVSLVDVGDSVIKGEVHLSRLGDLYWLRTAMVAICCLVAIRTRSR
FT                   LFHTSFVALNLAAQVLLIVHSYWSDA"
FT   gene            complement(45088..46392)
FT                   /locus_tag="BC1003_3571"
FT   CDS_pept        complement(45088..46392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3571"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_2g13280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3571"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59512"
FT                   /db_xref="GOA:E1THK8"
FT                   /db_xref="UniProtKB/TrEMBL:E1THK8"
FT                   /inference="similar to AA sequence:KEGG:bglu_2g13280"
FT                   /protein_id="ADN59512.1"
FT                   /translation="MIQLLLLLLGPRFAVRHLPKLLAFGAIWLAIGAIVVVDALDGALW
FT                   FPLQTFGVLLLAEGIAALVLARSGISLQTGFRYVKGAIGVLIGVLVIARHSYSDFLLAM
FT                   LFGAGFALEGCLLIAAAWIVRYRHWRSTIAIGVFSLVLAVIFFQPYPTHYRGTVPYCIG
FT                   MWLVVSGVRMIWLYRRLRKSGYGRDCATAPACADTGAVEAIKDSPMVVHVWTPVGSSKN
FT                   AAVRRPVIDRYIAAVDINGVISTGHAALEAGNLYLSLYPAVEIDRSPDEFARLLRADSS
FT                   NDVRGRYLPSYPEEAAAWCDSTMKIAFRRYDAARLVAFATEYKATEIYNLTNRNCSSTV
FT                   AEAVDAALEGSEYRNGGWRDVLRLIVLPELWIAAQLRHRAQTMAWTPGLVLDYARALRV
FT                   VSQPPAIGWIALAALAWRQSRRARVTHNANNAEQR"
FT   gene            complement(46389..47171)
FT                   /locus_tag="BC1003_3572"
FT   CDS_pept        complement(46389..47171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3572"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgo:TGME49_084800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3572"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59513"
FT                   /db_xref="GOA:E1THK9"
FT                   /db_xref="UniProtKB/TrEMBL:E1THK9"
FT                   /inference="similar to AA sequence:KEGG:TGME49_084800"
FT                   /protein_id="ADN59513.1"
FT                   /translation="MKKAVLADAVGGVVLTVFVTAVLTGLHAQVGGNHGIVNFLGSAEL
FT                   PIVASVLMLDSLREAIGSIYEGEHRQNIFVAGIVLFVVALLLASKGVDIEVARHRALED
FT                   AVLGATAVTQMPAAQQYAWLHSAEQALPLPVWVVPANVLVWVAAIAVSIWNRALAIGEK
FT                   ERSISRENVEAFVRLLDESRRGDAVVTALLEDERRARAELERDHGAPGAEERESVRRRR
FT                   DAQRRHQRALDALQLCLRRDLSQRETEHHVQPAVCEQK"
FT   gene            complement(47547..48659)
FT                   /locus_tag="BC1003_3573"
FT   CDS_pept        complement(47547..48659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3573"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: pfl:PFL_1360 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59514"
FT                   /db_xref="GOA:E1THL0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1THL0"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADN59514.1"
FT                   /translation="MTRRAGVLQPSNTAKAKHRPAAPRDAVPVDAPGSDNRVDTLTEAD
FT                   SRLRYRVIHDQLKSAIALGKIPPGLVLLEGPVARIFGTSRVPVRKAFEMLHAGGLLVTF
FT                   EGRGFLAASPDGSVPEPLRTPISEDMLGFDRPPEPLDIPSNSERISDSLESAISLGIVF
FT                   GHFRIDESIAAESFGVSRGTVREVLSRLRDRGLVEKSAYSHWLCGPLTARAVREDYELR
FT                   RLLEPAALAASAQSLSRAQLEAALEEVQGAIARPDSVDAGALYRLEATLHQTLLAGAPN
FT                   RKLLAAISHAHIPLIVNHAFYDAFGLHPETSMLLEHRTVIELLLRGEFDAAARALAQHL
FT                   EHGEARTRQRLKVLAVLPEPDLPGYMQRIA"
FT   gene            complement(48678..49877)
FT                   /locus_tag="BC1003_3574"
FT   CDS_pept        complement(48678..49877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_1368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3574"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59515"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E1THL1"
FT                   /inference="similar to AA sequence:KEGG:PFL_1368"
FT                   /protein_id="ADN59515.1"
FT                   /translation="MQSSKVELRVLGTTVTLQEHIRKRAEQDLGIRLRFIVQDGGAVQR
FT                   DGAMHPDRYELYDQWFHSLDCLWPTHALQPIELARIRRWDEVNALPRTGRIGQAPEPGT
FT                   TDRTGAAGCTPADRLYVQEDGSLGHEPSPRISMLPLTHNADSFVYLEDALPASLAQGEE
FT                   SWAWLLAPELAGRVALQADAAIGAIDAALAVQASGLMRFDDIGNLSIEEIDGLIAILID
FT                   YKRRGHFAGFWSSFAEAAQLMIANKVAIQSIWSPATVELERAGLKFRLARPREGYRAWF
FT                   GGIGISRLAHGRVLDAAYEYLNWWLEGWPGATVARQGFYISNPERSREHMKPDEWAYWY
FT                   DGARASTDLPGPTSKHLVPAGQVRDGGSYVARMSRIAVWDSVMDEHNYLVRRWTEFMRS
FT                   "
FT   gene            complement(49919..50989)
FT                   /locus_tag="BC1003_3575"
FT   CDS_pept        complement(49919..50989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3575"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: dac:Daci_2088
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3575"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59516"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:E1THL2"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADN59516.1"
FT                   /translation="MSLAYDVIPVTIVTGFLGSGKSTLLADVLKGDAARDTAVLVNEFG
FT                   EVGLDHLLIGELDAQTVLLDNGCVCCAIRGELKDALATLFSRRARGEVPAFSRVVLETT
FT                   GLATPAPIVATLLGDSVVSSHYSVGAIVTVVDAVNAGQQRARHAQWLAQVTAADRIVVS
FT                   KVDLVSQAALAGLERSLAELNPAASIARRTCTDDAALVLDSASNLHDFAEFVRRTGSAR
FT                   TDATHAANPLARLNATPAHRDELAALKAFCIEFDEPLDWPVFTLWLTMLLNRHGDNILR
FT                   VKGILALAGATQPVVIHAVHHLVYPILHLDAWPGDGKHEAHRSRLVFIAQGFEGDALAD
FT                   SYRRLCRHLQTAEAIA"
FT   gene            complement(51014..51313)
FT                   /locus_tag="BC1003_3576"
FT   CDS_pept        complement(51014..51313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:pRL120139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3576"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59517"
FT                   /db_xref="UniProtKB/TrEMBL:E1THL3"
FT                   /inference="similar to AA sequence:KEGG:pRL120139"
FT                   /protein_id="ADN59517.1"
FT                   /translation="MCGMCGLLGGGRHWSNSVAPGETAGARRQRYVQVAHANRVLAAFR
FT                   LKLADFHGQSFVLSSPTGAQIIVEDFMQIWKAAETMLGRPLDPLTLFADEEEHI"
FT   gene            complement(51331..52089)
FT                   /locus_tag="BC1003_3577"
FT   CDS_pept        complement(51331..52089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3577"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   dac:Daci_2089 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3577"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59518"
FT                   /db_xref="GOA:E1THL4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1THL4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59518.1"
FT                   /translation="MASMFSLDGRRAVVTGAASGIGAAIALAYAQAGARLVLADLDGKR
FT                   LAAHADACRASGVQVETIVADVGDESGAHGIVDRCIAAYGGIDILVNNAGMLTQARCTD
FT                   LTTQMWDEMLRVDLRSVFLCSRRALPSMTAQRFGRIINVASQLGIKGGAELAHYAAAKA
FT                   GVIGFTKSLALEAAPDNVLVNAIAPGPIETPLVDGISASWKETKSKELPLRRFGRAEEV
FT                   APTAVLLASDPGGNLFVGQTLGPNSGDVMP"
FT   sig_peptide     complement(51997..52089)
FT                   /locus_tag="BC1003_3577"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.593 at
FT                   residue 31"
FT   gene            complement(52124..52879)
FT                   /locus_tag="BC1003_3578"
FT   CDS_pept        complement(52124..52879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3578"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   dac:Daci_2090 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3578"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59519"
FT                   /db_xref="GOA:E1THL5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1THL5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59519.1"
FT                   /translation="MKVALVTGAASGIGQALAVAYAQAGVAVVGGYFSRDAHDPRSTEQ
FT                   AVEQAGGQCLMQAVDVTSADQVEAFALAAMERFGRIDYAVANAGLLRAAPLTEMLDEQW
FT                   HQMLDVDLSGVMRTFRAAARHMQDGGAMVAVSSIAGGVYGWENHTHYSAAKSGVPGLCR
FT                   AVAMELAPRGIRCNAVIPGLIETPQSLDAVNSLGPDGLREAAKGIPLGRVGRPQEIASL
FT                   IRYLTSDDASYITGQSIIADGGLTVRWPG"
FT   sig_peptide     complement(52823..52879)
FT                   /locus_tag="BC1003_3578"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.551 at
FT                   residue 19"
FT   gene            complement(52899..54236)
FT                   /locus_tag="BC1003_3579"
FT   CDS_pept        complement(52899..54236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3579"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pst:PSPTO_4202 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3579"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59520"
FT                   /db_xref="GOA:E1THL6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1THL6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59520.1"
FT                   /translation="MKENPLSASGFKLEQILPSDVKRATVVAFFAWVFAVYDFILFGTL
FT                   LPEIGKHYNWDAAAQAEIATLVAIGTAVIAFAIGPLLDRLGRKAGLLWTVAGAALCSGL
FT                   TVVGGAMGQVPLVLIRSLSGLGYAEETVNATYLNELYSAANDAKLNRNKGFIYSLVQGG
FT                   WPIGALIASGLTALLLPRIGWQGCFIFATFPAIVIFFMTRRLKESPQFLLHQRIKHLRE
FT                   GGQDSEARTLASVHSVDYEEHSRAGLAEAFRGSALRATLVLGGGILLNWSAIQVFSVLG
FT                   TTVLTRVHNVSFENSLLILVLSNVIGYCGYLCHGFIGDKIGRRNTLAIGWMLGGLSFAA
FT                   MLFGPSSAGVVVALYSLGLFFLIGPYSAALFFIGESYPTAIRGTGSSIVHAMGPIGAIL
FT                   AGVGVTWMLNHGGDWLHAALWFGAVPCFLSGVLIFFARHVDPARTK"
FT   gene            complement(54304..55185)
FT                   /locus_tag="BC1003_3580"
FT   CDS_pept        complement(54304..55185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3580"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   dac:Daci_2092 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59521"
FT                   /db_xref="GOA:E1THL7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:E1THL7"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADN59521.1"
FT                   /translation="MAKEILVAFGIDVDAVAGWLGSYGGEDSPDDISRGLFAGEVGSMR
FT                   LLKLFEREKLKTTWFIPGHSIETFPEQMKAVADAGHEIGIHGYSHENPIAMTPEQEEAV
FT                   LDRSIDLVTKLSGKRPTGYVAPWWEFSNVTNELLVKKGIKYDHSLMHNDYHPYYVRVGD
FT                   SWTKIDYSKHPDTWMKPLQRGHETDLVEIPANWYLDDLPPMMFIKKAPNSHGFVNPRDI
FT                   EQMWRDQFDWVYREHDYAVFPITIHPDVSGRPQVLLMLERLIAHFRQHEGVRFCPCDEI
FT                   ADDFLRRQPRQP"
FT   gene            complement(55209..56621)
FT                   /locus_tag="BC1003_3581"
FT   CDS_pept        complement(55209..56621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3581"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: pfl:PFL_1361 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3581"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59522"
FT                   /db_xref="GOA:E1THL8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E1THL8"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADN59522.1"
FT                   /translation="MLSTIYIYVGVKVTFHPSDKPSASDLVAAFKDGSADAETVARQSV
FT                   AQARTCNAAFISVDEQRAIAEARAAAARWREGRPASALDGVPIAWKDLFDVAGSVTTAG
FT                   SALYRERAPATGDAPLVAAAARAGLVCIGKTNLSEFAYSGLGLNPHFGTPFNPAFDASV
FT                   ADGGHRVPGGSSSGAAVAVATGVVPIAVGTDTAGSIRVPAAFNGLVGYRASRARYAQQG
FT                   MIGLSQSADTCGPLARSVADCAAFDAVVGGRDLHRALDDLRGQRFVVPTGWQLRFAVTE
FT                   AVGADFMRFVARLSDAGARVDEVKVGAFDAACDLIATRGWFGSLEAFERYRRVLDSDAA
FT                   ACIDQRVRTRLEMSRDVPASRLAELLEARARLIGQFGAELGDATLLLPTVPHVAPECAP
FT                   LEADPERFARVNLATLSMTMPGSFLDTPAFAMPAGADAAGLPTSVQLMRAQNDDDALIA
FT                   LALTVERTVAPN"
FT   gene            complement(56821..57522)
FT                   /locus_tag="BC1003_3582"
FT   CDS_pept        complement(56821..57522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3582"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: bam:Bamb_1229 GntR domain-containing protein;
FT                   PFAM: GntR domain protein; regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3582"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59523"
FT                   /db_xref="GOA:E1THL9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1THL9"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADN59523.1"
FT                   /translation="MKQTEPKRLYQSVAAQILSLIRQRELTAGTRLPPERELANTLGVS
FT                   RPSLREALIALEIGGQIEIRMGSGVYVRDPEEGDDSAVPALGESPTELMQARMAVEGSV
FT                   IVLAAGKLSAATLDKLRRTVERMKRLAAAGKSPVDADRQFHMLIAETAGNSVLSRFVAE
FT                   MFDSRHDPIAAAIRDHSESPQTWSAAVREHEEILKALQAGDPIAAQTAMRSHLKASGER
FT                   WITDELLRQLG"
FT   gene            57764..59311
FT                   /locus_tag="BC1003_3583"
FT   CDS_pept        57764..59311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3583"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bpy:Bphyt_5471 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3583"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59524"
FT                   /db_xref="GOA:E1THM0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1THM0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADN59524.1"
FT                   /translation="METQLAQHSMQREPKPPECEDILQLKGVGKRFPGVVALDGINLDL
FT                   RSGEVHAVCGENGAGKSTLMKIISGQYRADDGVVTYQGKPVQFASALEAQAAGIAIIHQ
FT                   ELNLVPHLSVAENIYLAREPKRGPFVDYRKLNADARQCLQRIGLNVSPTTLVGALSIAQ
FT                   QQMVEIAKALSLNARVLIMDEPTSSLTETETAQLFRIIKELRADGVAIVYISHRLDEMA
FT                   GIVDRVTVLRDGRHIATSDFAATTINEIVARMVGRPLDDAYPPRESVPTDDILLRVQDL
FT                   QRSGTFGPLSFDLRKGEILGFAGLMGAGRTEVARAIFGAERPDSGSIMLGDTPVSIGSP
FT                   REAIRHGIAYLSEDRKKDGLALSMTVSANITLANIGGVSSRGFLRFADEASVAERYVRD
FT                   LGIRTPTVRQVARNLSGGNQQKIVIGKWLYRGSRILFFDEPTRGIDVGAKYAIYGLMDR
FT                   LAADGVGVVLISSELPELLGMTDRIAVFHEGRITAVLDTKQTSQQEILHYASGRSHA"
FT   gene            59286..60335
FT                   /locus_tag="BC1003_3584"
FT   CDS_pept        59286..60335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3584"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bac:BamMC406_1253 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3584"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59525"
FT                   /db_xref="GOA:E1THM1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1THM1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADN59525.1"
FT                   /translation="MHQGEAMLEMTSDQTQAIERQARQRRRDLIQKFAALGSLVVLIVA
FT                   FSLASSAFFSVGNLMTVALQVTSIAYLGVAATCVIITGGIDLSVGSVLALSGVAAALLV
FT                   KAGVPVPVAMLGGMLVGAACGWVNGICVTRMGLPPFIATLGMMLVARGVALQITGARPV
FT                   SGLGDAFGELGNGALFKISHIGPDGFPDTVFPGIPYPVVIMVVLFVAVSVLLSRTSLGR
FT                   HIYAVGSNAEAARLSGVNVQGVKLFTYVLSGLLAGATGCVLMSRLVTAQPNEGVMYELD
FT                   AIASAVIGGTSLMGGVGTISGTAIGAFVIGVLRNGLNMNGVSSFIQQIIIGVVILGTVW
FT                   IDQLRNRKS"
FT   gene            60408..61355
FT                   /locus_tag="BC1003_3585"
FT   CDS_pept        60408..61355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3585"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bpy:Bphyt_5473 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3585"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59526"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1THM2"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADN59526.1"
FT                   /translation="MKKLSILSAAVAMCAMFSAYAEAAGGEIAVIVKTANSNYWQNVQK
FT                   GATAAMADAKGYTMTFQGPAAESAIADEVNMVENAVNRHVAGIVLAPSDPDALVPAMKK
FT                   AWEAHIPVVLIDSTVSDSGKQYYQSFLSTDNAKAGELCAKAMIDRVGQTGKIAVMSYVP
FT                   GAGSEIGRVGGFRKYIAAHSKLQIVGPFYSQSQMANALNQTTDVLSANPDLKGIFGANE
FT                   PTAVGMGRALQQSGKGGKVIAIGFDGNQDLQGFVRDGTIQAIAVQSSYQMGYKGIQTLV
FT                   NVIERKPVPKQVDTGVLLVEKQNLDSSEAKNVLY"
FT   sig_peptide     60408..60479
FT                   /locus_tag="BC1003_3585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.502 at
FT                   residue 24"
FT   gene            61433..62449
FT                   /locus_tag="BC1003_3586"
FT   CDS_pept        61433..62449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3586"
FT                   /product="Pyridoxal 4-dehydrogenase"
FT                   /EC_number="1.1.1.107"
FT                   /note="KEGG: bam:Bamb_1225 aldo/keto reductase; PFAM:
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3586"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59527"
FT                   /db_xref="GOA:E1THM3"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E1THM3"
FT                   /inference="protein motif:PRIAM:1.1.1.107"
FT                   /protein_id="ADN59527.1"
FT                   /translation="MKATETRALPGSGLTLTTLGLGCSQLGGLYRPMSTADANALVDGA
FT                   WDAGIRYFDTAPFYGYTLSERRLGQSLQARERHAFVLSTKVGRLMRPDDTVRPGDDGWA
FT                   QPLPFRPHYDYSFDGIMRSYEDSQQRLGMHTIDVLYVHDIGAATHGDAHARYWEQLTRG
FT                   GGFRALAQLRDAGAVAAIGLGVNEWQVAADSMQEADLDLVMLAGRYTLLEQHALTPLLD
FT                   RCIGTRTRIVAAGVFNSGVLAGNGKFNYGDAPPDVARKVARLADACARFDVQLAAAALQ
FT                   FPLAHPAVVSCVVGARSIDQLQRNITWLEAPIPRQLWHALQRDGLLDEASPVPEGCA"
FT   gene            62636..63643
FT                   /locus_tag="BC1003_3587"
FT   CDS_pept        62636..63643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3587"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   bpy:Bphyt_5476 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3587"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59528"
FT                   /db_xref="GOA:E1THM4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1THM4"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADN59528.1"
FT                   /translation="MLSVICESPGVLRHQDSTPPRRAPGEVLLRVSRVGICGTDMHIYT
FT                   GNQPYLQYPRVMGHELSAIVAEAEPGAHVAPGDAVYVMPYLSCGTCIACRQGKTNCCVN
FT                   IKVLGVHRDGALTEYLSVPAQFVHKAEGVTLDQAAMLEFLAIGAHAVRRADVSAGQRVL
FT                   VVGAGPIGMAAMLFAKLRGAVVTCLDTRADRLAFCAKHIGVSTVTIGPADSAELSALTD
FT                   GEFFDVVFDATGNIKAMNRGFEFIAHGGKYVLISIVPGEVTFSDPEFHKREATLLGSRN
FT                   ATAQDFETVLEAMRAGRIPDKALNTHRMSLADVPTEFPKLMEPGQTVVKALVEC"
FT   gene            63669..64829
FT                   /locus_tag="BC1003_3588"
FT   CDS_pept        63669..64829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3588"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: bpy:Bphyt_5477 mannitol
FT                   dehydrogenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59529"
FT                   /db_xref="GOA:E1THM5"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1THM5"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ADN59529.1"
FT                   /translation="MTQPILQFGTSRFLQAHVALFVSQALERGDALGGISVVQTTSNPA
FT                   SEARVAALNRQGSYPVMIRGRQDGEIVDKVIECRAVQAAWIADRDWATIRHAAIHDVRV
FT                   IVSNTGDAGYRLDEHDSAALLAQPEQVPRSFPAKLLALLHARWSVRPDSGVTLLPCELV
FT                   TRNADTLRDLVIGLAKDWQQPALFLDYLSQQCIWVNSLVDRIVSEPLQPVGAVAEPYAL
FT                   WAIERRKGMELPCLHEDIVVTDDLRSYEQQKLFFLNLGHTWLADQWLAQGRSATETVAD
FT                   AMNNAALRESLEAVWTEEVLPVFDAMGLRERAEAYVASVRERFLNPYLDHRLSDIAGNH
FT                   VEKVRRRIVPLIGLADSMAVAFAQTRLRDLVARHGLAMSKGTVDAR"
FT   gene            complement(64930..65376)
FT                   /locus_tag="BC1003_3589"
FT   CDS_pept        complement(64930..65376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3589"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   abc:ACICU_01218 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3589"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59530"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1THM6"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADN59530.1"
FT                   /translation="MPHDKPMLPRTCPVARTVDLIGDKWTLMILRDVFNSVHRFGDFQR
FT                   NLGVARNILSGRLARLVEEEILAMRPASDGSNYQEYVLTPKGESLFAVIVALQQWGERY
FT                   LFSRGERRSRRVDIVTNKQLPLMSPRSSDGRVVSRADTVVKADS"
FT   gene            65459..66709
FT                   /locus_tag="BC1003_3590"
FT   CDS_pept        65459..66709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3590"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: bbr:BB2331 hypothetical protein; manually
FT                   curated; PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59531"
FT                   /db_xref="GOA:E1THM7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1THM7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59531.1"
FT                   /translation="MDTCSHAAPSACTASNTNSDSPSRCMPRSLLGLFATASGLSVANV
FT                   YYAQPLLDAMADDFGIAHAAIGGVVTATQAGCALALLLIVPLGDSLERRRLMLAQLMAL
FT                   VVALLAVAVAHTPAALLAAMLCVGMLGTAMTQGLIAYAASAAPNHERGRVVGAAGSGVF
FT                   VGLLLARVFAGAVSDVTGWRGVYAASAAVMLVLGIALSARLPRLPATRDERNYVSLLVS
FT                   MLGLLRSERVLHIRGVLALLMFASLNIFWSALVLPLSAPQFNLSHTQIGAFGLVGACGA
FT                   FAASRAGHWADKGYEKRTSAGALGLLLLAWLPAAQLNPTHYGLAALIAGIVLLDIGGQA
FT                   LHVTNQSLILRGRSTSSRLIGLYMLFYATGSGLGAMSTTFVYAHAGWQGVCLLGAGVSF
FT                   AACLFWMATQHLVRQPS"
FT   gene            66913..67434
FT                   /locus_tag="BC1003_3591"
FT   CDS_pept        66913..67434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3591"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: bte:BTH_II0671 bkd operon transcriptional
FT                   regulator; PFAM: Transcription regulator AsnC-type-like;
FT                   SMART: Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3591"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59532"
FT                   /db_xref="GOA:E1THM8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1THM8"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADN59532.1"
FT                   /translation="MSAVTRKLDRIDIAILNELQQNARITNAELARAVNLSTTPCFNRV
FT                   RALEKLGLIKQQVTLLNPEPLGLRINVFIQVSLEKQVTQALRHFEEAIDKRPEVMECYL
FT                   MSGDADYLLRVVVPDMPSLERFILEQLTTIPGVANIRSSFALKQVRYRTALPLPAAGLT
FT                   LSLGDDENRE"
FT   gene            complement(67488..67808)
FT                   /locus_tag="BC1003_3592"
FT   CDS_pept        complement(67488..67808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3592"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="KEGG: rpf:Rpic12D_3721 histone family protein
FT                   nucleoid-structuring protein H-NS; PFAM: histone family
FT                   protein nucleoid-structuring protein H-NS; SMART: histone
FT                   family protein nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3592"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59533"
FT                   /db_xref="GOA:E1THM9"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:E1THM9"
FT                   /inference="protein motif:PFAM:PF00816"
FT                   /protein_id="ADN59533.1"
FT                   /translation="MQDLETLKTQREILQAQLADIENTIHVHKVAEKVQVIAAIKSKMA
FT                   AYNITLEELRRGPRKPPRAAPKDSRPVRYRNPETGDTWSGRGRRPKWISGNKDIDRFRV
FT                   HS"
FT   gene            complement(67853..69187)
FT                   /locus_tag="BC1003_3593"
FT   CDS_pept        complement(67853..69187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3593"
FT                   /product="Glycoside hydrolase family 71"
FT                   /note="PFAM: Glycoside hydrolase family 71; KEGG:
FT                   bam:Bamb_5111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3593"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59534"
FT                   /db_xref="GOA:E1THN0"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniProtKB/TrEMBL:E1THN0"
FT                   /inference="protein motif:PFAM:PF03659"
FT                   /protein_id="ADN59534.1"
FT                   /translation="MNRRNLLKGLALTAMLPGRPALVHAQPSAMRYVFAHYMVAWPKGG
FT                   PNASVDDYAAEFREAMARGIDGFALNCGGWSVSEPLYKARVLQMYRAAERFGGAFKLFV
FT                   SADGKAQDELADIVRTTSAQKAQLKQDGKTVVSAYGLGGRDSGRCETLMREANGLGVWF
FT                   IPHFSPSSGEATIGEEQAAEIAARSTSADGYFYFGAAAPPDVVARSTTLLSSTFKRIGK
FT                   TLMTSVTPYYRGLSSGTNYRAFETGGFSGMAKEWRAAIDSGANWVQIVTWNDWAESTYV
FT                   APIGSALKARVYDARFGELLNHTAYLDASRYYIKWFKTGVRPAIENDALYYFYRLHPVD
FT                   LATDLARAMTDPSAVPPRAATALTAQIHVTAFMTRRATLTVTCGANRAVFDLVEGVNEV
FT                   SMPSAPGRPVFELVRNNAVVLQKTGEAEITRTDFSSAFNYFSGSL"
FT   sig_peptide     complement(69110..69187)
FT                   /locus_tag="BC1003_3593"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.891 at
FT                   residue 26"
FT   gene            complement(69218..70471)
FT                   /locus_tag="BC1003_3594"
FT   CDS_pept        complement(69218..70471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3594"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3594"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59535"
FT                   /db_xref="GOA:E1THN1"
FT                   /db_xref="UniProtKB/TrEMBL:E1THN1"
FT                   /inference="similar to AA sequence:KEGG:Bamb_5112"
FT                   /protein_id="ADN59535.1"
FT                   /translation="MKKDFLYVVLASALPALGNFIAVAVALRHLDPDWLGKSYALLAFF
FT                   YVTIDLFNFGSPRIFTVERIRSRVSTLIFLDFASATGSTIVFASLAGWLARTGLFAEPH
FT                   YVCTLIAAPACYGLSHFSLGVLRLYGRSGLVCLVSTISALSRVGVVLLVIVVQHLRPML
FT                   PDLLLLVEAAYGAMLLLAYLATARGGNARPADFAAYPNAERFNPWTFRYREFLSENRKE
FT                   ILGSWYSNAIFSGAKHVDIMIVTFILGPSAAALYRGVKSVHNLAFNSGQAFALVVSGKL
FT                   TRAIAPLLRMRAAAALAGSAIAIALLTLSSWIALRIHLFPTSLLGAPVAQFGFLFAAFL
FT                   GAGVIFVCRIFSLHVFSIDRRSFVRISSLEVAASLLFVSALSYVFGLIGATSGIALAGA
FT                   IVLALSTRIRAKPAAACA"
FT   sig_peptide     complement(70397..70471)
FT                   /locus_tag="BC1003_3594"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.727 at
FT                   residue 25"
FT   gene            complement(70468..71646)
FT                   /locus_tag="BC1003_3595"
FT   CDS_pept        complement(70468..71646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3595"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bam:Bamb_5113 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59536"
FT                   /db_xref="GOA:E1THN2"
FT                   /db_xref="UniProtKB/TrEMBL:E1THN2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN59536.1"
FT                   /translation="MKYNASITLLMDGNFSRVGTEIYSPHMGYEQFAVRFTQSFDEVNI
FT                   AARSFPTAKALGKRVTGAKAAFVDLGANRGAGALVLGIPRLLQRLYHVVRRADVLLIRF
FT                   PGNIAMLAMLICKLTGKPFSAEVVADPADYFSEAASSHPLRRVARSVHCWATQHAVRRA
FT                   QTVRYVTARSLQQHYPPARMDRSFGFSDVYLPDAMFERTPSATVGEQVGFRIVNVAMMH
FT                   NESKGHDPLIRAIGRLRARKLDVRLTLIGDGALRERFERLAQEEGVADAVHFAGAMDGD
FT                   EVRQRVAQHALFVLPSFQEGMPRAMLESMALGVPVVATRVGGIGEVLDEQSLIEPGDVD
FT                   TLCERIERLATDPAFRRSEADRQRAIAGRFRFSTLQEQYQIYCDELKAVSQR"
FT   gene            complement(71585..72700)
FT                   /locus_tag="BC1003_3596"
FT   CDS_pept        complement(71585..72700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3596"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59537"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:E1THN3"
FT                   /inference="similar to AA sequence:KEGG:Bamb_5114"
FT                   /protein_id="ADN59537.1"
FT                   /translation="MRTPEVFLLHAYSPRNSGDGLLVKLSLRAIRAAGIRAPITVVCLD
FT                   KAAFAGYLDDSNVELVSLSQFVLRIVRRIGSVRPAIFFGVGGGYLRSGTFSEGWKALIA
FT                   HGTQIAGTAFGGRSSRTVYLPQSVGPFRGLSGLVLKALIRRHVDTIFLRDDKSGEELQH
FT                   RKGVRTGDLVVLEIGTNLQIPVTALSAQARRKVFFVFRDLSGKPYSDVYLKNIKRLVEL
FT                   IPDAEFALQSSGRGNSDDVFYRRTFGVECTTLLRDIVQRRDAIIVSVRLHGSLESVLAG
FT                   VPSVHLSYERKGHAAYSDLGIDDYVFHAGDFDPQKVADVVDGLRNDPSPFWNSLDKASA
FT                   NRYDELVEYIKHEVQRFDHFADGRKLLARRN"
FT   gene            complement(72687..73763)
FT                   /locus_tag="BC1003_3597"
FT   CDS_pept        complement(72687..73763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3597"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bam:Bamb_5115 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3597"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59538"
FT                   /db_xref="GOA:E1THN4"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1THN4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN59538.1"
FT                   /translation="MKIVHVVETWIGGVANYVRALMIEQRNMGHEIVLLCDPRNLKLAD
FT                   IGVDGIMVVHYRSSRNPVLVPAIAYRLKNMLADMNADVIHCHSTFPGLYVRLNRFGKEK
FT                   ILYTPHAWSFMKRDIPTAMRHAFAFVERALSNRCTRILCMSFDEVRAAKRHRIGLHNID
FT                   LVYTGIASDALSERSIEAAAVSANPAATIHIGYFGRLDYQKGFDILLNAIPLLREGLHV
FT                   HVFGTAVRGGVNVRADDPRVTYHGWVGPDETRRAMLEMDVIVVPSRWEGLALVPIEAMR
FT                   AGKVLVVSSEGSLPEQVIHGYNGLMLRELSGACLAEQLNALSLEECRRMGANARHVFDH
FT                   AFRADRFFKSLMSCYENA"
FT   gene            complement(73912..76140)
FT                   /locus_tag="BC1003_3598"
FT   CDS_pept        complement(73912..76140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3598"
FT                   /product="exopolysaccharide transport protein family"
FT                   /EC_number="2.7.10.2"
FT                   /note="SMART: AAA ATPase; TIGRFAM: exopolysaccharide
FT                   transport protein family; capsular exopolysaccharide
FT                   family; KEGG: cti:RALTA_A1638 tyrosine-protein kinase (EPS
FT                   I polysaccharide export protein EpsB); PFAM:
FT                   lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3598"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59539"
FT                   /db_xref="GOA:E1THN5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005700"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:E1THN5"
FT                   /inference="protein motif:TFAM:TIGR01005"
FT                   /protein_id="ADN59539.1"
FT                   /translation="MNNRIDMTVGDPVDDDADLIRYVDVLVGSRWLIAGICAVILAIGV
FT                   AYAFLARPNYEANIMIQVEEDNPTSATSLLGDVSSLFDVKTQAEGEVEILQSRAVVDQA
FT                   VNDLRLYIDAAPRRFPLIGWLIADHDKSLSNPGLFGMGGFCWGGESISVEQFEVPSDLV
FT                   GKRFKLTLLDNNRFRVTQSDLDAPIEGVVGEPVVSNQSIGQFRLLVSHVSGKPGAVFSL
FT                   TRYSKLLTLEALQKKLTVEQKGKQSDIITASLRGRDPQQITAILNSLGSAYVAQNIKRK
FT                   AAEADKSAAFLEGLLPGLKHDVEQAEQRYNAFRNSKGTYDLGLEAQTLLQETVAWQTNL
FT                   LTLQQKRAELSSGYSPDHPSVRAVEQQIAAMKARLQAVDGRMKSLPNLEQGTVALMRDV
FT                   QVNTDVYLGALNNLQQLKLVSAGKVGNVRQVDTARVPEEPVQPKKPLVIGLALIAGLMI
FT                   GVATAFAREHFYGGITDVQDIERYAGLNVYGAIPYSAEQRTLDEAIRTRRSGLALLAAA
FT                   RPDEPSIESLRSLRTALRFAMLDAPNNRLLLTGPGPGVGKSFIASNLAAIMASSDKRVI
FT                   LVDADMRRGYLNQYFGVSRGKGLSNVLSGEATLDEVIRRDVAEGLDLITTGSIPPNAAE
FT                   LLMSETMNRLMQRLSERYDLVVIDAPPVLAVADAGIIAGNAGTTFLIARFQRTVIGELT
FT                   ESARHLQRANATLKGVIFNAVDARAFGYRSKYGSYRYVAYRYDRKLTK"
FT   gene            complement(76156..76593)
FT                   /locus_tag="BC1003_3599"
FT   CDS_pept        complement(76156..76593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3599"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="KEGG: rso:RSp1019 low molecular weight
FT                   protein-tyrosine-phosphatase; PFAM: Protein-tyrosine
FT                   phosphatase, low molecular weight; SMART: Protein-tyrosine
FT                   phosphatase, low molecular weight"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3599"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59540"
FT                   /db_xref="GOA:E1THN6"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E1THN6"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ADN59540.1"
FT                   /translation="MIRSMLVVCVGNICRSPMAEYLLRRELEGIAVASAGLDALAGYAA
FT                   DPAAVQVCAENGLDITQHRARQLNAALVSASDLILTMEDAHRQEIMRRHPSARGKVFRI
FT                   GDAHDFDVPDPYRKPLSHFYGVYELIARGAASWTSRIKALA"
FT   gene            complement(76590..77762)
FT                   /locus_tag="BC1003_3600"
FT   CDS_pept        complement(76590..77762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3600"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; Soluble ligand
FT                   binding domain; KEGG: bam:Bamb_6173 polysaccharide export
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59541"
FT                   /db_xref="GOA:E1THN7"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1THN7"
FT                   /inference="protein motif:PFAM:PF02563"
FT                   /protein_id="ADN59541.1"
FT                   /translation="MPKRDKQIARAAGNRQSGRALFNAVALALPVALAGCAAAPGMKMA
FT                   KPATIAVSHDAQARAEAAPVPIVNIDATLIHQLRVTRSKDIDQAVRELSTKPSPYVVGA
FT                   GDVLQITVWDHPELAVAQGAPGQAATRTSDPVPGFVVDQRGNLQFPYAGTLHAAGMTTD
FT                   QIQQALALRLTKAFLNPQVTVRMASFRARQVFVDGEVHAPGAQPLNDIPMTLYDAVSRA
FT                   GGFSSTADQSRLVLVRDGRSYPLDMTSMFEGGFNPAKIILRDGDLLRVRARDDSGVYVM
FT                   GEVSKPSTALPMRDGTLSLSEAISQAGSINSNSADPSEVYVIRDSLSASPQVYHLDAKS
FT                   PVSMVLANQFALQPHDIVYVDGNGLVRFSRVLNLLLPAVNAALYGAIAGK"
FT   gene            complement(77825..79207)
FT                   /locus_tag="BC1003_3601"
FT   CDS_pept        complement(77825..79207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3601"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /note="KEGG: bpy:Bphyt_4056 undecaprenyl-phosphate glucose
FT                   phosphotransferase; TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3601"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59542"
FT                   /db_xref="GOA:E1THN8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E1THN8"
FT                   /inference="protein motif:TFAM:TIGR03023"
FT                   /protein_id="ADN59542.1"
FT                   /translation="MKIVLARLCDIAMTLLGAAIAARLCFGEAVPHPLLHCFSAVMVAA
FT                   LVAMAFPGYSIYLSWRGRPLRPLFLRVLAAWFSVQALACALVFLLGGIHTLSGRWLLVW
FT                   ALLTAVLLVATRMAVYSMLRRYRHAGHDLRHVSVIGHGRYFDRVSRDTDGNAAAGFKVV
FT                   DVVKLAAVSADADQSAVDHDIDALRRVHDSIESNAIREVWLALPMTAEASLQRCVDALR
FT                   GTLIDLRLLPDVDALGVQEHGGALAFIGRPAISLSPVALPREAITGKEVFDRVFAALAL
FT                   LALSPLMLGIALCVKCSSPGPVFFRQRRKGLNGQTFSIYKFRSMRLHAPEHGVVKQATR
FT                   DDPRITRVGRFLRRTSLDELPQFINVLRGEMSVVGPRPHAIEHDELYRTLISGYMDRYR
FT                   IKPGITGWAQVNGHRGETERVEKMAARVEHDLYYLRHWSFALDLRIVVATILRGFVGHQ
FT                   AY"
FT   gene            complement(79781..81265)
FT                   /locus_tag="BC1003_3602"
FT   CDS_pept        complement(79781..81265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3602"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3602"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59543"
FT                   /db_xref="GOA:E1THN9"
FT                   /db_xref="UniProtKB/TrEMBL:E1THN9"
FT                   /inference="similar to AA sequence:KEGG:Bamb_5110"
FT                   /protein_id="ADN59543.1"
FT                   /translation="MIAIKSSGRTPAPPNSLKAVWLALVAGAVSAIALVVLYTARAHTL
FT                   TIILNAILIALILSIKPRNPTVRWFRVFLLFFFGVFPLWQLLVGDEIYLKLFPQDSAPV
FT                   VAWYLLSIAGIALTKIALDINGKALTQWTAPTDTTARAGGLAYLFAALSLCALAFMYVK
FT                   LGGYSHVVQLYNTRVESNGTDYDPFRGLGVIQAFANTSPLWVFVCLTMRRRRNVLFTTI
FT                   AFVQLGALGWLSAGVAGSRQGIVFVLVFALFIYHGFVKPISAKKARTFGIGVALTGILL
FT                   IPLKLGLGYSDLARLPQRFAEQRDLEVSMGPLSAFLFRDLSRFDVQAVAINEVEKPAYD
FT                   LAMGRSFAGALASIVPSALWHDKPETFAQEKSEIVRALERGTMDKTTLLFGMPGEFLIN
FT                   FGLAGFVLSFAIPVWLLVTLNRVGRHSSRWTALRTVLWPLPFLFFLFDSNVLVYYVVRW
FT                   VVLFGMPMGFALKWPGGKRAPSISREMHDIAISAKP"
FT   gene            complement(81262..82329)
FT                   /locus_tag="BC1003_3603"
FT   CDS_pept        complement(81262..82329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3603"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bxe:Bxe_B1653
FT                   putative exopolysaccharide production protein ExoZ"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3603"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59544"
FT                   /db_xref="GOA:E1THP0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E1THP0"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADN59544.1"
FT                   /translation="MLYSVQVLRALAAVLVVVCHAIHKQGQISGTGATWEFGGSGVDLF
FT                   FIISGFIMCYVTMNRQVTARDFLKARVLRIVPLYWTLSLVALAVYLANPAIVNSSGGTT
FT                   TIVNSFTLIPTGDKFLIQTGWTLSYEFLFYLVFAASLSFAIGRRLAFTCGALLVLVAGG
FT                   VLLSPSNPTLKFVTSPLLLEFVMGIVAYLYVREESRPLPLSVALVAGGILALCVMPPAI
FT                   TADARVISYGLPFMMIFAGLVKMELLVRQACETIPGRLATAIGAASYSLYLAHPFALAA
FT                   AAMIVKRSGIQHYPVLSVAILVASALVAGYACFSLIEVNLNRWIKSASRKRTARLSKTV
FT                   HEAVEQPKTTRTWPQ"
FT   gene            82638..83633
FT                   /locus_tag="BC1003_3604"
FT   CDS_pept        82638..83633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3604"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bpy:Bphyt_6251 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3604"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59545"
FT                   /db_xref="GOA:E1THP1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1THP1"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN59545.1"
FT                   /translation="MGPRSGEAHENALDTQSSTHEGSAKHIGVALFNGFALPDVASIIE
FT                   VFQSANALGDPDQSGRVHYEVSLLSASGGRIASSSSVFIWTDGVDSLRRTDNFHALFIA
FT                   GGIGATTAFRDDRLIVWLRRVFPTSALVHAIAEGRLLLDAAGLTADGNGRMDGQHRAEL
FT                   KGAARAIDHSMSPLQIALRIVEEDIGADIAHQVAEWAAPRQRLKTDANIRATPAPHVSE
FT                   QIQASARWMEANGTRPVSIEAAAQVAAMSERNFLRRFKNEMGVTPSDYLLHVRLEMSCK
FT                   LLASTSLPVDKIARRCGIGSGGRLAKLFRKHLSTTPTEYRMMRQGLQKPS"
FT   gene            complement(83860..84078)
FT                   /locus_tag="BC1003_3605"
FT   CDS_pept        complement(83860..84078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3605"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_6248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3605"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59546"
FT                   /db_xref="UniProtKB/TrEMBL:E1THP2"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_6248"
FT                   /protein_id="ADN59546.1"
FT                   /translation="MHKQYIQAIVDAACETADAIVGAREWNTIEDATAMHELIFWDMIA
FT                   RKLPDLSAPELLAALEISNGRRVSRTG"
FT   gene            84638..85630
FT                   /locus_tag="BC1003_3606"
FT   CDS_pept        84638..85630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3606"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bxe:Bxe_B2791 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3606"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59547"
FT                   /db_xref="GOA:E1THP3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1THP3"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN59547.1"
FT                   /translation="MELIETLPRCTPQNSESAHKTEVAHVDIALFNGFALPKVAAIIEV
FT                   FHKANALTASQRNGRVYYDISLLSAAGGRIASSSSVFVWTDSVETHRGTNDRHLLFIAG
FT                   GAGVQQACRDERLSSWLRRRHPFSEIVHPIAEGRQLLEATGLPSRYCPLMYGEQDAHEP
FT                   YSRRSLTEAPSAVSTALRLVQEHLGPDLARQIAQSIAPEHRTPFSNDMTRASHQVSEKI
FT                   MASVRWLEANVDRPISIDAAAQVAAMSERNFLRRFKSEMGMTPSDYLLRARLNMSCRML
FT                   VESRLPVDKIARRCGIGSGGQLAKLFRKYLATTPSDYRTSKGAPLTNLS"
FT   gene            85801..86277
FT                   /locus_tag="BC1003_3607"
FT   CDS_pept        85801..86277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3607"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3607"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59548"
FT                   /db_xref="UniProtKB/TrEMBL:E1THP4"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2801"
FT                   /protein_id="ADN59548.1"
FT                   /translation="MIYPTTRRSSFNASDAEVLNRHNRIYTNASPLLIGLRLWGFERLE
FT                   VRHWGENLPTLGGRLAWEIMREPDNDAVDVVIHLVRSSATTLGSFCWNCVGANRAMHGA
FT                   RHGAVLNVAIFSGDARRLPAQLNGLWVMAGKRPAEDIVHEVVRTLVFPRVANAR"
FT   gene            86674..89103
FT                   /locus_tag="BC1003_3608"
FT   CDS_pept        86674..89103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3608"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: bcm:Bcenmc03_5898 amine
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3608"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59549"
FT                   /db_xref="GOA:E1THP5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1THP5"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADN59549.1"
FT                   /translation="MPTIEPGSSASGSNPHLPPPGGIPSEPAKPAATPQPHVPGLPAAR
FT                   ARGAQGSGEPAPTARSRQALPTAKTDTATPASRNQWPSGKEFMGEYLRANGSGALARDN
FT                   TLSTVGRALPPLTPQSVGRYFREPVGDWPRDRNKLGPAVNKNLTRLASMEAGPQREQLH
FT                   LETTLQWHALCEAEQGDVLNTLGAQQSELLGDTSRQAAPDLPRTPVRDWLEHTAVFMKP
FT                   ELAAKLLNSCTPEAREKLAMPMKAAGDDADLKALLKDRFTDLRMTMPLDHMYDYTGFWW
FT                   DNNRQVGTLPEGVAENLKVCVVGAGPAGIMAADALNRIGVKPNVLEQADHIGGRIASGR
FT                   WEGDPTPYHPGGMRFHTTRGNFYWSIAKHYGLEHVPFPNSSSVPTSYIIGGKVYEAQPG
FT                   EPPENATMRKVAEDVMRSMTEPLLAPIREARDAGDTARFRELCDDAKQKFDSHTFQSGL
FT                   KALLQEKGITWNRDEWRTFGATGIGVGGYSGYFSTGFLEEFRFLVDERLEDHVALVDGA
FT                   DAPLHKMIEDSEGLPEGAVSLAEQNAIQLNAEVTSIKKVDGKYHVTWLDKTSNETKTEQ
FT                   YDELFFAGGPREAVRLGLTGPQAGSEPLLPEDFAAAIKDARVVGATKMAVKIAADLMED
FT                   RDLPGNVQADELFQQSYVVPASDGGAVVYPSYTLGDNSTKVAGMTGREQMDLYVRTLRD
FT                   VASRDPDNPAHQKLANLAEVVEQSRDGIAYTHWGLERHQWGAFKMDGPDQLDNTRTLYA
FT                   ALLRMSDGAIAIGEELTFEGGFASGALASATHGVQQFVRRQGGKLPPNSPYYQELL"
FT   gene            89254..90213
FT                   /locus_tag="BC1003_3609"
FT   CDS_pept        89254..90213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3609"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bxe:Bxe_C1311 putative
FT                   carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3609"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59550"
FT                   /db_xref="GOA:E1THP6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E1THP6"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADN59550.1"
FT                   /translation="MQPPNLRFQRWSGGFLFWETKTAMSHYDLAKPGLEELVIACVQME
FT                   PHIGAKRANVARLIRHVETAASQGASLVVLPELATTGYVFADRDEAFSLAEGLPDGETA
FT                   GLFADTAQRLGIHIVTGIAERAGKRLYNSALFTGPSGHIGIYRKLHLWNNENRFFEPGD
FT                   RGVPVFGTPLGRIAIAICYDGWFPETYRLAAMQGADIVCVPTNWVPMPSQPENRSAMAA
FT                   TLTMAAAHSNGMAIACANRIGTERGQLFIGQSLIVGGDGWPLAGPASTDREEVLYASID
FT                   VKRTRAGRTLNAFNHVLRDRRADVYDPMLGARWPAFQT"
FT   gene            90269..91438
FT                   /locus_tag="BC1003_3610"
FT   CDS_pept        90269..91438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3610"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_C1310 branched chain amino acid ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59551"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1THP7"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADN59551.1"
FT                   /translation="MRPVIKLFLVAAVAAIAGAGTGASVFAAEPIRIGVAVGLSGANSV
FT                   VAPAVVQASQLAVDEINASGGILGRPVQLEITDDASGAVGAQKAYDTLVFQKNVDAIIS
FT                   METSAARNAALPIVARGKKPFIYTSFYEGRSCNPWMYVNGWVPEQQVAPVVDYFAKAKG
FT                   AKTFYLVGNDYAFGRGMLQFTRKYIEAHGGKVVGEEYLPTDGTDWTPILSKIRAAHPDA
FT                   LISATAGGAPNVSLAKQLKGSGLTLPYGNLAIDEGTAKSMGDVATGIYMSGSYLTSIDT
FT                   SANKKFLAAMDKRFGKDVKTPNELSEPQYEAFFLYKAAVEKAGSTDSAKVIKALDQVSF
FT                   NGPRGQIEMVKSRHTPLAMRLGQIQSDGSVKILQTFPDVDPGAQCPNIK"
FT   sig_peptide     90269..90352
FT                   /locus_tag="BC1003_3610"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            91523..92356
FT                   /locus_tag="BC1003_3611"
FT   CDS_pept        91523..92356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3611"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_C1309 branched chain amino acid ABC transporter
FT                   inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3611"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59552"
FT                   /db_xref="GOA:E1THP8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1THP8"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADN59552.1"
FT                   /translation="MVLALDILTTTAVLFIVTAGLMVIFGVMKIVNFAHGALLTMGAYA
FT                   SFVVTQLKLNPWLGLPLAVVVGTVVGMLVEWIIVRPLYKRPLDAILATWGLGIVIGQLI
FT                   VMTFGREVQFVETPLKGVVSIAGTDYSAYRLLLIPVALGICAIMTALLTGTRFGVKTRA
FT                   VIMNEDLARGLGIHSGRIRFITFSLGAAFGSLAGVLITPLSSVDPDMGLPWLVSAFMLV
FT                   MVSGHSMLSLLVTCFVFGACQVLVSTFVSPVLGGLTIAVLAALTLRIRPQGFSHG"
FT   gene            92349..94208
FT                   /locus_tag="BC1003_3612"
FT   CDS_pept        92349..94208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3612"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bxe:Bxe_C1308 branched chain amino acid ABC
FT                   transporter ATPase/inner membrane protein; PFAM: ABC
FT                   transporter related; inner-membrane translocator; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3612"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59553"
FT                   /db_xref="GOA:E1THP9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1THP9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADN59553.1"
FT                   /translation="MAKVNASLGHAGREPSPAGKRQRSRSRPLRGLATIGVLGVLLIAA
FT                   GPFLFGSYLLNVLIQAFFFSIVAVTVDVLWGYTGYLTFGQSAFFGLGAYAAGLVFTHGG
FT                   FSAAYVLLALAATLAVTAGVAALLGWLSFYRGASPFFATVMSLVLPIVLSQLLLSGGEW
FT                   TGSSSGLTGYQTFDLSLEAWYWIAGAALAVVVGLAWIFVRSDGGRVLAAIRDNESRCLY
FT                   LGINTSLVKIVLLVATAAVAGLAGFGYGSFSGVVAPELTGFVLGTQLIIWVALGGRGTL
FT                   WGPVIGALLINVGTSYLSGIMPFAWQLILGAAFVAVIVLLPQGLVPLLLTPLRHLAGES
FT                   REPELVERPVQSGHAPDAGAPALRMSGVARHFGSLKVLQGIDLDAQAGELVGLIGPNGA
FT                   GKTTLIRCMSDGAERSAGTVMLCGNDIRQLPPDRCVRFGLGRKFQNANIFETLTVAQCL
FT                   RIAGTLIERPSFVRRSGTLALPPYALEVVRATNLERKLGAVAKDLSHGEQQALELAMVL
FT                   ALEPRIVLLDEPTAGLTKTERTQIGNVLAALAHRYNLCCLLVEHDLDFVAGIATRIVVL
FT                   HQGRIVMQGNFDEVVNSELVRTIYAGTAQGDSAVGAATQREAS"
FT   gene            94205..94918
FT                   /locus_tag="BC1003_3613"
FT   CDS_pept        94205..94918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3613"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bxe:Bxe_C1307 branched chain amino acid ABC
FT                   transporter ATPase; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3613"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59554"
FT                   /db_xref="GOA:E1THQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1THQ0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADN59554.1"
FT                   /translation="MNESQIALNLKDVTSGYKASVVLRKLSLSVANGEAVALLGKNGMG
FT                   KTTLLKTIMGYLPKQSGAVYVHGEDMTRLPPHRIARAGIAYAPQEHALFQDLSIRDNLR
FT                   LGLANVSVFDERFAQIEPIFPVFGSRLRQYAGTLSGGEQKMLLVARALMMRPSIILLDE
FT                   ITEGLQPSVIDRLADALLWERSRHGTTLLLIEQNVPFALKVADRYAVLKQGEIVDEGNA
FT                   KDAAAAESIYEHLRV"
FT   gene            94947..96254
FT                   /locus_tag="BC1003_3614"
FT   CDS_pept        94947..96254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3614"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bxe:Bxe_C1306 putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3614"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59555"
FT                   /db_xref="GOA:E1THQ1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E1THQ1"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADN59555.1"
FT                   /translation="MTPAQSFYRPLSAHALLERTARDPAERSHLVPESLARIDEVDAAV
FT                   RAMTAVAPRDAALANAAAAAGPLAGLPVAVKDIFDTSDLVTSYGSPIYEGHQPKSDAAI
FT                   VTLLRRNGAVVIGKTVTSEFAYMAPTVTHNPAALDRTAGGSSSGSAAAVAAGIAPFAIG
FT                   SQTGGSTIRPASYCGVAGFKPTFGMLPTAGMKCFSWSFDTVGLFAAGVRDAALLAQVLS
FT                   GRALAIRGNEQPPVFGVPERYPWTEPSANASHVLETAVRAVERAGGRVRPVRFEPWMAE
FT                   LIAVHDTIQSYEAWQTLGFEYDRHRAQLSPMLFAFLARASNVDAAAYESACAGMNHAKT
FT                   RLTQLFEGVTMLLTPSAPDEAPEGLASTGDPAFNRNWTLLGCPCVNVPGLTGARGAPVG
FT                   VQVIGRPWDDARCLEAAAFVEQAIIATAAPGERATH"
FT   gene            96287..97462
FT                   /locus_tag="BC1003_3615"
FT   CDS_pept        96287..97462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3615"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_C1305 branched chain amino acid ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3615"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59556"
FT                   /db_xref="GOA:E1THQ2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR039570"
FT                   /db_xref="UniProtKB/TrEMBL:E1THQ2"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADN59556.1"
FT                   /translation="METNPLQSAKAPPAEAGWRVGVLFSRTGVTAATESEHFFGTVLAI
FT                   EEINAAGGIDGRLLDPVVYDPKSDPDEYRRLASRMLQEDEVTVIFGCSTSSSRKAVLPV
FT                   IERYNALLWYCSIYEGFEYSPNVIYTGAVPNQNSMQLAAYLLRNHGRRFFLVGADYIYP
FT                   RESNRIMRDMVEQHGGEIVEEVYLPSDAEPAALREVVQQIRAVEPDVVFSTLIGRGARA
FT                   FYQLYREHGIDPARIPIASLTMTEGETRMIGPELCGHHIISASYVNTLPLPGNQRFLKS
FT                   WRARFGEQPASMWSEMAYNQVHLFALALARTRSLDTAKLVDAVYEVEFDSPEGTLRIDR
FT                   ANNHAILTPRIAVCRPDGAFDIVWEGRHPVKPDPYLTSYGFAEFWLDGEPV"
FT   gene            97459..98079
FT                   /locus_tag="BC1003_3616"
FT   CDS_pept        97459..98079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3616"
FT                   /product="ANTAR domain protein with unknown sensor"
FT                   /note="PFAM: ANTAR domain protein; KEGG: bxe:Bxe_C1304
FT                   response regulator receiver/ANTAR domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59557"
FT                   /db_xref="GOA:E1THQ3"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1THQ3"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADN59557.1"
FT                   /translation="MNAGARRIFDDLRTLRVVVIHPPGDDRSVLEEQLRRIGCPVRAVW
FT                   PLPAHLPTDADVIFFLVGPEIRNAGNWSAADTQATLIALSDYENPTALKMLLDTQAHGV
FT                   ITKPYRSTGVLSTLVLARASSGYQQRLHAKISKLEEAIKARRHIERAMRILIDAHRLSE
FT                   NEAYEHMRSRATELRVTVGEIATIVIDAHEGMEKLGLGKRTRP"
FT   gene            98316..99053
FT                   /locus_tag="BC1003_3617"
FT   CDS_pept        98316..99053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3617"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3617"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59558"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI50"
FT                   /inference="similar to AA sequence:KEGG:HCH_03570"
FT                   /protein_id="ADN59558.1"
FT                   /translation="MIDAAELKRLDQLIHQLGPSGSGSGSASDEDIAREIEQILAELFS
FT                   DGGSSSSGMPSMPSRPAMPSSAGRASPASYRSTASTAGVPAGDGSGQSASASTPEAKKT
FT                   AQYFMTNLQRDFGLTRNQAAGIVANLWHESGGMNPGINQGGAIGAPNSNLQSGYGIAQW
FT                   TGSRKQDYLDYCSANHLDPSSEQANYGFLKHELQTSQSGAIDAIRNTQSAQDATVVFCN
FT                   TFERPGDPQMSSRLADLQYVLTA"
FT   gene            complement(99155..100627)
FT                   /locus_tag="BC1003_3618"
FT   CDS_pept        complement(99155..100627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3618"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="KEGG: bgl:bglu_2g02470 HrpB; PFAM: helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3618"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59559"
FT                   /db_xref="GOA:E1TI51"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI51"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN59559.1"
FT                   /translation="MFVTLYFPLAASLSVHDLPDGFLNKVRDGDLQPAGAQASRWSELA
FT                   RGAAGSSELLRLHADMQMTLGICDEAEEQYRRAQKAIRSPRHAIRAASCRNAGWQALFR
FT                   HRLATALSCFARLVDEPDVDMAQQVEARLGIVGALHELGRSRDSGDALDELAAATTDPS
FT                   LGHWRELVATVRFDIAVQRELRGATLLSDHAYWQSGLTEHSLRGVGAAGGFHAMASASD
FT                   AADLHEVEALNVCTPLLRQRVDYLRQLRALARGERTALEGITAHLNWAQQRGFGDYLRS
FT                   TRLEVVLAALAADAPQLAEMLLEPLHRIDHAGSTGHRQLEYLYAVAKTHQALGRSREGM
FT                   LFFGRYALIATQCLRDDSQVLVSYAGKAARQAPQLDDVAARLPARYRRAYRYLQENLDR
FT                   RDLSVREVAAEVGVTERALQSAFKHSLGLSPTELIRRLRMERIRADLLDDSFTGERTVL
FT                   LTANKWGVQNRSTLVSGYRKQFHEAPSETLER"
FT   gene            101094..103394
FT                   /locus_tag="BC1003_3619"
FT   CDS_pept        101094..103394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3619"
FT                   /product="transcriptional regulator, CadC"
FT                   /note="PFAM: transcriptional regulator domain-containing
FT                   protein; KEGG: bgl:bglu_2g02260 transcriptional regulator,
FT                   winged helix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59560"
FT                   /db_xref="GOA:E1TI52"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI52"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADN59560.1"
FT                   /translation="MPSLRPNETVIAFSRFTLSQEPPRLVADGLEVELGARALELLIAL
FT                   VEARGRPVAQAELGRRGWPDLNVDVNTVQVQISALRRALGDDRDLIVTVPGFGYRFAAE
FT                   VHTNSLAHAQEPVTAAAAAATTTAAAAPLRGSRLPGEPAGAGAPRAAQPAFAGGASGGV
FT                   SSGASGGVSGGTARTPQQFTPFIGRHAELSEVLGLMSIARLITLVGATGTGKARLAHEA
FT                   ARRLAARFRDGVVPVALSPLASEEAFASALALALNLPAGAAQTPLARLLDGLRERDVLL
FT                   VIDCNACNDGRHEHARNRALAAEIIDAVLTAGPNVRAIVTASAPLGLRNEEVVTLGPLR
FT                   TPEQPQVNATLAPEYDALRLLFARLAILSARRDRQRMAAPASPRPLSGNALLAALDGGA
FT                   MPQAAIDAAVSITQLLAGVPLALELAAATIDHDLRAGEPLEAAMSRYAQCLEALIGPRI
FT                   ETPGVAHPRSAPIALAFDLHVARLDRRARLHLLRLAMFAGEFPRCAAIGLLTACDPPAS
FT                   GEWSGDTPSDTHNAMSEAIRGDALADASLDALTEAGLVEELDSSGQWMLHIRRPIRHLA
FT                   RDMLRDAGELDRTAHALAAGLPVRLNAHRKRGERAHIDALDMSDLEDLRAALQWCVECG
FT                   RFDTAIALLECSAWLWARLSLEREYLQRGRAVLAGVQAGATPRRRDEMRLHAILASALP
FT                   LAHAPVAQAIAAWETVYELANACADSAFRERALTGLIVCCSEAGDARRAAELQARYDRI
FT                   VRASQARNGAAAR"
FT   gene            complement(103505..103975)
FT                   /locus_tag="BC1003_3620"
FT   CDS_pept        complement(103505..103975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3620"
FT                   /product="Type III secretion protein HrpB1/HrpK"
FT                   /note="PFAM: Type III secretion protein HrpB1/HrpK; KEGG:
FT                   bte:BTH_II0763 hrp protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59561"
FT                   /db_xref="InterPro:IPR013394"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI53"
FT                   /inference="protein motif:PFAM:PF09613"
FT                   /protein_id="ADN59561.1"
FT                   /translation="MKNDQCSFAVLGVLLTIFSVGLRIGAHADLEELLLVLRQLHPNPA
FT                   VVDICEVRLLVNSRRWIDALRLLRQIDEQGYGSPVVTALQSWCLYMLADRDWRRCAAAV
FT                   LHSGDPTALAIVAKFLGIGGEPSAARIATVLASESGNLLGNTLGNELGSEYR"
FT   sig_peptide     complement(103889..103975)
FT                   /locus_tag="BC1003_3620"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.737 at
FT                   residue 29"
FT   gene            104321..104929
FT                   /locus_tag="BC1003_3621"
FT   CDS_pept        104321..104929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3621"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A2263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3621"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59562"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI54"
FT                   /inference="similar to AA sequence:KEGG:BURPS668_A2263"
FT                   /protein_id="ADN59562.1"
FT                   /translation="MTTNNVNSAYFQSPTFQYPGGQSYGGANQAQIDADIQQLLNDLGI
FT                   SGGQYPGGSQNAGGQFPGSTGQYPGIPANGNPPLRSIKLSTRSGGEVSLLEDPSGNLYD
FT                   KSGKSVGTIGADGSVSFTADGKKEVNELMTNGRSPFDLIMSGSLVTGEKQSDGTYKFAA
FT                   DQVNIGAGDLNLSGTPNSRVQPLTVEQPAQSPGNYGLAV"
FT   gene            104991..106190
FT                   /locus_tag="BC1003_3622"
FT   CDS_pept        104991..106190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3622"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: bcm:Bcenmc03_5892
FT                   cytochrome P450-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3622"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59563"
FT                   /db_xref="GOA:E1TI55"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI55"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADN59563.1"
FT                   /translation="MTCAIADPGSHSVLPSIIGTGSGDPYPLYEWLRAQRPLWRDASGV
FT                   WLASSHALVTRILDDARFSARPPPGAQPLDDPLGYTNMVVFETGEAHERLRRLLAPLFS
FT                   RKALLSLQAFIDGEVARLLDQCEALPRFDLVAHIASVLPVRTICRLLGFPDAHGASYLQ
FT                   ASTGAWQLISGAPMSVEERTHAAVQTETFIGNVDAFLREVDPDAAPDHAASRFLRLEQE
FT                   GGIGRREMLVNVLFLFIAGYGTTLLSIGNSIAALLRAPHAWQALVDDTSLVSQAVRELY
FT                   RYDPAVQSVFRYAWDDVEIDGCRIRRGESVMPLIGAANRDPTVFAAPDELRFEREAARS
FT                   LTFGAGPHSCMGVALARMQLESLLRALLRRMPELRLAPGWQPRQQHGSFHGYDRLIVER
FT                   "
FT   gene            106190..106915
FT                   /locus_tag="BC1003_3623"
FT   CDS_pept        106190..106915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3623"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nve:NEMVE_v1g200695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59564"
FT                   /db_xref="GOA:E1TI56"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI56"
FT                   /inference="similar to AA sequence:KEGG:NEMVE_v1g200695"
FT                   /protein_id="ADN59564.1"
FT                   /translation="MVSGVAVLGWRCWGGGVGVAVLGWRCWGWRCWGWRCWGGVVGVAL
FT                   LGWRCWGGVVGVALLGWRCWGGVVGVALLGWRCWGGVVGVALLGWRCWGGVVGVALLGW
FT                   RCWGGVVGVALLGWRCWGGVVGVALLGWRCWGGVVGVALLGWRCWGGVVGVALLGWRCC
FT                   VAVLASLSLPHAPGRRCVSRRRPAARDGALNPAMSDAHASRVGVIPTGTSHRRGCRCTC
FT                   RMTRPVGRCRLACCSNRSA"
FT   gene            complement(106809..107621)
FT                   /locus_tag="BC1003_3624"
FT   CDS_pept        complement(106809..107621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3624"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0418 LysM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3624"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59565"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI57"
FT                   /inference="similar to AA sequence:KEGG:MXAN_0418"
FT                   /protein_id="ADN59565.1"
FT                   /translation="MTYSAFSTLSYPAGGYMGAADPSSQFTRSIVAQPNAWTNAGTGTA
FT                   FDSGNSAGWNSSGGFGDNALEQLFLQFLLSITSPSQESSGMPMPSMPSLPSSGGVAQAS
FT                   YRRSSGTGSVSSGGAVERGDPNVRPAGSGNAAGVAQTQLHKSAASIMADQGVPMDKGVD
FT                   TTVCCANFASACLVKSGKISESQHTNLVSTLHSELKGDGWRTVSRSEAKPGDICIVGAD
FT                   EHVEIVASNENGRITLIGSNNTQGGSGPQVVSYDTYTGNRGDVTFLSE"
FT   gene            108055..108771
FT                   /locus_tag="BC1003_3625"
FT   CDS_pept        108055..108771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3625"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_2g02510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3625"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59566"
FT                   /db_xref="InterPro:IPR021851"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI58"
FT                   /inference="similar to AA sequence:KEGG:bglu_2g02510"
FT                   /protein_id="ADN59566.1"
FT                   /translation="MPKHALADPSRVAAPLVRPAPAAANVANVAVRAALALALASLMAA
FT                   CADPAPGGAQLKIAQQQKLVPPANETLPLSLRADSQEVLQDVLSAVGDEVWNCRRSGAA
FT                   LQWTSAGAEATLVDQARKSVGTVMPNRMFSAYDGSYVIGRVTADETVTPGALPWQRVTA
FT                   RFNAGERTGDGRFARTTSVQRVLTSGGLPPNPLCTQEGVSLFVPYSATYLFYRASDPDA
FT                   VVPTPEPPLDAASATQ"
FT   gene            108868..112668
FT                   /locus_tag="BC1003_3626"
FT   CDS_pept        108868..112668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3626"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc2139 AWR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3626"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59567"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI59"
FT                   /inference="similar to AA sequence:KEGG:RSc2139"
FT                   /protein_id="ADN59567.1"
FT                   /translation="MNFRLTALASLLPGRESAAASAAHPQQPDEAPQPQPDPSADSETP
FT                   LSGLARLSDRVRHNPVTRTFRASNTTVTVLESTLSAAGSVANPAGDARFPRPPQRRPPQ
FT                   PAAAQAGEHPTSIENEHVMDVPEIAIGAHGAKLADASIARTTASLAAGDATRGALPVPK
FT                   FMNPRAIRDTLRRLRNREANATAREWADTLDEHFMQPVIAVNRLFPVPANASREVADAR
FT                   QAAIDSLLDGLTLRRPRPAQADPTLPLTVDRLPQECVVPVADALAEASGGDPALAARIL
FT                   HRLQQPLDIGGLSGVSAIGDTSSTRDTAGTAENSGISGTSDASGTSGTSNTSNTSNTTT
FT                   IRAAPAQHPSQAAPADLEQRAWRCAQNLAHARCAALEGLLRLQYGDSARHAERGNGMAA
FT                   RLVVYLQAAHKLRSMDADLGATPADLNDDAAYRMFIEDPYARHALLALDAARRLPPDAA
FT                   SVHDTGDCEIEAITAYRLWQMGFDESGPGSDLERAAQLLFDGGTTWVARGAERQARKDR
FT                   ALGPIDGAPPAQRFAQARARVGLAVHDVPRAFGRNRTPIDTSSLLGADTPFFDTTRGQY
FT                   DSALIAAREALLDYSNEQLPCAATPGRMLTHALNAQRLQAWTDARPDVPAHAKPRELQK
FT                   RRPESFALGRREARRMWDAARARVAGLRVEGDQRTQRNVERALRMFDDPQRRRRFVDDV
FT                   TSSGFTLAALERCFNASGMAADHPVRAQPAQRNLQAAHDLLDNPGIAPLQRITTHNLRE
FT                   QHLALMAQNIPGTGFTSYDGNALGIDASAWGNLPARLLVSAGPIVTVLGGRDSMYSIGT
FT                   AYEGGQMMFGTRSRVNGTLGAQGFVGATLDVAGVAGMAGAWAASSVGGYLAREESVVLR
FT                   ARRLAPTPATAELEAELWHKDSQQMVNAYWDAAEQAQTPDEFMQILAAGIADNERISLS
FT                   SQNNNATTVTATPLTVGGVARANVPGANSPERVGAYAGVSSGVTLYSAADLKESGALAS
FT                   TIGATAVQGTLSASAGTQFAPRALMLGDGAGEVGSVSPGAKTLASAAVEATPFGRSSFV
FT                   FAMRDNRGFVAEYTMQDRMFRNADDWARSVRANPAWLQGIGAQRLQQVIEQTQLESSGE
FT                   FSFGERWVIADEYVPRLNQYLTLSNQLRARLDDASPPAPTRAERALIEARLRVLERKMQ
FT                   RTFEDPSAWRPLGLFGLREVSRSSSQGWKYGVRASHEQSRIGRSLTFWTPVSEPELEST
FT                   GTAGGSVATRSLASEMNEAQKLAGAGAAGSAASSAGPGGGV"
FT   gene            complement(112749..113819)
FT                   /locus_tag="BC1003_3627"
FT   CDS_pept        complement(112749..113819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3627"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   azl:AZL_c03710 vanillate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3627"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59568"
FT                   /db_xref="GOA:E1TI60"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI60"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADN59568.1"
FT                   /translation="MPYLLNAWYVAALSSEVTAHAPLGRTLLDEPVVLYRTAGGEAVAL
FT                   ADRCPHRFAPLSSGRIVDGTLECPYHGLRFGAHGHCVFNPHGDGRVPARAQARRYPVHE
FT                   RYGAVWFWPGDPQRALGTPLPAFDYLDPRDHFTSERYLHTRANYQLSADNLLDLSHFQY
FT                   LHPDTLGSEQMASGVVRATVAGDTVSVHREMKGELLRPMLTQSFELLYGERADRELDVQ
FT                   WMPPGLLTIAVRVCESGWPETTREAVSAHWLTPETAASSHYFFAFGLPRAIGAHGAELV
FT                   NRTAQSLLAPFRDEDIPMLEAQQRMIGERDFWSLRPAMLPIDAGALHARRIMERLIADE
FT                   ARQGGREGVSSVEKAS"
FT   gene            114450..115493
FT                   /locus_tag="BC1003_3628"
FT   CDS_pept        114450..115493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3628"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: transcriptional regulator domain-containing
FT                   protein; KEGG: bgl:bglu_2g02500 probable response regulator
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59569"
FT                   /db_xref="GOA:E1TI61"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI61"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADN59569.1"
FT                   /translation="MKLAVMTRSATLFGLICRCFEADGAVCHRFADDVAFARAIYRDEY
FT                   SAILIDADTGLNPLRPVLARRACYADRRAPLIVIGAGHDREAIGRLFDAGADDVVLSPV
FT                   DAREVMLRVHLALLRAQLQSADSSDMLECGVYRLDRRTCTVHVDSHAVRLTPREFAIAW
FT                   LLFSRRGEYVSRRQIAGAVWSRSEDIIGRTLEQHIYKLRKKLELNGPWGVHLRTLYAHG
FT                   YRIEMADTADAALDESTQGTQSMQTMESLDSPASVESMESTAFASLRGEARAAAAVVCI
FT                   GPMPRASVPVPPPRAEVHPADSAVARNAPSWSESQAAFAASAGGVPKTPYALLSAAALA
FT                   ARTRGNG"
FT   gene            complement(115589..117421)
FT                   /locus_tag="BC1003_3629"
FT   CDS_pept        complement(115589..117421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3629"
FT                   /product="type III secretion outer membrane pore, YscC/HrcC
FT                   family"
FT                   /note="KEGG: bpd:BURPS668_A1985 YscC/HrcC family type III
FT                   secretion outer membrane protein; TIGRFAM: type III
FT                   secretion outer membrane pore, YscC/HrcC family; PFAM: type
FT                   II and III secretion system protein; NolW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3629"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59570"
FT                   /db_xref="GOA:E1TI62"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI62"
FT                   /inference="protein motif:TFAM:TIGR02516"
FT                   /protein_id="ADN59570.1"
FT                   /translation="MNNKRLMLAARLAASLAFALPALLASPAEAAAIHWRSSVVHVSAE
FT                   GQDVKDVLRDFTAGQGVPTTISGDVHGSVSGRFDMPPQRFLDTLASSFGFVWFYDGSVL
FT                   SISDVNTVTRRVIKLDHASAADLRSALTQLRIENARFPITYDETQGTALVSGPQAYVQL
FT                   VSEVARRLDDNAAQRSGSMIRVFQLHHAWAADHNVEIDGKTVTVSGVANVLSAMYHPRD
FT                   QRGRNGADSYEQAANRAAREPTMRRLQPMRDVTGSTDGGGYQSGVNPPLPAGIAANGGV
FT                   APGIGGLLNGMAAGGGPGMQSIGSSSSGDGDSAADTSVSGSQTLPVIEADPRTNSVLIR
FT                   DVPQRLAQYQSLIDKLDVRPRLIEIEAHIIEIDDNALKQIGVDWRAHNSHIDIQTGNGT
FT                   TQQNGYNGNIDPIFGTQTLADGTTVINTTPVGGSLTAVLGNAGRYLLARVNALQQSNLA
FT                   KIDASPKVATLNNVEAVMDQKTRFFVRVSGYTSADLYSVSTGVSLRVLPLVVEENGRTD
FT                   IKLNVHIEDGAITSQQVDNIPVITTSTINTESFVGQGESLLIAGYRVDTSTNGETGVPG
FT                   LSKIPLIGALFRYRDDQRSHMERLFLLSPRIIEF"
FT   sig_peptide     complement(117329..117421)
FT                   /locus_tag="BC1003_3629"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.894 at
FT                   residue 31"
FT   gene            complement(117645..118460)
FT                   /locus_tag="BC1003_3630"
FT   CDS_pept        complement(117645..118460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3630"
FT                   /product="type III secretion protein SpaR/YscT/HrcT"
FT                   /note="KEGG: bgl:bglu_2g02460 type III secretion-associated
FT                   protein; TIGRFAM: type III secretion protein
FT                   SpaR/YscT/HrcT; PFAM: type III secretion system inner
FT                   membrane R protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59571"
FT                   /db_xref="GOA:E1TI63"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI63"
FT                   /inference="protein motif:TFAM:TIGR01401"
FT                   /protein_id="ADN59571.1"
FT                   /translation="MYDTITTLPQFGATLIRSLTVLGVCSVRLFVVLYLFPPTADGILQ
FT                   GVVRNGVVLLFSSFIAYGQPVSLYTSLSGTALVVIGLREAAIGLLLGFAASTVFWVAEG
FT                   AGIYVDDLAGYNNVQITNPLREEQSTPTGTLLAQVASVAFWTFGGMTFLLGALYESYHW
FT                   WPLTAATPVPANVLESFVLQQTDSLMQTTAKLAAPMMLMLLLVDFAFGFAAKSAQKLEL
FT                   MTLSQPVKGALTVMMLALFVGIFVDQVRDQLVLTGLGEQLRGIAGAVRK"
FT   gene            complement(118493..118993)
FT                   /locus_tag="BC1003_3631"
FT   CDS_pept        complement(118493..118993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3631"
FT                   /product="Type III secretion protein HrpB7"
FT                   /note="PFAM: Type III secretion protein HrpB7; KEGG:
FT                   bpd:BURPS668_A2289 type III secretion protein HrpB7"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3631"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59572"
FT                   /db_xref="InterPro:IPR013392"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI64"
FT                   /inference="protein motif:PFAM:PF09486"
FT                   /protein_id="ADN59572.1"
FT                   /translation="MAALQLTISRRERLEHRLQSGMVAAREAHAAALAQRDAQLARTDA
FT                   ERAQLHGFHTRISQMMTGGTAFQLAELNATMRYAEVVAVRVSQMENELAALEAALRGKA
FT                   DQLAAATRALAQNRGRIDLCSERMAGLRAALEREAADAGDEEAEEAALARLRFSAQAQR
FT                   PAA"
FT   gene            complement(119037..120440)
FT                   /locus_tag="BC1003_3632"
FT   CDS_pept        complement(119037..120440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3632"
FT                   /product="type III secretion apparatus H+-transporting
FT                   two-sector ATPase"
FT                   /note="TIGRFAM: type III secretion apparatus
FT                   H+-transporting two-sector ATPase; ATPase, FliI/YscN
FT                   family; PFAM: H+transporting two-sector ATPase alpha/beta
FT                   subunit central region; H+transporting two-sector ATPase
FT                   alpha/beta subunit domain protein; KEGG: bgl:bglu_2g02440
FT                   type III secretion system ATPase; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3632"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59573"
FT                   /db_xref="GOA:E1TI65"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR013380"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI65"
FT                   /inference="protein motif:TFAM:TIGR02546"
FT                   /protein_id="ADN59573.1"
FT                   /translation="MSSPRAAAMPRIRETSEPDHALLPLFDAQRLADAIEHEILSTPSI
FT                   ARTGKVLEVIGTLVKVAGLDVTLGELCELRAANGALLQHAEVIGFTRDVALLSPFSRLA
FT                   DISRSTRVVGLGRSLTVPVGDTLLGRVIDSLGEPIDGLGPLEATEQRPVFANPPSPMSR
FT                   RMIDTPLATGVRVVDGMMTLAEGQRMGIFAPAGVGKSTLLGMFARGAQCDVAVIALIGE
FT                   RGREVREFVELILGPEGMARSVVVCATSDRSSIERAKAAYVATAIAEHFRDRGQRVLLM
FT                   MDSLTRFARAQREIGLAAGEPPARRGFPPSIFAELPRLLERAGMGEHGSITALYTVLAE
FT                   DESGNDPIAEEVRGIVDGHMILSREIAAKNQYPAIDVLASLSRVMPQVMTPEYVRAAAR
FT                   LRELLAKHREVELLLQIGEYQPGGNPLADEAIRKIDAIRAFFNQATHELAAPQDTEARL
FT                   FELARAATG"
FT   gene            complement(120437..121447)
FT                   /locus_tag="BC1003_3633"
FT   CDS_pept        complement(120437..121447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3633"
FT                   /product="type III secretion apparatus protein, HrpE/YscL
FT                   family"
FT                   /note="KEGG: bgl:bglu_2g02430 type III secretion apparatus
FT                   protein, HrpE/YscL family protein; TIGRFAM: type III
FT                   secretion apparatus protein, HrpE/YscL family; PFAM:
FT                   Flagellar assembly protein FliH/Type III secretion system
FT                   HrpE"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3633"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59574"
FT                   /db_xref="GOA:E1TI66"
FT                   /db_xref="InterPro:IPR010586"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI66"
FT                   /inference="protein motif:TFAM:TIGR02499"
FT                   /protein_id="ADN59574.1"
FT                   /translation="MAIWLRSDRLLPAVGEGISDVLCDGERPGEMPGEPRGKSSGKPSD
FT                   RLPGKPPGKPNGLGHVGAHADVVPRAAFGALLELDAAYAQLAADRDATLAAARDEAAAI
FT                   VAAAHAEAHAIREAAQHEYEQAAARGYRDGEQRALADWMARLADAGAEQRRAQLKMRER
FT                   IASIVTVAVEQIVQVQQADQLFERALSTVDRIVEGATWLRVAVSPVDYDKACIAFERLS
FT                   TRWRDLGRPFPLSVVADKRLAPGSCLCESDFGAIDASLATQMRAMRLAVSRALKQSASE
FT                   MGDTGEAGEVGEADEAAEADEADEAMQPLARNQQTLDRHAAELADAGASNNEGWQ"
FT   gene            complement(121432..122361)
FT                   /pseudo
FT                   /locus_tag="BC1003_3634"
FT   gene            complement(122775..123605)
FT                   /locus_tag="BC1003_3635"
FT   CDS_pept        complement(122775..123605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3635"
FT                   /product="type III secretion apparatus lipoprotein,
FT                   YscJ/HrcJ family"
FT                   /note="KEGG: bgl:bglu_2g02410 type III secretion apparatus
FT                   lipoprotein, YscJ/HrcJ family protein; TIGRFAM: type III
FT                   secretion apparatus lipoprotein, YscJ/HrcJ family; PFAM:
FT                   secretory protein YscJ/FliF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3635"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59575"
FT                   /db_xref="GOA:E1TI67"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI67"
FT                   /inference="protein motif:TFAM:TIGR02544"
FT                   /protein_id="ADN59575.1"
FT                   /translation="MLNTTQAPRPHAMRAALLGLALAGCMLVSGCQKELYRNLTEQDAN
FT                   EMVVALLEQGVDASKSTVDNGKSWTLEVDDKQLVRAMQVLRERGLPHSRYDDLGSLFKK
FT                   DGLVSTPTEERVRFIYGLSQELSATLSKIDGVIVARVQIVLPNNDPLAQQMKPSSASVF
FT                   IKYRPDSDANALVPQIKTLVMHSVEGLTYDAVSVTAVAADPVDLPRAAPMQTSPLPALV
FT                   AATLVFLVGAASLFLWLRRGMPAQRTAASLYSRIHARVHALVGKWRRAKPSSAA"
FT   sig_peptide     complement(123513..123605)
FT                   /locus_tag="BC1003_3635"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.739 at
FT                   residue 31"
FT   gene            complement(123609..123998)
FT                   /locus_tag="BC1003_3636"
FT   CDS_pept        complement(123609..123998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3636"
FT                   /product="type III secretion protein HrpB2"
FT                   /note="KEGG: bgl:bglu_2g02400 type III secretion protein
FT                   HrpB; TIGRFAM: type III secretion protein HrpB2; PFAM: Type
FT                   III secretion protein HrpB2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3636"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59576"
FT                   /db_xref="InterPro:IPR013391"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI68"
FT                   /inference="protein motif:TFAM:TIGR02558"
FT                   /protein_id="ADN59576.1"
FT                   /translation="MALSVTNQQIAAALQAAAPAAGGDASLQQAGDRFKAMMQNPRMAP
FT                   PNRGDDMSNNIIAQMAASQDAEIQKSVNDVVALSSQANSMSVQEMTAAAMKATLELAST
FT                   QLDMEAKMGVVNSSKSSVETLMKNQ"
FT   gene            complement(124113..124688)
FT                   /locus_tag="BC1003_3637"
FT   CDS_pept        complement(124113..124688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3637"
FT                   /product="type III secretion protein HrpB1/HrpK"
FT                   /note="KEGG: bgl:bglu_2g02390 type III secretion protein,
FT                   HrpB1/HrpK family protein; TIGRFAM: type III secretion
FT                   protein HrpB1/HrpK; PFAM: Type III secretion protein
FT                   HrpB1/HrpK"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3637"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59577"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013394"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI69"
FT                   /inference="protein motif:TFAM:TIGR02561"
FT                   /protein_id="ADN59577.1"
FT                   /translation="MSTATPDYLNCSQAIVGGLIDTLSCALLNNFPTLEADPYDIELTL
FT                   DALRLLRPRMAELDTMEAVLYMQRGHWDDAIRVFSRVIEGAPHFSYAKALLAFCLSVKG
FT                   DAGWRQWASAALAQNPDRDTRQLVRALEARDDLREAIRVYRNGGTFEVPLSITALNDEL
FT                   PQEPPVVTAPPPPASHHEALAQQGYLRI"
FT   gene            124992..126158
FT                   /locus_tag="BC1003_3638"
FT   CDS_pept        124992..126158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3638"
FT                   /product="type III secretion protein, YscU/HrpY family"
FT                   /note="KEGG: bgl:bglu_2g02380 type III secretion protein,
FT                   YscU/HrpY family protein; TIGRFAM: type III secretion
FT                   protein, YscU/HrpY family; PFAM: type III secretion
FT                   exporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3638"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59578"
FT                   /db_xref="GOA:E1TI70"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI70"
FT                   /inference="protein motif:TFAM:TIGR01404"
FT                   /protein_id="ADN59578.1"
FT                   /translation="MGVAYRHHTRRAAAHSVTSGKVMSEEKTEQPTDKRLRDTRKDGET
FT                   SKSADLVDAATMAAVLGVLAFAAAHFGGALRSIVNIALEFVSGSHDQPLMFGKLFDLGK
FT                   EALIVIVPCVGAAALAAVAALMPQVGFQIATKPVVPDLKHVSPVDGFKRIFSWRTVIDL
FT                   VKMIVKAAIIGAVMWFTIKWILPLIVGSLYQPLPELSKLFWSLLVKLCAVAVAVFIVIG
FT                   VVDVKLQRVLFLRKLKMSKDEVKRERKQMDGDPKIKAERKKLAREFATSAAPAQRVGFA
FT                   NALIVNPTHYAVAVRYAPAEHPLPLVIARGMDESAAQLRRFARDANVPIIGNPPVARAL
FT                   YKVGIDEPIPQELFETVAAILRWVDAIGARRIEDREDHNVGSRDVQDT"
FT   gene            126142..128238
FT                   /locus_tag="BC1003_3639"
FT   CDS_pept        126142..128238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3639"
FT                   /product="type III secretion protein, HrcV family"
FT                   /note="KEGG: bgl:bglu_2g02370 putative HrpO; TIGRFAM: type
FT                   III secretion protein, HrcV family; PFAM: type III
FT                   secretion FHIPEP protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3639"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59579"
FT                   /db_xref="GOA:E1TI71"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI71"
FT                   /inference="protein motif:TFAM:TIGR01399"
FT                   /protein_id="ADN59579.1"
FT                   /translation="MFKTLKLPAGGEIGIALLVVAIISLMILPLPPFLIDILLAINITI
FT                   SVTLLMVTMYVPNVVSLSVFPSLLLFTTLYRLSLNIASTKSILLHADAGNIIESFGELV
FT                   VGGNLVVGMVVFVIITTVQFIVIAKGSERVAEVGARFTLDALPGKQMSIDADLRANLLT
FT                   PEEARRKRATLAVESQLHGGMDGAMKFVKGDAVAGLIITLINIIAGIAVGVAYHEMSAG
FT                   EAANRFSILSVGDAMVSQIPSLLLSVAAGVMITRVSDERDARPLSLGDEIGRQLSASAR
FT                   ALYFASLLLLGFAAVPGFPSALFLLLAAILAFCGYRLGKSKPAATTHAGEAVNAMQRAG
FT                   SKAETPAILTRAPQFTCPLGVRISPDLVPRLSTSALDRSFETERARLQEYLGLPFPGIT
FT                   MWTSDALPASSCELLMHDVPYCTIELPPGKVMLPNPALTGSHDAARADAETLAAHGDPR
FT                   AEKRRGLDGGPGPTWWLDEKSLPPKQSAWRAEQVIAHASVAMLRKHASLFLGIQEVQWI
FT                   LDQQNAEYPGLVAEVQKVLPPQRIADVLRRLLEEQIPIRNVRNILESLVVWGAKEKDML
FT                   MLTEYVRGDLARFLAHRAAGAGRQLPAVLFDLPVEQHIRQAIKQTPTGNFLALPPDEVG
FT                   FLIDRIQSFVGDTPRDGVALVTSMDIRRYVRRMIEARLGWLAVYSYQELGEHVELQPLG
FT                   RVTI"
FT   gene            128267..128971
FT                   /locus_tag="BC1003_3640"
FT   CDS_pept        128267..128971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3640"
FT                   /product="Type III secretion protein HpaP"
FT                   /note="PFAM: Type III secretion protein HpaP; KEGG:
FT                   bgl:bglu_2g02360 type III secretion protein HpaP"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59580"
FT                   /db_xref="InterPro:IPR013390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI72"
FT                   /inference="protein motif:PFAM:PF09483"
FT                   /protein_id="ADN59580.1"
FT                   /translation="MTLIDSRPLRIIPADSEQRQADRTARARRFDYAALVRRTTRSPRP
FT                   PVCSSEAADAAQADCVAGTAGGSNRAARERSFDDPQARDDAQARDSSADTEAATADEGA
FT                   RTSAAALAAHDALLQRLPAATMPAVDALFRTQGHFLELARSLAREVAAFCADPAIGEAG
FT                   NWEVRMALDERILPDTTLYLSLSRFWLSLRFDTRGIETRQLLFDHSAMLERELAALLNA
FT                   WGTPRDIELTVW"
FT   gene            129030..130565
FT                   /locus_tag="BC1003_3641"
FT   CDS_pept        129030..130565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3641"
FT                   /product="type III secretion system apparatus protein
FT                   YscQ/HrcQ"
FT                   /note="KEGG: bgl:bglu_2g02350 type III secretion system
FT                   apparatus protein YscQ/HrcQ; TIGRFAM: type III secretion
FT                   system apparatus protein YscQ/HrcQ; PFAM: surface
FT                   presentation of antigens (SPOA) protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3641"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59581"
FT                   /db_xref="GOA:E1TI73"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI73"
FT                   /inference="protein motif:TFAM:TIGR02551"
FT                   /protein_id="ADN59581.1"
FT                   /translation="MAYSTAELRGMEAAAEHAATHDAAHGVGQAALRVEEIGDTEELRE
FT                   RDHAGGVSEADAASGHRTVARPKHEAAAPAAQTTLPRVSPATTHTATAATTPTAPISTL
FT                   PLRAVAPLAARVTRLVCDAGTARRLERELAIAAWQATLEASSDSNSDTFEQPGVLDLAH
FT                   PAGPIRVLFDLAEYPALYIAALPDGLRPATPGDTARALRIAVAGVLLEPLLKRLEALGL
FT                   AGMHVTQLARGIPPALNEPDPRNCAAFSVTFSLDGTRHCARVLLTAPVIDALEALQAAC
FT                   TVRHTPRAFATHAASQLTQSAPAFADCMVPGRLILGSRRLPVDTLRALEAGDVLLRSLP
FT                   ASLRALLPGSGRDAHEADEAGAAPAAGGHVAPFAQPANATVAWGSPGLMRVHAQVNLEG
FT                   RRLSLTKEPIMTDELDPVRPDDLLAPDQHSSPIEIGELDLPVQFEVDTVALPLSQLYAL
FT                   RPGYVLELPTPVAEAQLKLVTHGQTIGYGELVTVGDHLGIRILRMAHGDGPVQ"
FT   gene            130549..131199
FT                   /locus_tag="BC1003_3642"
FT   CDS_pept        130549..131199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3642"
FT                   /product="Yop virulence translocation R"
FT                   /note="KEGG: bgl:bglu_2g02340 type III secretion-associated
FT                   protein; TIGRFAM: Yop virulence translocation R; PFAM: type
FT                   III secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3642"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59582"
FT                   /db_xref="GOA:E1TI74"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI74"
FT                   /inference="protein motif:TFAM:TIGR01102"
FT                   /protein_id="ADN59582.1"
FT                   /translation="MVQFSDITGLLIVIVAISLVPFVAMVVTSYAKIVVVLGLLRNALG
FT                   VQQVPPNMVLNGVAILVSIYVMAPVGMQAMQSMQGQAIAGQPTQALIQVFSAAREPFRT
FT                   FLQKHTNEREKRFFIRSANVVWPKEAASSLHENDLIVLAPAFTLTELTDAFKIGFLLYI
FT                   AFIVIDLIIANVLLAMGLNQVTPTNVAIPFKLLLFVVMDGWSTLIHGLVMTYR"
FT   sig_peptide     130549..130629
FT                   /locus_tag="BC1003_3642"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.301 at
FT                   residue 27"
FT   gene            131239..131502
FT                   /locus_tag="BC1003_3643"
FT   CDS_pept        131239..131502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3643"
FT                   /product="type III secretion protein, HrpO family"
FT                   /note="KEGG: bgl:bglu_2g02330 type III secretion-associated
FT                   protein; TIGRFAM: type III secretion protein, HrpO family;
FT                   PFAM: export protein FliQ family 3"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3643"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59583"
FT                   /db_xref="GOA:E1TI75"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI75"
FT                   /inference="protein motif:TFAM:TIGR01403"
FT                   /protein_id="ADN59583.1"
FT                   /translation="MDIDTLVRFTTQGMLLCMYISLPIVIVAALVGLGVSFLQAITSMQ
FT                   DQTLSHGVKLIAVTIAIVIAAPFSAAALLHFANEIMHTAVPQ"
FT   gene            131499..132419
FT                   /locus_tag="BC1003_3644"
FT   CDS_pept        131499..132419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3644"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3644"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59584"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI76"
FT                   /inference="similar to AA sequence:KEGG:BTH_II0756"
FT                   /protein_id="ADN59584.1"
FT                   /translation="MTRVGGHSHAASLGAQAQTVRERSQQATLARFAVLYRGTVTFGYA
FT                   RTQQMAMRGSLPARKLAALNARKRNAARRTGTRRPLVVTGNDAYEHAADSGDSGRIQRD
FT                   GGGGGRGNDQSPHDGADSDSNMPRAQIRTRSGHAVIAPLAPGALQKYVAAQGLCSDRDL
FT                   AQTLPRLWCETLLALRDEAAARPQARLDALLHEHFIDLLAVQQQTGASGGISGGISGDA
FT                   SSGTSGDASMGAWRQRLIDASGERDAAPQAGASAEKISRAGRLNLLMPLLLLSYGRPST
FT                   PAMRERAMNVRIVQRGAALTAAQRG"
FT   gene            132565..133959
FT                   /locus_tag="BC1003_3645"
FT   CDS_pept        132565..133959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3645"
FT                   /product="secretion-associated protein"
FT                   /note="KEGG: bgl:bglu_2g02300 secretion-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3645"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59585"
FT                   /db_xref="GOA:E1TI77"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI77"
FT                   /inference="similar to AA sequence:KEGG:bglu_2g02300"
FT                   /protein_id="ADN59585.1"
FT                   /translation="MTKLLRILTGVHAGAELRLSAGIHRIGADDDADIRISDWRGDDVS
FT                   LVVDASGVVSARRMRPVVVLAEGEPCSEPLSDADTGAHNSTRTHANEGNDGEQGARHAA
FT                   QNDDEPGTVILLEFVPMQFGDTVICIGSDDAAWPSDLELLSTLLVKPDQTRRAAERSRR
FT                   RKMTGVVSACAMLGAVLVIGSVMLTTAVSRAALPRDAGDLAQRVNLELAAVHMKELHAQ
FT                   VRGSTVTVSGMVATADEDTQVRKMLMRISPDRIVRHYDIAQNDVRNIADSLAMQGLKVT
FT                   YAGRGVFEISGKAANPRDVEAAVARMRHDLSDNVKSVRVSVAQAEDALPSAPSFSFLMS
FT                   SDDVRYGQTPDGVKHIYTVPEDPASSAATATATATATNGLAGSSANGAANLAANSANSF
FT                   DTSATDIAGEAPGVHSLTPAPADSPGLVRSGAARGVMQPVEDIPATPPSPATRSANTTA
FT                   YLPLPK"
FT   gene            133968..134228
FT                   /locus_tag="BC1003_3646"
FT   CDS_pept        133968..134228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3646"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A2005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3646"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59586"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI78"
FT                   /inference="similar to AA sequence:KEGG:BURPS668_A2005"
FT                   /protein_id="ADN59586.1"
FT                   /translation="MTQTTNIYAPLEACATDFNDLQKTLADPAGGPRLAAIREALEATA
FT                   KNVGEAQGATELDRNDLARLYRGLLAAGRIVGQLADKRGAS"
FT   gene            134336..134500
FT                   /locus_tag="BC1003_3647"
FT   CDS_pept        134336..134500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3647"
FT                   /product="triple helix repeat-containing collagen"
FT                   /note="KEGG: acr:Acry_1166 triple helix repeat-containing
FT                   collagen"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3647"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59587"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI79"
FT                   /inference="similar to AA sequence:KEGG:Acry_1166"
FT                   /protein_id="ADN59587.1"
FT                   /translation="MSIGPAMGAITGMAAQGSTAAIGAAQATLQMSLAGAVANTMKTAG
FT                   QTIQGGTGH"
FT   sig_peptide     134336..134398
FT                   /locus_tag="BC1003_3647"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.608 at
FT                   residue 21"
FT   gene            134735..135202
FT                   /locus_tag="BC1003_3648"
FT   CDS_pept        134735..135202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3648"
FT                   /product="Tir chaperone family protein"
FT                   /note="KEGG: bcm:Bcenmc03_5922 hypothetical protein;
FT                   manually curated; PFAM: Tir chaperone family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3648"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59588"
FT                   /db_xref="GOA:E1TI80"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI80"
FT                   /inference="protein motif:PFAM:PF05932"
FT                   /protein_id="ADN59588.1"
FT                   /translation="MDTHDSSDRYASLVRDLCATVGLADAEHVLRTRAVEVEGFDVRLE
FT                   HFENDLDALYANFHYGTVTAGRTLVVFRLMLEANLLIYAQDQAQLGLDTDTGGIVLVLR
FT                   VPMTHDVDGAALADLLAHYAEHGRYWRKSIIESTDEMFEGIVAGEFTWLRA"
FT   gene            complement(135311..135814)
FT                   /locus_tag="BC1003_3649"
FT   CDS_pept        complement(135311..135814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3649"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ljo:LJ0484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3649"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59589"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI81"
FT                   /inference="similar to AA sequence:KEGG:LJ0484"
FT                   /protein_id="ADN59589.1"
FT                   /translation="MAAHVGLPRRTWETVTVNSKAIAGWSAASVGSMEGTHNRATHEKA
FT                   ASRAALVPTSTKLAGELVPLRDIPPPQGPVKFSLSRKEADRLPVLRKSSVVVIGPGAAR
FT                   ERDDVASSWARTLPVPPVQTRFSEAPPAGDSAFDAAAARQLLDNLQALVEFTKHVGHVI
FT                   HGAT"
FT   gene            136432..137130
FT                   /locus_tag="BC1003_3650"
FT   CDS_pept        136432..137130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3650"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_5890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59590"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI82"
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_5890"
FT                   /protein_id="ADN59590.1"
FT                   /translation="MSPFRFPALIESADLLMRPPEPRDARALFGEMLGDVETTRHLSFK
FT                   RHTQLDETLAFIDDSTHGWRSGELIRWVLEDRASGRLTGMIELRPHPPRVEVGVMISRR
FT                   GGARRRRAGLHALRKLLAWMLAQPPILRIDAYCAVDGDAHSSMEKLGFTLEAKLTNYEC
FT                   RPNLGVLAGDSYLYAMTRPLQAPDDTPATRWLAEHAALDADFEPGGIDTASHAHALAHG
FT                   HAKGPQIAAS"
FT   gene            137226..140831
FT                   /locus_tag="BC1003_3651"
FT   CDS_pept        137226..140831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3651"
FT                   /product="putative awr type III effector family protein"
FT                   /note="manually curated; KEGG: bgl:bglu_2g02250 probable
FT                   awr type III effector family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3651"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59591"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI83"
FT                   /inference="similar to AA sequence:KEGG:bglu_2g02250"
FT                   /protein_id="ADN59591.1"
FT                   /translation="MFRYRPLDVSSTDNLLDNSPSAGQPQEAPAPVQPTQRRMPEWIRA
FT                   SLARPARIVGARRVELSTALFQHSTHGSASGPEHHVPGERRFPPAHTARHARRETGPLA
FT                   DTGLLAARAALASTSTSTSTSTSTSASASASASASASASASASASASASASASASASAS
FT                   ASASASASASASASASASASASASASASSVLGAGFGVDAKSGGDAHGLPAARESGEHEA
FT                   TAALGPCLNAVVTRADLAAYVHRRFNARPDQTIDAAALADRLYRLCATAGPINTAAPPG
FT                   NDAAHADVGHADDAQAALRGALLADALARAGAADCRSAHLTIERIGMLDFAAPNQRRSE
FT                   SGAERDAWRAARVLARSGEGREILAALRTATLNSYRDELQRFGIEVLLTSANALDPVAT
FT                   DDPLAASDPACAPLAARAFDAASTLLAFGRDALSADQHGALFAWRQSFGEDSRHSELSQ
FT                   TRQRLARFVGNTIPRVGEKRWKTLLPRMFRGRHGSPLSALRLGTQGVPRKTIAAEQAKV
FT                   RKHLQAALPQLLQSPAMSPRAALAHARPEASLAELAALCVWLERGGFPPGRLDDDALRA
FT                   IAQRAHALCEEALLPRSADEHGAAAAAHVDVPRRVRARAREATVNWLAMPPQQLARTRP
FT                   FRSIAKRPFTVERLAVWGKVAGLPHDAPFWHTVNELRTATRHEQDARAANNVDDVRETL
FT                   LDVAANLQSGQRLRLTDGGRQGISTRGLNLTVETVLRGHGVPVSPRLDLRASRTREAVV
FT                   DISRSTHGAAIFIGTARSSMRHVGAGLLVGYDVSTALTALRAGLVANATLHARELSEPR
FT                   GVTLRVARRPLPDGSGFDDATLRAKLAGVVEHLFDESGAAHGDGPEGVWNRLASRYWDD
FT                   PDVSVSWTDAHTLVRRRGVTLDANATVKVASFGGETLMDPHSGERARALSVRTGPSAGG
FT                   GWQRSRQSAEVVERSGRVQVEEHRVGIGSHWQLRGGIAPGFSHPLDAEGRHTVGLFSID
FT                   APAATVALRERNRSAKLLLVREDGRLNHRGSILDIEYQDARTYTRAVDAARGELIALFA
FT                   AEAVARNQRNEAAGARRLAHDAAHAPTPEAQAAERIDEHLANVRRNQRPNLTYVQRYRL
FT                   RRHAALRLDANHAALAQADGDPRLQAEIAQANARILDDPATWMATELKVKERNASARSF
FT                   GPNVMLQLTTRTGALGDREIVTEGVPFAVLETLDR"
FT   gene            140942..142219
FT                   /locus_tag="BC1003_3652"
FT   CDS_pept        140942..142219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3652"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: clu:CLUG_01018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3652"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59592"
FT                   /db_xref="GOA:E1TI84"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI84"
FT                   /inference="similar to AA sequence:KEGG:CLUG_01018"
FT                   /protein_id="ADN59592.1"
FT                   /translation="MSTPVGGSAQAPDARIEHEQYGRPESEDGRSSPGAKSAGGAQAQP
FT                   GSHSPIDGLPRAQSGRAAGGAHRVQWGMGANGGPDGAGRPAAAGGPSAGGAGAYESGAA
FT                   GQPHRAPPPYPPYAPYAPHPPHPPHPPHPPHPPYPPHASYASYASPPPNAQTAQSAQNA
FT                   PNYQARGPSLLQSWQSNPNAKRWAVVAGLMTIPSVLSLGMMGGGMSFGAMSAIFGLSSI
FT                   AEMGLLGMLLFRGSRGAGQFAGRWAQPGQQTGPYASPWQGGPQAPYAGAPGPAPYAPPY
FT                   SPPFAPPFAPPFAPPHAGPTGWQDTGSQPTGWPSNAAAQTSPPAGTQGGSWQQPNPASS
FT                   FGWGPPFAPQPPAYPTAAPPSTTGAGWAQRSAATSEPPAMRPPAPPRPVSPPAGWPTVS
FT                   DDSGLGARRSRGWPAGPEGTGNDGRR"
FT   gene            142325..143287
FT                   /locus_tag="BC1003_3653"
FT   CDS_pept        142325..143287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3653"
FT                   /product="alpha/beta hydrolase domain-containing protein"
FT                   /note="KEGG: bcm:Bcenmc03_5942 alpha/beta hydrolase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3653"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59593"
FT                   /db_xref="GOA:E1TI85"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI85"
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_5942"
FT                   /protein_id="ADN59593.1"
FT                   /translation="MALAPSVQQFLLRRASAGAQSFDAFDVAHARQRFAYYTPLGDVPP
FT                   RALAAVEDLSIEARDHARLDARIYYPAPPCWADPQPALLFFHSGGYVVGSIATADALCR
FT                   TLADEAGCAVVSVGYRLAPENRFPRAVDDALDALHWLHRNAASLAVDGTRLAVGGESSG
FT                   ATLAAVCAVHARDSGIRLALQLLVYPALSAGMETPAHRRYGDGYFLSLDIIRWIQRHYL
FT                   ADADDRHDWRFAPLDGERDAPRDWSSLAPAWLVSAQYDPLQDEHARYIDKLRRYGNEAS
FT                   VVYYPGMIHGFFSMGGMIPEASLAHRDAARMLRSALHIP"
FT   gene            complement(143267..143854)
FT                   /locus_tag="BC1003_3654"
FT   CDS_pept        complement(143267..143854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3654"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bpy:Bphyt_3935 lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3654"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59594"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI86"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADN59594.1"
FT                   /translation="MRVLMATLILSSFRPGDRVDARALRGRCASRVHAYAAGLALACAA
FT                   SAATPARANCFDDAAAYQHVNPLILRAIAWQESRNQPGATHANANGSTDYGVMQINSIH
FT                   LAALSRYGITRAELMAPCKNIYIAAWQLRRMIVKYGNTWAAVGAYHSATPALRDRYARQ
FT                   IAAILRSWNVLPEQGTGAGGIERVSASRNVQR"
FT   gene            144069..145067
FT                   /locus_tag="BC1003_3655"
FT   CDS_pept        144069..145067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3655"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="KEGG: aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein; TIGRFAM: aliphatic
FT                   sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3655"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59595"
FT                   /db_xref="GOA:E1TI87"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI87"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ADN59595.1"
FT                   /translation="MSTIKTPNHRRSFIQLSLGAAAAAAVAATPLVTPLAFAQTPSKGA
FT                   ARSLRIGNQKGYLNLLKGRGTLEKRLAPLNVSVSWTEFAAGPVQLEALNVGSIDFGDVG
FT                   EAPPIFAQAAGAPLAYVAATVPRPQSEAVLVPPGSPIQTVADLKGKKIVLNRGSNVHYF
FT                   LVKLLQQHGLQYADVKTVFLAPADARAAFERASVDAWVIWDPFLAAAQKTLGARLLADA
FT                   SGVVGNRGYYFSSQSYVAKNPDVIGIVIEEIEKIDQWGSRNKDQLSSELAQLWGLPKGV
FT                   VDAVVARQRFGTERITRAILGEQQQIADAFLDLGLIPKHVDVLRAGPPNLA"
FT   sig_peptide     144069..144185
FT                   /locus_tag="BC1003_3655"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 39"
FT   gene            145305..146711
FT                   /locus_tag="BC1003_3656"
FT   CDS_pept        145305..146711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3656"
FT                   /product="selenium-binding protein"
FT                   /note="PFAM: selenium-binding protein; KEGG: bxe:Bxe_C0088
FT                   putative selenium binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3656"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59596"
FT                   /db_xref="GOA:E1TI88"
FT                   /db_xref="InterPro:IPR008826"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI88"
FT                   /inference="protein motif:PFAM:PF05694"
FT                   /protein_id="ADN59596.1"
FT                   /translation="MGMRPDPTFHASPRLAMDAPAEEYAYTLLLSPDFSQPDALAVIDV
FT                   KPGSPTYSQVVHTVPVPNKGDEFHHFGWNACSSALSPLTGHAFLERRYLIIPGMRSSRI
FT                   YIVDTKPHPTEAKIHKIIEPEEIFRKTGYSRPHTVHCGPEGIYVSTLGGAGPDGTDGPP
FT                   GIFIMDCETFEVLGRWEIDRGPQQKHYDFWWNLPRDYMVSSEWALPPQFENGIVAEDLL
FT                   ANKYGHAVHFWDLRARRNVQTIDLGANHQMALEVRPAHDPSREYGFIGVVVDTTNLEGS
FT                   IWTWWREGGQFHIEKTATIAPEPADPAQLPPLLQGFGAVPPLVTDIDLSIDDKFLYVAC
FT                   WGTGEMRQYDVTEPRKPKLVGSVHIGGIVRRTPHPNGESFAGGPQMVEISRDGKRVYWT
FT                   NSLYSTWDNQFYPNGVPAAQVMAHADPAGGLTLADDFWVKFPDGYRAHQIRLEGGDCST
FT                   DSFCYPSVGV"
FT   gene            146708..147385
FT                   /locus_tag="BC1003_3657"
FT   CDS_pept        146708..147385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3657"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3657"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59597"
FT                   /db_xref="GOA:E1TI89"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI89"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3284"
FT                   /protein_id="ADN59597.1"
FT                   /translation="MSAGWSQAGLWLAVAASGCYHGVNPAMGWPLAVSNALLQRKASAL
FT                   LSALCWLAAGHLLAIVLMMLPFALLGMLLAWQREIQAGASVLVIGFGVLLLLWRRHPRV
FT                   LARIAPSRLALWSFAIALAHGAGLMLVPIYLGLCRADQLDRAHQAAQALMQSRLGMALA
FT                   VSGVHAATMMLAGGVIAWLVYRYLGLRFVSRSWFNLDTVWACSFIVVGALALLLNASDF
FT                   SRF"
FT   gene            complement(147517..147750)
FT                   /locus_tag="BC1003_3658"
FT   CDS_pept        complement(147517..147750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3658"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3658"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59598"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI90"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3288"
FT                   /protein_id="ADN59598.1"
FT                   /translation="MAQHPARSQNHRHPDEPRPDDIARALEGAQFPTTRDKLVELAQRN
FT                   GADSEVLAVLKRMGDRNFDSVSAVVREASNAE"
FT   gene            147901..149931
FT                   /locus_tag="BC1003_3659"
FT   CDS_pept        147901..149931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3659"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bam:Bamb_5957 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3659"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59599"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI91"
FT                   /inference="similar to AA sequence:KEGG:Bamb_5957"
FT                   /protein_id="ADN59599.1"
FT                   /translation="MHFLRAPGAFTAFLAVLPITLAGCGGAANQQPTISGSVYLGPVAG
FT                   ANVAAYAIDASGHAAATPVATIVTDANGHFVLPRALHWPLLVRASGGTYTEEATGASAS
FT                   AGQTELTAVYVREPSSMVITPYSTAVVTDAMAAGGLTASNVAAASARVSAFLGGIDPQQ
FT                   TAPAFVAPGATAAALTDGNRMALALGAESQSRADNDTSVAASVQYIVAQAAKGDTLAAC
FT                   HAGAGDVAADGSLAAPADDTCHISSGAANFAANPLNRSGVTTLSMLGTTAASGPQTASA
FT                   SANACGDRVALLEQNRWLFEGRKNSVQASLVPGMTSSNWSTFPTTSTWGPHAAIYGTIS
FT                   APSSCTNLDTFRRELVMAIENYWVDQNLNYCHHHIPGWTPPENTASTDYRDSSAGSTSG
FT                   GSSDPHSPKMTCTAQRGADGSQSVQTSTAQTPAVIGTALMWNGADCSNFTSWVYNFAGL
FT                   ATNQLSGAIGVQACSTPASGTDPLTGVLLDINRGNLSSMEQYLLPGDLLYITQKDTVGS
FT                   GSFAADYKLAHVITWTGKRFSDLQAGADRAKYDLSRIGQPDSRLGGDFLALLGPTDTAA
FT                   NLGQPGHDPWMIIDSHYAGPAYRPFLGWYAERLSHVRRIVGADQVASDPHLADYVIKPL
FT                   PPTRKGWLTLASKHANASSTSGFRLIYQTGGTQSCYQAGTP"
FT   gene            150141..152345
FT                   /locus_tag="BC1003_3660"
FT   CDS_pept        150141..152345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3660"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="KEGG: bph:Bphy_5412 phospholipase D; PFAM: SNARE
FT                   associated Golgi protein; phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59600"
FT                   /db_xref="GOA:E1TI92"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI92"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADN59600.1"
FT                   /translation="MREPDPMQPALLDPPSRDTADAPPVVHDGEVMDTSSTCEWILKAH
FT                   RASVLIDAASYYEVLRKMIPRARHSVFILGWDIDSRIELVPGGVDDGFPAKLSEFLCAV
FT                   LDENPHLRIYLLGWDFAMLYAFEREWLPSYKPAWHAHRRLWFRLDGRHPLGASHHQKIV
FT                   VIDDSLAFTGGIDLTGSRWDTPEHRPDDPLRKNLGKTSYEPMHDAQLMFDGPAAAAIAH
FT                   LARERWRRSRRSGKAGRPFNGKPPPRTDLWPADIEPDFVDVDLGISLTEPAYDGRPAIQ
FT                   QVKALHLAAVAAARRNIYIENQYFTANSVGSALQKRIAEPDGPDLAVVCPYRQSGWLQE
FT                   ATMGVLRARLHKLLAAADSNGRYAMYAPAVDAPNGQFINVHSKIMIVDERLLVIGSANL
FT                   NNRSMVLDSECCIVIDGRDNPQRQAAIARIRNRLLAEHLDSTEADVEQALARHGRLNAA
FT                   IASLKGNSTRTLQPLTPEVPPELRDIADSVHVLDPEAPIAANELLAQFLPEPTHRPVIA
FT                   KLLVLGALALGVVALTIAWRFTPFGHELSFAKLTAETQRLAATHFGPLAVVAMYALAAL
FT                   LSVPVTLLIAVTGLVFGAVAGAAYALAGTLIAAAAGWAAGAWLGRDAVRELAGARLNQL
FT                   SERLRSKGLVAVIVLRLVPVAPFSIVNLAAGASHIRFRDFMAGTAIGMTPGVVLATSFA
FT                   RQLVSAVRHPTPLSLLLVAVIGVALVSMSLVLRRMLMRRQ"
FT   gene            152342..153118
FT                   /locus_tag="BC1003_3661"
FT   CDS_pept        152342..153118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3661"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   bam:Bamb_5588 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3661"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59601"
FT                   /db_xref="GOA:E1TI93"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI93"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADN59601.1"
FT                   /translation="MSGRANETVALEEAQPAPRVQTRPAHASHAGEPLRIVTYNIHGAV
FT                   GTDGKRSGARIAEVISALNADVVALQEVPLGGAASIDILRELQDLTGMHAVPGPTLDGP
FT                   DRRFGNAVLTNLPVRAIRTLDLSFGSREARGALDVDIDTGNGLMRIVATHLGLSARERR
FT                   AQVRLLLEAFDTPELPVILLGDLNEWFVWGWPMRALLTRFGRVAAPRTFPSRFPTFALD
FT                   RVWVHPAARLVDIQVDKSRPARIASDHLPLVARVLR"
FT   gene            153335..153664
FT                   /locus_tag="BC1003_3662"
FT   CDS_pept        153335..153664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3662"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcj:BCAS0428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3662"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59602"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI94"
FT                   /inference="similar to AA sequence:KEGG:BCAS0428"
FT                   /protein_id="ADN59602.1"
FT                   /translation="MTEQQNTSSSPASNPSSNATPEPAAPPSPSTPSREGLSGPGPAQP
FT                   QPIPSPAPGTPRTPGGNQLDAIDEKDADKVVPKDSKETQLRDPSSAPGAGSHSVDDAGS
FT                   PPKPL"
FT   gene            complement(153722..155764)
FT                   /locus_tag="BC1003_3663"
FT   CDS_pept        complement(153722..155764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3663"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3663"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59603"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI95"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2767"
FT                   /protein_id="ADN59603.1"
FT                   /translation="MSMETDTVTDERVAQIADRMAGEGKKVSALAIWGEVRSGSIVAVS
FT                   AALERWRQARQPASAQAPESVMTSLPDDVAQTMLSAAGALWASAREEAERVVNQRLALA
FT                   GGHADALAAERDEALAEYQNTLAEAELARERVATLTNALSISEEALNRLANEQPALRDR
FT                   AKAAEDRVAELEERAAAAESRVAQTEEREAASEARIAEAEERAATAQARVAEFEQRALA
FT                   AEARVTELEERAATAESRVAEFEQRALSAEARVTELEERAASAESRVAEFEQRALSAEA
FT                   RVTELEERAATAEGRGAEFEQRALAAEARVTEFEERAATADARVAEFEQRATAAEARIA
FT                   EADERASAAEARLQAAEAASAEDSQAREALSTAAIAKDEEIARLVEERDAARQEATALG
FT                   EAGQAHAREVQRWADESNAASSRAQDAAMQASENLAQLAALQTELDEARAELAAERDAH
FT                   AARGDEASASRAELERVQHELAGAREQLTQMSEANAAATAETTRLAQDAAAAATRAQTA
FT                   EQRVAELERQLAETESTHAQRLQELQQQSASVDTPSPEQESKEAAMAEELESLRRQMAS
FT                   QAKAHEKAYAELRTLAEQWIAHAKELKQRLGATNQKVTFLDARSAAEVALLRRLSSELE
FT                   RLKPDHDLISRDAQQKLISATLAERLEQKGYRYDPATAVMSKIDA"
FT   gene            complement(155904..157250)
FT                   /locus_tag="BC1003_3664"
FT   CDS_pept        complement(155904..157250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3664"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /note="KEGG: bpy:Bphyt_4119 L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3664"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59604"
FT                   /db_xref="GOA:E1TI96"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI96"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_4119"
FT                   /protein_id="ADN59604.1"
FT                   /translation="MNKLYAGLREARVGAVAVLFALSLTACASTAEDIGDTGLGPHPEL
FT                   QAPQTSLLPTINIAPVQKRASENMPTAPEGFTVSAFATGLEHPRWLYALPNGDLLVAES
FT                   NAPAQHDEHQGIVGWFRKQVMKLVMKRAGAGVPSPDRIVLLRGAGSSAQSRSVLIAGLH
FT                   SPFGMALVGDSLYVADTDALLRFPYRPGDTQITAAGEKVADLPAGPINHHWTKNVVASR
FT                   DGQRLYVTVGSNSNVGENGLDQEEGRALILEYTLATGRSRVFASGLRNPNGMDWQPESG
FT                   ALWAAVNERDELGDNLVPDYMTAVKDGGFYGFPYSYYGQHVDTRVKAQQPDKVASALTP
FT                   DYALGNHTASLGLAFYTGRSFPQHYWGGAFVGQHGSWNRKEPSGYKVIFVPFAQGRPVG
FT                   MPETFLSGFLSPDGHAWGRPVGVVVDRAGALYVADDVGNVVWKVVYGGK"
FT   sig_peptide     complement(157164..157250)
FT                   /locus_tag="BC1003_3664"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.493 at
FT                   residue 29"
FT   gene            complement(157288..158952)
FT                   /locus_tag="BC1003_3665"
FT   CDS_pept        complement(157288..158952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3665"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: bph:Bphy_5237 alpha amylase catalytic region;
FT                   PFAM: alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3665"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59605"
FT                   /db_xref="GOA:E1TI97"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI97"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADN59605.1"
FT                   /translation="MLNDLWYKNAIVYCLSVGTFMDADGDGVGDFRGLLRRLDYLQGLG
FT                   VTTIWLMPFQPSPGRDNGYDICDYYNVDPKYGTLGDFSEFTHACRERGLRVMIDLVVNH
FT                   TSDQHPWFRQARSDPGSQYRDWYVWSDRQPPNAKDGVVFPGVQKSTWTFDKQAKRWYFH
FT                   RFYDFQPDLNTSNPYVQAELLKIMGFWIQLGVSGFRMDAVPFVIATKGPKVRKPVEQYD
FT                   MLRAFREFLQWRQGDAIILAEANVLPNTDLDYFGDAGERLQMMFNFQLNQNTFYTLATG
FT                   DTAPLKKALTATRPRPPTAQWGVFLRNHDELDLGRLTPEQREAVFAAFAPEPDMQLYER
FT                   GIRRRLAPMLAGDRRRLELAYSLMLTLPGTPVFRYGDEIGMGDDLSLPERECARTPMQW
FT                   STEPHGGFTKNPKPPCRVITGGAYGFERINVATQRRDPNSMLNWMERMIRMRREVPEIS
FT                   WGDFEVLRVSRGDVLALRYDWRNNSVLCLHNFGAEACTVRFRSGCTEPGQNRLINLLSD
FT                   DHSEENDDGRHAVVLEPYGYRWYRVGGLDYLLRRSEI"
FT   gene            159001..160575
FT                   /locus_tag="BC1003_3666"
FT   CDS_pept        159001..160575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3666"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: alpha amylase catalytic region; PFAM: alpha
FT                   amylase catalytic region; SMART: alpha amylase catalytic
FT                   sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3666"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59606"
FT                   /db_xref="GOA:E1TI98"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI98"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADN59606.1"
FT                   /translation="MSELAWWQRGVIYQIYPRSFQDSNGDGIGDLAGITSRLSYLAELG
FT                   VNAVWISPIYPSPMADFGYDVADYCNIDPMFGTLADFKQLVDRAHDLGLKVLLDFVPNH
FT                   SSDRHPWFEESRASRDNPKRDWYLWRDPAPDGGPPNNWLSRMGGSAWEWDARTGQYYYH
FT                   AFLREQPDLNWRNPQVRRAMDDVLRFWLDRGVDGFRVDVLWLLIKDAQFRDNPPNPAYE
FT                   PGQPDHHRQVQRYTEDQPEVHEIVRSMRATLDAYGERVLIGEIYLPVPQLVRYYGANGD
FT                   GADMPFNFQLLNATWHAGDIARMIADYDSALPEHAWPNWVLGNHDNPRVASRVGAAQAR
FT                   VAAVLLLTLRGTPTLYYGDELGMTDGVIPPDQVQDPAELRQPGIGQGRDPERTPMQWDA
FT                   ALPNAGFTTGRSWLPVATETSVQTQDGDASSMLSLYRRLLELRRSNAALVQGTIEHVAA
FT                   YGDVLTYERHYRNQRLWIALNMGAADAQVQSPAGNVLLSTLPGRDGQRLVNGMNRLAPA
FT                   EALIASI"
FT   gene            complement(160579..162336)
FT                   /locus_tag="BC1003_3667"
FT   CDS_pept        complement(160579..162336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3667"
FT                   /product="histidine kinase"
FT                   /note="KEGG: rfr:Rfer_1978 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3667"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59607"
FT                   /db_xref="GOA:E1TI99"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TI99"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN59607.1"
FT                   /translation="MRLALTRLARLPRSLRWQFTLATVVLTLLIVTSGLTAVYTLRVTT
FT                   NETRLLATGELTRMQAADTLVQHTLLIEREASRLASAGSLDAMRASYADILRQLETFDR
FT                   LSDRLAAANDDLSVLDLHQASQLFRNTVNIVAQLRESELRAAIQPAPRAAAGQSDAGAH
FT                   AASRPPASRDTFSDRLSQQASAMVASAQLQSDRCTQEFQQAVQQLAGASARNERWITGL
FT                   VAVSLLFAWLVAHAFLGKHVLARLEVVSSNLRSGEAAQEARAARVLTDRDEIGDMARAV
FT                   EQFQQDRRELARAYAALREEKIRQEALIDELAQAHSQLLQSEKLASIGQLAAGVAHEIN
FT                   NPVGFVNANLGTLQRYVADLLTALAAYERTEAELIAESRATLAALKREIDIDYLRTDIP
FT                   ALLSESVEGLQRVKRIVQGLKDFSHVDKAEKQWANLESNLDTTIDVVWNELKYKAELER
FT                   EFGAIPELECIPSQLSQVFMNLLMNAAQSIEGHGRITVRTGHDESTVWVEIEDTGQGIK
FT                   PEHRDRIFDPFFTTRPVGTGAGLGLSISYGIVRKQGGRIEVRSQVGQGSTFRVILPKSP
FT                   AEALTASGT"
FT   gene            complement(162368..163510)
FT                   /locus_tag="BC1003_3668"
FT   CDS_pept        complement(162368..163510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3668"
FT                   /product="signal peptide protein"
FT                   /note="KEGG: rso:RS02363 signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3668"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59608"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIA0"
FT                   /inference="similar to AA sequence:KEGG:RS02363"
FT                   /protein_id="ADN59608.1"
FT                   /translation="MHSRVALIVTLLVLCGPGMRPACAQNAPQPAGRAAGAAQLDLAAM
FT                   QRAVDSASEPASRWSGPRSGPAAVRGATIAIISEDLRNGGVLGVAKGIKEAANAIGWNT
FT                   RVYDARGTAAGRSKAATAALALQPDGVILVGVDAADMKPDLLPFVARKVPLVGWHVGPV
FT                   AGAMTNAPVAMNVSTNPLEVARITAMAAVIQSGGRAGVVVFTDGNFQIARAKTDAMLDV
FT                   IRACRDCRLLAVHDVAISKSAEQMPALTDELLAQYGKRWNYALAINDIYFDYAAPALTR
FT                   AGERNPGLSMLSAGDGSAAAFLRIQAGTFQTGTVAEPLNLQGWQLVDELNRLLAHQPVT
FT                   GYVSPVHLVTAANIRFDGGLQGQFDPDNGYRDIYRGIWKR"
FT   sig_peptide     complement(163436..163510)
FT                   /locus_tag="BC1003_3668"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.988 at
FT                   residue 25"
FT   gene            163874..165292
FT                   /locus_tag="BC1003_3669"
FT   CDS_pept        163874..165292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3669"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bte:BTH_II1588 sensor histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3669"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59609"
FT                   /db_xref="GOA:E1TIA1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIA1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN59609.1"
FT                   /translation="MKTKLSEAIVERVNCGVFTVDRSLRILTWNRFMHSHSGRSAESVV
FT                   GQNLLDAFPELPRQWLSRKIEGVFVLGTPAYSSWEHRPYLFRFEHSRPITGTIDAMRQN
FT                   CSFIPIEDDQGEVFAVGVTIVDTTDVCIAYGELQDREKAVTSALAELTVRNEQLTSLNE
FT                   ALAHAHQQLLQSEKLAAIGQLAAGVAHEINNPVGFVLSNLNTLDNYVKTLIRYAADVER
FT                   MVSEATPALKKDIEALAEQADLEYLVGDAPTLVNESKEGLARVRTIVVDLRDFSRVDST
FT                   HVWELADIHRCIESTLNIVHNEVKYCAHLVRDYAEIPLVRCIPSQISQVVLNLVVNAAQ
FT                   AYGANHEQHGAPRGTITVRTGMDAADPSHVWFEIADAGCGIPPEHLKRIFDPFFTTKPV
FT                   GQGTGLGLSVTYGIVNAHRGTISVDSTVGKGTTFRVTLPVDATQFEETSRTEALAPNGS
FT                   LDAIALPAQSPAAI"
FT   gene            165302..165670
FT                   /locus_tag="BC1003_3670"
FT   CDS_pept        165302..165670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3670"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bpd:BURPS668_A1201 response regulator; PFAM:
FT                   response regulator receiver; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59610"
FT                   /db_xref="GOA:E1TIA2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIA2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN59610.1"
FT                   /translation="MPLPVLVVDDSTLARKLLIRSLPEEWDVEITQASDGASALELYRA
FT                   GKGAVIFLDLTMPVMNGFQVLEAIQHEGLNTFVIVVSADVQCGAVERAKALGAIGFISK
FT                   PVSPEAIRPILAEYGLHE"
FT   gene            165663..166265
FT                   /locus_tag="BC1003_3671"
FT   CDS_pept        165663..166265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3671"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: CheC domain protein; KEGG: bte:BTH_II1586 CheC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3671"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59611"
FT                   /db_xref="GOA:E1TIA3"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIA3"
FT                   /inference="protein motif:PFAM:PF04509"
FT                   /protein_id="ADN59611.1"
FT                   /translation="MNEQSLNEDQRDALQEICNVGMGKAAAALAKLLGAFVTLSVPDIR
FT                   LVGVEQLRTALGAQDEGQLRPVRQAFQSDISGEAIVLVGKDGQRELQQLMGHDVSAPDT
FT                   EVEVLCDITNLLVGACVQSVFEQLGRHICFSQPTLLPLAGKKQDALLPGGRWDVALLLE
FT                   IHFTLEEGGFGARMVLLLPDAAIRGMKEALDHFLEAL"
FT   gene            166349..167758
FT                   /locus_tag="BC1003_3672"
FT   CDS_pept        166349..167758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3672"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bte:BTH_I0615 response regulator; PFAM:
FT                   response regulator receiver; Metal-dependent hydrolase
FT                   HDOD; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3672"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59612"
FT                   /db_xref="GOA:E1TIA4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIA4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN59612.1"
FT                   /translation="MSELLASATPGAPRNVELAEPASPAAADTEAAPVPTLLLVDDEPG
FT                   VISSLKRLLRPLKYEVLSANSGAEALALLESAQVDVIISDMRMPNMDGAEFLARSRTMT
FT                   PDAIRILLTGYSEVDAVVRAVNEGHVYHYLHKPWDDQDLLLTIQRALEQLALHRKAERL
FT                   TALLQEQNGKLASFNMELEREVHARTEEIRQTVMFLEGAQQDLKSNFLTMVKVCANMVE
FT                   MRCGLPGHSARIGETARQLGAALGLSDYACNELLMAGLLHGIGKLFLPDALLKTPIAKL
FT                   QPQEAKLYQLHPLHGQMALTPVSQLSGVQTMIRHQYERYDGRGTPDGLIGGLIPLGARV
FT                   LALARDAEDLRIGVIAPQKMSDAQIISTVRAQSGIRYDPAIAEKYIELLTKHAELTPEG
FT                   VPDRVDASHLREGMKLADDLRTSRGTLLMTKGKVLSADQVAQIRRYELHEGEPFVILVE
FT                   RAADARKAEAV"
FT   gene            complement(167918..168403)
FT                   /locus_tag="BC1003_3673"
FT   CDS_pept        complement(167918..168403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3673"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_4769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3673"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59613"
FT                   /db_xref="GOA:E1TIA5"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIA5"
FT                   /inference="similar to AA sequence:KEGG:Bphy_4769"
FT                   /protein_id="ADN59613.1"
FT                   /translation="MNHLVDLICRAMVSGTAAGGAAAVTAGARARADGSTPYAPLNAVT
FT                   HCLWPRRAFSETGPSARFTLTGLAIHQASAIFWGVLFEGLLERWQCRVRRRAGVAEIAA
FT                   TAATTAAIAYTVDYHAVPSRLTPGFEVHLSKRSMFYVYAALAAGFAAAALCRSNDSD"
FT   sig_peptide     complement(168305..168403)
FT                   /locus_tag="BC1003_3673"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.328 at
FT                   residue 33"
FT   gene            complement(168403..168708)
FT                   /locus_tag="BC1003_3674"
FT   CDS_pept        complement(168403..168708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3674"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_5820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3674"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59614"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIA6"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_5820"
FT                   /protein_id="ADN59614.1"
FT                   /translation="MAGTDIRSTDLETHSDGTMRVKHRGVDIVVSAKQNDRGAWIALIE
FT                   ASVNGEPFPLPDMEPVTPEWTTHAEALRDGVERGCYLVERRAGHGLEDSAHGSGAS"
FT   gene            168784..169839
FT                   /locus_tag="BC1003_3675"
FT   CDS_pept        168784..169839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3675"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   bmj:BMULJ_04292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3675"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59615"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIA7"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADN59615.1"
FT                   /translation="MHRPLGRALSRVRVHGPITPLQQRVCRAMARAMLPSWSTPRSQDH
FT                   SDNDVKSTPGGIHIGISGWRYKGWRGTFYPKGLKQANELQYAAGLMQTIEINGTHYSLQ
FT                   SLDSWQHWYAQTPPGFVFSVKGARYLTHLLRFRDETATVACANFFAQGLLALKDKLGPI
FT                   LWQFPPSLRFDPEHMERFLSLLPRDTEAALALAQQHDQRVKTPYLQIDRKRKLLHAVEV
FT                   RHESFVDPAFVRLLRRHKVALVVSDSTEAWPQFEDLSAGFVYIRLHGTETKYSGEYSDA
FT                   SLERWARRIEAWSRGAQPADARLAAPQLQPPRAQTRDVYCYFDNDAKTNAPFDAQRLME
FT                   RLGLHAHEAAA"
FT   gene            complement(169858..170523)
FT                   /locus_tag="BC1003_3676"
FT   CDS_pept        complement(169858..170523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3676"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   bxe:Bxe_B0404 phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3676"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59616"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIA8"
FT                   /inference="protein motif:PFAM:PF03167"
FT                   /protein_id="ADN59616.1"
FT                   /translation="MATTRRTAKSTPAAEGETAASPEVHPDQQPATLDACRRCALWVNA
FT                   TQGVPGAGPKRAPIMMVGEQPGDKEDLAGLPFVGPAGALLDDALAEAGVARKEVYVTNA
FT                   VKHFKWTPRGKRRMHKTPAQREVDACRYWLERELENVGAHVIVALGATALKAVLEDPKS
FT                   RLQDSIGTVIEHGDRLVVATYHPSFALRAPDPETRQRAYAAIVAALQDAKKLAQRHKK"
FT   gene            170789..170959
FT                   /locus_tag="BC1003_3677"
FT   CDS_pept        170789..170959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3677"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3677"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59617"
FT                   /db_xref="GOA:E1TIA9"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIA9"
FT                   /inference="similar to AA sequence:KEGG:BC1002_6099"
FT                   /protein_id="ADN59617.1"
FT                   /translation="MTLLIYLVGWIIFIGGVAWGLMALHVAQHVIAIVAVILFGIAVIT
FT                   GATRARNRDRS"
FT   gene            complement(170919..172073)
FT                   /locus_tag="BC1003_3678"
FT   CDS_pept        complement(170919..172073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3678"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3678"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59618"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIB0"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1388"
FT                   /protein_id="ADN59618.1"
FT                   /translation="MNKTTPRARRYDVITDEAQFRALQPEWDTLWTRAQGHYYQSFSYC
FT                   WLAWQHVSKPHGRLLRCIVGREAGQLVVVWPLEAVKRAFWTYVVPLGPEGGDYTSVLVA
FT                   DDASATALIEGAWNTARRRCGADFIHLSYVRETLHLHTLISRARHVLFTEAHQASAARL
FT                   RGQGAWDDYCRSLGTLFGKRPGTFAKRLSKEGTVAVRVLDPAEERETASLIEWMFNCKR
FT                   SWSDRVGKRSVWLDSSAFELFLGKLIHSEEVPSMARLIVVTLNDAPVAGIIVSLGNPWA
FT                   SAIFAGYDPYYGRCCPGLIAVEQCVKWAFDNGYDLDFGVGAERFKAYWAHGEASRAWTT
FT                   QIVNSSWGLLAIHARRFVRALASGARRVTQRATSGRDCALASRR"
FT   gene            172594..173859
FT                   /locus_tag="BC1003_3679"
FT   CDS_pept        172594..173859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3679"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   bpy:Bphyt_5260 acyl-CoA dehydrogenase type 2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3679"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59619"
FT                   /db_xref="GOA:E1TIB1"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIB1"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADN59619.1"
FT                   /translation="MSAPISHDAAPHAAGIADAAQLFDDSPLTRRFAPVFERIAQGAVH
FT                   RERHRELAYAPVEWLREAGYTKLRVPVEYGGEGVSLSEFLALVTRLGEADSNLPQILRV
FT                   HGGFIESLLEYGDDALRERWFARIAQGQIIGGAVAERTAVTSNSVRLTQSGGACHLDGE
FT                   KYYTTGTLYADWVDVAAHDGQSDVRVLVRTDAPGLERIDDWDGFGQRLTGSGTARFTHV
FT                   PVTAENIYRRYDASAPRRNSVLTSYYQALHVANLAGISRAALRDAVAFTRGKTRTFGIP
FT                   GESSPRDNPLVQRVIGRLASLAYSTQSITASLARAIDDVVVARQQGRTTEETYFRLDIQ
FT                   TFQAQQIVIEQTLQAATLLFEAGGASATSETRRFDRYWRNARVLASHNPAIIREAAIGD
FT                   FYLNGNPHNERFGVARTAAVAA"
FT   gene            173948..174466
FT                   /locus_tag="BC1003_3680"
FT   CDS_pept        173948..174466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3680"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59620"
FT                   /db_xref="GOA:E1TIB2"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIB2"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1357"
FT                   /protein_id="ADN59620.1"
FT                   /translation="MKNLPAYEPPVDEQQLLLKWIRRARESQMSHYDMADLLSARDRQM
FT                   GWLVTVLAAFVGTAVFASLNTSGVSFEIRLLVGLVSVVAAVSSALQTYLRYAERAEKHR
FT                   AAGARYGAVRRRLEAVFAGDADALNGHYLSAIREELDRLAQDSPNVPPRNFYRTQRALS
FT                   TDPRRSTDA"
FT   gene            complement(174477..175178)
FT                   /locus_tag="BC1003_3681"
FT   CDS_pept        complement(174477..175178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3681"
FT                   /product="protein of unknown function DUF480"
FT                   /note="PFAM: protein of unknown function DUF480; KEGG:
FT                   bxe:Bxe_B1356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3681"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59621"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIB3"
FT                   /inference="protein motif:PFAM:PF04337"
FT                   /protein_id="ADN59621.1"
FT                   /translation="MNSTPDVPSRPSIRALTLLEGRVLGVLVEKQHTVPDSYPLSLNAL
FT                   TLGCNQKTGRSPVMNATEAEVLTALDGLKRLSLVMEGSSSRVPRFEHNMNRVLGLPSQS
FT                   AALLTTLLLRGPQTAAELRLNSARLHGFADISSVEAFLDELAANEPPRVVKLPRTPGER
FT                   EHRWMHLLCGEVSASEFAQSAASADESVPLSAFEALKAEQKRLADEVSRLQAVVRRMAA
FT                   ELGIDANDLDV"
FT   gene            175455..176024
FT                   /locus_tag="BC1003_3682"
FT   CDS_pept        175455..176024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3682"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein; KEGG: bxe:Bxe_B1355
FT                   putative outer membrane lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3682"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59622"
FT                   /db_xref="GOA:E1TIB4"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIB4"
FT                   /inference="protein motif:PFAM:PF08212"
FT                   /protein_id="ADN59622.1"
FT                   /translation="MRSSRLVLRASAISLAVGAVCLLGACALSPAGKSGNARVPEPAKP
FT                   VDLARYLGRWYEFARYDNRFEKNCEAVTADYAAREDGLIDVTNSCRKGGVEGPLDVSKG
FT                   RAKVVAGSGNAKLKVSFFGPFFFGDYWVLDHADDYSWSIVGAPGGRYLWILTREARPAA
FT                   SLKEALIERVRALGYDTSMLRITQHG"
FT   sig_peptide     175455..175538
FT                   /locus_tag="BC1003_3682"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.534 at
FT                   residue 28"
FT   gene            176117..176395
FT                   /locus_tag="BC1003_3683"
FT   CDS_pept        176117..176395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3683"
FT                   /product="transport-associated protein"
FT                   /note="KEGG: bpy:Bphyt_5271 transport-associated; PFAM:
FT                   transport-associated; SMART: Transport-associated and
FT                   nodulation region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3683"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59623"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIB5"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADN59623.1"
FT                   /translation="MTRSRFATPHDEDSDDANGARLSDATIAAEATRRLAWDAAVPART
FT                   VEVDVHDGRVTLYGELERLAQKLAALEDVARLFGVSGVCDRLVVKAG"
FT   gene            complement(176412..177620)
FT                   /locus_tag="BC1003_3684"
FT   CDS_pept        complement(176412..177620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3684"
FT                   /product="acetate kinase"
FT                   /note="KEGG: bxe:Bxe_B1346 acetate kinase; TIGRFAM: acetate
FT                   kinase; PFAM: acetate and butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3684"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59624"
FT                   /db_xref="GOA:E1TIB6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIB6"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ADN59624.1"
FT                   /translation="MNPDNGAHEGAHNGAHEGATNGTHQGASGQTILVLNSGSSSLKFG
FT                   LFAYADGDESLLLEGSAQGIGRGDGSLRISAPDGRVLVREEHVLESQTDALQKLSAVLA
FT                   GQHHAQPVAVGHRVVHGGPYLRTHQRLTPEVRRRLADAVHFAPLHIPPALALIDEAQKI
FT                   FGGAAHFACFDTAFHATLPPRAAQLPLPRRYGEAGVIRYGFHGLSYESLVTQLGAALPP
FT                   RAVFAHLGNGSSVCALQDGRSVDTSMGMTPTGGVPMGTRCGDLDPGVLLYLLRVEKLDA
FT                   DALETLLNRHSGLAGYADGESDMQALEQRAEAGDAHAALALDAFSAAVRKTIGGYAALL
FT                   GGIDLLVLTGGIGEHSAGMRKRICEGLAFLGLREDDPAGRVRVLHTEEEKQIARHCRAL
FT                   MRG"
FT   gene            complement(177633..180026)
FT                   /locus_tag="BC1003_3685"
FT   CDS_pept        complement(177633..180026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3685"
FT                   /product="Phosphoketolase"
FT                   /EC_number="4.1.2.9"
FT                   /note="KEGG: bxe:Bxe_B1345 putative phosphoketolase; PFAM:
FT                   Xylulose 5-phosphate/Fructose 6-phosphate
FT                   phosphoketolase-like; D-xylulose 5-phosphate/D-fructose
FT                   6-phosphate phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3685"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59625"
FT                   /db_xref="GOA:E1TIB7"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIB7"
FT                   /inference="protein motif:PRIAM:4.1.2.9"
FT                   /protein_id="ADN59625.1"
FT                   /translation="MAEAVSRPTPPQTLDPETLRNMDRYWRACNYLSAGMIYLLDNPLL
FT                   REPLAPEHIKNRLLGHWGSDPGQSFLLVHLNRLIKKLDLNMIYVSGPGHGAPATLANCY
FT                   LEGHYSEIYPDRSEDEAGMRRFFRQFSFPGGIGSHCTPETPGSIHEGGELGYSLSHGYG
FT                   AAFDNPDLIVTVMIGDGEAETGPLATSWHSNKFLNPVRDGAVLPVLHLNGYKIANPTVL
FT                   ARIPREELEALLTGYGHKPYFVEGDEPESMHQQMAATLEQCIGEIRAIQQHARANNDAT
FT                   RPRWPMIVLRSPKGWTGPKEVDGHKVEGSWRAHQVPIADPATNPASLALVEAWLRSYEP
FT                   ESLFDETGRLVEELRELAPKGARRISANPHANGGVLCKMLDMPAFRDYAVEVKRPASTY
FT                   SSPTQVLGTFLRDVMRRNMNNFRVFGPDETASNKLTAIYEASDKTWLADSQPNDADGGA
FT                   LSPDGRVMEILSEHTLEGWFEGYVLTGRHGLFATYEAFVHVIDSMFNQHAKWLEKAKRE
FT                   LGWRQPVPSINLLITSLVWRQDHNGFTHQDPGFLDVVTNKSPDVVRIYLPPDANCLLSV
FT                   ADHCLRSRDYVNVIVSDKQPHLQYLDMESAVTHCTKGIGIWEWASTDQGAEPDVVIACA
FT                   GDIATMEALAAVQILKQHFADLKIRFVNVVDLFRLMPEHAHPHGLSSRDFDSLFTTSKP
FT                   VIFNFHSYASLVHKLTYNRTNHDNLHVHGYHEKGNINTPLELAIINQVDRFSLAIDVID
FT                   RVPKLRGVGDHTKEWLRGQIIEHLAYAHAEGIDKEEIRNWTWTD"
FT   gene            180361..180486
FT                   /locus_tag="BC1003_3686"
FT   CDS_pept        180361..180486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3686"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3686"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59626"
FT                   /db_xref="GOA:E1TIB8"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIB8"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5274"
FT                   /protein_id="ADN59626.1"
FT                   /translation="MPTSNRLKAPLVLLLTLVLLCAGVAVLVGVFGLLVKLFGHL"
FT   sig_peptide     180361..180447
FT                   /locus_tag="BC1003_3686"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.439 at
FT                   residue 29"
FT   gene            180587..181117
FT                   /locus_tag="BC1003_3687"
FT   CDS_pept        180587..181117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3687"
FT                   /product="Ankyrin"
FT                   /note="SMART: Ankyrin; KEGG: bxe:Bxe_B1343 ankyrin
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3687"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59627"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIB9"
FT                   /inference="protein motif:SMART:SM00248"
FT                   /protein_id="ADN59627.1"
FT                   /translation="MTNPADSSSPSGQPVDPQLIELAQQVFDLARRGDAAMLAAVIEKG
FT                   VPPNLRNDNGDSLLMLASYHGHVDAVRTLLERGADPDLRNNNGQTPLAGAAFKGFEGVV
FT                   QTLLAHGADVEGASPDGRTALMVAAMFNRTAIMDLLIAHGANPDALDASGASALDAARR
FT                   MGAADAQAKLGSS"
FT   gene            complement(181114..181830)
FT                   /locus_tag="BC1003_3688"
FT   CDS_pept        complement(181114..181830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3688"
FT                   /product="haloacid dehalogenase domain protein hydrolase"
FT                   /note="KEGG: bpy:Bphyt_5276 haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3688"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59628"
FT                   /db_xref="GOA:E1TIC0"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIC0"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5276"
FT                   /protein_id="ADN59628.1"
FT                   /translation="MPAAQVTSSTAARSAPHEVVFLFDCDNTLLDNDHVLSDLRAHMMR
FT                   EFGTDNSTRYWEIFEQLRSELGYADYLGALQRYRTEHPRDTRLLLMSSFLIDYPFANRL
FT                   YPGALDALRHVGQYGPTVILSDGDVVFQPRKVARSGLWEEVEGRVLIYIHKELMLDQVM
FT                   ECYPARHYVMVDDKLRILTAMKKAWGGRLTTVFPRQGHYALDPKEILSNPQADVTVERI
FT                   GDLAQLDVKTLLAGKS"
FT   gene            complement(181876..182913)
FT                   /locus_tag="BC1003_3689"
FT   CDS_pept        complement(181876..182913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3689"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="KEGG: bxe:Bxe_B1341 6-phosphogluconate
FT                   dehydrogenase-like protein; TIGRFAM: 6-phosphogluconate
FT                   dehydrogenase, decarboxylating; PFAM: 6-phosphogluconate
FT                   dehydrogenase NAD-binding; 6-phosphogluconate dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3689"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59629"
FT                   /db_xref="GOA:E1TIC1"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIC1"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ADN59629.1"
FT                   /translation="MQLGMIGLGRMGADMVRRLTQGAQQCIVYDVQPAAVERLVQEGVS
FT                   GASSLEDLVARLDKPRAVWLMVPAAVVDGTLEKLVPLLDPGDIVIDGGNSYYHDDIRRG
FT                   AELAARQLHYVDVGTSGGVAGRERGYCLMIGGEAQVVARLEPIFAALAPGAAAAPATPG
FT                   RTPGSSTAEQGFLHCGPLGAGHFVKMVHNGIEYGLMAAYAEGLNILRHADAGKHAREAD
FT                   AETSPLRRPEFYQYDLNLADIAEVWRRGSVIGSWLLDLIAGTLAGDADLQRYAGRVSDS
FT                   GEGRWTMAAAIDEGVPAPVLSAALFARFSSRGEADFANRVLSAMRHDFGGHLEKPAEPP
FT                   QNLQG"
FT   gene            complement(183185..184555)
FT                   /locus_tag="BC1003_3690"
FT   CDS_pept        complement(183185..184555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3690"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: bxe:Bxe_B1339 major facilitator superfamily
FT                   sugar efflux pump; manually curated; PFAM: major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59630"
FT                   /db_xref="GOA:E1TIC2"
FT                   /db_xref="InterPro:IPR004750"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIC2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59630.1"
FT                   /translation="MPLQSTPPPVLKNSRFLGLLHIPGFKPLAAATLMLGVAMSFTAPY
FT                   LSLFGVERAGMTPFRLGVFMTLIAASGVLASTFAGRSCDASGRHRPMLLLALVLAALGY
FT                   LCLCVVRDYRLLLIVGVVFIGAGGSAISMVFSFSRAALPVPDAAERVFASATLRTILSA
FT                   AWVFGPSVGALVLAATSFTGLFLFAAASFAACAAIVWRMREPQGHLGDHTVEDTASEPS
FT                   ASITVPPLTEPGPDAHEDLPGVASANDIGRAVAALTLLGLAANATMIVLPLYIVHGLQG
FT                   THLDVSVMLGLGALTEIPMMLALGAKSSRLHKPNWLAACAAVHAAYFVGMSLAGNVQVL
FT                   IPMQILNAFVVAVTSCLGMTYVQDLMPLAPGRATALFFNAARVGSILSGVLSGLLVQAF
FT                   GYRGTFLFCGLLALCALVLFAVPGYRYPLMWRAVRRFARMQYDAFRARRSVRRGREL"
FT   gene            184866..185186
FT                   /locus_tag="BC1003_3691"
FT   CDS_pept        184866..185186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3691"
FT                   /product="Thioredoxin domain-containing protein"
FT                   /note="PFAM: Thioredoxin domain-containing protein; KEGG:
FT                   bxe:Bxe_B1336 putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3691"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59631"
FT                   /db_xref="GOA:E1TIC3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIC3"
FT                   /inference="protein motif:PFAM:PF00085"
FT                   /protein_id="ADN59631.1"
FT                   /translation="MATRKPYSTHAPTRAEIDALPGATVIEFGTDWCGYCQGAQPSIAK
FT                   AFEAHAGVRHMKIEDGPGRPLGRSFKVKLWPTLIFMRDGAEVARIVRPTSVEQISDAFA
FT                   SL"
FT   gene            185207..185626
FT                   /locus_tag="BC1003_3692"
FT   CDS_pept        185207..185626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3692"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   bxe:Bxe_B1335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3692"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59632"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIS2"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADN59632.1"
FT                   /translation="MRQAIHHLSVKARTRGLVEFTAEARRFVAAQQIQTGLLTLFCRHT
FT                   SASLLIQENADPSVQRDLERYFASLAPEDEQRYEHDAEGPDDMPAHLRTALTQVQLSVP
FT                   VEHGQMVLGTWQGLYLFEHRRHTQHRDIVLHLIGE"
FT   gene            185756..186778
FT                   /locus_tag="BC1003_3693"
FT   CDS_pept        185756..186778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3693"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: bxe:Bxe_B1334 fructose-bisphosphate aldolase;
FT                   PFAM: fructose-bisphosphate aldolase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3693"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59633"
FT                   /db_xref="GOA:E1TIS3"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIS3"
FT                   /inference="protein motif:PRIAM:4.1.2.13"
FT                   /protein_id="ADN59633.1"
FT                   /translation="MDTRSELQATVEAMVQPGKGLLAADESGPTIAKRFKTIGIESTEE
FT                   NRRAYRNLLLSTPGLGEYVSGVILYQETLGQKADDGTPFAELAARNGIVPGIKVDLGKV
FT                   ALAHAPGDEITEGLDGLARRFVDYKQQGARFAKWRAVYNIAANLPSRLAIEANADSLAR
FT                   YAAISQEAGIVPIVEPEVLMDGDHTIERSAEVTEAVLHEVFHALHRHRVVLEHILLKPS
FT                   MVLAGSESARPSSTAEIAAHTLRVLKRTVPAAVPGIVFLSGGQTPEEATANLDAMNRLG
FT                   PLPWNLSFSYGRALQEPPLQAWKGAAAQVKEAQQALLKRARLNSAAALGKYDAAQENQD
FT                   "
FT   gene            complement(187011..187307)
FT                   /locus_tag="BC1003_3694"
FT   CDS_pept        complement(187011..187307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3694"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3694"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59634"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIS4"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3892"
FT                   /protein_id="ADN59634.1"
FT                   /translation="MMIKKALLVTTLLAASSLAIAQGAGGSGGGAGGGPAGNDPSTSAG
FT                   ANASSREGGDMQGSGTSHSKMKKHSSKSSKKMKPATDTTNMPGANASSDTKGQ"
FT   sig_peptide     complement(187242..187307)
FT                   /locus_tag="BC1003_3694"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 22"
FT   gene            complement(187427..189580)
FT                   /locus_tag="BC1003_3695"
FT   CDS_pept        complement(187427..189580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3695"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="KEGG: bxe:Bxe_B1330 periplasmic sensor hybrid
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3695"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59635"
FT                   /db_xref="GOA:E1TIS5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIS5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN59635.1"
FT                   /translation="MQRAERVAVDFPMPSRNFTATRRVLLVVLAVSILFPLACLAGYGY
FT                   FDYQRRIADSNDMIDRLVRVAEEQAVKVLDLNQQMASRIVELIGTEDDAQIRARERQLN
FT                   QQLREIGGDFPQVASIYLLGAQGDLLVSTRAYPAPAVSVSQREDFVAARAMRPHFYFSL
FT                   PMHGALSQTNVFSTAIGRIGPDGGFLGVVSVALRTEYFSRFYRELTNADPSLALALYRQ
FT                   DGNLLVRYPPWPGGAKPPASDAFAAALRDKQLSGHVRVKSPVDGVERLVTFRRVGDYPL
FT                   YVTSAYARASIVDAWRQHFLVIAALTAVPCIAIWILVIYSLRQLEAERVAWERWQGEVA
FT                   MRLSAEASSRQLQRMGALGNLVANVAHDFNNLLMVVSANIDLARLKRYNNLEKEMNAVQ
FT                   RATATAESLTRRLLSVAKKQPLKQEPIDLKKWMPGAAPLLEAALGDHIELAFNIVDDVW
FT                   QVLADPTDLELAIMNLAVNARDAMPRGGRFVIRCQNHRLVGSDTLLPDGEYVLIACSDD
FT                   GEGMPESVARRAFEPLFTTKLSGSGAGLGLAQVLSMCEQAGGTAKIDSVQGSGTTVRLY
FT                   LPRHRERRPTNDVPQQAVEQPALRHAGLVLLVEDNEDVAAGVAAVLETFGCEVRHEPTA
FT                   DQAFDVLTGGERFELVLSDIQMPGKLNGIDLAEKVRNAWPSQKIALMTGYADELERARR
FT                   LGVAILAKPFNIEELHALVACES"
FT   gene            189720..191459
FT                   /locus_tag="BC1003_3696"
FT   CDS_pept        189720..191459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3696"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   bpy:Bphyt_5285 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3696"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59636"
FT                   /db_xref="GOA:E1TIS6"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIS6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADN59636.1"
FT                   /translation="MLARLRHRAQQLLGRKKTRCNFAGVHCRPLTLLTPARSCFLLADD
FT                   PETRMPITARHVAQFSQLREDRAQRVVVDDEKILLVRDGDTVRAYSADCPHAGGPLEEG
FT                   ALCRGRIVCPWHKGTFDAATGKVLEPPPLVPLERYAVIVDGDNVLVTPQKLPGETELAR
FT                   THEPHFVVIGAGAAGAAACAALREYGFTGRVTLIGDEPHAPYDRTSLSKFVPPNEMPPG
FT                   DVAPLLPTDWYEQHGVERLVAKVARLDVPARTIHLESGGELTYDTALLATGSTPTVPRI
FT                   SGCELAGVHVLRHLDDAAALVEALANSDTDGLTRDTASTRVAILGSSFIGLETAAALRK
FT                   RGAQVAVISPDKEPFAKQFGERVGAMFRELHERHGVQFHLQAKVASLEGEEGNVHEVML
FT                   ESGEHIAADVVLLGTGVAPATGFVEGLPLQHDGGVIVNAGMQAAPGLYAAGDIAVFPLY
FT                   ENEEPLRIEHWRVAQQHARIAAQNMCGARNRYDGVPFFWTYHFGKNFEYLGHASEWDEL
FT                   VVDGELERHDFAALYVKNDKVAAVLACNRDTQTAQLIEAMREGALTREQALRIVGRDSC
FT                   GTA"
FT   gene            191603..191773
FT                   /locus_tag="BC1003_3697"
FT   CDS_pept        191603..191773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3697"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3697"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59637"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIS7"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1328"
FT                   /protein_id="ADN59637.1"
FT                   /translation="MPETKEQHPNADKTEKQIDKEVEDTFPASDPPSTGGTTKIVTDDD
FT                   DKSSEDEATGK"
FT   gene            complement(191872..193944)
FT                   /locus_tag="BC1003_3698"
FT   CDS_pept        complement(191872..193944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3698"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bxe:Bxe_B1324 membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3698"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59638"
FT                   /db_xref="GOA:E1TIS8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIS8"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADN59638.1"
FT                   /translation="MKDIPEAPRGRPATRIDAPPAAFGLDALIALAVGAGLVACLYFAR
FT                   AVLIPMTLAILLSFLVAPLVKWLGRLKLGHVASVFAAVVISVSVIGVLGAVIAMQLTEL
FT                   AAGMPRYQATIERKMEAAHTLTVGKLDRFAKAAGQALQRATVEPSQPAPRRDASSADGR
FT                   APAAVPVEVREPVPTPLEVARRVLSPAISPLETAFIVFVVMVVILLQRDDLRDRAIRLF
FT                   GSRDLHRTTMVMDEAARRLSRYFVSQLGLNAALGVAIGAGLFFIGVPSPILWGILAALL
FT                   RLVPYVGIWIAGGLATALAAAVSPGWDMAVWCIALFVTVELLVGQVVEPLLYGRSTGLS
FT                   PFSVVVAAIFWSWIWGPIGLILSTPLTLCLLVLGRHIRRLEFLDVMLGDQPALTPVENF
FT                   YQRALAGDPDEAIAQAEALLRERSLSAYYDEVTIKGLQLAANDVVRGSVTTAQLARIES
FT                   TTNDLVDGLDSYPDEPPPRAAAAQPDAELGPVAPSREALPASMPAHRLFANHAARGDAE
FT                   ELPDNVSDTGAERDPQRIAERGAQNPPAAPRATSQRVLCIPGRGPLDPLATTIMLQLLG
FT                   KHGFTARGLPHEAASRASIDQLDADDVGIVCVVYLQIDGIPSHLRYMVRRIRARLPNVS
FT                   IIVGLWSAEDLEKWSVDLQNAMGADAYVTSLQEMLAVCHSRGDSTSDAPVAVASA"
FT   gene            complement(193996..194175)
FT                   /locus_tag="BC1003_3699"
FT   CDS_pept        complement(193996..194175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3699"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3699"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59639"
FT                   /db_xref="InterPro:IPR021327"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIS9"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5288"
FT                   /protein_id="ADN59639.1"
FT                   /translation="MEQDETSQEDQIRTRAYYLWEHAPEPKGTPDEYWEQARSEIEKEA
FT                   PPVENGPIAEEPKK"
FT   gene            complement(194314..196530)
FT                   /locus_tag="BC1003_3700"
FT   CDS_pept        complement(194314..196530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3700"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; KEGG: bxe:Bxe_B1322 glycogen operon
FT                   protein GlgX; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59640"
FT                   /db_xref="GOA:E1TIT0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIT0"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ADN59640.1"
FT                   /translation="MSTPASNLTRIAEGTPFPLGATWNGTGVNFALFSAHATKVELCLF
FT                   DETGQNEIERIELPEYTDEVWHVFVPNLKPGAIYGYRVHGPYEPEKGHRFNPNKLLLDP
FT                   YAKAHIGELKWAPEIFGYTLDSEEGDLSFDERDSAPFVPKCKVVDATFSWTHPERNPLP
FT                   WDRVIFYETHVRGFTKRHPQVPENLRGTFAGMGQKAVIDYIRSLGVTSVELMPIQTFVN
FT                   DSYLLEKGLTNYWGYNTIGFFAADPRFFASSTESVGEFKGMVDAFHNAGLEVILDVVYN
FT                   HTAEGNERGPTLSFKGIDNASYYRLMPDEPRYYINDTGTGNTLNLSHPRVLQMVTDSLR
FT                   YWVTEMKVDGFRFDLATILGREPHGFDEGGGFLDSCRQDPVLSSVRLVAEPWDCGPGGY
FT                   QVGGFPPGWAEWNDRFRDTVRAYWKGDEGMVPDLATRMTGSGDKFNRRGRRPWASVNFI
FT                   AAHDGFTLNDLVSYNDKHNEANGEDNNDGHSDNRSWNMGVEGPTDDPEIRQQRERQKRN
FT                   LLATLLLSQGTPMLLAGDEFGRTQKGNNNAYCQDNEISWVDWEGIDEDGQALTEFVRKL
FT                   TTLRHRLPVLRRSRFLTGEYNEALDVTDARWLAPDGTDLTPEQWADPAMRCFGLVIDGR
FT                   AQASGIRRPASDATLLLVLNAHHDVVNFQLPDVPEGERWTCLLDTNMPVRAELPQFSAG
FT                   DEYQVTARSLLLFALEAPSRATQRVFAKLEEQLTSDESEAPPAA"
FT   gene            196723..197124
FT                   /locus_tag="BC1003_3701"
FT   CDS_pept        196723..197124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3701"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   bpy:Bphyt_5290 PRC-barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3701"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59641"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIT1"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ADN59641.1"
FT                   /translation="MRNLQSRTLLAAALFAGTLTCTLNVHAQGAPQSITERRTDVVQLA
FT                   SGYRASKLTGADVFNKNKDTIGTVDDLIVSPGGDRSTYAILSVGGFLGMGKHLVAVPFN
FT                   DLQITNRRVVLPEATKKSLEALPEFKYAD"
FT   sig_peptide     196723..196806
FT                   /locus_tag="BC1003_3701"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            complement(197301..199550)
FT                   /locus_tag="BC1003_3702"
FT   CDS_pept        complement(197301..199550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3702"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: bxe:Bxe_B1320 xanthine
FT                   dehydrogenase, molybdenum binding subunit apoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3702"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59642"
FT                   /db_xref="GOA:E1TIT2"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIT2"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ADN59642.1"
FT                   /translation="MNRIETLPALRASGVPHKRVDGRLKVTGAAQYAADFTAKGLTYGF
FT                   VVSSTIAAGRIVSIDSSAALALPGVLHVMTYQNRPELPREDKPYKDMVAPGGSPLRPLW
FT                   DDRVWYSGQPVALVLAESLELARHAASLVDVRYESAPHQTDMGEVLMNAEPPSTEKGGF
FT                   DPPPAPRGDADTALASAVARVDAFYSTPAEYHNPMEMHGCTVVPDEHGHLTVYEKTQGV
FT                   MNTKSYLTAVFGLKDDELQVVSPFVGGAFGSGLRPQYHLALAVMAALELKRPVRLTLTR
FT                   QQMFTFAHRPQSIQRVALGAAADGRLQAVIHEAVSETSQYEDYCDVVVNWAGQLYQCDN
FT                   VTLGYKVARLDVPTPADMRAPGAAQGLFPLEVAMDELAEALQMDPLELRLINYAERDAN
FT                   KNLPFSSKALRDCYREGAARFGWDRRPLAPRARREGNELIGWGMATGAWDAMQNEASAR
FT                   AVLTRDARVTVSSSTADIGTGTYTAMTQIAADALGVPLHDVVFELGDTRLPKAPLEGGS
FT                   WTVSSVGSAVDAACRRLHNRLVELARQYGGARFAAAAREDIRRMGKRIVCGSGTDDAID
FT                   IDTLLARAGLETLEEQASVKPHEKQQAYSMGTHSAIFAEVRVDEALGTVRVTRVVSAVA
FT                   AGHIVNPKTAANQVAGGVVWGISMALHEEGQFDHDIGRQMNHNLAEYHLPVNADIHEID
FT                   VLFVEEHDDIVNPLGVKGVGEIGVVGVAAAVCNAIWHATGKRVRELPITLDKLFA"
FT   gene            complement(199547..200551)
FT                   /locus_tag="BC1003_3703"
FT   CDS_pept        complement(199547..200551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3703"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   bxe:Bxe_B1319 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3703"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59643"
FT                   /db_xref="GOA:E1TIT3"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIT3"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ADN59643.1"
FT                   /translation="MNRFSYTRASEVRQAIQQHRENGAAAFIAGGTNLVDLWREDVVRP
FT                   QFVVDINRLPLKQIEPTAAGGLKIGALVTNSAAAYDATVNARYPLLAKAILAGASPQIR
FT                   NVASVGGNLLQRTRCLYFYDVGTRCNKREPGTGCPAMEGVHRMHAILGASEHCIAVHPS
FT                   DMCVALAALDATVHVSGPEGSRVLPFADFHRLPGDTPHIDTNLGDDELITAVELPKQGF
FT                   AAHHAYVKVRDRASYAFALVSVALGLELDGDTIVEAHCALGGVAHKPWRDVNAEASLCG
FT                   KPLNADTVRSFATDLLRDARGRRGNAFKIELTARAIERAFALAAQRSLEEPAP"
FT   gene            complement(200548..201081)
FT                   /locus_tag="BC1003_3704"
FT   CDS_pept        complement(200548..201081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3704"
FT                   /product="(2Fe-2S)-binding domain-containing protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain-containing protein;
FT                   ferredoxin; KEGG: bxe:Bxe_B1318 2Fe-2S iron-sulfur cluster
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3704"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59644"
FT                   /db_xref="GOA:E1TIT4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIT4"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADN59644.1"
FT                   /translation="MNTSTAEMPLDVVPDDVQRMPVSFEINGKRHEFQLQAWTSLLDLL
FT                   REHCHLTGTKKGCDHGQCGACTAIVNGQRINTCLALAVVYDGASITTIEGLANGEALHP
FT                   VQQAFIDHDAFQCGYCTPGQICSAVAMLQEGHAKTADEVRELMSGNLCRCGAYTNIVAA
FT                   ILDAADKTDAGARP"
FT   gene            complement(201258..202124)
FT                   /locus_tag="BC1003_3705"
FT   CDS_pept        complement(201258..202124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3705"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bxe:Bxe_B1317 short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3705"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59645"
FT                   /db_xref="GOA:E1TIT5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIT5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59645.1"
FT                   /translation="MSDTERPTPPFEGQQQDQTPGRTAPMQPQPDHGEKSYKGSGRLAG
FT                   KAAIITGGDSGIGRAVAIAFAREGADVLIAYLNEDDDARETARWVEEAGRKAVLMPGDI
FT                   TDRAHCNAIVDKAVQEFGRLDVVVNNAAYQMTYPSLDAITDEEWDKTFDTNIGAMFRIT
FT                   RAAVKHMRPGGAIVNTTSINADHPNPGLLAYATTKGAIQNFTGGLAQLLAEKGIRVNCV
FT                   APGPIWTPLIPSTMPPEKVEKFGQQVPMKRPGQPAELAPAYVMLASDEASYISGATIAV
FT                   TGGSPII"
FT   gene            complement(202417..202875)
FT                   /locus_tag="BC1003_3706"
FT   CDS_pept        complement(202417..202875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3706"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bpy:Bphyt_5291 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3706"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59646"
FT                   /db_xref="GOA:E1TIT6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIT6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN59646.1"
FT                   /translation="MTLDNRLDDSEDVVVWRPIQYAMASHRRVLVVDDYREAADALQML
FT                   LNADGFECRALENPHEVCDMACAWQPFAVVLDIKMPGLDGFELARRLRAHPATAHMLLV
FT                   ACTAFASRDDRARARAVGFDAHCAKPLTPERLLRVLESAAALHAAGPP"
FT   gene            complement(202990..204675)
FT                   /locus_tag="BC1003_3707"
FT   CDS_pept        complement(202990..204675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3707"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; ATP dependent DNA
FT                   ligase domain protein; KEGG: bxe:Bxe_B1315 ATP-dependent
FT                   DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3707"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59647"
FT                   /db_xref="GOA:E1TIT7"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIT7"
FT                   /inference="protein motif:PFAM:PF01068"
FT                   /protein_id="ADN59647.1"
FT                   /translation="MKRFAALYTALDATTSTHDKLEALTSYFSIAEPEDAAWASYFLAG
FT                   GKPRQSVPTRLLTEFARERAGLPAWLFEESYHAVGDLAETIAHILPPAQRSSELGLTQW
FT                   IEQRVLPLRGLAPEELRTRLFSYWDELDWSGRFLLTKLIGGGFRVGVARQLVVRALAEV
FT                   AGIDHKRIAQRMVGWTDSRQKPDAARYLRLIAPEATDVAGDDAQHATERHDSDLGLPYP
FT                   FFLAHPLQTEPGTLGDPSRWLIEWKWDGIRAQLVKRAGRVWLWSRGEDLITDRFPEVAA
FT                   LGEALPDGFVIDGEILAWEPGAAAPLPFARLQPRIARKTLTKKVLADSPAALLAYDLLE
FT                   AHGEDLRMAPLIERRARLDSLALSLENPLARDLLRVSPLVCGADWQALAALREESRARG
FT                   VEGLMLKERESLYGVGRTKASGTWWKWKIDPYAVDAVLVYAQRGHGRRASLYTDFTFAV
FT                   WDEANGVRTLVPFAKAYSGLTDEEMRQVDAIVRKTTIEKFGPVRSVTPTLVFEIGFEGI
FT                   QASSRHKSGVAVRFPRMLRWRTDKHIDDADTLAMLKGFIDDRAA"
FT   gene            complement(204672..205850)
FT                   /locus_tag="BC1003_3708"
FT   CDS_pept        complement(204672..205850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3708"
FT                   /product="putative exonuclease involved in mRNA processing"
FT                   /note="KEGG: bxe:Bxe_B1314 putative exonuclease involved in
FT                   mRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3708"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59648"
FT                   /db_xref="GOA:E1TIT8"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIT8"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1314"
FT                   /protein_id="ADN59648.1"
FT                   /translation="MAFEPASTIAADHAGPGDLVIARPEGLYCPPGDFYIDPWQPVERA
FT                   VITHAHSDHARFGHRHYLGSRAGANVLLSRLPDISLQTLAYGERLDINGVTVSLHPAGH
FT                   VLGSAQLRIEHLGRVWVASGDYKLDPDPTCDAFEPVRCDTFITESTFGLPIYRWDAPQS
FT                   VFDGVDSWWRHNAAQGRASVLFCYSFGKAQRVLASVDAAIGPIFCHGAVEPLNRAYREA
FT                   GVRLPPIRLVSEIAPKDKAVFKEALIVAPPSAQGSAWLRRFGDYSDAFASGWMRLRGAR
FT                   RRRGVDRGFVLSDHADWPALQTAIHASGAERVIVTHGSVEPMVRWLREQGLEAGAFATQ
FT                   YGDDTVEADALGGAETVAPDPAARGAVAQDSLAPEHSNEGSAAELDDTASRS"
FT   gene            206061..206963
FT                   /locus_tag="BC1003_3709"
FT   CDS_pept        206061..206963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3709"
FT                   /product="ribonuclease BN"
FT                   /note="KEGG: bxe:Bxe_B1313 ribonuclease BN; TIGRFAM:
FT                   ribonuclease BN; PFAM: ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3709"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59649"
FT                   /db_xref="GOA:E1TIT9"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIT9"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ADN59649.1"
FT                   /translation="MPFIIDRRTLYVAQHPGRFTLETLKAFRANQGLLLAGAVAYYALL
FT                   SIVPLMILIVIALSRVVPQHLLLPALGHLLQWLVPGQSRALVQELANFLAHRAVIGWVL
FT                   FVTMLFFSSLAFTVLENAMSLIFVHRVAIRRRHFLLSALLPYCYILFLGVGALIVTVVS
FT                   SGLEAVGAEGFDFFGTYVSLQGPSRVLLYLLGLAGEIFVLTSIYMVMPVGRPSIRHALF
FT                   GGIVAAVLWEITRHVLVWYFATLSQVSVVYGSLTMAIVILFSLEWLATLLLFGAQVIAQ
FT                   YERFGLEPQGAPKQPIKTG"
FT   gene            207136..208212
FT                   /locus_tag="BC1003_3710"
FT   CDS_pept        207136..208212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3710"
FT                   /product="AFG1-family ATPase"
FT                   /note="PFAM: AFG1-family ATPase; KEGG: bpy:Bphyt_5297
FT                   AFG1-family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59650"
FT                   /db_xref="GOA:E1TIU0"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIU0"
FT                   /inference="protein motif:PFAM:PF03969"
FT                   /protein_id="ADN59650.1"
FT                   /translation="MLDEALVASKLAERGLVPDARQRAAIAALVALFVTPRGGRDSRYQ
FT                   GVYCHGLPGRGKSLVVDTVFDLVEGRKRRLHFHEFLREMNQRLVNEPRGDDRLGSVSKQ
FT                   WLDGIELLCFDEFHVHDIADAFLMGRFLDTAIKLGTRIMLTSNYAPDSLLSDPEFHERF
FT                   VPTIQQIKQHFCVIHFDGARDYRFGGEAHPSPRFFSPLDAATGNALRDVFLRHESSGAL
FT                   EATKVSAAGRPLIARAVGAAMLWADFETLCVESRSHLDYLDLAERWHGFIVDNVHTGWL
FT                   SRSHTLQRLVWLVDILYDRKRALFIASDQPIHAALRGLEGAHDLSRTLSRLAEMGSRAY
FT                   RNTLDDAPAQPMPSRSES"
FT   gene            208333..209418
FT                   /locus_tag="BC1003_3711"
FT   CDS_pept        208333..209418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3711"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3711"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59651"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIU1"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5298"
FT                   /protein_id="ADN59651.1"
FT                   /translation="MIRTASLAAALCAACLSSACVHIGPSRLKADQVDYARALGDAKKR
FT                   EILAAVVGLRYGDAPAFLTVSSIIAAYTFDASGGATANAGSGSQPNYALATGSVSYSNH
FT                   PTFTFTPTTGEAFASAYIRPLAPALVLPLAEGGIPIDLLLRITAQSVGGLQNGNALGGE
FT                   NSAGAPGFFELLRALRRLQLAGELNVESRKVGEKNDQMSVFLVMGATTSGDSPQISADV
FT                   ARVRKLLHLSSNTRSYEIVYGPSSAWHKADKIPMVTRSVLGILTDLGAQVQVPTERISD
FT                   GSTKPTVGLIGGETRPTIIVHSGKTAPDNAYVTIPYGASAYWVERNDFDSKYAFTVVQN
FT                   LMALAEADTSNKAPVVTIPAN"
FT   sig_peptide     208333..208398
FT                   /locus_tag="BC1003_3711"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.410 at
FT                   residue 22"
FT   gene            complement(209448..211532)
FT                   /locus_tag="BC1003_3712"
FT   CDS_pept        complement(209448..211532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3712"
FT                   /product="transketolase"
FT                   /note="KEGG: bxe:Bxe_B1309 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain-containing
FT                   protein; Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3712"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59652"
FT                   /db_xref="GOA:E1TIU2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIU2"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADN59652.1"
FT                   /translation="MQNDPALDQLCINTIRTLSMDAVQKANSGHPGTPMALAPVAYHLW
FT                   QNHLRYDPEEPLWPNRDRFVLSVGHASMLLYSLLHLANVKAVDEDGKPTGQPAVSLADI
FT                   ERFRQIDSKTPGHPEYRMTTGVETTTGPLGQGLGNSVGMAMAARWYESRFNKPDAPLFD
FT                   YRVYALCGDGDMMEGISHEAASLAGHLKLSNLIWIYDSNRVTIEGHTDLAYSDDVESRF
FT                   RGYRWHTLHVDDANDAAALEAALVEAKSVTDRPTLIVVNSVIGWGAPNKQDTAAAHGEA
FT                   LGVEEVALTKKFYGWPEDKFFYVPDGVHERFAAGIGARGKAAREEWQARYDAYSKQYPE
FT                   LSREFALIEAHDLPVGWDNDIPTFDADPKGMASRDSSGKVLNAIAARVPWIIGGAADLA
FT                   PSTKTNLKFEGAGSFEYDNYGGRNLHFGIREHGMGAVVNGLALSNLRPYGSTFLIFSDY
FT                   MKPPIRLSAIMEVEAVYVFTHDSIGVGEDGPTHQPIEQLASLRGVPGLTVLRPGDANEV
FT                   AQAWRVALAQKRRPACIVVSRQPLPTLDRSRYASAEGVKKGAYVLADAPDGQKPQVILL
FT                   ATGSELSICVDVYEKLKAEGIAARVVSMPSWDLFERQDEAYRDSVLPPDIDARVAVEQA
FT                   ASLGWDRYVGRQGAQVVMHTFGASAPLADLKKKFGFTPEHVYEAAKQQIARVQAKSAGQ
FT                   "
FT   gene            complement(211839..212384)
FT                   /locus_tag="BC1003_3713"
FT   CDS_pept        complement(211839..212384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3713"
FT                   /product="Cupin domain protein"
FT                   /note="PFAM: Cupin domain protein; KEGG: bxe:Bxe_B1308
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3713"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59653"
FT                   /db_xref="GOA:E1TIU3"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014500"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIU3"
FT                   /inference="protein motif:PFAM:PF00190"
FT                   /protein_id="ADN59653.1"
FT                   /translation="MQEKSTHAFDAMQTEYEAFMLEPHDWVPNNRKLPVVVYRQAVDPA
FT                   IGDVAAAFEVLFARNQWPPQWRDGIFDYHHFHSTAHEVLGVSEGSAEVIVGGPGGKVVS
FT                   VSVGDVLLLPAGTGHCLQSFEGRFRVVGGYPAGQQWDIRREALTPQELAAMQAVPFPGM
FT                   DPVDGEHGPLCEHWLNAA"
FT   gene            complement(212597..212767)
FT                   /locus_tag="BC1003_3714"
FT   CDS_pept        complement(212597..212767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3714"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_05543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3714"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59654"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIU4"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_05543"
FT                   /protein_id="ADN59654.1"
FT                   /translation="MQQDNEPLNPGDEAPPDAPGVGEDICRACHGTGKVEGKQCTVCGG
FT                   TGKVLQGIGGG"
FT   gene            complement(212794..213198)
FT                   /locus_tag="BC1003_3715"
FT   CDS_pept        complement(212794..213198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3715"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3715"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59655"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIU5"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3925"
FT                   /protein_id="ADN59655.1"
FT                   /translation="MQPGTQPESHADTKPGTTPNAKSETKPETMPNIAPDTRTDAQRDT
FT                   QPDMQSGTSRANANAAEPSPEVKARNQPSGTHYVEPSPLGIEPVVQTGVDRQTNPPRSN
FT                   QHPEQTAEVPLGTGAHGEPAGGGGRASHKN"
FT   gene            213501..213737
FT                   /locus_tag="BC1003_3716"
FT   CDS_pept        213501..213737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3716"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3716"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59656"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIU6"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3926"
FT                   /protein_id="ADN59656.1"
FT                   /translation="MPITTIRVSDTEVQVERTLYTFAQKSDADAFAQCVVNDSIDTCYR
FT                   SHPPLSARPTVPDEHPDDPNRGSTISPSLGGMP"
FT   gene            complement(213813..214058)
FT                   /locus_tag="BC1003_3717"
FT   CDS_pept        complement(213813..214058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3717"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3717"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59657"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIU7"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1305"
FT                   /protein_id="ADN59657.1"
FT                   /translation="MARHKADVADDEFEIFASYHGTGDGRYVGGLKVLRKADRRILFPF
FT                   DGAPEIGPYETADEARRAAIEYGKQIVAADRASPEK"
FT   gene            214298..214513
FT                   /locus_tag="BC1003_3718"
FT   CDS_pept        214298..214513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3718"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3718"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59658"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIU8"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5305"
FT                   /protein_id="ADN59658.1"
FT                   /translation="MSLSNTYDAAARVMHTPTPPEIDPEAPPAPNIDPDPPPAPDDDPG
FT                   GAPPGAPEGDPPATPPPVHALQRVRH"
FT   gene            complement(214668..215774)
FT                   /locus_tag="BC1003_3719"
FT   CDS_pept        complement(214668..215774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3719"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bpy:Bphyt_5307
FT                   porin gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3719"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59659"
FT                   /db_xref="GOA:E1TIU9"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIU9"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ADN59659.1"
FT                   /translation="MRLPTKLVAALALASPLAYGQTSVTLYGRLDAGIEYMNHIDNGTG
FT                   ASSSRWRAEGGDWGTSMLGLKGAEDLGGGLKAIFNLETGLQVMDGTTSGGRLWSRRAFV
FT                   GLSSQQWGTLQAGRNLFIDSDGVWEFDPFVQQAFSSASLVRGRNWQQTSNNVEYHSPVF
FT                   WGFDVQAQYAFGNQPGAFNSGASGEFGRSDGIMLTYHSQLFDVRGIYDELRDSNGRFSN
FT                   IFQSSREYFVGANVHFDAVKIQGAYTHYSAPDSPAGVADTADHYWLGATYNFQPRWAVT
FT                   AGGYYVKVGDGAGDSAHDPSGHAMMYVLGTTYNLSKRTFLYGTVGYVRNSGNANFSLQA
FT                   SPRDATNNTNPLVGESQTGAYVGMLHQF"
FT   sig_peptide     complement(215712..215774)
FT                   /locus_tag="BC1003_3719"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.975 at
FT                   residue 21"
FT   gene            complement(215966..216646)
FT                   /locus_tag="BC1003_3720"
FT   CDS_pept        complement(215966..216646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3720"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: bpy:Bphyt_5311 multiple antibiotic
FT                   resistance (MarC)-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59660"
FT                   /db_xref="GOA:E1TIV0"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIV0"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ADN59660.1"
FT                   /translation="MVESLIADILFGFTGLISIINPIGVAFVFLDRTASLTTDERTALA
FT                   RKIAINVVCVLLVAFFIGTPILHFFGISMEALRIGGGLAVAVGGWQMLNAPDTQAAEQP
FT                   GVKRVDAENAKSRAFFPLTIPLTTGPGSIATAIALTANRTHKLSEFVLSGIASVVISLA
FT                   VALTVYLVYSRSVVFARYLGAEGTKVAMRVSSFLLLCIGVQIMLTGFSEFLIPIATMQP
FT                   VPGR"
FT   gene            217018..217233
FT                   /locus_tag="BC1003_3721"
FT   CDS_pept        217018..217233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3721"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3721"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59661"
FT                   /db_xref="GOA:E1TIV1"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIV1"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5312"
FT                   /protein_id="ADN59661.1"
FT                   /translation="MLLRVLAALPFIGILLGVPFVNRVEPLVLGMPFVLGWIVAWVVLS
FT                   SVIMAIVYRLDRSNQQIAADSEEVRP"
FT   gene            217230..218702
FT                   /locus_tag="BC1003_3722"
FT   CDS_pept        217230..218702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3722"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bpy:Bphyt_5313
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3722"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59662"
FT                   /db_xref="GOA:E1TIV2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIV2"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ADN59662.1"
FT                   /translation="MSALVIIAAITLFALFLGVRAKHGHDMSLEQWTVGGRSFGTAFVF
FT                   LLMAGEIYTTFTFLGGSGFAYGKGAAVYYILAYGTLAYILSYWMLPPIWRFAKQQRLVS
FT                   QPHFFTRKYESPALGTLVALVGVAALIPYLVLQLKGLGIIVATASYGAISSTAAIWIGA
FT                   AVVTAYVIVSGVRGSAWNSVVKDLLILAIVLFLGIYLPLHYYGSLGEMFHAIDAARPGF
FT                   LTFPAKGSSVTWFQSTVLLTALGFFMWPHTFGSIFTAKDERIFRRNAIVLPLYQLILLF
FT                   VFFVGFAATLKVPGLKGGDIDLSLFRLSLQTFDPWFVGVIGAAGILTALVPGSMILTSA
FT                   STLLANDVYRGMVNRNASDASVAKLARILVPVVALVAVAFTLHGGETIVALLLMGYSFV
FT                   TQLFPAVVCSLFPHNRATRQGAFCGIVAGVAVVAITTTMHLTIAQLMPFLPDALKDVNI
FT                   GFVALAVNVIVFVIVSAMTQSGRVEQAQASAH"
FT   gene            218977..220578
FT                   /locus_tag="BC1003_3723"
FT   CDS_pept        218977..220578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3723"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="PFAM: Starch synthase catalytic domain-containing
FT                   protein; glycosyl transferase group 1; manually curated;
FT                   TIGRFAM: glycogen/starch synthase, ADP-glucose type; KEGG:
FT                   bpy:Bphyt_5314 glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3723"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59663"
FT                   /db_xref="GOA:E1TIV3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIV3"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ADN59663.1"
FT                   /translation="MPLNVLLVASEALPLAKSGGLGDMVSAYASALRDAGVDVSILMPA
FT                   YPAALEKAVDVAPVARMTGLPGGDARLLRGRMPDSGVTVLLLQMDHLFAREGLYRDPQG
FT                   RDYLDNLTRFASLAAAATRVARGVRNLKRPDIVHAHDWHAGLTPLYMRLAGVAAKSVFT
FT                   IHNLAFQGNHPLAMGGWIGVPPELLVPALTDERSIEFYGSLSMMKAGIVHADRVTTVSQ
FT                   RYAREILTPRFGHGMEGVLQAQAAKLAGIVNGIDTSVWNPATDAYIARPYSVDDTAGKQ
FT                   ACKRELQQACGLTRDPFAPLVAIGSRLTEQKLADVVIRALPVLLEQHPRLQFAILGQGE
FT                   RALEHAMQELAAAWPGRVGVQIGYDERRAHMLHAGADILLHGSRFEPCGLTQLYAMRYG
FT                   TIPVASRVGGLADTIVDYAPDCARGEDCATGFLFDGEDTYDVVQALGRALAAFMRPTSW
FT                   HALQRNAMSRDSSWEASTWSYLALYADLVDARPALRDTRVRKTPGRARTAGSAAARQVH
FT                   RDEAFGAGVGEMVRSA"
FT   gene            complement(220780..221928)
FT                   /locus_tag="BC1003_3724"
FT   CDS_pept        complement(220780..221928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3724"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bpy:Bphyt_5319 diguanylate
FT                   cyclase; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3724"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59664"
FT                   /db_xref="GOA:E1TIV4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIV4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADN59664.1"
FT                   /translation="MAAEASKTSTRIPEPLFAWRPGLLRVNGRPLTPGPATLAVASLLC
FT                   LLIGLLYLALQIRTVFSDQVKQEYASLVLEAVEQAGTARARVGAWDQVPGAHDAAANGY
FT                   RDARAELTRRLASLAALINASPAGAPRMPSSVLLPDATLAEMDALLSNASSYWHAQRDA
FT                   HSADIRKRITLVSRMLIALAALLFCMLITALGMYARRNRLLAGQSHEFEHAALHDPMTG
FT                   LANRRKLVAELQEAAMQASADASARKMAVLYVDLDGFKQVNDSLGHRVGDEFLIEVSKR
FT                   FRESVRKEDLVARIGGDEFAVLVRQFSAQDELRHIAQRLIGCVAHTDKQMGMGMVRASI
FT                   GIASYPDLVDDYRRLVAAADEAMYEVKRGGKDGYAFASRAAR"
FT   gene            complement(221888..222787)
FT                   /locus_tag="BC1003_3725"
FT   CDS_pept        complement(221888..222787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3725"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3725"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59665"
FT                   /db_xref="GOA:E1TIV5"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIV5"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5320"
FT                   /protein_id="ADN59665.1"
FT                   /translation="MYNDPDLPHVRADHDDDGLDPRTAQATDMTPRFGRLALCVAAASA
FT                   LAFGVVGTVAYGVWFNSDQQTYAEAIARARQALRMPAPNHTASMLATASERSGSLPATA
FT                   APTAPATVAATPGPLVMPAPGASARSPTAPATVATTAGPLVMPAPDALARSPAVATSSP
FT                   ADAIALLDLPAIPAQSSAATVDERRKPSTWAGEISRPQDEAVLADDAADARSSLAAAPA
FT                   IAPRATQAAATAAPAAVPQLASTRPAREAKSAQQERRASASNARRKGNLFARMGSFFRR
FT                   VSYRQHGSGSQQDLYSHP"
FT   gene            complement(223544..225709)
FT                   /locus_tag="BC1003_3726"
FT   CDS_pept        complement(223544..225709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3726"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: bpy:Bphyt_5329 peptidase M1 membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3726"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59666"
FT                   /db_xref="GOA:E1TIV6"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIV6"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ADN59666.1"
FT                   /translation="MRINFRLQIQCLALAGTMALAGCGGGDGSASLTSKSAQAPASASD
FT                   TPVVPASAAVADTSIDKTVQPVELPNTVTPVNYKLWFRPNPALSSFDGRADVQIKVLKA
FT                   VNAITIAGHRIKFTNGTIMLQPGNIALIATPQDDGDFYQLRPVSGQIAAGNYSLHMEWS
FT                   GIINFKSYDDPVTKTGGSCGDDPYPGCSAAEGVFRVDLKATDGSTSGAILTQGESNLAR
FT                   QWFPGWDEPAFRPTYEVSAEVPQNWNVVSNAAEKPAVNVGGGYKLVSFEKTPPMPSYLL
FT                   FFGGGQFDILEDDFTSPLPDGKGLHLRIFTPPGMRDWAKPAMQQTKQALDYYYRYTGIP
FT                   LPLTKFDTIAANDAFKEQKDLNFGGMENWGAILEFADDILPAPGTSMSDYGVTVLTHEA
FT                   AHQWFGDLVTLDWWDDVWLNESFATFFENKTKVRFFPDRFSWVDDVKNKYAVINADLKA
FT                   TAFPVQPNFNGWASNDFVLSASAFTYDKGGHVLKMLENYLGEETMRKGLQQYLADYALG
FT                   NVTPKRLWDELTKASGQPMGAIGDSFVRQTGVPLISLDTQCDLTTNQTIVTLKQAPFPN
FT                   QNQYPGTQWTIPLTLAYGDGLTSRKTVAMKDLQTQVRLNGCSAVLADPSGLDYYVTNYS
FT                   NNAWSQLLAQSNALTDPVLLTSLQLEAKLLVAHGLADPSRETTIGSLTSANTMVARQLL
FT                   KAPAPTTQSLRPTIRYQGKLRQKAQTQ"
FT   gene            complement(226298..227461)
FT                   /locus_tag="BC1003_3727"
FT   CDS_pept        complement(226298..227461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3727"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: Epoxide hydrolase domain protein; alpha/beta
FT                   hydrolase fold; KEGG: bxe:Bxe_B1262 putative epoxide
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3727"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59667"
FT                   /db_xref="GOA:E1TIV7"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIV7"
FT                   /inference="protein motif:PFAM:PF06441"
FT                   /protein_id="ADN59667.1"
FT                   /translation="MQIQPFHIAVPEHDIDDLRRRVLATRWAPATPSPAWQQGMDAAWL
FT                   RELAAYWAGQFDWRAAEERLNRQPQFMADVEGQRVHFVHRRGAGPAPYPLVVTHGWPGS
FT                   FVEFEALLERLCDPGAFGGEPADSFDVVVPSLPGFAFSAAPARPGMSAFQVADLWASLM
FT                   HGLGYPRFGAQGGDLGAGVSIALAARHPEVVDGIHLNFLPGSYEPAIGATQQALSAEEE
FT                   RFLRDRNEWAALEGGYSHLHMTKPLTLAASLNDSPVGLAAWIAEKFRAWSDCEGDVERV
FT                   FSKDELLTNISLYWYTQSIGPAMQMYWENRLQPMRFAQAQRVVPPVGFARFPKEISHPP
FT                   RSWLERTFNVTQWTDMPGGGHFAAMEKPDLLAAEIRSFFRPLRTGRR"
FT   gene            227599..227982
FT                   /locus_tag="BC1003_3728"
FT   CDS_pept        227599..227982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3728"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: bpy:Bphyt_5344 LrgA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3728"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59668"
FT                   /db_xref="GOA:E1TIV8"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIV8"
FT                   /inference="protein motif:PFAM:PF03788"
FT                   /protein_id="ADN59668.1"
FT                   /translation="MLGALAALLTFQCLGEGVSYVFRLPVPGPVIGMLLLFGFVMMRPQ
FT                   TADAIEPTALELLRHLSLLFVPAGVGIMVSASRIRGDAIAVIVSIAVSTTLAIAVAALV
FT                   TRALMRRQQRSGPDNRADTEAAQ"
FT   gene            227979..228719
FT                   /locus_tag="BC1003_3729"
FT   CDS_pept        227979..228719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3729"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: bpy:Bphyt_5345 LrgB
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3729"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59669"
FT                   /db_xref="GOA:E1TIV9"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIV9"
FT                   /inference="protein motif:PFAM:PF04172"
FT                   /protein_id="ADN59669.1"
FT                   /translation="MTALPKLGAIWVYLAASPLLGLTITLIAYLIAQALYAKARFNPLA
FT                   NPVLIAVALLVAVLELTGTPYATYFEGAQFVHFLLGPATVALALPLYRQWPKLRRYALP
FT                   LIGGLVAGSLTAIVSAIGVAALFGASHQTLASLAPKSATTPIAMAVASQIGGIPSLTAV
FT                   LVISTGVFGAVFARAILNVLRIAEPEVRGFALGIASHGIGTARAFQVSEQMGAFAGLGM
FT                   GLNGVFTAFVVPVLMPVMARWLGV"
FT   gene            229062..230765
FT                   /locus_tag="BC1003_3730"
FT   CDS_pept        229062..230765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3730"
FT                   /product="Alpha,alpha-trehalase"
FT                   /EC_number="3.2.1.28"
FT                   /note="KEGG: bpy:Bphyt_5350 alpha,alpha-trehalase; PFAM:
FT                   glycoside hydrolase family 37"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59670"
FT                   /db_xref="GOA:E1TIW0"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="InterPro:IPR023720"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIW0"
FT                   /inference="protein motif:PRIAM:3.2.1.28"
FT                   /protein_id="ADN59670.1"
FT                   /translation="MIVSLQARSIRCAGRAPGMPGCPNGLPQPLPPGARLKYLQRAAAV
FT                   SGFAFLFGLSSLCHADTQVGGTLPPAPDILYGELFVAVQTAQIYPDQKTFVDATPNADP
FT                   AVIVQLYQQQKNNPGFSLANFVNQYFTPPSEPVITPPANQTLREHINWLWPALTRTTTS
FT                   APPNSSLIPLPKPYVVPGGRFREGYYWDTYFTMLGLQEAGREDLVDNMLDNFAYMIDKF
FT                   GHIPNGNRTYYLDRSQPPFFSHMVELASKVEGHGVYQKYLPALRKEYGYWMQGESSTPA
FT                   GSATRNVVVMPDRTVLNRYWDELDTPRDESYLEDIQTAQKATGRNPNDVYRELRATAES
FT                   GWDFSSRWFGDNMTLATVRTTSIVPVDLNSLMFHLEISIAKGCGETRDFRCVGEFTARA
FT                   AKRALGINRYLWNSNGYYGDYDWQLGKPRDNKTAAMVFPLFVGAAWPDRAKKTAQQVQS
FT                   TLLQPGGLVTTTYNTTQQWDAPNGWAPLHWVAIQGLKRYGQDALAQQIGTRFLADVKGV
FT                   YASDKKLVEKYVVEGAGTGGGGGGEYPLQDGFGWTNGVTLKLLDLYSPGE"
FT   gene            230880..231518
FT                   /locus_tag="BC1003_3731"
FT   CDS_pept        230880..231518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3731"
FT                   /product="DNA-N1-methyladenine dioxygenase"
FT                   /note="KEGG: bxe:Bxe_B1259 DNA-N1-methyladenine
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3731"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59671"
FT                   /db_xref="GOA:E1TIW1"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR032854"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIW1"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1259"
FT                   /protein_id="ADN59671.1"
FT                   /translation="MNQSFPGGPVPARRSIMASQQGLFAPEPVSLFSDREGGIRYLPES
FT                   IAPDIAQQWFVELLNSIGWSSHQRMMYEREVAVPRLIATFLRESADLPAPLGAAFEAVR
FT                   SLVGAPFNRVGLNLYRDEHDSVAPHNDKTANLVRGAPIAIVSLGAARRMTIRPKKGPGR
FT                   AVHVELEPGSCLVMSYASQFTHDHGIPKLVESVGPRISLAFRCYNGPRD"
FT   gene            complement(231538..232173)
FT                   /locus_tag="BC1003_3732"
FT   CDS_pept        complement(231538..232173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3732"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: bxe:Bxe_B1256 carbonate dehydratase; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3732"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59672"
FT                   /db_xref="GOA:E1TIW2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIW2"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADN59672.1"
FT                   /translation="MQEIIEGLIRFQREVFPQQSALFKRLSTAQSPSTLFVTCSDSRVV
FT                   PELLTQAEPGALFVIRNAGNIVPSYGPEPGGVSATVEYAVAVLGVRDIVICGHSNCGAM
FT                   TAITANTNLERLPAVAGWLRHADAAKAINASRSYESPAQRLDALVKDNVVAQLANIRTH
FT                   PSVAVGLANKTLQLHGWIFDIESGVMLALDGRTGQFVPLLENPDIFAV"
FT   gene            complement(232392..232664)
FT                   /locus_tag="BC1003_3733"
FT   CDS_pept        complement(232392..232664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3733"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="PFAM: protein of unknown function DUF1488; KEGG:
FT                   bpy:Bphyt_5356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3733"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59673"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIW3"
FT                   /inference="protein motif:PFAM:PF07369"
FT                   /protein_id="ADN59673.1"
FT                   /translation="MRIEFTGRREVVAAARVAFEANVDGKDVWCSVSLDALNDHFGNGG
FT                   PSAHDLVGTFEANRAQIEKAATRVLEKNGGQSVELETRDFDKTGP"
FT   gene            232849..234342
FT                   /locus_tag="BC1003_3734"
FT   CDS_pept        232849..234342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3734"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_5357 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3734"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59674"
FT                   /db_xref="GOA:E1TIW4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIW4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59674.1"
FT                   /translation="MSRNPQSSRPLVIAAVMASMAMVAIEATIVSTAMPQIVAQLGDLH
FT                   LYSWVFSSFLLAQTAMTVVFGKLADLYGRKPIALAGIAIFLLGSVLAGFAWSMPAMIAF
FT                   RLIQGIGAGAIQPVTLTIVADLYPARERGKVQGYLASVWAIAAVIGPMVGGFIIHNMSW
FT                   AWIFWMNVPIGLASAAGFIAFLRESERHARPSIDFAGAALFMAAIAALMTALTYAGDDD
FT                   LAHASMAAGAFVVCLLLFVLQERRASEPMISFALWSRRPIAACNGATLLSGMILMGSTT
FT                   FLPMYVQGVLNRSPVIAGLALTMMMVGWPTGATLAAKAFHRIGLRRMLIGGSAFIPVGA
FT                   VLLLFLAPGGSPVVAGLGSLVMGFGMGISSVSCLMLIQEIVKMDERGSATASNLFSRNL
FT                   GSTLGATLFGAVLNFGLSHSRGSAVVTSDQLKSLLQNQAANFAGSEAVRTVLHQSLHLT
FT                   FVSLFAIAIFVVVLLALVPAINIGGEKKMPLEALAPLED"
FT   sig_peptide     232849..232929
FT                   /locus_tag="BC1003_3734"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.424 at
FT                   residue 27"
FT   gene            complement(234414..235139)
FT                   /locus_tag="BC1003_3735"
FT   CDS_pept        complement(234414..235139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3735"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; KEGG:
FT                   bxe:Bxe_B1249 precorrin-4 C11-methyltransferase /
FT                   precorrin-2 C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3735"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59675"
FT                   /db_xref="GOA:E1TIW5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIW5"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ADN59675.1"
FT                   /translation="MTVFFIGAGPGDPELITVKGQRLVRSCPVILYAGSLVPAAVLEGH
FT                   SALEVVNTAELDLEQIVALLKRAHRNGRDVARVHSGDPSLYGAIGEQIRRLRELAIPYE
FT                   IVPGVTATAACAATLGCELTLPGISQTLILTRYATRTTMPEGEQLADLARHRATMAIHL
FT                   GVRHLARIVDELRPHYGGACPVAVVYRASWPDEEKITGTLDDILGKIQSTQIERTALIL
FT                   VGDVLAAEGFANSTLYAKS"
FT   gene            complement(235168..235890)
FT                   /locus_tag="BC1003_3736"
FT   CDS_pept        complement(235168..235890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3736"
FT                   /product="Precorrin-6A reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="KEGG: bxe:Bxe_B1248 cobalt-precorrin-6x reductase;
FT                   PFAM: Precorrin-6x reductase CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3736"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59676"
FT                   /db_xref="GOA:E1TIW6"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIW6"
FT                   /inference="protein motif:PRIAM:1.3.1.54"
FT                   /protein_id="ADN59676.1"
FT                   /translation="MTRVLLLGGTGDALRIARHLSARDVYSLAGLGKVPDDLRCTVRVG
FT                   GFGGSEGLQRYIEQEAIGLVIDATHPYAAQMSANAALAARAARVPCWALRRPAWQPQPG
FT                   DDWRMVDNWDELTAALAAFRRPLFTLGREPLAHLDEIPAHQFWFMRCLDSHADTPRARI
FT                   LAARGPFTLEGERALFALQGFDVLISKNSGGSATEAKLEVARERGLPVVMLRRPALPAV
FT                   EREFASTTDLLAALGLPD"
FT   gene            complement(235887..236975)
FT                   /locus_tag="BC1003_3737"
FT   CDS_pept        complement(235887..236975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3737"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="KEGG: bpy:Bphyt_5367 cobalt-precorrin-6A synthase;
FT                   TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3737"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59677"
FT                   /db_xref="GOA:E1TIW7"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIW7"
FT                   /inference="protein motif:TFAM:TIGR00312"
FT                   /protein_id="ADN59677.1"
FT                   /translation="MRDETPEQPAPLRSGYTTGSCATATSLAAARLLLAGVASEVAEIV
FT                   LPKGQHVPMPLVFCRLTDDGAEAGTIKDAGDDPDVTHGALVFARVRLVPGPGVVFRAGP
FT                   GVGTVTRAGLTLAVGEPAINPVPRKMMTEHLAELAAEHGYRGGFEVTIGVEGGEALAQK
FT                   TMNPRLGILGGLSILGTTGIVRPFSCSAYIASIHQGIDVARANGYRHVAACTGNASEDA
FT                   MRAHYGLPDIALIEMGDFVGAVLKHMKRAPVERLSICGGFGKLSKLAAGHLDLHSRSSS
FT                   IDLACLASWAAEHGADATLQAAIRAANTSQQAVALAHAQQVPLADIVCQHALHVAREIV
FT                   PPQVQVEMFAIDRQGNLIGAAR"
FT   gene            complement(236981..238231)
FT                   /locus_tag="BC1003_3738"
FT   CDS_pept        complement(236981..238231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3738"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; precorrin-6Y
FT                   C5,15-methyltransferase (decarboxylating), CbiT subunit;
FT                   KEGG: bpy:Bphyt_5368 precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3738"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59678"
FT                   /db_xref="GOA:E1TIW8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIW8"
FT                   /inference="protein motif:TFAM:TIGR02467"
FT                   /protein_id="ADN59678.1"
FT                   /translation="MPAWLTVVGIGDDGFAGLGRPARRALLEASVIYGGERHLSMLPAR
FT                   LAARRAAWPRPFDLAPLLAQRGRPVCVLASGDPMLFGVGATLTRQLPADELRVLPAPSS
FT                   LSLAAARLGWPLQEVATVSLVGRPLSAVNAQLHDGARIFVLSADGSTPAALAALLSARG
FT                   FGATRMTVLEHLGGDAERRIDGRADQWSTEPSAALNLIALECRATEAAPRLPLTCGLPD
FT                   DAFRHDGQLTKRDVRAITLARLAPAPGELLWDVGAGSGSIGIEWMRAHPACRAIAVEAH
FT                   AERQRFIEHNRDALGVPGLQLVAGRAPEALAGLPAPDAVFIGGGVTAPGVLEACWASLR
FT                   DGGRLVANAVTLQGEAALAAWRERHGGTLTRIALADAQPLGGFDTWRQALPITLLEVVK
FT                   PRDAAGAASDPSRNLSA"
FT   misc_binding    238315..238505
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 104.00"
FT   gene            238552..240132
FT                   /locus_tag="BC1003_3739"
FT   CDS_pept        238552..240132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3739"
FT                   /product="precorrin-3B synthase"
FT                   /note="KEGG: bpy:Bphyt_5369 precorrin-3B synthase; TIGRFAM:
FT                   precorrin-3B synthase; PFAM: nitrite and sulphite reductase
FT                   4Fe-4S region; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3739"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59679"
FT                   /db_xref="GOA:E1TIW9"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIW9"
FT                   /inference="protein motif:TFAM:TIGR02435"
FT                   /protein_id="ADN59679.1"
FT                   /translation="MACSGRRATLTAVSVLNPVCSSAVLSDAALALRPSACPGLVRIVA
FT                   ARDGGICRIKLPGGELGAAQAEAIAHASARHAAGVIELTNRANLQLRGVRGGDEAALTA
FT                   ALVEAGLGPMATAGFDGGADAEATSFPDLGGVSAAGAASGAGAASAASTMSTLTAPTAL
FT                   TPSAADDIRNVMISPTAGRDPSALFDTRPLCAALLALLQSDARFAALSPKFALLVDGGE
FT                   RLARLDHPHDVWLAASQDACGEIRFVFGLAGCPPVSATRPAAALSSVRPAQVAALVRAL
FT                   LHTFLDLAAADATRMRHLLATHCVDAVLQHAQRYVDFPLQRDAALAQWQRSTAAEPALC
FT                   VGAHAQRDAGTWHVGGQPFLGRIDASTLQRLAALARQHGNATLHVTPWQSVLLPDIRTQ
FT                   AVPAVLAALTTLGFACDASDPAARLIACAGSSGCARSLADTKADALTLARRLPAAAQAH
FT                   LSGCPRSCAAAHCAPFTLLAVAPGIYDLYRRNAQPGFGECVARRLTIEQAADALAPLAS
FT                   SEPRHDPDE"
FT   gene            240138..240764
FT                   /locus_tag="BC1003_3740"
FT   CDS_pept        240138..240764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3740"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="KEGG: bpy:Bphyt_5370 precorrin-8X methylmutase;
FT                   PFAM: Precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3740"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59680"
FT                   /db_xref="GOA:E1TIX0"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIX0"
FT                   /inference="protein motif:PRIAM:5.4.1.2"
FT                   /protein_id="ADN59680.1"
FT                   /translation="MLDYIRDGAEIYRQSFATIRAEADLSRIPADLEKLAVRVIHACGM
FT                   VDVIDDLAFSPQAGTAGRLALAQGAPILCDAGMVAQGITRARLPANNDVICTLTDERVP
FT                   ELARTLGNTRSAAALELWRPRLAGSVVVIGNAPTALFHLLDMLDAGAPQPALILGFPVG
FT                   FVGAAESKAMLAADSRGVPYVVVHGRRGGSAMAAAAVNALATEAE"
FT   gene            240761..241504
FT                   /locus_tag="BC1003_3741"
FT   CDS_pept        240761..241504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3741"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="KEGG: bpy:Bphyt_5371 precorrin-2
FT                   C(20)-methyltransferase; TIGRFAM: precorrin-2
FT                   C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3741"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59681"
FT                   /db_xref="GOA:E1TIX1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIX1"
FT                   /inference="protein motif:TFAM:TIGR01467"
FT                   /protein_id="ADN59681.1"
FT                   /translation="MTGARQPGGRLFGLGVGPGDPELITLKALRLLKAAPVVAYFVAKG
FT                   KKGNAFSIIEAHLHDGQQRLPLVYPVTTEALEPPLSYEAIIADFYDTAAQIVGAHLDAG
FT                   RDVAVICEGDPFFYGSYMYLHDRLAARYETDVVPGVCSMLGGAAVLGAPLVYRNQSLSV
FT                   LSGVLPEEELRRRLADADAAVVMKLGRNFDKVRRVLVELGLAHRALYVERATMGNQRIV
FT                   PLAEVDPMASPYFSLLVVPGEKWQG"
FT   gene            241501..243420
FT                   /locus_tag="BC1003_3742"
FT   CDS_pept        241501..243420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3742"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; KEGG:
FT                   precorrin-3B C17-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase;
FT                   cobalamin (vitamin B12) biosynthesis CbiG protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3742"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59682"
FT                   /db_xref="GOA:E1TIX2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIX2"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ADN59682.1"
FT                   /translation="MTPPAVVILGAGALATARRIQALYPGSQVHALRERVQAEMVDVVY
FT                   SELGAHLRELYARGTPIVALCAAGIVIRCVAPLLSNKGAEPPVLAVAEDGSAVVPLLGG
FT                   LAGVNVMAREIAAALAVAPAITTSGELRFGTCVLNPPPGYALADIGQGKRFVSDLLAGA
FT                   STRIEGDAPWLDDAQLPRSAGARLAIRITPHAWDGREDELVIHPRSVVAAVILQTGEAC
FT                   SASSIADRVRASLDAHGLATLSLAALLAAPEEMTNAALADAAASLGVPLRFAGRFAGRL
FT                   AESRAESEVASQAERRAEAPAESGAQSRAQSQAEGRAESEAQSQAEEAESRAAQAHMEH
FT                   SSSPTSLLQAALRIPYETLPGEHGKHDTHDKGIALALSPLAIDPDTIGRARGRLTVIGL
FT                   GPGSAELMVPAARRALDEATDILGYETYVKMAGPLRADQRVHGTDNREEMQRARHAFEL
FT                   ASEGRSVVMVSSGDPGVFAMAAAVLEALDTSGDPAWAAVDLRILPGVSAAMATAAQAGA
FT                   PLGHDFCMLSLSDNLKPWSIIEQRLRHAAQADLVMAFYNPISRARPWQLDKALDIVREY
FT                   RAPTTQVVLGRDIGRPGATLRTLTLAELRSTDVDMRTMVIVGSSTTRQFTKGAQWVYTP
FT                   RWYP"
FT   gene            complement(243446..246070)
FT                   /locus_tag="BC1003_3743"
FT   CDS_pept        complement(243446..246070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3743"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: bxe:Bxe_B1236
FT                   putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3743"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59683"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIX3"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ADN59683.1"
FT                   /translation="MKLQSIAIQEFKQFTGRLFIDDLQPGLNLFVGPNEAGKSTIAEAV
FT                   RAVFLERYKASHLKDLLPWGKASGQPSVEVSFDLDGVACRLSKQFVTRQRCELKIGQKV
FT                   FGEDEAEDRLAALLGFSRAARGPLKAENAGVPGLLWVQQGGTQDMRDSTGHAAQYLRDA
FT                   LSQLSGSREAAGEDALIAVVQRELRQLLTARTQKSTGALAEAEAALSALSAERDDLVRQ
FT                   REQFDENITRLASLQEAFDDAQRKSPWSLHEEKAALAQQRADAAADLERNVEGLVQALK
FT                   VSEAELALSLQREQAAVELETAVARERQQLDAARANVAAAETDHAQAASRVAQLEQAAA
FT                   DANRALELANAAVSAADLRSQLGMHRAELERLQAAIGAASEAHDALVEATRAAASLEID
FT                   EGKLKQLAALDASLTVLRARTEAAMTRVEYRLNGTITVDDEPVSGAGVLRVDEEKRIGL
FT                   GELGELRVVPGVSDLPARLSELAALEAQHAQLLQALGVSSLAEAEFRREQWKALLAQQK
FT                   SHANVLQAHAPQGIDALRAASASASARLQAASERLTGLPDVSAALPLDEARRRADLAHA
FT                   ALESARKLLSDAAEKRSTGIATAESLALQVQRKEAQLSDAAFSRERAQWQAKIVEQRVQ
FT                   VEALARQREGRERELQAVRLDDPAAEARRYRASAELARQEQHERQVRIAHLRSQLETVG
FT                   ASGLGERLAALEAKIEQATRRKEELSLRAGALSLLDEVLVAERDAAVAQLRAPLTERLG
FT                   HYLKRIFPQSTLALGDDLSPATLDRYGRADTLEALSFGTREQLGILTRLAYADLLKAAG
FT                   RPTLLMLDDAAVHTDAARRDAIKRALLDAATRHQILVFTCHPELWDDMGVRQRAIDDIK
FT                   AAA"
FT   gene            complement(246067..247209)
FT                   /locus_tag="BC1003_3744"
FT   CDS_pept        complement(246067..247209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3744"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bpy:Bphyt_5377
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3744"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59684"
FT                   /db_xref="GOA:E1TIX4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014577"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIX4"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADN59684.1"
FT                   /translation="MIRFLHTADWQIGTQFGQFEPDEAAHLAQARFDTVRRIAEAAAAR
FT                   KVDAVLVAGDVFDLQTVSDTVIRRLFAALQAFTGPWIMLPGNHDAALVESVWTRAQRLN
FT                   CVPPNVRVVLEPGVVVLDACRLALLCAPLTQRITYDDTTGFFDLADTPPGYHRVGLAHG
FT                   SVSGILQEGIDSSNPIAPTRAASARLDYLALGDWHGHLRVDDRTWYAGTHEQDRFRAND
FT                   PGFVLEVGLSEPGAVPVVQPLRVGQYQWHRWDETIAVPTDADALRTRLATLGHNDVLRL
FT                   TVSGTAALAEAEALHVAVDEARARVRALRVDLSALHVLPTTEDLAELGAQSGYLAKVVA
FT                   RLRAMQEDPQSDPQQVKRAAEALLLLARFQRELPREARSA"
FT   gene            247476..248756
FT                   /locus_tag="BC1003_3745"
FT   CDS_pept        247476..248756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3745"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   bxe:Bxe_B1234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3745"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59685"
FT                   /db_xref="GOA:E1TIX5"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIX5"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADN59685.1"
FT                   /translation="MNKALELKKAKRTPLLLLAAAACVFVATALLPRGVWIDGIKAVAE
FT                   AAMVGALADWFAVAALFRRVPIPIVSAHTAIIPRNKHKIADNLAVFVQDKFLDVPSLVG
FT                   LIKKHDPAQSITRWLSASANSARIADYVVKVTGGMLDLTDDVRIQAFIKDALRDVLGKV
FT                   DLSQSMGSILDTLTKDGRHQELLDAGIEQVLALLRHAEAREFIAERIVDWVKSEYPKME
FT                   KILPSAWLGEKGAEAIASAVNRMLEQISENPTHQLRQKFDDAAHKLIVKLKSDPAFLQK
FT                   GEELKRYLVEGEALGSYVKDMWGELRAWLKRDLQSSDSALHARVVAAGQWVGRELANDA
FT                   ALRQSLNDHLEEAARAMAPEFARFLTRHISDTVKNWNAEDMSRQIELNIGRDLQYIRIN
FT                   GTVVGGFIGLLLYVSSQLFELLRVQFG"
FT   sig_peptide     247476..247565
FT                   /locus_tag="BC1003_3745"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.835 at
FT                   residue 30"
FT   gene            248919..250877
FT                   /locus_tag="BC1003_3746"
FT   CDS_pept        248919..250877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3746"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bxe:Bxe_B1233 membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3746"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59686"
FT                   /db_xref="GOA:E1TIX6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIX6"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADN59686.1"
FT                   /translation="MKISLPPHGRPNRVYPPGAPGLHGLASVITGVVVVCALYFGRAVL
FT                   IPITLSVLLSFLLAPLVQTLRRLHMGQLPSIFIAVLFALAALLAIGALIGAQLVQLASD
FT                   LPQYQVAIEQKIETVQEKTIGRADSLMTRAAATLQRVAPSKPPPPRPTGRAARNAPAVP
FT                   TPVEVHEPSPTPLQLAQRALSPAIAPIETTFIVLVVTIFILLQREDLRDRLISLFGSRD
FT                   LHRTTTAINDAAVRLSRYFVAQLGVNLSAGGVIAIGLAIIGVPGALLFGVIAALLRFVP
FT                   YIGIWIAALLAVFLAAAIQPQWTMAVYTLILFIVVDVVAGQIAEPLLYGHRSGLSPLAV
FT                   VVAAIFWSWLWGPIGLVLSTPLTLCLVTLGRYADRLNFLTVLLGDQPALTPAQTFYQRL
FT                   LADDLHEAIVQAERLLREMSLIDYYDKVALEGLKLARNDAMRGVLMPDQLARVNEALVD
FT                   IVENLEIAEGLPDRLARPEPHDALALHAATSADLSERNATHARAHSSSHNGGERTAVLC
FT                   VPGRGAFDEVTTAIAVQLLGRLGFAPIMATHSGYRSARADEPSFRNAPIICIVTLDAPE
FT                   SPPYLRNMLRRTREWRPRATLVVGVGGAAENGHDAAMGATAAAHCAPTFRAMIEECQVA
FT                   ASVLHAREHSHVAGAAE"
FT   gene            complement(250911..251885)
FT                   /locus_tag="BC1003_3747"
FT   CDS_pept        complement(250911..251885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3747"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; KEGG:
FT                   bpy:Bphyt_5382 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3747"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59687"
FT                   /db_xref="GOA:E1TIX7"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIX7"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ADN59687.1"
FT                   /translation="MKAAIYGAGAIGGWIGVKLAQAGHEVGVIARGATLAAVREHGLRL
FT                   IEGGSTHAVEVQADEHPAALGVQDLAVIAVKGPAMASVAAQIAPLLGPQTIVLTAMNGV
FT                   PWWFCEGLGGAFMGKRLKSIDPDGAIAAAIPTEQTVGCVVHASCLVEAPGVIRHHQGNG
FT                   LIIGEAAGRSGERVKTLAGTLAAAGFNASVSEQIQRDVWYKLWGNMTMNPISAITGATT
FT                   DRILSDELVRGFVTSIMLEAKEIGARFGIPIDQHPEDRHAVTLKLGAMKTSMLQDVQAG
FT                   KAVELDALVSAVRELGQLTGVDTPYTDALLGLARLHARTLGLY"
FT   gene            complement(251890..252681)
FT                   /locus_tag="BC1003_3748"
FT   CDS_pept        complement(251890..252681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3748"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bpy:Bphyt_5383 aldolase II superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3748"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59688"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIX8"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADN59688.1"
FT                   /translation="MTTLDIAAASAPKNAAMHPDERQARVQLAACYRIFDMLGWTEMIY
FT                   NHITLRVPDSVSGGERQFLINPFGLHYSEVTASNLVKIDAHGRVLDGSHYPVNPAGFVV
FT                   HASIHQGVPGAHCVMHTHTTAGVAVACLEEGLQQTNFYSAQLHERIAYHDFEGITVHAE
FT                   EGPRLVEHIGDRQAVILRNHGLLAWGATLPQTFAILWTLNRACEIQMATFSMGRARPVP
FT                   QEVAIRCSRDALQFDPRHGAGQDVFDALVRRVERIDASYKD"
FT   gene            complement(252769..253968)
FT                   /locus_tag="BC1003_3749"
FT   CDS_pept        complement(252769..253968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3749"
FT                   /product="Aspartate transaminase"
FT                   /EC_number="2.6.1.1"
FT                   /note="KEGG: bpy:Bphyt_5384 aromatic amino acid
FT                   aminotransferase; PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3749"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59689"
FT                   /db_xref="GOA:E1TIX9"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIX9"
FT                   /inference="protein motif:PRIAM:2.6.1.1"
FT                   /protein_id="ADN59689.1"
FT                   /translation="MFEHIPAYPGDPILSLNEDFQLDPRPNKVNLSIGIYFDDAGKLPV
FT                   MDAVRRAETALLDAIGPRSYLPMAGLPLYRETAQALVFGAHSEARAAGRIATLQTIGGS
FT                   GALKVGADFLRSYFPASQIWISDPSWENHRVVFEGAGLTVNTYPYYDEATGGLRFADMI
FT                   DRIDRLPERSVVLLHACCHNPTGVDLSAAQWAELVPVLQRRKLIAFVDMAYQGFGAGLE
FT                   EDAACVRMLAEAGIPLMAANSFSKNFSLYGERCGALSVVCNNADEAGRVLGQLMSTVRA
FT                   NYSNPPTHGARLVANVLSDASLRASWEAELATMRERILAMRGTIHAGLAGRVDEVMRAR
FT                   YVAQRGMFTYTGLSESQVERLRNEHAVYVLRSGRMCVAGLNARNADYVASSIAAVVADA
FT                   "
FT   gene            254145..255086
FT                   /locus_tag="BC1003_3750"
FT   CDS_pept        254145..255086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3750"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpy:Bphyt_5385 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59690"
FT                   /db_xref="GOA:E1TIY0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIY0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN59690.1"
FT                   /translation="MALTRVTIRQFEAFLAIVDLQSIGAAAGRLGLTSSAVSQLLAELE
FT                   AELGFRLFDRTTRRVNLSSAGHDFLASAESVLRHVRAAAQSADDIRNRAAGIVRIGAPL
FT                   VLASTALPAAIADYARDKPKVVVRICDTVVEQLVERVESADVDLAIGPDRPSGARVQRD
FT                   TAFASPWVMWCAPSHPLGERRRVQWQQLRNIPIVATGRDHERAVDQMLAVLPVEARIVP
FT                   VDVVDNVTTAFGIASRGLAVTLAPAYVAPLARTFGLVMKRIVEPETIREVCLYRSTERA
FT                   LSPPAAGFADFLLPWLKRWDRDMQAHARVKRG"
FT   gene            complement(255115..256242)
FT                   /locus_tag="BC1003_3751"
FT   CDS_pept        complement(255115..256242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3751"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /note="KEGG: bpy:Bphyt_5387 response regulator receiver
FT                   sensor signal transduction histidine kinase; PFAM: response
FT                   regulator receiver; histidine kinase A domain protein;
FT                   ATP-binding region ATPase domain protein; SMART: response
FT                   regulator receiver; histidine kinase A domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3751"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59691"
FT                   /db_xref="GOA:E1TIY1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIY1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN59691.1"
FT                   /translation="MSNPPVNILIVDDIAHNITALKALLTRPDVAVLVADSGTAALDLL
FT                   LKHEVALAILDVNMPGMNGFELAALMRGSPRTSHVPIIFLTATAQDASRTFRGYEAGAV
FT                   DFLYKPFDPRILQSKVDVFVQLEQQKRQLAAQLVTTQQMLEANEMLMAVLSHDLRTPLG
FT                   AVLASAEYLMRTAADQQSATVAARVKNSSLRMARMVDQLLNLARLQGGRLPLQPRSIEL
FT                   ASLCRSVIDEFTSRENGKRIVFTSHGNTAGAWDTDLVWQAVSNLVSNALHHGAEGGDVS
FT                   VEVDGAADDFVRLKVANRGVIPPEVFPHLFKAFGPNNGGSRSRQGLGLGLHIVHEIARM
FT                   HGGSVSVKSDESAGTVFTIELPRMVTLQRGSFSGK"
FT   gene            complement(256252..256881)
FT                   /locus_tag="BC1003_3752"
FT   CDS_pept        complement(256252..256881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3752"
FT                   /product="CheB methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="KEGG: bxe:Bxe_B1218 CheB methylesterase; PFAM: CheB
FT                   methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3752"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59692"
FT                   /db_xref="GOA:E1TIY2"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIY2"
FT                   /inference="protein motif:PRIAM:3.1.1.61"
FT                   /protein_id="ADN59692.1"
FT                   /translation="MTTRSITQPEARATRSAQDARACELVVIGGSAGGMEVINLLLDAL
FT                   PATFAPAVMIVMHLPPDPPSYLVHALAHRCVLPVVEPDAGEQITPGRVHVAPPGYHMLV
FT                   EVDRTVALSTDAAVRFSRPSIDVLFESAATVYREHLLALLLSGANDDGAQGLQRVRALG
FT                   GVTWVQDPGTASSPDMPRTAIERGAADFIYSPETMARRLAAWPASL"
FT   gene            complement(256889..257764)
FT                   /locus_tag="BC1003_3753"
FT   CDS_pept        complement(256889..257764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3753"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /note="KEGG: bxe:Bxe_B1217 MCP methyltransferase,
FT                   CheR-type; PFAM: MCP methyltransferase CheR-type; SMART:
FT                   MCP methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3753"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59693"
FT                   /db_xref="GOA:E1TIY3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIY3"
FT                   /inference="protein motif:PFAM:PF03705"
FT                   /protein_id="ADN59693.1"
FT                   /translation="MVQAGDTGNAMSQSELDARQRMSDFDIELKLLLEAIYLKYQHDFR
FT                   HYAMSSLRRRLSQALEEFGLVTLSQLQDRIMRNGDEFSRLFQYLTVQVSDMFRDPAYFL
FT                   ALREHVLPRLRTYPSIKVWVAGCSTGEELWSLKILFDEEGLTERTLFYATDINPDALAR
FT                   AEAGIYALDRIQGFTQNYLAAGGTRSLSDYYHAAYNGARFAGSLKGRVVFADHSLSTDE
FT                   VFLEAHLVSCRNVLIYFDRGLQDRALGLFENALVRRGFLGLGSKETLRFSRHYEAFDEF
FT                   RPGERIYQKR"
FT   gene            complement(257790..261386)
FT                   /locus_tag="BC1003_3754"
FT   CDS_pept        complement(257790..261386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3754"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: bxe:Bxe_B1216 multi-sensor hybrid histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   CHASE3 domain protein; GAF domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; GAF domain protein; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3754"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59694"
FT                   /db_xref="GOA:E1TIY4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIY4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN59694.1"
FT                   /translation="MTASQVVDERYFRGIIRRNIALPLLVGLITIAVFVGLIVYLVSTT
FT                   NLAEHSERVIGKANQMLRLAVERESSMRGFLITGDESFLGQYDRGGPQFKVQMEELQAL
FT                   VSDNPMQVEKLKQIATIQERWNRFAENMIDSRRRMQDVASVVSSGRGKMEFDAIRKEFD
FT                   DFLDVELRLRQERSEASRRLTGVLVTVFLLFSIGINSLLAWMGRRELLNLAGVYDKALR
FT                   QQAEQTQALERQVWLRSGQRMLAERVVGQATPQLVGTAMLDCLAQYLDAVVAALYVRDK
FT                   RHGTLRRIATYGFNREGEQAAARDFGQADTLVGQAAVSRRMVVMRDVPDNYIQVVSATG
FT                   KSAPKNLIIMPVASEGEVNGVVELGFMRPLAPRDEEFIELVSNSMGDFIEAALYRERLQ
FT                   DALIETQQLNEELQVQQEELRVSNEGLEERGRALLDTQTRLQAQQAELEQTNVQLEEYA
FT                   HRLERQKAELLRAQDDLAANAERLEQSSRYKSEFLANMSHELRTPLNSSLILAKLLQQN
FT                   RTGNLTEEQVRYAETIHASNSDLLVLINDILDLSKVEAGQVSVELETVSIDATLQSLEE
FT                   LFKPMAGAKHLSLVFDRLPGAPETIVSDGQRVTQILRNLLSNAVKFTERGEVALSVSPA
FT                   DDGMLRIDVRDSGIGIAADKLEMIFEAFQQADGSTSRQYGGSGLGLSISREFARLLGGR
FT                   ITVASELGKGSVFTLWLPLDARAALAAGGESATAAAQQATPAIATGTNGNADQALVAPV
FT                   SWSDAAPSVITPANGLLAARPASAEGAGGAAQAGGAQESGLAAIADDREHRTRAGRLIV
FT                   AVEDDLAFAEILRDLVHELDFDFVHASNAASGLALVRDMRPAAVLLDVGLPDRSGLTVL
FT                   EWLKNDPLTRHIPIHIVSATDHADKALHLGAIGYTLKPTARSTMEAAIRRLEARLQQRL
FT                   KRVLVIEDDTPMRESIRALLQSENTEIVAVATLSEALEHLGKLSFDCVVTDLALPDGTG
FT                   YDLLERLAGNPEHAALPVIVYTGRMLSDEEEHRLRRYSKSIIIKGAKSPERLLDEVTLF
FT                   LHSVESSLAPEQQRMLRTVRQRDNAFEGRTILLAEDDVRNIFALSHVIEPLGAKLQIAR
FT                   NGREALEALENGPEVDLILMDIMMPEMDGLTAMGEIRRNPRFAHLPIIALTAKAMANDR
FT                   LRCLEAGADDYVSKPIDVDKLVALCRVWLRQR"
FT   gene            261629..263482
FT                   /locus_tag="BC1003_3755"
FT   CDS_pept        261629..263482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3755"
FT                   /product="Alpha,alpha-trehalase"
FT                   /EC_number="3.2.1.28"
FT                   /note="KEGG: alpha,alpha-trehalase; PFAM: glycoside
FT                   hydrolase family 37"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3755"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59695"
FT                   /db_xref="GOA:E1TIY5"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIY5"
FT                   /inference="protein motif:PRIAM:3.2.1.28"
FT                   /protein_id="ADN59695.1"
FT                   /translation="MTDNAYAVTRLRRLRGLRLCNALVAALVLHACFASAASVAPGTQP
FT                   QNDAATTSSGAITQVALHVEPPAQASPVVPVPPSEQYPELYRDVELAHLFPDSKTFADM
FT                   VPLEPPSQIAASYTSAKQQPGFNLGDFVKRNFALPARESKSYVSDPNQDVVSHIDTLWT
FT                   VLRREPDSTASRWSSLLPLPDPYIVPGDRFDEIYYWDSYFIMLGLEASGRHAMVVDALK
FT                   NFAALIDRYGHIPNGNRTYYLSRSQPPFFAQMVRLVAEKDGDAVYAQYLPQLRREYAYW
FT                   MNGSEGLAAGHASRHVVRLADGTLLNRYWDERAAPRDESYREDVASSQQTPQRNPEDLW
FT                   RNLRAGGETGWDFSSRWFADGKTLATVDVTSLAPVDLNCLLVDLERALAKAYRMRGDVT
FT                   HAENMAQRAATRADTIRRVLWDPQLQAFGDYDFVHRTLTHKLTAATAYPLYTGVASRQQ
FT                   AKAVAVTLQRELLRAGGLVTTRVASGQQWDAPNGWAPLQYLAVIGLRRYSEAALAQTIA
FT                   TRWIRTNVSYYQHTGKLVEKYDVEAAAPGVAAGGGEYPLQDGFGWTNGVLRTLLALYPQ
FT                   AVSSSRPSDIPAGPAGVSAAAASAAAAPKNTHRLQGMRVNP"
FT   gene            complement(263554..264450)
FT                   /locus_tag="BC1003_3756"
FT   CDS_pept        complement(263554..264450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3756"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   bpy:Bphyt_5393 MltA-interacting MipA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3756"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59696"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIY6"
FT                   /inference="protein motif:PFAM:PF06629"
FT                   /protein_id="ADN59696.1"
FT                   /translation="MLNSRRKWIGKIRNKQTGIAATSLTALAVGGIAALPGTALAQTPS
FT                   PLGEWQYSVGIPLQKMWQPTVPDWQLRIGAATSFQPRYEGSDRYHLMAGPSVDVRYKDL
FT                   FFFSSGEGLGVNLAQGQNWRASLAAVYDLGRRGHDDPQELNGLGNINPAPGLKLSGEYV
FT                   ISKDFPLVLRADVRRYFGGSNGWIGDLGAYMPMPGSSKKFFWFAGPNVTLADSTYMNSW
FT                   FGVNQNQAARSGYRQYHASAGFKSVGFGISAVWLFDKHWFATADGAFQQLVGSAGNSPI
FT                   THRKANGVADISINYRF"
FT   sig_peptide     complement(264325..264450)
FT                   /locus_tag="BC1003_3756"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 42"
FT   gene            complement(264835..265587)
FT                   /locus_tag="BC1003_3757"
FT   CDS_pept        complement(264835..265587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3757"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   KEGG: bpy:Bphyt_5394 peptide methionine sulfoxide
FT                   reductase; PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3757"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59697"
FT                   /db_xref="GOA:E1TIY7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIY7"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ADN59697.1"
FT                   /translation="MKIGKRIDSRHRGSRSARRFPGGVGAVSLLLGLLLAQRIAFSAEQ
FT                   AVPIAPPALDEPVAAASAHEESAVFAGGCFWGVQGVFQHVRGVKQAVSGYSGGGRETAH
FT                   YETVSGGATGHAEAVQVAFDPAQVTYGQLLQVYFSVIHDPTQLDRQGPDSGPQYRSAVF
FT                   PLNDTQRRVAQSYIAQLDKARAFPAPIVTKVEAFKGFYPAEFYHQNYLTQHPNSAYIAL
FT                   NDMPKVANLKRLFPNLYRDKPVLVPQAQ"
FT   sig_peptide     complement(265459..265587)
FT                   /locus_tag="BC1003_3757"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.966 at
FT                   residue 43"
FT   gene            complement(265748..266287)
FT                   /locus_tag="BC1003_3758"
FT   CDS_pept        complement(265748..266287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3758"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: bpy:Bphyt_5396 transcriptional regulator, AsnC
FT                   family; PFAM: Transcription regulator AsnC-type-like;
FT                   SMART: Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3758"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59698"
FT                   /db_xref="GOA:E1TIY8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIY8"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADN59698.1"
FT                   /translation="MKHLDKTKVRRASATPAAVRGAGSAPLESLDRIDRAILRQLQTDA
FT                   SISNVALAAKVKLSAPACLRRVERLKESGLIRGVVALIDPKSAGAGMLVIIGVVLDRST
FT                   PESFADFEKAAQKVPGCMECHVVTGEFDYFMTIRTRDSDSFNRLHAEQLLYLPGVRQIR
FT                   SFMVLKEILSTTRFPL"
FT   gene            266436..267452
FT                   /locus_tag="BC1003_3759"
FT   CDS_pept        266436..267452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3759"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="TIGRFAM: 1-aminocyclopropane-1-carboxylate
FT                   deaminase; KEGG: bpy:Bphyt_5397
FT                   1-aminocyclopropane-1-carboxylate deaminase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3759"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59699"
FT                   /db_xref="GOA:E1TIY9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIY9"
FT                   /inference="protein motif:TFAM:TIGR01274"
FT                   /protein_id="ADN59699.1"
FT                   /translation="MNLQRFPRYPLTFGPTPIQPLKRLSDHLGGNVHLYAKREDCNSGF
FT                   AFGGNKTRKLEYLIPEALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVN
FT                   YSDAVYDRVGNIQMSRILGADVRLVPDGFDIGFRKSWEDALESVRAAGGKPYAIPAGCS
FT                   DHPLGGLGFVGFAEEVRQQEAELGFRFDYIVVCSVTGSTQAGMVVGFAADGRADRVIGI
FT                   DASAKPAQTREQITRIARQTAEKVGLGRDITQKDVVLDERFGGPEYGLPNAGTLEAIRL
FT                   CARLEGVLTDPVYEGKSMHGMIEMVRNGEFPQGSRVLYAHLGGVPALNGYSFIFRDG"
FT   gene            complement(267514..268404)
FT                   /locus_tag="BC1003_3760"
FT   CDS_pept        complement(267514..268404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3760"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59700"
FT                   /db_xref="GOA:E1TIZ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIZ0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN59700.1"
FT                   /translation="MQLDDMRIFVATVDAHNFTAAARRMSLSKQFVSRRVMALEEALGV
FT                   PLLVRNTRKLAVTELGQEFYERARRILSEVEEAEQAMSLRRAGPRGLLRVSAPMSFGMT
FT                   HLSPLVADFLREHRDVRFDMELSDRTVDVVGEGFDMAVRIGVLPDSTLIAQKLVDVNFV
FT                   ACCSPGYLRRRGKPATPADLAGHSCLLYGHGGVVTWEFAVNGAMKSFEVHGPLRANNGD
FT                   LIRDAAVAGLGIVRLPHFIVANALRDGQLVTVLDDFMPGSIGVYAVYPQHRQSSLTIRA
FT                   FVDFLRKHLKKRLTV"
FT   gene            268582..269307
FT                   /locus_tag="BC1003_3761"
FT   CDS_pept        268582..269307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3761"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: pirin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3761"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59701"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIZ1"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ADN59701.1"
FT                   /translation="MLEIRHANQRGRAEHGWLSSRHTFSFAHYHDPKQNGFSDLLVIND
FT                   DRVAPAQGFGKHPHRDMEIFSYVLEGALEHKDTMGTGSVIVPGDIQLMSAGTGVAHSEY
FT                   NHSKSEPVHFLQIWIAPAQKGTAPRYQQQHFSEQDKRGVLRLVLSPDGANGSLTLQQDA
FT                   RVYAGLFNGDETARLELASNRYAYVHVARGSVTVNGVELGEGDGARVRGEEALTFTQGH
FT                   DAEVLVFDLRNIEVSELWA"
FT   gene            complement(269527..271119)
FT                   /locus_tag="BC1003_3762"
FT   CDS_pept        complement(269527..271119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3762"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="KEGG: bpy:Bphyt_5402 alkyl hydroperoxide reductase,
FT                   F subunit; TIGRFAM: alkyl hydroperoxide reductase, F
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3762"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59702"
FT                   /db_xref="GOA:E1TIZ2"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIZ2"
FT                   /inference="protein motif:TFAM:TIGR03140"
FT                   /protein_id="ADN59702.1"
FT                   /translation="MLDANLKTQLKTYLEKVSRPIEIVASLDDSAKSQELLALLNDIAT
FT                   LSERVSVVERRDDSERKPSFSIGEPGKDIGIRFAGIPMGHEFTSLVLALLQVGGHPVKL
FT                   DDAVIEQIRSLDGDYQFETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEV
FT                   EARQIMAVPTMFLNGEVFGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDTLIVGGGP
FT                   AGAAAAIYSARKGIVTGVVAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKTYE
FT                   VDIMDVQRAEALIPGRINEVRLANGAVLKAKTIILATGARWREINVPGEREYRNHGVAY
FT                   CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVSEVTLFEFGANLRADEVLQRKLRSL
FT                   ANVTIVTQAQTTEITGDGKKVNGLVYKDLRSGEVKKVELEGVFVQIGLVPNTEWLKGTV
FT                   ELSKHGEIVVDARGATSVPGVFAAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRSSEE
FT                   TEAVSEVEAEAAV"
FT   gene            complement(271315..271878)
FT                   /locus_tag="BC1003_3763"
FT   CDS_pept        complement(271315..271878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3763"
FT                   /product="peroxiredoxin"
FT                   /note="KEGG: bxe:Bxe_B1205 hypothetical protein; TIGRFAM:
FT                   peroxiredoxin; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3763"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59703"
FT                   /db_xref="GOA:E1TIZ3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIZ3"
FT                   /inference="protein motif:TFAM:TIGR03137"
FT                   /protein_id="ADN59703.1"
FT                   /translation="MPIINSQVKPFKAQAYHNGDFVTVTEESLKGKWSVFVFYPADFTF
FT                   VCPTELGDLADRYADFQKLGVEIYSVSTDTHFTHKAWHDTSDTIQKIKYPMLADPTLAI
FT                   SRNFDVLIEEEGLALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAAHPG
FT                   EVCPAKWTPGAETLTPSLDLIGKI"
FT   gene            complement(272002..274200)
FT                   /locus_tag="BC1003_3764"
FT   CDS_pept        complement(272002..274200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3764"
FT                   /product="proprionate catabolism activator, Fis family"
FT                   /note="TIGRFAM: propionate catabolism operon regulatory
FT                   protein PrpR; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; Propionate catabolism activator
FT                   domain-containing protein; helix-turn-helix Fis-type; KEGG:
FT                   bpy:Bphyt_5404 proprionate catabolism activator, fis
FT                   family; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3764"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59704"
FT                   /db_xref="GOA:E1TIZ4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIZ4"
FT                   /inference="protein motif:TFAM:TIGR02329"
FT                   /protein_id="ADN59704.1"
FT                   /translation="MAECANVPLSVSWNVSDASIAALGGHREFAVSTFAPSFSNADRGR
FT                   PGVALVSISRLQSLCETIAPRYAERARFFPVREGYGAAVTALQRYVDAGSVDVVLAAGS
FT                   NGAYLRDHLSVPVVMVKVNGFDVLSAITHATSTWPGAAIGLVLHETVAHELAELDGWLN
FT                   VRLTQRAYRSADEVRTAVNNLADAGCRVIIGPGMACDLAQQAGLASVFLYSLGAVEEAF
FT                   ERSVELARVSRQKESKRVRLNTIVAHLRDGVAAFDDAGQLEAVNPAMLDLLGLQRERDV
FT                   SAGLVRTVGPWLREALERGGAVDERIQQIGERSLIVNCVPILEQGVRSGSVVTVQDALV
FT                   AQRIDRSLRTSQRPKHLVARHRLEDLVGESAALQRVRRLARAAAAHDVTVLLSGESGTG
FT                   KELVAQGIHNASRRRGNPFVAFNCAALPEGLIESELFGHEEGAFTGARRGGKPGLFEIA
FT                   HTGTIFLDEIGEMPAALQSRLLRVLQEREVMKLGSGRATPVDVRVIAATHRDLHALVEQ
FT                   GAFRADLYFRLNLLQIELPPLRERRADAVALARHLLSRSALQYKLPEAAHERVLAFLAP
FT                   LFDGYAWPGNVRELENLLARAAIYLEAAGGDAAAADGAERTDDDSGADLRALFPEFERM
FT                   TRAEGRHTLANTAADEAVAARLNATPVAAVTGPKPGASRQAALTATGSAASVPRAAPSR
FT                   QQVLSALEQCQGNRAAASRMLGIGRTTLWRLLKADGNR"
FT   gene            274331..275212
FT                   /locus_tag="BC1003_3765"
FT   CDS_pept        274331..275212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3765"
FT                   /product="isocitrate lyase and phosphorylmutase"
FT                   /note="PFAM: isocitrate lyase and phosphorylmutase; KEGG:
FT                   bpy:Bphyt_5405 putative carboxyvinyl-carboxyphosphonate
FT                   phosphorylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3765"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59705"
FT                   /db_xref="GOA:E1TIZ5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIZ5"
FT                   /inference="protein motif:PFAM:PF00463"
FT                   /protein_id="ADN59705.1"
FT                   /translation="MSTSATRRAAFRAKVNQREGLLVPGAFNAMSARVIEDAGFEAVYI
FT                   TGAGVTNMSLGLPDLGFIGLAEVAEHTARIRDAVALPLIVDADTGFGNALNVRQTVRVL
FT                   ERSGADVIQFEDQIMPKKCGHFSGKEVISTSEMVGKIRAAVDAREDGNLQIMARTDAAA
FT                   VHGIEDAIERGHRFIEAGADILFIEATESLADIERLPSLFDKPQLINIVIGGKTPVQSR
FT                   EALAKLGYGIVLYANAALQGAVLGMQRALGTLKTNGRLDEDASLVAPFSERQRLVNKPL
FT                   YDRLDREYAAKD"
FT   gene            complement(275355..275627)
FT                   /locus_tag="BC1003_3766"
FT   CDS_pept        complement(275355..275627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3766"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_2672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3766"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59706"
FT                   /db_xref="UniProtKB/TrEMBL:E1TIZ6"
FT                   /inference="similar to AA sequence:KEGG:AZC_2672"
FT                   /protein_id="ADN59706.1"
FT                   /translation="MGFILLTTFLECVLVPCRSAGPAVAAATGATAAITPRGAWSPLSG
FT                   DMARPCPRLDLVDMGCESRLCTLSYLRHPSPLHPGAVLAGFAGRP"
FT   sig_peptide     complement(275529..275627)
FT                   /locus_tag="BC1003_3766"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.682) with cleavage site probability 0.333 at
FT                   residue 33"
FT   gene            275724..277163
FT                   /locus_tag="BC1003_3767"
FT   CDS_pept        275724..277163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3767"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_5406 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3767"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59707"
FT                   /db_xref="GOA:E1TJ87"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ87"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59707.1"
FT                   /translation="MSATHAAHKHVGWLPYIVAATFFMEYLDTTVIATALPQMAHSFGV
FT                   GPNSISLGMTAYMLALAIFIPASGWVADRCGSRNVFFSAIGVFTVASILCGLSQNVAEF
FT                   TAARLLQGIGGAMMVPVGRLIVVRSTEKSRMMQAISTITWPAIAAPVVGPPIGGFITTY
FT                   ASWRWIFLLNVPFGLAAMAVALAMVPNLRGSERRPLDVVGLLLSGTALTAILYGAELAS
FT                   QPAENPWVAGAIIAAGLLVGVVAFQHAKRHPHPLIDVSTLKIPTFSVTVVTGSFTRIGI
FT                   GAVPYLMPLLFQVGFGLSAFKSGLLLLASALGNLGMKALTTRILQRFGFRMVSIVDVTV
FT                   AGIFIIACGLLTPEVPLALVLIVVFVYGVARSMQFSTLATLAYADVAQPQMSAASTLWS
FT                   AAAQMTIGLGIAFGAVSLRAAAFFNGETSGHAFTLDDFRLAFLLAGVLTLLSVIGYMGL
FT                   SRDAGQSIGGGSRGAEDPAKG"
FT   gene            277192..277629
FT                   /locus_tag="BC1003_3768"
FT   CDS_pept        277192..277629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3768"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bpy:Bphyt_5407 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3768"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59708"
FT                   /db_xref="GOA:E1TJ88"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ88"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADN59708.1"
FT                   /translation="MTTSNDLKISSDNSELDLDIVHAFLSQQTPWAKGMPRETLERAIA
FT                   GSLCFGGYVDGRQVAFARVVTDHATFAYLCDVFVLPEHRGKGYAHALLTQLLASESLQG
FT                   LRRIMLATTDAHHVYRPHGFKALSNPALFMEVHNPDVYTSA"
FT   gene            complement(277692..278633)
FT                   /locus_tag="BC1003_3769"
FT   CDS_pept        complement(277692..278633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3769"
FT                   /product="Procollagen-proline dioxygenase"
FT                   /EC_number="1.14.11.2"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: bpy:Bphyt_5409
FT                   procollagen-proline dioxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3769"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59709"
FT                   /db_xref="GOA:E1TJ89"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ89"
FT                   /inference="protein motif:PRIAM:1.14.11.2"
FT                   /protein_id="ADN59709.1"
FT                   /translation="MHYACSIQQRGKGMPVVDAAWQEWLRTNAARGCTMESMIEAMVQA
FT                   GFAPDAAGEAVRGAFGATALDALPLAASAGGVQAALPQELQGSQKARAAYEYDAGPVAR
FT                   GNTIRAFDRDVQVLMRCERPQVIVFGNVLSPDECAEMIERSRHRLKRSTIVDPATGRED
FT                   VIRNRTSEGIWYQRGEDALIERLDQRIASLMNWPLENGEGLQILHYGPSGEYRPHFDYF
FT                   PPDQPGSAVHTARGGQRVATLVVYLNDVPDGGETIFPEAGLSVAAQQGGAVYFRYMNGR
FT                   RQLDPLTLHGGAPVLSGDKWIMTKWVRERPYV"
FT   gene            complement(278650..279129)
FT                   /locus_tag="BC1003_3770"
FT   CDS_pept        complement(278650..279129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3770"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   bxe:Bxe_B1198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59710"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ90"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ADN59710.1"
FT                   /translation="MRHPNIELIERFYTAFQRRDADTMIACYADDVVFSDPAFGELRGD
FT                   EVRDMWRMLVTRAQDFTLTFDSVEADDHAGRAHWTAGYVFSQTGRPVVNQIDARFAFRD
FT                   GLIVEHRDSFDLWAWLRQALGARGALLGWSPLVQRSIRARARKGLAIYRRQDHQS"
FT   gene            complement(279245..280693)
FT                   /locus_tag="BC1003_3771"
FT   CDS_pept        complement(279245..280693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3771"
FT                   /product="Nicotinamide phosphoribosyltransferase"
FT                   /EC_number="2.4.2.12"
FT                   /note="KEGG: bxe:Bxe_B1188 putative nicotinate
FT                   phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3771"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59711"
FT                   /db_xref="GOA:E1TJ91"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016471"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ91"
FT                   /inference="protein motif:PRIAM:2.4.2.12"
FT                   /protein_id="ADN59711.1"
FT                   /translation="MINESSGPGGVRAFLANPILNTDSYKASHYLQYPPEASAMFSYIE
FT                   SRGGRYDRTLFFGLQMLIKEYLCRPITASMIDEAKAFFIAHGEPFNEAGWRHIVEHYGG
FT                   YLPVRIRAVPEGSVVPTHNALVTVECDDPQVFWLASYLETMLLRVWYPVTVATQSWHLR
FT                   QTIRAYLHKTSDDLTQLPFKLHDFGARGVSSAESAAIGGAAHLVSFMGSDTVLGVVAAN
FT                   HYYNESMAAFSVPAAEHSTITSWGRERETDAYRNMIAKFAKPGAIVSVVSDSYDLFAAL
FT                   KVWGTELRQAVLDSGGMLVIRPDSGDPRSIVLQTLHALEASFGSSVNSKGWRVLRNVRV
FT                   IQGDGVNADSLEAILAAMEHAGFAADNIVFGMGGALLQQINRDTQRFAMKCSAIRLGDQ
FT                   WHDVSKDPVTDASKRSMKGRLTLLVNRRTGEYRTATLPLASHEHTGAANAEWQDAMATV
FT                   FDSGKLLVDVSLAEIRARAQAHEG"
FT   gene            complement(280840..281148)
FT                   /locus_tag="BC1003_3772"
FT   CDS_pept        complement(280840..281148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3772"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3772"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59712"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ92"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5416"
FT                   /protein_id="ADN59712.1"
FT                   /translation="MKTQISGPACAPRHDQSATSVTRSAARAPRLRYRAHVGAKRAWFF
FT                   AAPVDLTALVIAEAIKRRAQAELQRPALRDAYELPVSHERTDARGESIRPPESGDAD"
FT   gene            282504..284063
FT                   /locus_tag="BC1003_3773"
FT   CDS_pept        282504..284063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3773"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="KEGG: bpy:Bphyt_5417 sigma54 specific
FT                   transcriptional regulator, fis family; PFAM: sigma-54
FT                   factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3773"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59713"
FT                   /db_xref="GOA:E1TJ93"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ93"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADN59713.1"
FT                   /translation="MPVMNNVKQQSSASTESGVMEMTFASAEIGRTVLYVSNSPDQKLA
FT                   DFLAASGWHAVHAKTTASAERMIERENIKVGLVELPEDCTSQQLSALAACMRRPETNWV
FT                   AQIAPGQADNELVSRFILDYCFDFVTRPWLNERLVFALGHAHGLSALRHVQVAPEPSLG
FT                   RHGMVGQCEAMQQLYRRIDKCGPTEAPVFIAGESGTGKELTARAIHERSPRAGRQFVAI
FT                   NCAAIPPTLLQAELFGHERGAFTGALQRKIGRIESAHEGTLFLDEIGDMPHECQAVLLR
FT                   FLQEGTIERLGGNGPIQVDVRVISATHVDLDKAVEDGRFRADLYHRLCVLRLVEPPLRE
FT                   RGGDIRLLANYALGMYRQDGARKLRGLSSDAIVAMSNYAWPGNVRELINCVRRAVVMSE
FT                   GRFLTAGDLGLPATDNGPPVTLAEIRSKAEKDAIEHALQRHGYKLSEAAAELGISRATL
FT                   YRLMHADRLHQEPAGGHGSNGGGNGTSGTSGANGGSHRTPHADDDGESERRSPSLMSAA
FT                   SA"
FT   gene            284633..287410
FT                   /locus_tag="BC1003_3774"
FT   CDS_pept        284633..287410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3774"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bpy:Bphyt_5420 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3774"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59714"
FT                   /db_xref="GOA:E1TJ94"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ94"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADN59714.1"
FT                   /translation="MRKLLHACFVALLILGAPPVLAAVTPATPASAASGTAVTLTPDQA
FT                   RQALSVLNDPKRRAQVADTLQAIAAAGALSAPASTAAPASAPAPASGAAALVPAAFKSN
FT                   GLASQLARQGAHWAVHLGTSLRNSVTALLDVASVRAWWNWQLTSPQARSVLAHVAWSLL
FT                   AALLPALVLEWLARRLLRRAYRALAARREHGDLTDAPRTDLPVDVVPQPADAPNAAPPL
FT                   PAPPVAEARANAEAEAAAKQATAAAAASSAATPATGEPPVTPTPAPSAATGKAAEAKGK
FT                   QNATHHWTLLQRLPRALLVTVLRLVPLAVFVGASSALMSLFTDDNTPQDRALDSLVDIY
FT                   VLCRLVVIVSGFFLQPAAPRLRLLRMSDAWSVFVHRWVIRIVSVIGVGSAVAEIARSLG
FT                   LNEAAHLALMKVVALAGHVMLSILILQCAKPVGELIRQRAAARKSLELAGNALADAWAW
FT                   LAVFVVMALWFIWALDVQNGYHALLQLGGMSLAVLVGARVLAIVIFGGLARLFNGREDA
FT                   DQSLVHQHAYRYYPLLRRVVSWIIGIATALALLAVWGVDVGELFRDGSIGHRLASALVT
FT                   IGVAAVIALLVWESVNVSVERRLERWTTSGDLVRAARLRTLLPMLRTALFCAIALVVVL
FT                   TGLSELGVNIGPLLAGASIFGVALGFGSQKLVQDFITGIFLLMENAMQVGDWVTVAGVS
FT                   GTVEYLSIRTVRLRGSDGSLFTVPFSSVSTVNNTNRGIGNAAVRVNIVFGQDVDLAIET
FT                   LKEIGAALREEDKFKDGILSDFSFWGVDAVDGSAVTLAGQMQCRDSARWGVQREFNRRI
FT                   LDQFRERGIEIANPQRNLLTWDPQSVAPRVEAAEPPEQESQRPPQTTPEAAPEATPEAA
FT                   GATQAPSARSSADGASSDGASKGDAPVQDQIPVDPKPAGGPGTPANPGQASPHE"
FT   sig_peptide     284633..284701
FT                   /locus_tag="BC1003_3774"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.936 at
FT                   residue 23"
FT   gene            complement(287432..289696)
FT                   /locus_tag="BC1003_3775"
FT   CDS_pept        complement(287432..289696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3775"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; Helicase-like, DEXD box c2 type;
FT                   KEGG: bxe:Bxe_B1180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3775"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59715"
FT                   /db_xref="GOA:E1TJ95"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ95"
FT                   /inference="protein motif:SMART:SM00491"
FT                   /protein_id="ADN59715.1"
FT                   /translation="MTYVVAVRAMCEFTARRGDLDLRFTPAPTSLEGMAGHVTVAGRRA
FT                   SGYESEIALTGTHRNLTVRGRADGYDPVANRLEEIKTHRGDLERMPANHRTLHWAQALV
FT                   YGHLLCRARGLAELSVALVYFNVGSQKETVLTQLHTARELEIFFVDQCERFLDWAVQEE
FT                   AHRAARNAALSALQFPHAQFRSGQRELAVSVYRAARDGKALMAQAPTGIGKTLATIFPL
FT                   LKACAAQQIDRVFFLTAKTPGRALALDAIDTLHRSTAPLPLRTLELVARDKACEHPDKA
FT                   CNGESCPLARGFYDRLDAARSAALAVSRMDRVAVREAALAHDVCPYYLAQELARWADVV
FT                   VGDYNYYYDSSAMLYALTQINQWRVGVLVDEAHNLLDRARRMYTASLDQAALRLARKTA
FT                   PLTLRKPLERLQREWNAVRRAQQASYQVYAEVPGKLLAAAQNLIGAVTDQLAEAPLSID
FT                   EAALRFFFDAMHFVALAEQFGEHSIFDITLSTDRHAPRDKGSCVLCVRNVIPAPFLAPR
FT                   YAAARTTVLFSGTLTPHHFYRDTLGLAQDTQWLDVEGPFRAEQLRVRVAGNVSTRWRDR
FT                   DRSLEPIVDLIAAQYLAKPGNYLGFLSSFEYLQQVVALMRERHPGLPVWAQEPRMDEAA
FT                   RDAFLARFRTANQGVGFAVLGGAFSEGVDLVGQQLIGAFIATLGLPQMNEVNEQMRRTM
FT                   EARFGNGYEYMYLYPGLQKVVQAAGRVIRTEHDQGVVHLIDDRYRRSEVRRLLPRWWQV
FT                   Q"
FT   gene            complement(289693..291699)
FT                   /locus_tag="BC1003_3776"
FT   CDS_pept        complement(289693..291699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3776"
FT                   /product="VRR-NUC domain-containing protein"
FT                   /note="PFAM: VRR-NUC domain-containing protein; KEGG:
FT                   bpy:Bphyt_5422 VRR-NUC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3776"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59716"
FT                   /db_xref="GOA:E1TJ96"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="InterPro:IPR033315"
FT                   /db_xref="InterPro:IPR040603"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ96"
FT                   /inference="protein motif:PFAM:PF08774"
FT                   /protein_id="ADN59716.1"
FT                   /translation="MATDATPDSPAGVPYYLLNFERALAWLAQRYDDLLDADERAFFGA
FT                   FALLPQASRALLVRMLMRKGTLFRASRLAYDEIGCPLQAAAPISALGWLDPAPHLTLDD
FT                   LFALTTRAELLDIFADALALIPGARGLRKPELLEALRPFHAQRDDEDGSGKNSGNYTAN
FT                   NPGNNVARPLSAWHPHSSDCVFRVDVAPLCERLRLMFFGNLQQDWSEFVLADLGVFQYE
FT                   KVAFGPSSRAFQRRADVDVYLALHACREELASIESFGLLLDREAEEAVIGEIVTRVRAV
FT                   EVPDSWLEMRRAKLLFRIGQHCERRQLWARAMVVYELCKWPGARHRRIRVLERSERFDA
FT                   ALALALQAAASPESEEEQQRVARMLPRLRRKLGEPAVRVRAERAAERSTLILPRPQASA
FT                   SQYAPSPEATHAPPSVEYLVRDHLTCEAAPVYYVENALINSLFGLLCWQPVFAALPGAF
FT                   FHPFQRGPADLHAPDFHARRAAQFAACLGQLDNGAYRETILRHLRDKAGVQSPFVFWGL
FT                   LTPELVTMALDCLPAAHLKLWFERLLRDVRANRSGLPDLIRFWPAERRYELIEVKGPGD
FT                   RLQDNQIRWLTYCVQHGMPVRVLDVRWADEAQSDACADAAAAKVTNTATSAADAAAATA
FT                   TDAAAVAATNATDAANAAEATAAPAATLAERIT"
FT   gene            complement(291754..292344)
FT                   /locus_tag="BC1003_3777"
FT   CDS_pept        complement(291754..292344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3777"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162; KEGG:
FT                   protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3777"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59717"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ97"
FT                   /inference="protein motif:PFAM:PF02589"
FT                   /protein_id="ADN59717.1"
FT                   /translation="MATREAFLARVREAQPAARPRPEVPLFNPVGGDLRARFTAALETM
FT                   GGTCVEAQTASGVTGLIRERFGGAVSIVSATAEVPGTRTLTADTEPASLQDIDVGVVRA
FT                   RFGVAETGSVWFSEREYVVNALGYIVQHLVVLLDPAQLVDGLQDVYRRDDFRDARYAVL
FT                   VTGPSATADIEGVLIRGAQGVRSLTVVWLAAGA"
FT   gene            complement(292331..293722)
FT                   /locus_tag="BC1003_3778"
FT   CDS_pept        complement(292331..293722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3778"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162; KEGG:
FT                   bpy:Bphyt_5428 protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3778"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59718"
FT                   /db_xref="GOA:E1TJ98"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ98"
FT                   /inference="protein motif:PFAM:PF02589"
FT                   /protein_id="ADN59718.1"
FT                   /translation="MSRIDHAKAAGDFIKKTEHVAFHDRRLWDLRQKRDAQAQAIAEWE
FT                   TLRELASGIKEHTLSHLSQYLEQFAAAAEANGVVVHWAATAEEHNALVHKIMSERGMTT
FT                   LVKSKSMLTDECRMREYLEPRGITVMETDLGERIQQLDHQDPSHMVVPAVHKLRADVAQ
FT                   LFGRTIGTDPHNSDIHYLAESQRMNTRPYFVREKTAGMTGCNFAVAETGTVVVCTNEGN
FT                   ADLSANVPPLHIASIGIEKLIPKVADLGVFIRMLSRSALGSPVTQYTSHFRAPRPGAEM
FT                   HFILVDHGRSERLAMEDFWYSLKCIRCGACMNTCPVYRRSGGLSYGGTYSGPIGAIINP
FT                   TFDLKRYSALPFASTLNGSCTNVCPVKINIHEQIYKWRTVIAERHEVPFVKQEVLKMAG
FT                   RLLASPTLYRATVASMSGALRRLPNFVLYNPLNIWGRQRELPEPPKQTFHAWYKKNRGG
FT                   GDGNA"
FT   gene            complement(293719..294510)
FT                   /locus_tag="BC1003_3779"
FT   CDS_pept        complement(293719..294510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3779"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: bxe:Bxe_B1176
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3779"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59719"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJ99"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADN59719.1"
FT                   /translation="MCPPVHTSLPSSIHEHMKVALFIPCFIDAFYPEVGIATLELLERF
FT                   GIEVDYSQEQTCCGQPMANSGAHADAAGAERVFARNFAGYDYIVGPSASCIHHVREHLT
FT                   AIEQTDEVRKVRASAYELVEFLHDVVGAREFPWAEFPHRIGLHNSCSALRHLKEASMSE
FT                   VAGQPFSKPRTLLEGVKGIEFVKPSRPDECCGFGGTFSVTEEPVSVRMGQDKVRDHLNA
FT                   GAQYIVSGDMSCLMHQQGCAERMKADARFIHIAQVLNGARA"
FT   gene            complement(294759..295487)
FT                   /locus_tag="BC1003_3780"
FT   CDS_pept        complement(294759..295487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3780"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: bpy:Bphyt_5432 GntR domain protein; PFAM: GntR
FT                   domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59720"
FT                   /db_xref="GOA:E1TJA0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJA0"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADN59720.1"
FT                   /translation="MHFRPIQSFTRKRLSDVVADQIKQLISDGTLMPGDRLPAERDLAT
FT                   QLAVSRPSLREALIRLESDGYIATSGRGGFTVVDLTAPIISRPLAELLLQNPRTSADIL
FT                   ELRQGLESISTVYAAERATAADLRKIRTAFEALKAASQSQDRVNLAELDAAFHLAIADS
FT                   THNIALAHVMHGIHTLIGEGMRQYHRLIDYDEAMEKQLMSQHQAIYDAVMARDAQKARK
FT                   AAERHLAFVREIYQEDAAKL"
FT   gene            complement(295567..296736)
FT                   /locus_tag="BC1003_3781"
FT   CDS_pept        complement(295567..296736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3781"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   bpy:Bphyt_5434 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3781"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59721"
FT                   /db_xref="GOA:E1TJA1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJA1"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADN59721.1"
FT                   /translation="MKYSSRVEGLQGRRTSAWEIHRVAQQAAANGEDVIVLSVGDPDFA
FT                   TPAPIVERAIEALRGGDTHYSAVSGRDPLRAAIAAEQSRMSGCSVTAANVILTAGAQNG
FT                   VFAASLCLLEAGDEVIVPEPMYLTYEACVRAAGATLVPVPVDPARAFHLNCDALENAVT
FT                   SRTKAIFFATPCNPTGVVMPRADLERIARLACKHDLWVLSDEVYADLTFEREHVSIMAL
FT                   PGMAGRTVTLGSLSKSHAMAGWRVGWAIGPTQLIEHMGRLALAMLYGLPGFIQQAALTA
FT                   LQDKARIVAEMREIYRRRRDVVFEHLSRIPRLRCLLPEAGMFMMVDVSGTGLDTVDFTW
FT                   RLFRAQGVSVLDASAFGETANGFVRLGFVVDEARLAEACKRIAAFVATL"
FT   gene            complement(296878..298359)
FT                   /locus_tag="BC1003_3782"
FT   CDS_pept        complement(296878..298359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3782"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: bpy:Bphyt_5435 RNA polymerase factor sigma-54;
FT                   TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3782"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59722"
FT                   /db_xref="GOA:E1TJA2"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJA2"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADN59722.1"
FT                   /translation="MPSIELRTRQSLALTPRLQQSVRLLQLSSLEFQQELRTALDTNPF
FT                   LEYDSSDTEDVALATPTPGDESGALPATDAVAAAEPDALPAEAVTSETLDSGGPDDMPG
FT                   DFSGDYSSRSSARQNGDSDGSDPAEWARSQPTLREQLHDALRLYRLDDRDRAVARFIIE
FT                   ALDDDGYLRQNLADLADSVDLEPELTEEELLVALRLVQSLDRPGLGARSLSECLLLQLN
FT                   ALPAETPGREVARQIVEHHLERLARREQAELQKQIGCSAEELRVACALVRKLDPKPGNC
FT                   YGRTEDNYIVPDVIVRQVRNKWVVTINPAVQPRARIHRMYAELFAQSAGASRSPLAQQL
FT                   QEARWLIRNAQQRFDTIQRVAECIVAHQKAFFQYGEIALKPMVLRDVADELGLHESTIS
FT                   RATGNKYMATPRGIFEFKHFFPRELGTESGGTCSAAAVRALLKEMIAAENARDPLSDVT
FT                   LAKMLADQGVLVARRTVAKYRHLMKVPPAELRRQV"
FT   gene            298900..299238
FT                   /locus_tag="BC1003_3783"
FT   CDS_pept        298900..299238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3783"
FT                   /product="transport-associated protein"
FT                   /note="KEGG: bxe:Bxe_B1170 phospholipid binding protein;
FT                   PFAM: transport-associated; SMART: Transport-associated and
FT                   nodulation region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3783"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59723"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJA3"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADN59723.1"
FT                   /translation="MKTIQMLKTAGTIACVAFALNATAQTSASAPPAASESLGQHIDDG
FT                   TITTKVKAELLGAKNVKSTHIHVKTRKGVVWLTGTVPSADDKLAAQEVVEGVKGVSSVK
FT                   NRLKIAAE"
FT   sig_peptide     298900..298974
FT                   /locus_tag="BC1003_3783"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 25"
FT   gene            complement(299368..299817)
FT                   /locus_tag="BC1003_3784"
FT   CDS_pept        complement(299368..299817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3784"
FT                   /product="Protein of unknown function DUF2383"
FT                   /note="PFAM: Protein of unknown function DUF2383; KEGG:
FT                   bpy:Bphyt_5437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3784"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59724"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011971"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR016920"
FT                   /db_xref="InterPro:IPR019052"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJA4"
FT                   /inference="protein motif:PFAM:PF09537"
FT                   /protein_id="ADN59724.1"
FT                   /translation="MATNVVSVLNDLIETSKDGEKGFRKAAEDARDAQLKTLFLTRAED
FT                   CARGARELQDVVQRLGGKPETGGSVSGALHRGWVDMKSAVTDRSDHQILVEVEKGEDVA
FT                   KKNYHDALEKELPADVRAIVERQYQGVLQNHDRVRDLRDQYAARS"
FT   gene            300213..300464
FT                   /locus_tag="BC1003_3785"
FT   CDS_pept        300213..300464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3785"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3785"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59725"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJA5"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5438"
FT                   /protein_id="ADN59725.1"
FT                   /translation="MKISSAEFLATVAIVSSAAVLQLRQHAQPDENLATSAPQSVEVAP
FT                   SSCERARNGVIPASCEAAREQRPAEHAPPQRGAARIWV"
FT   sig_peptide     300213..300296
FT                   /locus_tag="BC1003_3785"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.807 at
FT                   residue 28"
FT   gene            complement(300612..301193)
FT                   /locus_tag="BC1003_3786"
FT   CDS_pept        complement(300612..301193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3786"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3786"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59726"
FT                   /db_xref="GOA:E1TJA6"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJA6"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1167"
FT                   /protein_id="ADN59726.1"
FT                   /translation="MSLIVAARFTTFPAAEEAAQKLFNAGFVEEDVTLFFVNPRGQHAR
FT                   FPIGGDTHTDAGAKGAPKGAGLGVTIGAVVGAIVGVGIFAAFSAPLLVSAIAAGVGAYI
FT                   GSLAGAMWRTRQGAEAGHRTPFHEETRDSGVLVAVHVSTDNQLEAARVLRDAGGVSIER
FT                   ATGRWQQGRWADFDPLKQPVPLNEFNEKRA"
FT   gene            complement(301344..301688)
FT                   /locus_tag="BC1003_3787"
FT   CDS_pept        complement(301344..301688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3787"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="PFAM: protein of unknown function DUF1488; KEGG:
FT                   bpy:Bphyt_5440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3787"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59727"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJA7"
FT                   /inference="protein motif:PFAM:PF07369"
FT                   /protein_id="ADN59727.1"
FT                   /translation="MNAILPRPAYEDSLMQITFPDDKPTFDGANLTVRFMARVEGEPVV
FT                   CAITVEALEDHFGAESPLESALMEAFEKGRNRIRSVCAEALDQNNGEGVILHSGLFRVE
FT                   GMESDRGTAA"
FT   gene            complement(301685..302251)
FT                   /locus_tag="BC1003_3788"
FT   CDS_pept        complement(301685..302251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3788"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3788"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59728"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJA8"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5441"
FT                   /protein_id="ADN59728.1"
FT                   /translation="MKLRYSLQVTALALGLGVASAGAAYAQASDAPASAAPAGGTSLSP
FT                   ADQQFIQDASQSDATEIAASKVALKNSRDPRVKKFAQQMITDHTKLARSMAAITAKMRV
FT                   PAAPAADSALVGKLQTLKGQQFDEAYVEQIGVEAHQRAVDLFQQQSQSGTDSQLKAAAA
FT                   RALPIIQHHLEMAKQLAGTMKGSSS"
FT   sig_peptide     complement(302165..302251)
FT                   /locus_tag="BC1003_3788"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.505 at
FT                   residue 29"
FT   gene            complement(302340..302891)
FT                   /locus_tag="BC1003_3789"
FT   CDS_pept        complement(302340..302891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3789"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="KEGG: bpy:Bphyt_5442 intracellular protease, PfpI
FT                   family; TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3789"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59729"
FT                   /db_xref="GOA:E1TJA9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJA9"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ADN59729.1"
FT                   /translation="MANSLDGVKVAVLAVDGFEQAELVEPKRALAEAGATVHVISEKPG
FT                   KIQGFKHVDKGDAIEVDTTFDKATAADYDAVVLPGGVVNGDAIRLLPQAQAFVKAADSA
FT                   HKPIAVICHGTWLPVSAGIIKGRTVTSWPSLQDDIRNAGGTWVDQEVVEDNNLISSRKP
FT                   DDIPAFNKALIGQLSKRKAA"
FT   gene            complement(303106..303450)
FT                   /locus_tag="BC1003_3790"
FT   CDS_pept        complement(303106..303450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3790"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59730"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJB0"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5443"
FT                   /protein_id="ADN59730.1"
FT                   /translation="MSSTLNPDEEPQQVVKQTSGTTGTLGPSDSSDSGSDVAGQKRHEF
FT                   DVDTELDNHALETGELELASDTDRAGTGERAAADGDSTLDPDRDIEPDRVVNPPEAADD
FT                   DGLDEDPSGL"
FT   gene            303624..304991
FT                   /locus_tag="BC1003_3791"
FT   CDS_pept        303624..304991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3791"
FT                   /product="DNA topoisomerase"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bpy:Bphyt_5444 DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3791"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59731"
FT                   /db_xref="GOA:E1TJB1"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJB1"
FT                   /inference="protein motif:PRIAM:5.99.1.2"
FT                   /protein_id="ADN59731.1"
FT                   /translation="MPTTNSTTPNAHAPADDAAKQAAATTMPPGLRHADDSKPGYTRKR
FT                   EKDGFAYFDVEGKRIEDEAEIQRINSLAIPPAYEDVWICPDPRGHIQATGRDTRGRKQY
FT                   RYHPRWRETRDADKYERMREFGRALPKIRARVARDLELPGMPCDKVMAAVVRLLDTTLV
FT                   RIGSVEYARENQSYGLTTLRKKHVKVEAGQVRFKFRGKSGIEHDVTVDDARVKRIVRRC
FT                   AELPGHDLFQYLDDEGNRRTVGSADINDYLRRASGADFTAKDYRTWAGSVYALATLRRL
FT                   VCESAAEARRHIVATVKEVAGLLRNTPAVCRRCYIHPAVISAFEADELQSLPPGQSRRG
FT                   LKVDEVAFAALLAHAEKRAAKLARQAGAKGRKLREAQEADSINGSISTLLQKSRAIRKE
FT                   ANKAALKAGAKTARQGRGKAAAKAGVQDEAQAGIKARARSSRRAAAGPGADKPAAG"
FT   gene            305139..305654
FT                   /locus_tag="BC1003_3792"
FT   CDS_pept        305139..305654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3792"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bxe:Bxe_B1160
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3792"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59732"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJB2"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ADN59732.1"
FT                   /translation="MVMQSQTQRMQGARIVGKGSATAEGPGPDVMAADTLDDNRVLSSD
FT                   GEDIGKIKDIMLDVRSGRIAYAVLSSGGFLGIGDKLLAIPWQALTLDTEQKCFVLNMPA
FT                   ESVKNAPGFDKDHWPSMADETWATSVHQYYGSEPYWSRDRFDLRDDTRIGDIPAGSSDA
FT                   PEAGGVKL"
FT   gene            305870..306280
FT                   /locus_tag="BC1003_3793"
FT   CDS_pept        305870..306280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3793"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3793"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59733"
FT                   /db_xref="InterPro:IPR021513"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJB3"
FT                   /inference="similar to AA sequence:KEGG:BC1002_4029"
FT                   /protein_id="ADN59733.1"
FT                   /translation="MATSKTTSKAKRPQARGKSGRPPRQRHAQAHAAQQRKAASAGGGK
FT                   RPRKWSHHVMETSDAMDLQPDIFKNANAEEIAQSLKQSSTKSRRRKGTPFQSAMSMLNF
FT                   YINRAGRNLPKTRRATLEQAKRKLREAFGRAP"
FT   gene            306531..307874
FT                   /locus_tag="BC1003_3794"
FT   CDS_pept        306531..307874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3794"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: bxe:Bxe_B1158
FT                   CPA1 family Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3794"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59734"
FT                   /db_xref="GOA:E1TJB4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJB4"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADN59734.1"
FT                   /translation="MAGLNRMHMHETYWFLIVGAVLVFMGIAATTLRRLPVSAAMVYVA
FT                   VGYGLGPPGLDLLHLDMIADAHLLRMLTEVALLVSLFTIGLRLRVGILDRLWTVPLRLG
FT                   FLAMLATVPLLALFCVYVLHLGWGPAILLAAILAPTDPVLAHDVQVHDPGDHDLLRFAL
FT                   SGEGGLNDGIALPFAMIGLAFCALPGAGAGDVLNLKLAGSAAWGVLGALAIGGLLGWGT
FT                   THAVAWLRTRHAHALGLEGFFALGLIGLSFGAAQLAQTYGFLAVFAAGVSMRRVEHRAS
FT                   GGTSPREAIGTIDSADVEATASDPDKAHAFMTESVLGFTIELERIAEVVIMAMVGNVLS
FT                   TLNAPLFTWPALALIVALFFAVRPASVELSLFGSAASPTQRRLMSWFGIRGVGSFYYLA
FT                   YALEHGPAADITPLVPLALAVVTASVVIHGVSSTPLMNRYRRLRRRER"
FT   gene            307932..308519
FT                   /locus_tag="BC1003_3795"
FT   CDS_pept        307932..308519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3795"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3795"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59735"
FT                   /db_xref="GOA:E1TJB5"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJB5"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1157"
FT                   /protein_id="ADN59735.1"
FT                   /translation="MPLRLPMTSSDPAHTRRRSAGESLFAFLKSLPFAERLAEGGLMAF
FT                   QAVAGASLAFGIGRMLHTEQAFWAAITAIAVSQHSYIDTRKLSRDQFIGAMVGGVCGLA
FT                   GATLGHGYFAAYAATVAAAIVICWVVNVGSAARLGGITATIMLLVPGIGPAWDKALLRL
FT                   GEVTLGTVCALLVAWLISVAEKHWSGTDRDAR"
FT   gene            complement(308533..309507)
FT                   /locus_tag="BC1003_3796"
FT   CDS_pept        complement(308533..309507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3796"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bxe:Bxe_B1156 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; Cupin 2 conserved barrel domain protein;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3796"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59736"
FT                   /db_xref="GOA:E1TJB6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJB6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN59736.1"
FT                   /translation="MDTLSRLLDLARPQASLDLRCLLSGAFDVDHAPMEAGIAPFHLVL
FT                   EGECVIETADGGPVPLRAGDFVLFPRGTAHRVRDTKRGTSTAPLVTGHDGLLPIKSNHA
FT                   AAARQPAAGELLNGADLDLLCGRFVYTPGSSALLLNALPDPFRVSLGGAHALGSLQALI
FT                   GLMRDEAGQRRPGALAIVTALSQALFTMALRVHGDEAGSAPGMLALLADARLAASVQGM
FT                   LAAPERPWTIAELGELAAMSRATYARRFNERAGMTVMDFLTQIRMTIACDLLRRTQRSA
FT                   AEVGEAVGYQSEAAFGKAFQQHVGVTPGRYRRLPHNGAPAAAA"
FT   gene            309635..309871
FT                   /pseudo
FT                   /locus_tag="BC1003_3797"
FT   gene            310325..314896
FT                   /locus_tag="BC1003_3798"
FT   CDS_pept        310325..314896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3798"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="KEGG: bxe:Bxe_B1153 DEAD-box ATP dependent DNA
FT                   helicase; PFAM: DEAD/H associated domain protein; DEAD/DEAH
FT                   box helicase domain protein; helicase domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3798"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59737"
FT                   /db_xref="GOA:E1TJB7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJB7"
FT                   /inference="protein motif:PFAM:PF08494"
FT                   /protein_id="ADN59737.1"
FT                   /translation="MPAPPATSAAPTTLAAPAVPTTPALPAAQNSHAALANFHPAVAGW
FT                   FLKTFPAPTDAQTAAWPSIRQGRSTLVAAPTGSGKTLTAFLSALDDLVQQGLASNGALP
FT                   DETLVVYVSPLKALSNDIRLNLQVPLQGIAAELAARGLPPLDIRTAVRTGDTTQQERNA
FT                   LKKRAPHILVTTPESLYVLLGSDSGRRMLATVRTVIVDEIHALAGSKRGSHLALSLERL
FT                   DALCGRRLPRIGLSATQKPVSAVARFLVGGASVDSEIAADCAIVDVGHIRARDLALEIP
FT                   PVPLEAVMPNEVWERVYDRLAELVALHRTTLVFVNTRRMAERAARHLTERLGKEAVAAH
FT                   HGSLAREHRFDAEQRLKRGELRVLIATASLELGIDIGDVDLVCQMGSPRAIAPFLQRVG
FT                   RSGHHVGGMPKGRLFPTSRDDLIECAALLDCVRRGELDALRIPRAPLDVLAQQIVAEVS
FT                   CAEWSEDALFELVRRAAPYAELAREQYDAVLRMLAEGYTSRNGPRAAYIHRDVVSGTLR
FT                   GRRGGKLVAVTSGGTIPENADYAVVLEPQAINIGTVNEDFAVESLAGDVFQLGNASYRI
FT                   LRIESGRVRVEDAQGQPPNIPFWLGEAPGRSDELSFGVARLRAQIGRLLGGDSGDLGSA
FT                   AGSAHSASSAHSADPAGPDNSPLPAAMPARLERAIDWLVAELGLDEAAARQIVEYLARA
FT                   RAALGVLPTQDTLVMERFFDESGGTQLVIHAPFGSRVNRAWGLALRKRFCRQFNFELQA
FT                   AATEDAIVLSLTGSHSFVLDEVWRYLHSASAERLLIQALLDAPLFGVRWRWNATTALGL
FT                   PRYTGGRKTAPQLQRMRSEDLLTSVFPEQAACLENVVGERELPRHPLVDQTVDDCLHDA
FT                   MDSERWLALLRRIESGDVRLVARDLPAPSPLAAEILNAKPYAYLDDAPIEERRTQAVLN
FT                   RRWSDPSSADDLGALDPDAIASVRDEAWPQARSVDEMHEALTGLACVTEAEARDNEGWL
FT                   EWLAALAQSGRATRLAIAADAALWLPVERLTCFAALYPDTNGARFAPPLAAPKGYTNEW
FT                   SAEDALLDVLRARLTGFGPLPASAIADALRLPQTAVDEALVRLEAEGYVMRGRFTAQTT
FT                   DDEWCERHLLARIHRYTVKRLRREIEPVERHDFMRFLFEWQHLTPDTRSEGRDALAAVL
FT                   QQLEGFEAAASAWEEDILPARVKAYSNTSLDELCRAGKIVWTRLTERSRSAAAPVRGTP
FT                   IVLLPRAQVRVWSALIDPARQPELSARAQSVHDALAEHGAMFFDELLHELRILRIELEN
FT                   ALGELVAAGLVNSDSFAGLRALLKPAAKRNAYAGSRRARSTALIGGMDDAGRWALVNRR
FT                   GSMAASAQSGDVAKDGQRSAQTPRQLPPEILEHVAMTLLRRYGVVFWRLLAREADWLPP
FT                   WRDLLRVYQRLEARGVIRGGRFVNGLAGEQFALPEAIPLLREVRRHANDSAFVCVAGTD
FT                   PLNLASTLLVGERVPAVAGNRVLYRDGIVVATLAAGAFWFDASVEADPLERERARSFLT
FT                   RRF"
FT   gene            315120..317123
FT                   /locus_tag="BC1003_3799"
FT   CDS_pept        315120..317123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3799"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; KEGG: bpy:Bphyt_5454 RNase II
FT                   stability modulator; SMART: EAL domain protein; GGDEF
FT                   domain containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3799"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59738"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJB8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADN59738.1"
FT                   /translation="MNDDQHEQVLYAQFGTSSPCWRLSSDSNALELTPVTGDVPANVAI
FT                   PLNPQQAAQIRCLTGITSHLVLDVRMFGEPLRLHLVGRKINSSNWAGTASAYDDTESVA
FT                   RDLMHGLSFAEQVVSEVNSVVVIVDRHGRIQRFNRLAEELTGVKEENIVGRNVWALFMS
FT                   SEDGAASSQNITGFFNRGVSYEVERRVKTLQGERLFLFRNKFVQSGSGVDEQYLICSGT
FT                   DITEERLAQERLTQLANTDSLTGLANRNAIQDKIRSAIEEAAPGESVGVLFLDLDNFKK
FT                   VNDHYGHVFGDRLIRDVSAAIGACLNEGDTLARLGGDEFIVLAAKGTAQELEATAQRIL
FT                   ERMRTPFSLGLVEVYTGCSIGIARYPEHGDNLESLIRSADTAMYVAKDAGKRTHRVFSP
FT                   EMNRKVAEYMWLDTNLRRGLEEGQLTLHYQPKLLLSTGAVQGVEALVRWNSPERGQIMP
FT                   VEFIRYAEESGLIGVLGRWVMQTAAKQAAKWKADGYNLRIAINVSARQLVDTAVVRHFT
FT                   EALAEARLDPCLVDVELTESCLIEDEAAAIDLIKQFRQIGAQVHLDDFGTGYSSLSQLG
FT                   RIPLDVIKLDRSFVRSINTDSKAQALVRSMVVVAQELGFKVVAEGIETESEEAFMKGLD
FT                   VEYVQGYLYAHPMPAADFERWLQDRQKLRLIA"
FT   gene            complement(317166..318053)
FT                   /locus_tag="BC1003_3800"
FT   CDS_pept        complement(317166..318053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3800"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bxe:Bxe_B1151 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59739"
FT                   /db_xref="GOA:E1TJB9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJB9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADN59739.1"
FT                   /translation="MNLQNHHACRPFLEAGNLSQISAYYEEGRNVMWMMLRAQPRPCFN
FT                   LDLVHDILGLAQAARESGLPIDFWVTGSLIPNIYNVGGDLNFFADAIRSGKRQALMAYA
FT                   RACVDCVHAAARGFDTGAISIAMVEGTALGGGFEAALAHHFLLAQSDARMGFPEIAFNL
FT                   FPGMGGYSLVARKAGMRLAEELIGAGESHTAEWHREKGLVDQLFEPGDAYVATRTFIDT
FT                   LKPKMNGIRAMLRARQRVLQLPRAELMEITEDWVDAAFMIEEKDLAFMERLVMLQNRRT
FT                   SNLRQTAASAANFG"
FT   gene            318653..319852
FT                   /locus_tag="BC1003_3801"
FT   CDS_pept        318653..319852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3801"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: bph:Bphy_5447
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3801"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59740"
FT                   /db_xref="GOA:E1TJC0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJC0"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADN59740.1"
FT                   /translation="MNFATFSSPAFFADPYPLYEKVREAGPLLSAGPSVLVTGRFEIID
FT                   ALLRDRRMGKTYLQSVRARYGDAATHYPVFQALSRTFLMMNPPSHTKLRTLLMKAFNAR
FT                   QIEKLKDIVEATSGALLDRIGSKAEFDLVREYALPLPVEIICRLLAIPSSHGTELGEAA
FT                   SRLVAAFDLAPLDEAALGAANEAALTLERYFLEVVEQRRADPGDDIISSLASVEDEGTK
FT                   LTDDEIVSNVILLFIAGHETTSNMIGNAMVALFRHPPQLEMLKRDSTLVSKAVAECMRY
FT                   DGAVQMVVRTAFEEVVMKDVTLPAGSIVFMLIGAANRDPAVFSHPDRLDFARGANVPSL
FT                   SFGAGIHHCLGARLALLELEVAIGSLLARFPDMQPTQLDQLRWHARNNLRGVQELRIRT
FT                   "
FT   gene            320054..320503
FT                   /locus_tag="BC1003_3802"
FT   CDS_pept        320054..320503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3802"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3802"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59741"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJC1"
FT                   /inference="similar to AA sequence:KEGG:Bamb_5745"
FT                   /protein_id="ADN59741.1"
FT                   /translation="MTTLSHMLLLYDGTAESQAALSRCKQLSLALKAHVDVVSVVDPDS
FT                   ANANCAGMLSELAYAYLEELGRRTLSTAVDELIQHGVTAHGYLSVGCKADAIFRHAVSS
FT                   PPDIVVIGHRLQRGLARWWRERPVHVDLADRLRGSTIVTVTLPDA"
FT   gene            complement(320544..321065)
FT                   /locus_tag="BC1003_3803"
FT   CDS_pept        complement(320544..321065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3803"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_2092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3803"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59742"
FT                   /db_xref="InterPro:IPR021851"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJC2"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_2092"
FT                   /protein_id="ADN59742.1"
FT                   /translation="MSTKYLQSTAMVALTVSVLALGACALAPAAPAAASIDPPQGQPIM
FT                   TLTASGIQIYSCEFDAQHRLGWVFQSPQATLFDRSGHAAVRHAAGPSWEAEDGSRIVGR
FT                   VLSQRPSDNPASVPQLLLQTHSTAGSGVLSAVRYVQRIHTVGGVMPAGACTTQGQVGSS
FT                   PYLADYVFYQ"
FT   sig_peptide     complement(320961..321065)
FT                   /locus_tag="BC1003_3803"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.905 at
FT                   residue 35"
FT   gene            complement(321115..321888)
FT                   /locus_tag="BC1003_3804"
FT   CDS_pept        complement(321115..321888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3804"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="KEGG: nmu:Nmul_A0501 superoxide dismutase; PFAM:
FT                   Manganese/iron superoxide dismutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3804"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59743"
FT                   /db_xref="GOA:E1TJC3"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJC3"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ADN59743.1"
FT                   /translation="MLNSLISRRRLIAAGSLASIGAGFSRFAFGDTRQESSTRSASTEK
FT                   PTLSVVPAYLGASPQTLPPLPYAQDALEPTISARTIGIHYGKHHRAYFDNLHKLLAGTP
FT                   LEQATLEQIIMQSHDQPALADVFNNAAQAWNHNFYWNSLSPASAATAPSAKLQAAIERK
FT                   FGSVEALSKALVATSASQFGSGWGWLVVDRGELAVVKTSNAETPFTRGLAPLLTVDVWE
FT                   HAYYLDYQNRRPDYLVAAVAHHLNWAFASANLARV"
FT   sig_peptide     complement(321796..321888)
FT                   /locus_tag="BC1003_3804"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.878 at
FT                   residue 31"
FT   gene            322210..323313
FT                   /locus_tag="BC1003_3805"
FT   CDS_pept        322210..323313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3805"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_5305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3805"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59744"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017549"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJC4"
FT                   /inference="similar to AA sequence:KEGG:Bphy_5305"
FT                   /protein_id="ADN59744.1"
FT                   /translation="MKLHRDAVLAALLGLTAVALAACGSSDNSANQTPTIAPQFKATTL
FT                   VSDGSANAANVDPNLKNGWGIAFNPTGVMWVSDNNTKKSTLYDGNGVVQPLVVTLPPNA
FT                   AGKAAGPTGIVFNKTTDFQISANGQAVSNAVFLWATDAGTIAAWSPKVLPTQAVNAFDD
FT                   GAGGAVYKGLAIGSNAGANLLFATDFHNRKVDVFDKSFNKIQLPGNFVDPTLPAGFSPF
FT                   GIAAIGNTVYVTYALLGPDGRTQVNGAGNGVVDAFDTAGNFVKRIATSATLNSPWGVVM
FT                   APANFGAASNQLLVGNFGDGTIDVFDPSSGEFKGALTNTDGTTFKQPGIWGLSFGNNAA
FT                   NQPLNTLFFAAGPTPTSGVYGRIDVRP"
FT   sig_peptide     322210..322275
FT                   /locus_tag="BC1003_3805"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.326 at
FT                   residue 22"
FT   gene            324054..326852
FT                   /locus_tag="BC1003_3806"
FT   CDS_pept        324054..326852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3806"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: cwo:Cwoe_2276 transcriptional regulator, LuxR
FT                   family; PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3806"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59745"
FT                   /db_xref="GOA:E1TJC5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJC5"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADN59745.1"
FT                   /translation="MTNPTDNASVPSMNECTEIKQLMPPVLQGRERDVALINHLIDRID
FT                   ESSATLVISGEPGIGKSALLEVAKHRAAERGIAVLTMTGVRAEVHLPFAALELALRPLM
FT                   KRAASLVPRQRSALLTAFGVCDDAGPPDIFLVALATLTLLTATSEAVLLVADDAQWLDQ
FT                   ETYDVLAFVSRRLGADSAVLLVAMRDDFNRSFGDTSALRLRLSGLDDADAGRLLDSRAP
FT                   NLPADIRSRFLKEAAGNPLALLELPRGERAAQAPDAPWLPLTERLERAFSSRLSDLPGA
FT                   TRTLLFVAAENDGTSLHEILSAGEAVLGERSSLDALSPAIAAGLIQIDGTEVRFRHPLV
FT                   RSAMHQAADPATRQKIHAALAAIIQDQLDRRLWHRAAATIGTDDALADDYDRMAARALR
FT                   RGAVAMAIEVLERAARLSSTASGRTDRLLRAAELAADLGQPELLERLLRQAHVNECDQL
FT                   ASARVGWCREIIQPPAISNPAKIPALIHFAAQADAAGAKDLASNLMWRAAQRCWWSSAN
FT                   EELRTRVLTAANRLGLPQTDPRLIAISAYVEPLRLGGDLHARLQQLSEARHGDPAVARI
FT                   LGSTANVIGAFDLGVGFLSESSAALREQGRLSDLARVLFAQAWAEMEVGRWTSAMREAE
FT                   EALRFAEETGGTPWIAAATIVKARLAGMQGDIEQSEAFAAQAERLALSIGASFLLAMLQ
FT                   VARGISAIGAGRHWEAYEHLRRVFTPSDPAFNAGLQFFGLADYVEAGVLSGNAEAVRGV
FT                   IEEAGRIAAPKPVPWVETMLNYGKALLAAPAEAERFFLQGLGPCAKNWPFLRARLLLAY
FT                   GEWLRRQRRSANARAPLREARDIFDALGATPWGNRAREELRASGEASRRRTERAWQTLT
FT                   PQELHIAQLAAEGLSNKEIGVRLYLSHRTVGYHLRHIFAKTGITSRSSLGSIVAKAEDP
FT                   AA"
FT   gene            326944..327168
FT                   /locus_tag="BC1003_3807"
FT   CDS_pept        326944..327168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3807"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bav:BAV0516 O-antigen biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3807"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59746"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJC6"
FT                   /inference="similar to AA sequence:KEGG:BAV0516"
FT                   /protein_id="ADN59746.1"
FT                   /translation="MKLVFSLAILPLGAALMTQTASATSRATGRARKPATELRADSGRH
FT                   AILSVRRAAKFSVPAASAVRFGRDGRYRL"
FT   sig_peptide     326944..327015
FT                   /locus_tag="BC1003_3807"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.911 at
FT                   residue 24"
FT   gene            327165..327821
FT                   /locus_tag="BC1003_3808"
FT   CDS_pept        327165..327821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3808"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bac:BamMC406_4615 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3808"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59747"
FT                   /db_xref="GOA:E1TJC7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJC7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN59747.1"
FT                   /translation="MTAVTGGANEPTVFVIDDDSAMRQALHSLLDSVGLNVRLFASAQA
FT                   FLALDLPDVPSCVVLDVRLKGQSGLAVQRHIAHTLHIPVILITAHGDIAMSVQAMKAGA
FT                   TDFFAKPFRAQDMIDAIGHALEADRKRRAAERSTAVLRACYELVTPRERAVMTRVVNGM
FT                   LNKQIAAELNLSEITVKLHRAQAMKKMESPSLADLVLKADALGLVDRENRLTRNN"
FT   gene            complement(328008..328388)
FT                   /locus_tag="BC1003_3809"
FT   CDS_pept        complement(328008..328388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3809"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bac:BamMC406_4620 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3809"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59748"
FT                   /db_xref="GOA:E1TJC8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJC8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN59748.1"
FT                   /translation="MNPIVSIVDDDESVRIATSSLVRSLGWGARLYASAEQFFASDEIH
FT                   DVTCIISDVQMPGISGLQMYWRLLESGVRLPVVFISAFASDLVCRQALEAGALCVLSKP
FT                   VDAVELSRHLETVKAGRTDASR"
FT   gene            328885..329382
FT                   /locus_tag="BC1003_3810"
FT   CDS_pept        328885..329382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3810"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   rlt:Rleg2_4342 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59749"
FT                   /db_xref="GOA:E1TJC9"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJC9"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADN59749.1"
FT                   /translation="MSNVSHTTAAHTSYGFDERAIGAISDALNPLLADVFALYLKTKNF
FT                   HWHMLGAHFRDYHLMLDEQGAQIFAIADDIAERVRKIGGTTLRSIGDVARRQRIADNDA
FT                   SGLRAQAMLNELREDNLQLAAFMLGAHEVCESHRDVATASLLENWIDEAQRRAWFLAEA
FT                   YR"
FT   gene            329471..329815
FT                   /locus_tag="BC1003_3811"
FT   CDS_pept        329471..329815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3811"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3811"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59750"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJD0"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_3757"
FT                   /protein_id="ADN59750.1"
FT                   /translation="MKPIALRSVKPLRLVALTVVAAAVTHVIGLPAFIDAVRGVGTDMQ
FT                   MPLERMATDAPDASEPSTRGAPRVETPAPATSATQLTGSKDALRPRAAHRTSPLAPGYR
FT                   HSVSDSKYWT"
FT   gene            complement(330175..330624)
FT                   /locus_tag="BC1003_3812"
FT   CDS_pept        complement(330175..330624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3812"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_4631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3812"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59751"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJD1"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_4631"
FT                   /protein_id="ADN59751.1"
FT                   /translation="MDFATNMTQVDPWTQTLALLSQLCGGDARPAARERQTQIARMAGS
FT                   ASASAEASPVRAQPGNAMRRSFSLSVLDRPTSTSVTIAWRDSTHCSYGDQLWLAARARS
FT                   SGICAMSGRAIRRGDLVYQPRRSRPRPLNDGAMILASVLREVEAD"
FT   gene            complement(330658..330867)
FT                   /locus_tag="BC1003_3813"
FT   CDS_pept        complement(330658..330867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3813"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6540 ROK family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3813"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59752"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJD2"
FT                   /inference="similar to AA sequence:KEGG:SGR_6540"
FT                   /protein_id="ADN59752.1"
FT                   /translation="MSIDDQIPTFLAISEAFLRAAGSVLPAKLAWPAAGPSEDIGMPCC
FT                   GLRAHDINRATRTGSDDTFAAPRV"
FT   gene            complement(330854..331834)
FT                   /locus_tag="BC1003_3814"
FT   CDS_pept        complement(330854..331834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3814"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bac:BamMC406_4632 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3814"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59753"
FT                   /db_xref="GOA:E1TJD3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJD3"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN59753.1"
FT                   /translation="MNLSSPKLSEPAAAAADAVALAGSRPVSSPISAERAWRDPGAAAR
FT                   DADADIALSRWTRNAAQPLELVNHGSSRWHCIGINLKCTTLTFSHAGRTLVQGRVTAGA
FT                   AQITAPGVACRAVFDAPSDVLHLFASQAVFAECYEDLFGHPYAGDIVIDDPRLVCDPAL
FT                   ERLGQALAVSHTQDATLGKVFADSVSLAIVSRIVARRFAPDERDERDTRSAAALPPWRM
FT                   RRTVEYIDAHLADSIGLADMAQSAGLTRMHFAAQFRRATGLRPHEYLMRRRIEHAQQLL
FT                   LDTRHGVLDVALNCGFRSQAHFTAVFKRFVGETPSCWRMKAHVNR"
FT   gene            complement(331841..332068)
FT                   /locus_tag="BC1003_3815"
FT   CDS_pept        complement(331841..332068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3815"
FT                   /product="outer membrane insertion C-terminal signal"
FT                   /note="TIGRFAM: outer membrane insertion C-terminal signal;
FT                   KEGG: ecg:E2348C_1383 outer membrane protein W"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3815"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59754"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJD4"
FT                   /inference="protein motif:TFAM:TIGR03304"
FT                   /protein_id="ADN59754.1"
FT                   /translation="MSACRALGTARAMLDAPTRQCPTKPSYDPITLSAGVSYRFMALDN
FT                   LFVRLVWRTAFRYLVVTALQAPRATLHDSR"
FT   gene            332395..333732
FT                   /locus_tag="BC1003_3816"
FT   CDS_pept        332395..333732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3816"
FT                   /product="histidine kinase"
FT                   /note="KEGG: bac:BamMC406_4635 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3816"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59755"
FT                   /db_xref="GOA:E1TJD5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJD5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN59755.1"
FT                   /translation="MNEPHTRAIAVPIQKPLDASPHFANEALIETDALFRDAPIPILIE
FT                   DWSGIKAWVDSLRNSGVDDLDAWLDEHPEVIQKLRELHAFVDANDATLALFDATSKEVF
FT                   FEWSRQLLPANRFSNSQVLRAMFEGHASCQGERILTTLTGRKVPIVWRCSLPKDIAQYR
FT                   RLHFYAFDVTEHKENTDRLQALRAQIAHTARVSMVGQLVASITHEIGQPLGAVRTGLDA
FT                   AVRWLDRSEPNVAEALAAFRHASRWTDDIAGICRRLRGFLTGAPVEAVQLDCAEIVDSA
FT                   MLLIASEANAHAITLAKEIEPAVTAYADRIQLQQVLTNLLINGIHAIAAVSAEGREPLL
FT                   TVRARRYNDSQTLFEVVDTGGGIQALQPDAIFQPLSSTKSDGMGMGLPISRSIVEAHGG
FT                   AIWVADTGASGTRFCFTLPCSARAHGPRSPVAHATRAAANSNGGLL"
FT   gene            333749..335053
FT                   /locus_tag="BC1003_3817"
FT   CDS_pept        333749..335053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3817"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bac:BamMC406_4636 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3817"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59756"
FT                   /db_xref="GOA:E1TJD6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJD6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59756.1"
FT                   /translation="MHRSPGYDHADATASHRLAPGTLATIVLANAIEFFDYFCYTVFAA
FT                   FIARAFFPHAVGACATLLSLGTFAAGFLSRPVGALVIGTQADTAGRKPALLLTAALVTA
FT                   GSLGVALTPGYATLGILAPIAVLLCRILQGLAVGGEMGSSGALLIEHCPAGQKNLYAGW
FT                   LMAGQGLALVAAGACGIVLHDLLTPEQIGRWGWRVPFALAAALIPVQIYLRRHIAETWQ
FT                   PPHDGRQFRGRLVRLRWQWLLAVVLIFGGTVPTYVATYSTTFGVAGASPSAYASFTTTA
FT                   AVGMVTLALSVAGGWLADRIGQLRTIAFARALTMLSAVPSFHYAASHPQPGALFCVVAL
FT                   FAGLSALAGGPSIVVILEMFPARGRALAMSVVYATGVALFGGTTPFVVACVASWSGSQT
FT                   AAGWYVCASAAATLIALHLLRVPNAAGTQGPAANA"
FT   gene            335240..336277
FT                   /locus_tag="BC1003_3818"
FT   CDS_pept        335240..336277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3818"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_4637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3818"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59757"
FT                   /db_xref="InterPro:IPR025566"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJD7"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_4637"
FT                   /protein_id="ADN59757.1"
FT                   /translation="MSHHLDSPLARQDVRLDITDLYCFRGETGTALVINVCHSIAGEGR
FT                   TPGYHPEGFYEFKIDLDDDAVEDVTYRIAFDERDAQGKQRFLVRRIAGAQATDPHAQGD
FT                   VVARGGTDETVTTPSGLRVWAGLAGDPFWIEPDVLHAVGHAFQDGTPLDLGNWQPADAR
FT                   NLFAGHTVYSIVLEIPDADLLATAGANRKIGVWAVATLATDAGGWRSINRVGLPMIHPL
FT                   FTQYNEDLGDRLNAGRPADDFKTYGAQLIQSIAGAVRANGTSEDPEGYATAVAHRFLPN
FT                   ILPYSVGTPAVFGVALWNGRTMTDNAPDVMFTMAANTPISLGIGKESVTSKPSSTFPYV
FT                   PKAVA"
FT   gene            336389..337444
FT                   /locus_tag="BC1003_3819"
FT   CDS_pept        336389..337444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3819"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="KEGG: bac:BamMC406_4638 high-affinity
FT                   nickel-transporter; TIGRFAM: high-affinity
FT                   nickel-transporter; PFAM: high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3819"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59758"
FT                   /db_xref="GOA:E1TJD8"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJD8"
FT                   /inference="protein motif:TFAM:TIGR00802"
FT                   /protein_id="ADN59758.1"
FT                   /translation="MGGFIALLHLVGWGTLLALVAPLHRGGTATALGIGAGIAAYALGM
FT                   RHAFDADHIAAIDNTTRKLVGEGKPCLSVGFWFSFGHSSIVFGLSLLIAVSMRSVSSQL
FT                   VDTGSTLRTVTGVLGAVISSGFLFVIALLNVAAFRDIYRVFRQMKSGRYDDAYLAQRLE
FT                   SRGLVNRVLAPLMRIVSKPAQMYLVGLLFGLGFDTATEIALLVLTGSGAASGLPWYAIL
FT                   CLPVLFAAGMLLFDTIDGSFMSYAYRWALDKPVRKIYYNLVVTGLSTSVAVGIATIEVL
FT                   GLLDAALGAAGKHGVFQAWTASVDLNEAGYAIVGLFVATWAVSAAIWKFGRIEERWSVV
FT                   PQPAVRDEHDA"
FT   gene            337506..338411
FT                   /locus_tag="BC1003_3820"
FT   CDS_pept        337506..338411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3820"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bac:BamMC406_4639 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59759"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJD9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59759.1"
FT                   /translation="MNQVVLITGASSGFGRLTAEALAKAGYTVYASMRDTHGRNASVAE
FT                   EMAALAREAGTDLRTVELDVSSQASVEAAVAKVIADAGRIDVLIHNAGHMAFGPAEAFT
FT                   PEQYAQLYDVNVVSTQRVNRAVLPHLRRQKRGLVVWVSSSSAAGGTPPYLAPYFGAKAA
FT                   MDAIAVLYARELSRWGIETSIIVPGAFTHGTNHFPHAGLPADQARAAEYETGPYAGFGK
FT                   EVQEAFAAIVPPDADASLVADAIVKVVDAPFGKRPFRVHIDPAEDGANVGFTVLDRLRA
FT                   EMLHRVGLGDLLVPQVHVPT"
FT   gene            338554..339294
FT                   /locus_tag="BC1003_3821"
FT   CDS_pept        338554..339294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3821"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bac:BamMC406_4640 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3821"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59760"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJE0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59760.1"
FT                   /translation="MSSTSGKVAIVTGSSRGIGAEIAIRLAQDGFRVVVNYANEARPAE
FT                   EVAAKIREAGGDALPVKADIADPAATVALFDAAQKAYGGIDVVVNSAGIMKQAKIVDFD
FT                   DATFDRTVAINFKGAFNVSREAARRVRDGGRIVNLTTSVTGVRLPTYAVYIATKCAVEG
FT                   LTQVLAQEMRGRGITVNAVAPGPVATDLFLAGKSPELIDRMAKMNPLERLGQTEDIASV
FT                   VAFLVGSQGGWINGQIVRANGGMC"
FT   gene            complement(339357..340253)
FT                   /locus_tag="BC1003_3822"
FT   CDS_pept        complement(339357..340253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3822"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcj:BCAL2528
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3822"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59761"
FT                   /db_xref="GOA:E1TJE1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJE1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADN59761.1"
FT                   /translation="MAHGVGHDFFPGFERLDLVAGDVSFRGRIGGSGSPVLLLHGYPQT
FT                   HIAWRFIAPTLARSHTVIVPDLPGYGDSRTRNDQPRWTKRRVAGALVALMDRLGHERFA
FT                   VVGHDRGARAGYRLALDHPRRVAAYASLTVIPTLDAFATIDKTFALNAWHWFFLAQPGD
FT                   LPERMLAADPDAYLDTALAKMAGGLERIDPLALDVYRNAFRNPHVRHAICEDYRAAASE
FT                   DLEHDASDAAAGRKLACPVLVLWSEREQRAASMPPLDAWYRWAANVTGRAVPGGHLLPE
FT                   DAPDVVLSSLQSFLAGQ"
FT   gene            complement(340279..341187)
FT                   /locus_tag="BC1003_3823"
FT   CDS_pept        complement(340279..341187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3823"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bmj:BMULJ_05422 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3823"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59762"
FT                   /db_xref="GOA:E1TJE2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJE2"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADN59762.1"
FT                   /translation="MSLRAFSHFLIPALCAATLLASASNAIAAPTSYMVTSADGVKLAV
FT                   QESGDPNGPPIILVHGLLGSRLNWDAQVQSPALRQYRIITYDLRGHGLSDKPSGREPYH
FT                   DGSRWGDDLAAVVQGSHARKPVLVGWSLGGVVISNYLAKYGDRAIAGAVYVDGVVELAP
FT                   GQIVDHPDVYRDMNSPDLKTHLDGERTFVGLCFNHRPDADTFDRLLANAAMASWDMQKE
FT                   VPTMTVFAAEGLGKARVPLLFIYGAEDALVNTQATLARATALNSRVVSKVYTDSGHAPF
FT                   IEEAERFNRDLAKFVRSASQQ"
FT   sig_peptide     complement(341101..341187)
FT                   /locus_tag="BC1003_3823"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 29"
FT   gene            341274..341660
FT                   /locus_tag="BC1003_3824"
FT   CDS_pept        341274..341660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3824"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: bmj:BMULJ_05421 MerR family transcriptional
FT                   regulator; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3824"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59763"
FT                   /db_xref="GOA:E1TJE3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJE3"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADN59763.1"
FT                   /translation="MENTPSRELLTIGQLSQLTGASVRSIRHYDEHGLLASVRASNGYR
FT                   MFPEKAVTQVKQIQRMIATGFTIDDIRGFPDCMLLIEGARSCDQITDAQRMRLHAIERQ
FT                   IADLEKRRARLIKTLLEGAVPPID"
FT   gene            341900..343213
FT                   /locus_tag="BC1003_3825"
FT   CDS_pept        341900..343213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3825"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3825"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59764"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJE4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADN59764.1"
FT                   /translation="MAMPKNIPKAETRVKPIPLLTACAFLGASVPMLATAQTCNVPVLK
FT                   MLAQKSLGLSVMEKSLPDYQKRSGTRIEINYFGENDRRSKSRLDASTGAGSYQIYYVDE
FT                   ANVAEFASAGWIVPLLKYYPKDADYDDFLPGRRAVASYKGVAYFAPLIGGGDFLFYRRD
FT                   ILEKAHLPVPKTLDELVADIKKLNAPPNMYGWVARGQRGSGMNVWRWAPFMLAEGGTWT
FT                   DRNQAPSFNSPGAVKATQLYRDLFKYAPPGSSTYDWSNALEAFRSGKVAFMIESTPFAD
FT                   WMEDPTKSSVADKVGYVRPPAPLPSAAYGHGLAISSVGAKDECTRQAAGKFIAWATGKD
FT                   QEQARLRDNVFSDYNRSSTIKSDYFQKHVKPQILAGLNDTNPVTKVTIWSSPQWPDIGD
FT                   NLGIALEEVFTGTQPDVQATLNDAVQYARDAMEHGVKK"
FT   sig_peptide     341900..342010
FT                   /locus_tag="BC1003_3825"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.847 at
FT                   residue 37"
FT   gene            343325..344203
FT                   /locus_tag="BC1003_3826"
FT   CDS_pept        343325..344203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3826"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bph:Bphy_6664
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3826"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59765"
FT                   /db_xref="GOA:E1TJE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJE5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADN59765.1"
FT                   /translation="MFNRGKTSLPFVFLGPPLALMAVLGLVPTVAAINLALKNRVLRYP
FT                   DSEYVWLRNFLRLFSDRRFLNSIEVSAIWEIATVIGSVVVGVLVAIYLFEQIHGRMRSV
FT                   ISLLLIVPVLLPRVSAAFIWKFMYSPLTGILGWFLGLLGIGNTAFLSDPHLALYAVALV
FT                   DIWQWGLFFAVVVLKLLETLPPEPLEAARLDYARTWQVYAYIALPMLKVPIMSLVFIKM
FT                   VESLRSFDLVYVMTKGGPGITTETLDMYAYSQGIGLSGKVSYASSMAVLMMVATTVIFT
FT                   FIWKRVNKWED"
FT   sig_peptide     343325..343420
FT                   /locus_tag="BC1003_3826"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.888) with cleavage site probability 0.559 at
FT                   residue 32"
FT   gene            344191..345003
FT                   /locus_tag="BC1003_3827"
FT   CDS_pept        344191..345003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3827"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bph:Bphy_6663
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3827"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59766"
FT                   /db_xref="GOA:E1TJE6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJE6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADN59766.1"
FT                   /translation="MGRLISRSTAWSFGLVLAVVAVFPIFWAFLNSLKNLLDIVTPTPR
FT                   FIFSPTLENYRQVVSSPEVLIGLANSLSIVGLAVVLGALLGVPAAYVIARYHVPGKRDI
FT                   QFFLLSLRFLPPVAVAIPLIAIWVDLGLYDTKFSMVVTYLLVTLSTITWLSIPVFQRLP
FT                   REVEEAATLDGYGPYGVFWRIALPISATTLMGGIVFSFVLVWNELMIALALTSSRSATL
FT                   PVVASAFTSLGQEVPWGVINASTVLLALPPIIFVGVLSRLLNSMLKGK"
FT   gene            345014..346048
FT                   /locus_tag="BC1003_3828"
FT   CDS_pept        345014..346048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3828"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3828"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59767"
FT                   /db_xref="GOA:E1TJE7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJE7"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADN59767.1"
FT                   /translation="MKALVLEEARQLALRDIDLPLEVGPRDVKIKIHTVGVCGSDVHYY
FT                   THGRIGPFKVEAPMVLGHEASGTVVETGSEVTHLRIGDRVCMEPGIPSFDSPATMRGLY
FT                   NLDPAVRFWATPPIHGCLTPYVVHPAAFTFRLPDNVSFAEGAIVEPLSIGLQAAKKAAM
FT                   KPGDVAVVIGAGTIGAMTALAALAGGASRVILADVVKEKLALFDDNRAVTTVNVAQQRL
FT                   ADVVQEVTTGWGADVVFEASGNAKVFDDLFDLLCPGGCAVLVGMPVDRVPLDVVAMQAK
FT                   EARLESVFRYANMFPRALALISSGMIDVKPFISRKFAFADSLSAFEEAAAGRPDNVKIQ
FT                   IEMD"
FT   gene            346052..347227
FT                   /locus_tag="BC1003_3829"
FT   CDS_pept        346052..347227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3829"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bph:Bphy_6661 ABC transporter related; PFAM:
FT                   ABC transporter related; Transport-associated OB
FT                   domain-containing protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3829"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59768"
FT                   /db_xref="GOA:E1TJE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJE8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADN59768.1"
FT                   /translation="MAKIVCRGLTKRYDGGPPVLHPLDMEIRDSEFVVLLGPSGCGKST
FT                   MLRMIAGLEAITGGELAIGDTVVNDLPARERNVAMVFQNYALYPHMTVYDNVAFGLRRL
FT                   KVPAAEIDRRVREVAAMLNLDALLDRKPRAMSGGQQQRAAIARAMIKTPEVFLFDEPLS
FT                   NLDAKLRAQLRGDIKRLHQRLRTTTVYVTHDQLEAMTLADRVILMRGGRIEQAGTPSDL
FT                   YHFPRTLFAAGFIGTPAINVISGTIERTGETCFVQAQGQRWALPGPRFAGLQDRQAVKL
FT                   AIRPNYLKVASADDESGSLRLRGKVELIELLGAEALVTFESGGERLAALVPAGELPELN
FT                   SVVTFQFKIADLHVFDAQTEQNVSLPVAENTGTTHAASSHQDAGVQGAALH"
FT   gene            347272..348150
FT                   /locus_tag="BC1003_3830"
FT   CDS_pept        347272..348150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3830"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bpd:BURPS668_A1744 AraC family transcription
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59769"
FT                   /db_xref="GOA:E1TJE9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJE9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN59769.1"
FT                   /translation="MNPDLELVHTRRDESFRAWAHDYPHTVAKWHFHPEYEIHVIRAST
FT                   GKFFVGDFIGDFAPGNLVITGPNLPHNWISEVGERETVPSRDVVLQFSRDAVERMVAAF
FT                   PELHSIVGLIDDAARGIQFPDAVGLAIAPMMLELAVSHGCRRVELLMSIFDRLSSCTER
FT                   RLLAGPAYDVNAHRYMQSTINQVLSYIQQNLPGTLREADVAELAGMSVSTFTRFFRRHT
FT                   GCTFVQYQNRLRINEACELLMCSTLSVTEICYRVGFNNLSNFNRQFLATKAMPPSKFRA
FT                   LHQLNEHMIAA"
FT   gene            348199..349659
FT                   /locus_tag="BC1003_3831"
FT   CDS_pept        348199..349659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3831"
FT                   /product="xylulokinase"
FT                   /note="KEGG: bph:Bphy_1198 xylulokinase; TIGRFAM:
FT                   xylulokinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3831"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59770"
FT                   /db_xref="GOA:E1TJF0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJF0"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ADN59770.1"
FT                   /translation="MTFLGIDLGTSEVKTLLTDDESHTIATGGARLEVEHIHPHWSEQS
FT                   PQAWWHATLDAIAQVRAANPAGFSALRGIGLSGQMHGATLLDRAGQVLRPAILWNDTRA
FT                   FAECVELEALVPESRSITGNLAMPGFTAPKLLWLSKYEPAVFRAAHKVLLPKDYVAWRL
FT                   TGEFVSEMSDASGTLWLDVAKRDWSDRMLAATGLSREHMPRLVEGSEAAAQLNDTLRRE
FT                   WGIASPVLLCGGAGDNAASAIGMGVVDAGSAFLSLGTSGVLFAGTDRFAPNPAQAVHAF
FT                   CHCLPDRWHQMSVILSAASSLAWLSGVLKKDVVEVAGLAEQADARGAPLFLPYLSGERT
FT                   PHNDANAKGVFWGLTGAHSEADLAYSVMEGVAFAMADGYAALQSAGTALDTASFIGGGS
FT                   RSRFWAKLCATATGVAMRRHHGGDVGAALGAARLARLAVTKENVNEVCTSPATIEICEP
FT                   DAAHRTVTEDRLARYRRIYAALKDEFSR"
FT   gene            complement(349829..351292)
FT                   /locus_tag="BC1003_3832"
FT   CDS_pept        complement(349829..351292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3832"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: bpy:Bphyt_5457 peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3832"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59771"
FT                   /db_xref="GOA:E1TJF1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJF1"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ADN59771.1"
FT                   /translation="MISDDTTQEAQRLNPDTLREFVDRKWNDEIVPALTDYIAVPAKSP
FT                   AFDPEWVQHGYLERVITDAAQWVEQQPVRGLTLEIVRLPGRTPVIFFETPATRSGSDET
FT                   IVLYGHLDKQPEFDGWRSDLGPWTPKLENDKLYGRGGADDGYAIYASITALAALDAQGV
FT                   ERPRCVGLIETCEESGSYDLLPYVDALRERLGKVGLVVCLDSGAGNYDQLWLTTSLRGL
FT                   VAGDLEVQVLDEGIHSGGYGGIAPSSFRIMRQLFDRLEDAANGTLLPKGFHCPIPAERL
FT                   REAEATAHILGDDVWKKLPWACGQDGRQVLPTTTDPKEALLNSTWRPSLSVTGAAGLPA
FT                   LADAGNVLRPRTAFKLSLRLPPLIEAEKAVAELKALLELDPPYNAKVTFKPDAGAASGW
FT                   SAPELAPWLATALNDASRAHYGADVAYIGQGGTIPLMNVLKAGFPQSQFMVCGVLGPKS
FT                   NAHGPNEFLHVPYGKKLTAAVAQVIAAAP"
FT   gene            351700..352011
FT                   /locus_tag="BC1003_3833"
FT   CDS_pept        351700..352011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3833"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3833"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59772"
FT                   /db_xref="GOA:E1TJF2"
FT                   /db_xref="InterPro:IPR016410"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJF2"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1149"
FT                   /protein_id="ADN59772.1"
FT                   /translation="MNERVAIQIIAVVIALALYFLPAILADRRKRVDVLTLALFNACLG
FT                   WTVLGWLLALYWSLQPNPPKDLAGEVVEKRKLVSMRAFSSALLVRVQRRDTTRNRPQK"
FT   gene            complement(352032..352301)
FT                   /locus_tag="BC1003_3834"
FT   CDS_pept        complement(352032..352301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3834"
FT                   /product="Protein of unknown function DUF2158"
FT                   /note="PFAM: Protein of unknown function DUF2158; KEGG:
FT                   bpy:Bphyt_5459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3834"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59773"
FT                   /db_xref="InterPro:IPR019226"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJF3"
FT                   /inference="protein motif:PFAM:PF09926"
FT                   /protein_id="ADN59773.1"
FT                   /translation="MLTATIDALTPLPARFSTGDVVTLKDGGPRMTVTYAGPVALNPGE
FT                   WLVCEWFDEHGELRREMFAPSSVRAEPRSIPAGSVRWNRMSRAA"
FT   gene            complement(352780..354459)
FT                   /locus_tag="BC1003_3835"
FT   CDS_pept        complement(352780..354459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3835"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_5462 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3835"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59774"
FT                   /db_xref="GOA:E1TJF4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJF4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59774.1"
FT                   /translation="MKSEPIKSSSTACAEADGVAAARGAAAAGVAVCPGPVAASAAAQS
FT                   ATATARHRMANSGGPSGNPAQPASLAGQPAPAFARQGLALVVLFIGAFLAPLDYFIVNL
FT                   ALPSIHSGLNATDAQLQLVVSAYSSVYAVLLITGGRLGDLFGRRRIFMAGMAGFVVASA
FT                   LCGLATSGQMLVISRIVQGMTAAIMAPQVLATIRAVVPLHQQTRVMSLYGFVFGLSSIV
FT                   GQLGGGALITYHPFGLDWRIIFLINIPIGIVAFLGTWRFVPENQPATRTSLDMKGVALL
FT                   CAVLLLVIYPMTHGREAGWPAWTFAMFALAVPALALFVATEKRVEQGGGHPLVDLQLFR
FT                   NPAFALGLALAFLFYCNSAFFLTYGIFLQTGLHWTPLASGVAIMPFAVGFVIGPLTSPA
FT                   VVARIGAHVLTLGFSLMTLGFAVTGWAATEAATPDLAFYAGLVCAGVGHGLLLPNIMRI
FT                   ALQEVAPEKAGLASGVVSSTLQIGSAFGTAAISGAFFGALGAANAPGMSSGHAASATPV
FT                   AYAQAFQLSLAINAVLMFACIGLSVLLVRHQQLALRRAARTL"
FT   gene            complement(354490..355080)
FT                   /locus_tag="BC1003_3836"
FT   CDS_pept        complement(354490..355080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3836"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B1146
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3836"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59775"
FT                   /db_xref="GOA:E1TJF5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJF5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADN59775.1"
FT                   /translation="MCPRGRPREFDTNAVLASASQVFWNHGYHATSIDDLCKATGLLRG
FT                   SLYGVFGDKHGIMLAALDHYAEGSVARLAERLNAPVPPQEALRDALLHYARVACALSGE
FT                   RSCFITNTTLEMQPGDDELRSRVAAIQRRMATLLAASVIRGQASGAFNSTLDEKAAGDF
FT                   LLCVMQGLRVLGRVAHKEDALTGIVEVAMRALI"
FT   gene            complement(355252..357669)
FT                   /locus_tag="BC1003_3837"
FT   CDS_pept        complement(355252..357669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3837"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; KEGG: msl:Msil_2417 oxidoreductase alpha
FT                   (molybdopterin) subunit; PFAM: molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3837"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59776"
FT                   /db_xref="GOA:E1TJF6"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJF6"
FT                   /inference="protein motif:TFAM:TIGR01701"
FT                   /protein_id="ADN59776.1"
FT                   /translation="MSKREVPGVGPYGGPAGGWGALQAVARAVRQQMGVAREATMLLKV
FT                   NQPTGFDCPGCAWPDPRSTSSFEFCENGAKAVSWEATSKRTTPEFFARHTVSELWKWSD
FT                   FALEDEGRLTHPMRYDAATDRYLPIEWDAAFERIGAALRALPDPDMAEFYTSGRASNEA
FT                   AFLFQLLARRFGTNNFPDCSNMCHEPTSVGLPESIGVGKGTVTLADFDHCDAIFSIGHN
FT                   PGTNHPRMLATLRAAARRGAKIVVLNPLRERGLERFASPQDPVEMVTGRSTPIATDYVQ
FT                   VKVGGDVAVLKGMMKTLLQMDRESREQSGDGVLDRAFIDEHTIGFDELVRDLEATPWDD
FT                   VVSTSGVAREEIEKLAQIYAEARAVIACYGMGITQHRSGTANVQQIANLLLMRGNIGRD
FT                   GAGICPLRGHSNVQGDRTVGITEVPPPAFLDSLKRVFGFEPPRAHGHGAIAAMQAMRDG
FT                   RAKALICLGGNLPVAMSDPRVCFDAVRKLDLAVHIATKLNRSHLLTARETLLLPCLGRT
FT                   ELDVQATGPQSVTVEDSMSMVHASQGSLTPASEHLRSEPAIIAGIAKASLDDATLDWDG
FT                   WVADYSRIRDLIEAVFPQFERYNERIREPGGFRLYNAASARRWDTPDGRARFIAHRGVM
FT                   EDPRVNRSDALLLATIRSHDQYNTTIYGYNDRYRGISGRRDVVFVNEQDLDARGLQHGD
FT                   LVDVEAIEDTVSLGGSRRLCGVTAVAYDIPRGSMAAYYPEANGLVALDDCDARSGTPSY
FT                   KSIPVLLSLSNGDCLPDDDVSSWQRGDVRNDRTGAAVASEEPHRPNNGATPM"
FT   gene            358233..358868
FT                   /locus_tag="BC1003_3838"
FT   CDS_pept        358233..358868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3838"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   bgl:bglu_1g22580 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3838"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59777"
FT                   /db_xref="GOA:E1TJF7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJF7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADN59777.1"
FT                   /translation="MLPRRPNPGTTYTKNSMDIRTLSAYDHNSASFAKDWHEQPPATDL
FT                   HALVRKYFRPGRTADVGCGSGRDAAWLCSNGFPTVGLEPSKGLLNEARRRHPEVQFQLA
FT                   ALPELEGIADASFQNVLCETVIMHLEAELIGPSVRKLLDITEPGGTLYLSWRVTEGNDR
FT                   RDEHGRLYAAFDPSLVLQALSNAAIVLDEQVVSPSSGKVIRRIIARKE"
FT   gene            complement(358892..360028)
FT                   /locus_tag="BC1003_3839"
FT   CDS_pept        complement(358892..360028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3839"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: gdj:Gdia_0781
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3839"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59778"
FT                   /db_xref="GOA:E1TJF8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJF8"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADN59778.1"
FT                   /translation="MNVKSFTSLRGVACLAVVGTHVWTIFDLRRLIVERYGAGSLEEFI
FT                   SILVDRTLNGQAAVELFFVLSGCVLALSLQTASGTTDRSWIKAFYVKRFFRIYPALWVS
FT                   IALTLCLWPLIRMGLASPAYSTWALDAYPSEITARSVMLSLAAIYVHLNWPMWTLRVEL
FT                   FYSILFPVIFLMVTNERTRGPFMILIALLALLPIPRNLSLHYSLAFSLGALIPSSRGIG
FT                   NAHYRLIGLGLIPVLMYFRVALETSVGLKNIETLEILIAAVIVYCLYHNKKRMPLLDGR
FT                   FFGYIGKISYSVYVLHFPIVFGIAAAMVAVFGTAAIQHNPLLMASLLGVLTLLLTTPLS
FT                   MVANRFVEDGGNALGKRLATRKYGRSPERISADPGLQR"
FT   gene            complement(360582..362495)
FT                   /locus_tag="BC1003_3840"
FT   CDS_pept        complement(360582..362495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3840"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: bph:Bphy_1112 ATP-dependent
FT                   metalloprotease FtsH; PFAM: AAA ATPase central domain
FT                   protein; peptidase M41"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59779"
FT                   /db_xref="GOA:E1TJF9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJF9"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADN59779.1"
FT                   /translation="MMPIQRSSRGPRKSARWSDATTIAFTLFFFLLAALQFLMFQSPTT
FT                   EVAYSDFQKLVAARQVENLEVTPTQIRGTLRMPGAASLLPASDATAAKNHGEPWRFTTT
FT                   RVADDKLVESLSAAGIRYTGDVDSAWPGMLLSWALPLLALFFVWNLLWRRSGGLQQYTQ
FT                   MGKTNAHILVQDETGITFDDIAGIDEAKAELRQLVAFLRDAERYRKLGGKIPKGVLIVG
FT                   APGTGKTLLAKAVAGEASVPFFSVSGAAFVEMFVGVGAARVRDLFEQAQAEAPCIIFID
FT                   ELDALGKVRGAGLTSSNDEREQTLNQLLIEMDGFKSNSGVIILAATNRPETLDPALLRP
FT                   GRFDRHIAIDRPDLIGRRQILAVHTRHVKIAPEVDLNELASRTPGFVGADLANVVNEAA
FT                   LHAAEADKPAVDMSDFDEAIDRAMTGMERKSRVMNAQEKITIAYHEAGHALVAYSRKHC
FT                   DPVKKVSIIPRGVAALGYTQQVPTEDRYVLRYGELLDRLDALLGGRVAEELIFGDVSTG
FT                   AENDLERATAMARHMVTRYGMSKRIGLATVGGSPEQMASQGVDRWRGSFCSDDTARLVD
FT                   EEIRTMLDDAHTRVSATLATQRSTLERIARLLLEREVLDQQMLQEAISGVSTERAPETA
FT                   AG"
FT   gene            complement(362492..363328)
FT                   /locus_tag="BC1003_3841"
FT   CDS_pept        complement(362492..363328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3841"
FT                   /product="UspA domain-containing protein"
FT                   /note="PFAM: UspA domain-containing protein; KEGG:
FT                   bxe:Bxe_A1890 putative universal stress protein, UspA-like"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3841"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59780"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJG0"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADN59780.1"
FT                   /translation="MKPAELLDEAPRNRAAVGKPAAHGCYRRLLVVVREGSALPVMAVD
FT                   YVSAWATPDAVAGVASLPGSESSCDGTPRNPRGVSSADVATADAVRCALLARGVDAIES
FT                   GTLKLAAGANAAESIGAVAHRWGADIVLCDDRSIAHLAQAAACNVLFLPTDGSHRFHVP
FT                   PRRIFVASDESACALGAVAEAQRVAGNNAELRRAYISFEADSASASDPASTVLAAAHHG
FT                   DNLAHAIVQAAREWGADLLVQGTHGALPRAVWRYGSVAAAVALVADMPLLLVPAQS"
FT   gene            complement(363534..364121)
FT                   /locus_tag="BC1003_3842"
FT   CDS_pept        complement(363534..364121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3842"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3842"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59781"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJN4"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A1905"
FT                   /protein_id="ADN59781.1"
FT                   /translation="MKDAYERRALLLHLGDVLEAVNRLMNCSSGEQTVDEALAATDSLK
FT                   GLPLLTQVSSSMTTRNFVRHAVAAFRSWPKELLELELDREQLAREVQRALFVGNAPGWH
FT                   AYVATLREEVVWFGTGLEAVEQSKADLAAASEDALAPNPLTGETAGARADSSDIESDDH
FT                   AHARKSRESVESVESVESDPRFYPSWPWKSEV"
FT   gene            complement(364318..364968)
FT                   /locus_tag="BC1003_3843"
FT   CDS_pept        complement(364318..364968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3843"
FT                   /product="transport-associated protein"
FT                   /note="KEGG: bxe:Bxe_A1899 periplasmic phospholipid binding
FT                   protein; PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3843"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59782"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJN5"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADN59782.1"
FT                   /translation="MKTDQELKHDVDQELLWDPALDARNVTATVLNRIVTLEGSVNSCA
FT                   QKLALQKAVQRVAGSRAVVLDVVVRAPSPLRHSDEDLAAAIVSALQWQEGLPRDAIRAV
FT                   VEHGCVTLTGEVEYGFQRQMAETLVTRMRGVVGVANQIEVRANPVAADISKQIADALQR
FT                   RSRHKSEGVSVDVRDGVVRLTGVVDSLLDKRVACGVAWGTKGVRWVVDQLTVA"
FT   gene            365703..366260
FT                   /locus_tag="BC1003_3844"
FT   CDS_pept        365703..366260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3844"
FT                   /product="Heme oxygenase-like protein"
FT                   /note="PFAM: Haem oxygenase-like; KEGG: bpy:Bphyt_1281 haem
FT                   oxygenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3844"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59783"
FT                   /db_xref="GOA:E1TJN6"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJN6"
FT                   /inference="protein motif:PFAM:PF01126"
FT                   /protein_id="ADN59783.1"
FT                   /translation="MPLSVNTVSRGDYVAHLGILREWLGQLEAWLQRFSDGPQAAHVVS
FT                   PVNRLALIEADLSHPCVTAQERIAVPPANAYPNSEQPNWRSRSESAAYRWGVCYVIEGS
FT                   QLGGAVLYDRLKERLAPHPLNYLALGRGAPGKRWPAFIQAMCAGLDTEAKIQEACRGAS
FT                   DAFAHLIELVPCSALACGKNAD"
FT   gene            366279..367955
FT                   /locus_tag="BC1003_3845"
FT   CDS_pept        366279..367955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3845"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; KEGG: bpy:Bphyt_1282 PAS/PAC sensor signal
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3845"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59784"
FT                   /db_xref="GOA:E1TJN7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJN7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADN59784.1"
FT                   /translation="MNRCHEDSSAPSHPLDAAAAFDLLPDAYLILDRQFRVLHANASYR
FT                   SLVDQSSSDVLGKSIFDINQFGPREQRDARRSWLDSALADLVPGESKWSTLFRYETPPR
FT                   TTAAAREPASDPEASAPQLAVRYWRVKATLLAPAHDGNAYIALRVSEVTDRVDEYERQQ
FT                   RERAKLRSQAQLRLVVAQEAKEQLRENEERFQLALEFSQLGAWELDPRTRLINCTDQCK
FT                   ANLGLGSTSVITEQRLFGEIAHPEDSGRLRDAMNMAVASRDHFEVDFRVGWATGSIRWI
FT                   LVRGVGRFLPDGTLNSVIGFTLDITTRKEAELEQQQIALSEKRAREQSERLATAMDHFV
FT                   TTVSHELRSPLSAIISWTHLLERASEPSQVAPRAASVISRNARQLAHMVDDLLDSGAIV
FT                   TGKLSVNLSPVDLGALAGNVAEDMRIDVEAKGLRLIADDLASVTVLADESRMKQVVWNL
FT                   LSNARKFCTTGSIELWVKADTEHVELAVRDTGVGLDDQSLERIFERFQQFTAHGSGRVA
FT                   GLGLGLWLVKNLVDLHNGTIVAESAGLGHGATFRVRLPLYR"
FT   gene            complement(367971..368411)
FT                   /locus_tag="BC1003_3846"
FT   CDS_pept        complement(367971..368411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3846"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bpy:Bphyt_1283 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3846"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59785"
FT                   /db_xref="GOA:E1TJN8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJN8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN59785.1"
FT                   /translation="MLKPILLVEDNPNDIELTLIALEKTRLANPVVSLRDGEEALQWLR
FT                   REGRWADRSEGSPAVILLDKKLPKVDGHEVLKSVREDEELRRIPVVMLTSSREESDLLR
FT                   SYDLGVNAYVVKPVQFDDFMDAIKDLGVFWAVLNEPPPHPRT"
FT   gene            complement(368460..370820)
FT                   /locus_tag="BC1003_3847"
FT   CDS_pept        complement(368460..370820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3847"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bpy:Bphyt_1284 multi-sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold-2 domain protein; GAF
FT                   domain protein; Phytochrome central region domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; GAF domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3847"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59786"
FT                   /db_xref="GOA:E1TJN9"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJN9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN59786.1"
FT                   /translation="MAQLHSSPLSSAAEADCAREPIHIPGGIQPHGFLFSVAADGTLLQ
FT                   VSANIATLTGSSAESALGRPIAHVLGDEWSARIISGLASHEAEGVPLYIGSMGDPRGDT
FT                   SGAPIGPFAVVVHRYQGVLFVELEPALGTEDVFSSMYPLVRTFINRLEEANSVPRLAQL
FT                   AADEVRRITGYGRTLVYNFDEAGVGHVIAENIQPGYASYIDQHFPGSDIPAQARELYVR
FT                   NRIRLIADAAYQASPLVPSLHPSTGRPTDLTYASLRSVSPVHVQYMKNMDTLSSMSMSI
FT                   VVRGKLWGLISCHHASGRVPPFEVRMACEHIAQVLSLQIESKEDHAQAEYRLKLRRTLT
FT                   RLLGVMADADSFTETLASDPTDLLALTAADGAAIVFDGRIQLIGAAPSEEEVGKLVEWL
FT                   DSKSEETFATDALGFTCPVLPANPNYAGLLAISISTLFKNYVLWFRKEAIQTIKWAGDP
FT                   REKLANLAPSLSPRQSFEVWTDTVRDRSLAWSPAEVEIAADFRTALLGIVLRRAEELAQ
FT                   LAQELGRANEELEGFSYTVSHDLRAPLRHIASFADLLRQMENDALSERGQHFLERIISS
FT                   AKFGGELVDDLLAFSQMSRAALRPQLVDVNALVESLIADEAKHTAHRNIEWHVGDLGEV
FT                   TADATLIHIVLRNLIENAVKFTATRDVAIIHIGRYAGTDQLADQEVFFVKDNGVGFDML
FT                   YVDKLFEVFQRLHRMEEFGGTGIGLASVKRIVERHGGKAWAEGEVEKGATVSFSLPHSL
FT                   HVAASQGDESSAISTARSSALLTGKRMRVVPKS"
FT   gene            complement(371068..372312)
FT                   /locus_tag="BC1003_3848"
FT   CDS_pept        complement(371068..372312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3848"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bgl:bglu_2g16870 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3848"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59787"
FT                   /db_xref="GOA:E1TJP0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJP0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59787.1"
FT                   /translation="MNPRYALEALNFFMADVQAGIGPFLGVFLQAHGWRPDAIGTVMTV
FT                   GGIAGMLATSPAGALVDATHHRRAVIVIAGCMTTLASLVLWVSHTYWTVVVSQIFTAVT
FT                   GAALGPAVAGVTLGIVREQGFDRQFGRNQVANHAGNVVGAALSGWLGWRYGFGAVFVLA
FT                   GVFGFLTVVSTLLIRRDAIDHDSARGLGRSVPGEPHAAHEQASGLRVLLTCRPLLVLAA
FT                   SLALFHLGNAAMLPLYGLAVVGAHQGDPSAFTAQTIVIAQLVMVVAAWCANRLIRRIGY
FT                   WGVILIAFLALPLRGLLAAMFVTAWGVWPVQALDGIGVGLQSVAVPALVVRLLRGTGRV
FT                   NVGQGIVMTVQGAGAALSPALGGVLAQHFGYASAFLVLGAVSTGSLALWLLFGAALKKA
FT                   CDLRRDVINDVPQAT"
FT   gene            complement(372468..373010)
FT                   /locus_tag="BC1003_3849"
FT   CDS_pept        complement(372468..373010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3849"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_6057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3849"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59788"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJP1"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_6057"
FT                   /protein_id="ADN59788.1"
FT                   /translation="MHWIDPISLPETRGKVTRFLLNPHGELDGLVLGARQVHFPPHLSK
FT                   QLARHVAPGDEVRVRGVKPRDADMISAVSLTSASGVLILDEGPHHNGEKHHKPHVERKA
FT                   MEASGEVVLSLFGPKGELRGALLDDGTSLRMAPHAAAELAAYLTRGAHVQAWGHGVKNR
FT                   HGRTIEVDEIAELVDES"
FT   gene            complement(373060..373809)
FT                   /locus_tag="BC1003_3850"
FT   CDS_pept        complement(373060..373809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3850"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: bgl:bglu_2g21060 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59789"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJP2"
FT                   /inference="similar to AA sequence:KEGG:bglu_2g21060"
FT                   /protein_id="ADN59789.1"
FT                   /translation="MQSIRCRNLRIAVLAALFAASTGCAAQPSVTPPPAPVAGSPQPPP
FT                   RPAPPPSGAEPDRLAEPASIATAQGTVARFLTNPDGDVDGFLTDDGTLVRLPPHMGVQV
FT                   ATSLRRGDLVEMNGMREEAGAFAAQRITDTRTGRQIIDEPPPRGPSPLPRTLRGAGLSR
FT                   LSAQGQVARVTTAPHGEPDGVILSDGTVIKLTPPVAQQFATLVRTGATVSAQGYGTRNE
FT                   YGTALQATAFGSPGNLTPLYDRNAPLP"
FT   sig_peptide     complement(373729..373809)
FT                   /locus_tag="BC1003_3850"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.837 at
FT                   residue 27"
FT   gene            complement(373957..375327)
FT                   /locus_tag="BC1003_3851"
FT   CDS_pept        complement(373957..375327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3851"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: bgl:bglu_2g21070 two component, sigma54
FT                   specific, transcriptional regulator, Fis family protein;
FT                   PFAM: sigma-54 factor interaction domain-containing
FT                   protein; response regulator receiver; helix-turn-helix
FT                   Fis-type; SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3851"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59790"
FT                   /db_xref="GOA:E1TJP3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJP3"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADN59790.1"
FT                   /translation="MATILIIDDDDAFREGLAETVQDLGYSPFEARSGDEAFEQLRGRS
FT                   APDCIFLDFRLPGADGLAVLETLRKTPGLQTVPVVMLTAHATSDNTIGAMRLGAFEHLT
FT                   KPVGREQIAALLERILSARRETPVPRVFADEATSHEPQLLGVSEAMREVQKRLGRAAIG
FT                   NSTVLITGETGTGKEIAARVLHHASTRAGGPFVAVNCAAIPDELLESELFGHAKGAFTG
FT                   AHTDRRGRVEEAHGGTLFLDEVGDMPLPMQAKLLRVLQERQVTPLGTNRVVTVDVRVVA
FT                   ATHRDLSSMVEAGTFRQDLLFRLNVIPLHMPPLRERVADILPLAEHFLAGASSGVARKH
FT                   LSADAQRLLATFAWPGNVRELANAIERASALAPAQVLTREDFAFLTATRDSSDDAIPRA
FT                   LLELPLPQAVAQLERALIAHALSASSGNRTEAARRLGISRQSLYTRMAALDMSEASA"
FT   gene            complement(375312..376799)
FT                   /locus_tag="BC1003_3852"
FT   CDS_pept        complement(375312..376799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3852"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: bgl:bglu_2g21080 signal transduction histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3852"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59791"
FT                   /db_xref="GOA:E1TJP4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJP4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN59791.1"
FT                   /translation="MPRPSFSSQLLTLWILIAVLCGLLSVAVWLMLSSALSERVVAAKQ
FT                   QAEAACTAVASRYDLSMQRSGETNVDLMHAVLDIVLIQTEGIEGGFWTRSEPATKTVNG
FT                   FIAYAFPTYGGSGVKRDVPEAETPLILRALRSASSSGQLQAEVVTSGTDAVLTVACPVP
FT                   HHADLLAWTLTRARPPLGQYGERATAILASVLAVIVVLALFLALTLKRWKRNLMRLEQA
FT                   LAPDGEFEQGKRLERLGERDLDQIVDALNRYGERAERLKRVANALDRQLAQAERFSTLG
FT                   KMAAQIAHEIRNPAGAMRLKAENALAGDGARREAALRTIIEQVGRIESQVTSLLALTQS
FT                   VTVHAREVDLQAWLDDIAHTHESRAESRHVTLGVEVAPHTTQPVFDPAQLARALDNLLV
FT                   NALRHAPSGGNVTVRAYCAVTEEGEWLRLEVIDNGSGVSPADRERIFEPFVTGRPDGSG
FT                   LGLAVVREIASAHGGRAYLAEDPNMTRFVIDIPWRPS"
FT   sig_peptide     complement(376671..376799)
FT                   /locus_tag="BC1003_3852"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.773) with cleavage site probability 0.299 at
FT                   residue 43"
FT   gene            377093..379615
FT                   /locus_tag="BC1003_3853"
FT   CDS_pept        377093..379615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3853"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein; GAF
FT                   domain protein; PAS fold-4 domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; KEGG:
FT                   bph:Bphy_5679 multi-sensor hybrid histidine kinase; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS domain containing protein; GAF domain
FT                   protein; PAC repeat-containing protein; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3853"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59792"
FT                   /db_xref="GOA:E1TJP5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJP5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADN59792.1"
FT                   /translation="MTTIPHPRLESNLAEQLAAERSTNARLLKLINAHSKIAATKLNLD
FT                   TFLSAVTDALLDLVPAAHASVVEWVDGDDMVYRACSGSIARHVGLRLKREGSLSGRCSV
FT                   ENRLLYCNNTSNDPRVDRQACEQVGAASMIVAPLAYHDEVAGVVKLIADTHDAFSAEDI
FT                   ETLERITSLVASGMAHQRVFAENQTLIEENAITIAKLRTEIGLREAADKRLASSLRRRR
FT                   LVLDTTHDAFICTDSHGIIIDWNDAANRTFGYSRDAVIGQPMLTLLFPARCVAEYAQLD
FT                   VFAFDRKQPGHRPRTELTAARSDGSEFPAELSVVAVQYDGSKELAYFVRDVTERFNARD
FT                   LDKRFRVLVDAISDYAITLLDADGLITTWSAGAVQVMGYQADEVIGKPHSLFYTPQDVA
FT                   SGRPQKDLDQAAREGRSEVEEWRVRKNGTNFWANTIVTALRDPNGALQGFAKITRDMSR
FT                   RRRMEELEASSQRMSQFLGLLGHELRNPLAPLRNAVSMLQLKSKGHEAILPEHELIDRQ
FT                   LSHLTRLVDDLLDAGRVTLGRVYITPTPCALQAVVQLSIEGSAPLLAARKQTLNVSMPE
FT                   EPMRVNGDLTRLVQVVQNLLNNASKFSPIGASIDLTVFRSARLLAIRIDDPGRGIQPDA
FT                   IDAVFNLFVQETPTEEQADKSGLGIGLTLARAIVDLHGGHIDARSAGRGKGSSFTVWLP
FT                   AYENEVVDEGIREKTPVAPRQANLRVLVVDDNNDSANSMAALIEVLGHEARAVYDGAAA
FT                   VELAKNWQPALVLLDLSMPKITGFDALPQIRAALRAPGAVIAAMTGLGTSEDRARTAAA
FT                   GFDLHLTKPVGLDDLEDVLCLAGKRTAT"
FT   gene            complement(379869..380384)
FT                   /locus_tag="BC1003_3854"
FT   CDS_pept        complement(379869..380384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3854"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hha:Hhal_1125 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3854"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59793"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJP6"
FT                   /inference="similar to AA sequence:KEGG:Hhal_1125"
FT                   /protein_id="ADN59793.1"
FT                   /translation="MLNQSNPTACRDRASWKAAQLAELHSLVDAICSVIAMIEMKQNEI
FT                   DALRKVVSESARGASRTRPHLMELSDAIETVFAATSPYHLRTAGRVALKLKQMLAQAVA
FT                   SLNELPESVTDGQTPPRILAETTEEALVHVRETTGVLLRVMGHADEEVQTLQAAFLAIS
FT                   VAQPRTGL"
FT   gene            complement(380490..382181)
FT                   /locus_tag="BC1003_3855"
FT   CDS_pept        complement(380490..382181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3855"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bvi:Bcep1808_5173 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3855"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59794"
FT                   /db_xref="GOA:E1TJP7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR004091"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJP7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADN59794.1"
FT                   /translation="MKYLGNLRIGTRLRIGFGITLLLLMMTGGLAMLQASRIYAGTEEI
FT                   ADNWLASVQTLGEIRALANGVRRASLRSVMESEATAKQSQRAQHDAALSSFKTAMASYE
FT                   KLVSSPEERQIFDSLTKAWAAFETSDTKLLQLSESGDTGFAAARSLATGESATLFTQAL
FT                   QLVEQDVKLNRAGAAAARTDAAGNYHATLVLTGVLCGAALLLSVVVAWLITRSIVTPLE
FT                   RAVGIAETVARGDLTSQIEVSGRDETSQLLLALRNMNARLLDVVSRVRSSSESIATGSA
FT                   QIAAGNTDLSQRTEEQAASLEETAASMEQLTATVKQNTDNARQGNTLASNASEVAAKGG
FT                   QVVAEVVDTMHDISDSSAKVAEIIAVIEGIAFQTNILALNAAVEAARAGEEGRGFAVVA
FT                   SEVRGLAQRSASAAREIKELINQSVAKVEAGTLLVDNAGATMKEVVDSVKRVTDLMGEI
FT                   ASASVEQHTGIEQVNQAVMQMDEVTQQNAALVEEASAAAQSMASQSSTLRELVSVFRLP
FT                   DSFSVSASVSERPTVAPTVAKQKNRMPRKAPVAADSSAGNGDWQNF"
FT   gene            complement(382324..383598)
FT                   /locus_tag="BC1003_3856"
FT   CDS_pept        complement(382324..383598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3856"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="KEGG: bvi:Bcep1808_5174 diguanylate
FT                   phosphodiesterase; PFAM: EAL domain protein;
FT                   Metal-dependent hydrolase HDOD; SMART: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3856"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59795"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJP8"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADN59795.1"
FT                   /translation="MSHAWQGTLTEAATTFVARQPIVDRGGRMVAYELLFRDGDTAAAN
FT                   IADGFGCTAHVVERTVGALGLDTVLTGLDGYLNCTVHFLHSGVPQILTGGRFVLEVLES
FT                   CELDGALRKRCNALRAAGLRVALDDVVALSPEIEAFLPAVDIVKLEWPALDATTAQAMV
FT                   EQLKRAGKIVVAEKVDDREQWRNAINWGCDMVQGFYFSRPQIMEARRLVPDLGQLLELL
FT                   NLLINDACDHRIIRALSDMPVLVTQVLRLANCSGNANPKRTAIASLHQALATIGTTRLF
FT                   QWCSLLLYNHSDPDAVCRDPLLALARQRASFMLQAALAENPRETAFAQTAYLTGMLSLL
FT                   HVIYGRNEDEFVETLPLDPGMKAALVGRCGRLGELLTCAEIFEGTRRLSETDHARHDAQ
FT                   THVRSAEPAGTRQENGALHDALPVC"
FT   gene            383997..385127
FT                   /locus_tag="BC1003_3857"
FT   CDS_pept        383997..385127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3857"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: GAF domain protein; regulatory protein MerR;
FT                   KEGG: rpc:RPC_2479 putative GAF sensor protein; SMART: GAF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3857"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59796"
FT                   /db_xref="GOA:E1TJP9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJP9"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADN59796.1"
FT                   /translation="MEDPIITTREAAELLGVSTRTAQTWIETNTLDSWKTPGGHRRVRR
FT                   SAVMELKARLATERIHGPARVLVHAPRHKAQRFVEMFSAMPECAVHASSEVDQTLLSAG
FT                   HLLPSVIVLDFDADGSACMRVVEAILAHPALGHTHVVIAGDVGGTDLSALPNAGRRVHV
FT                   VTSRRSAGTLQSTVRRLLGDGGPLTRPALEPLSGDPAANEAQRLIAVAASGLVDSPAEE
FT                   SFDEITRLAATILEAPIALLTLLTPDRQWFKSRWGLEAAETPRSWAFCNFTILQDGVFV
FT                   VEDATIDLRFASNPLVTGDPHIRFYAGVNICDVQGYRLGSLCVIDRTPRRLLDSQRDAL
FT                   TTLGRLASDHINLRVMERKLRWATAQPASPTATSGA"
FT   gene            385561..386361
FT                   /locus_tag="BC1003_3858"
FT   CDS_pept        385561..386361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3858"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_5563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3858"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59797"
FT                   /db_xref="GOA:E1TJQ0"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJQ0"
FT                   /inference="similar to AA sequence:KEGG:Bphy_5563"
FT                   /protein_id="ADN59797.1"
FT                   /translation="MEVKNSKRWAPRGRKRWIAAVAALVAAAIIRVILHPLLGPFMPGS
FT                   AFLIAAVLVEYYCGLAPALCVMLLGLCLADYLFVPPYGHIDVIDASDLHLLISYPLITI
FT                   FVISLVERLRRAQYRAELLAAVAQSRYEMLLRHDNERLIARRASDEMHRMLRHIAQYNR
FT                   SLILIKALDPANSLPPGSFVAAAAAATPHALVGDASLHAGIAYCAKHTQVHEEDLAHVS
FT                   VHLTPGRHRMRFLSAARDDWRPVECACDRFTTSSGEFLILRADD"
FT   gene            386354..387244
FT                   /locus_tag="BC1003_3859"
FT   CDS_pept        386354..387244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3859"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3859"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59798"
FT                   /db_xref="GOA:E1TJQ1"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJQ1"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5263"
FT                   /protein_id="ADN59798.1"
FT                   /translation="MTDMNATPFSSTDGSDHVVLLLHGLSSSPLELRFLARLLADEGFA
FT                   THTPELPGYSAGTGHLPMEQWIDAAIAEFDKLAAQYQHVSICGLSMGATLAAAVAHERP
FT                   AARALLLLSITLNYDGWSLPWYRFLLDYAYYTPLRSRYRYREQEPYGLRNEALRSKIAR
FT                   AMQKNDISEVGPAFIGMPALHEAGRLAASVKKKLKGIGTDCLIIHAIDDETSSPHNARF
FT                   VGTNIGASFLRTIWLDDSYHMITSDNEREVVARECALFLRESVAATVSSHNPAPVVSRA
FT                   LARRLRQLATVARKA"
FT   gene            387241..388017
FT                   /locus_tag="BC1003_3860"
FT   CDS_pept        387241..388017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3860"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   bpy:Bphyt_5264 MltA-interacting MipA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59799"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJQ2"
FT                   /inference="protein motif:PFAM:PF06629"
FT                   /protein_id="ADN59799.1"
FT                   /translation="MKRTPMLAAVCGFALVAVTGAAHADEPQAASDWKISVGPGLYVFP
FT                   KYPGSSQIQVLPFPVQDISWKDRFFSQGPDVLGVNVLAGENYHAGASLSFDFQSRSSSD
FT                   DARLKGLPDVHYGPKLRLFADYTWWAFTGSAAVYRDIAGTGQGLTAMADLFVSAPLGKL
FT                   LLSAGPGVTWANATYTQTFFGVNAQESAASGLPRYATHSGLRDVHFNVNALYKFDSHWS
FT                   ANVAAVIGRLQKSAAGSPITERRLDLNGLASVLYQF"
FT   sig_peptide     387241..387315
FT                   /locus_tag="BC1003_3860"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            388187..388696
FT                   /locus_tag="BC1003_3861"
FT   CDS_pept        388187..388696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3861"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="KEGG: gur:Gura_1530 lipoprotein signal peptidase;
FT                   TIGRFAM: lipoprotein signal peptidase; PFAM: peptidase A8
FT                   signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3861"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59800"
FT                   /db_xref="GOA:E1TJQ3"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJQ3"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ADN59800.1"
FT                   /translation="MSKKQRLTTAVLCALAWIVVDQLTKAVFKQVLAPGDVKSFLAGSL
FT                   VVLPIYNHGAFLSLGAQMSDATRNMVFIYGVLALLVGLFVWLFRSPRLGRTEVLAIASI
FT                   LGGGLSNLFDRCVYGGLVFDFLNMGIGQLRTGVFNVADVGIMLGVAMLFFAGMKRKPTL
FT                   PGSASV"
FT   gene            complement(388952..389887)
FT                   /locus_tag="BC1003_3862"
FT   CDS_pept        complement(388952..389887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3862"
FT                   /product="catechol 1,2-dioxygenase"
FT                   /note="KEGG: bpy:Bphyt_1590 catechol 1,2-dioxygenase;
FT                   TIGRFAM: catechol 1,2-dioxygenase; PFAM: intradiol
FT                   ring-cleavage dioxygenase; Catechol dioxygenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3862"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59801"
FT                   /db_xref="GOA:E1TJQ4"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR012801"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJQ4"
FT                   /inference="protein motif:TFAM:TIGR02439"
FT                   /protein_id="ADN59801.1"
FT                   /translation="MSVKVFATQEVQDLLKAAANIGSDSGNARAKEITQRLLSDLFKAI
FT                   EDLDMTPDEIWAGVNYFNKLGQDGEAALLAAGLGLEKYLDIRMDAADRQAEIEGGTPRT
FT                   IEGPLYVEGAPVRDRMSKIDLDADADAGPLVIRGTVRGPDGKPVAGAVVECWHANSKGF
FT                   YSHFDPTGAQSEFNLRGAVRTGEDGTYEFRTLMPVGYGCPPHGATQQLLNMLARHGNRP
FT                   AHVHFFVTANGLRKLTTQINIEGDPLIWDDFAYATREDLIPHVVEKTGGAALGLKADAY
FT                   KEIEFDIALTGFVKGRDNQVVNRLRASVAV"
FT   gene            complement(389932..390222)
FT                   /locus_tag="BC1003_3863"
FT   CDS_pept        complement(389932..390222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3863"
FT                   /product="muconolactone delta-isomerase"
FT                   /EC_number="5.3.3.4"
FT                   /note="TIGRFAM: muconolactone delta-isomerase; KEGG:
FT                   muconolactone delta-isomerase; PFAM: Muconolactone
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3863"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59802"
FT                   /db_xref="GOA:E1TJQ5"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJQ5"
FT                   /inference="protein motif:TFAM:TIGR03221"
FT                   /protein_id="ADN59802.1"
FT                   /translation="MLFHVRMDVNLPPDMPAHIADEIRSREKAYAQELQKSGKWRHIWR
FT                   VAGEYANYSIFDVESNAQLHDILVGLPLFAYMKISVTPLCRHPSSIRDGDM"
FT   gene            complement(390243..391379)
FT                   /locus_tag="BC1003_3864"
FT   CDS_pept        complement(390243..391379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3864"
FT                   /product="muconate and chloromuconate cycloisomerase"
FT                   /note="KEGG: muconate and chloromuconate cycloisomerase;
FT                   TIGRFAM: muconate and chloromuconate cycloisomerase; PFAM:
FT                   Mandelate racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3864"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59803"
FT                   /db_xref="GOA:E1TJQ6"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJQ6"
FT                   /inference="protein motif:TFAM:TIGR02534"
FT                   /protein_id="ADN59803.1"
FT                   /translation="MTTATIERIETSLVDLPTIRPHKLSVATMNGQTLMLVKVFCSDGV
FT                   FGIGEGTTIAGMAYGPESPESMKLAIDAYLAPAALGRDATRIQELMAHLGKLVKVNHFA
FT                   KSALETALLDAHGKRLGVPLSELLGGIRRERLPVAWTLASGDTAKDIAEAERMLDMRRH
FT                   KVFKLKIGAREPRVDIAHVAQIKRELGDRGAVRVDVNMAWGETQAAWAIAALADAGCEL
FT                   VEQPVASAAALARLTRRFPIALMADEILQGPESAFEIAKSNGADVFAIKIEQSGGLFAA
FT                   QRVAAIADAAGIELYGGTMLEGAVSTVASAHLFASFANLQWGTELFGPLLITEQILTRP
FT                   LDYSEFELTVPKGPGLGIELDEEMVKRFTRDGLKKVTR"
FT   gene            complement(391576..392790)
FT                   /locus_tag="BC1003_3865"
FT   CDS_pept        complement(391576..392790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3865"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bph:Bphy_3816
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3865"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59804"
FT                   /db_xref="GOA:E1TJQ7"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJQ7"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ADN59804.1"
FT                   /translation="MNRKRLKRSLAATGVLAMCAGAHAQSMVTLYGTVDAGITYTSNQQ
FT                   FTRADGTVGSGHGWALTGGNLVPSRFGLTGTEDLGGGMQAKFMLENSFYTGSGAFVQSG
FT                   AQFNRQAWVGVAHERFGTLSFGRQYDSYSDFLGPYVSSNSWATLYGSHFGDVDNLNEAF
FT                   NFNNAIKYTSPDWNGLSFGGTYSLGGVAGDFAQRRGYALAATYAHAPFSISAGYLNLRN
FT                   PLDAALGGENGYFGDFACSNASALYCQLQNAQALKAYGAGASYAIGPATIALSYTHTRL
FT                   EHSQYFANAANPQGRNVAFDIGEANLTYAATPFLQLGIAYIYNIARVDGESSSRFHQLN
FT                   LGANYALSKRTALYGVAILQKAAGAGLGVDPATGAPVNYAQIPNLPNSGSDRQLSVTLG
FT                   IRHNF"
FT   sig_peptide     complement(392716..392790)
FT                   /locus_tag="BC1003_3865"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(392800..394308)
FT                   /locus_tag="BC1003_3866"
FT   CDS_pept        complement(392800..394308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3866"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="KEGG: bmj:BMULJ_04931 NAD-dependent aldehyde
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3866"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59805"
FT                   /db_xref="GOA:E1TJQ8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJQ8"
FT                   /inference="protein motif:PRIAM:1.2.1.8"
FT                   /protein_id="ADN59805.1"
FT                   /translation="MNDNSRPLDMLDSTRTFLAAPKRMFIDGEWRASASGATLDVLNPA
FT                   DGSLLAQVPSADEADVDLAVQAARRAFDDSAWSRMKPTDRERILLRVAELIEANARELA
FT                   EIESLDNGKPVAVAQGLDVSMAAQCFRYMAGWATKIEGSTLDAALPYSPSNAFFAYTRK
FT                   EAVGVVGAIIPWNFPLLMASWKLAPALATGCTVVLKPAEDTPLSALRLATLLSEAGLPK
FT                   GVVNIVTGYGRSAGAALARHPGIDKIAFTGSTQTGKAIGHAALDNMTRMSLELGGKSPV
FT                   IVLPDVDIERAAEGVANAIFFNSGQVCTAGSRVYVHETVFDRVMERVAAIAEALPVGPG
FT                   LDANTQIGPLVSARQMDRVLGYIEAGRDEGARAIAGGAREGGAGFFVKPTVLVDTDHSM
FT                   RVVREEIFGPVLVAMPFKDIDSAVAQANDTPYGLGASIWSNNLSAIHNLIPRIKAGTVW
FT                   VNCHSLLDNAMPFGGVKQSGFGRELGRAVIDMYTEMKSVLINHA"
FT   gene            complement(394323..394769)
FT                   /locus_tag="BC1003_3867"
FT   CDS_pept        complement(394323..394769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3867"
FT                   /product="class I cytochrome c"
FT                   /note="KEGG: class I cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3867"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59806"
FT                   /db_xref="GOA:E1TJQ9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJQ9"
FT                   /inference="similar to AA sequence:KEGG:BC1002_1585"
FT                   /protein_id="ADN59806.1"
FT                   /translation="MKRRAWLLATLLVALSSRAQSYDAARARESWVLNCMGCHTADGSG
FT                   IPGKVPALRDSLGHFVSLPEGREFVMRVPGAANSALSDAELANVLNWVLGTMNAQTLPA
FT                   SLKPYTADEIAAHRRPALTDVARVRAKLVKQLQANGVQAVAEHY"
FT   sig_peptide     complement(394704..394769)
FT                   /locus_tag="BC1003_3867"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.608 at
FT                   residue 22"
FT   gene            complement(394766..395242)
FT                   /locus_tag="BC1003_3868"
FT   CDS_pept        complement(394766..395242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3868"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bph:Bphy_3813
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3868"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59807"
FT                   /db_xref="GOA:E1TJR0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJR0"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADN59807.1"
FT                   /translation="MNKLRLATAALALAAAAQVPAQTVHYPGGKGTFDGKCAVCHQAGG
FT                   KGMDGLAPPLVEYPGRYAGANDGRAQLGHTVLYGMYGPIKVKDRTYNFKMPSFATLSDA
FT                   EIADVLNYVVFDLNAEHGGARQFDAAEIHALRANPLDASAVHRQRDAVVKGLGL"
FT   sig_peptide     complement(395189..395242)
FT                   /locus_tag="BC1003_3868"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.512 at
FT                   residue 18"
FT   gene            complement(395239..395760)
FT                   /locus_tag="BC1003_3869"
FT   CDS_pept        complement(395239..395760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3869"
FT                   /product="Aralkylamine dehydrogenase"
FT                   /EC_number="1.4.9.2"
FT                   /note="KEGG: bph:Bphy_3812 amine dehydrogenase; PFAM:
FT                   methylamine dehydrogenase light chain domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3869"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59808"
FT                   /db_xref="GOA:E1TJR1"
FT                   /db_xref="InterPro:IPR013504"
FT                   /db_xref="InterPro:IPR016008"
FT                   /db_xref="InterPro:IPR036560"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJR1"
FT                   /inference="protein motif:PRIAM:1.4.99.4"
FT                   /protein_id="ADN59808.1"
FT                   /translation="MKWLDSFFEQSARGVAQRTSRRGAMAKLGKALVGSAMLPLLPVDR
FT                   TAYAAEPKKPASAVNDDPMSCDYWKYCAIDGWLCSCCGGTSSSCPPGTTPSPITWIGTC
FT                   RNPHDGSDYIVSYNDCCGKTSCGRCFCNRNEREKPLYKLSLDNDINWCMANGNSNYHCS
FT                   VSVLLGASTQ"
FT   gene            complement(395797..396444)
FT                   /locus_tag="BC1003_3870"
FT   CDS_pept        complement(395797..396444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3870"
FT                   /product="methylamine dehydrogenase accessory protein MauD"
FT                   /note="KEGG: methylamine dehydrogenase accessory protein
FT                   MauD; TIGRFAM: methylamine dehydrogenase accessory protein
FT                   MauD; PFAM: Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3870"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59809"
FT                   /db_xref="GOA:E1TJR2"
FT                   /db_xref="InterPro:IPR013478"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJR2"
FT                   /inference="protein motif:TFAM:TIGR02661"
FT                   /protein_id="ADN59809.1"
FT                   /translation="MMQTALMISAALSWAALLALGAICLALVRQVGILYERMMPAGALM
FT                   IDKGPAVGSVAPMFELVDIAQRPVKVGGLSAKRRNTLVFFLSPTCPVCKKLLPLLPSIQ
FT                   AREGATDIVLASDGDIDEHAAFYRKTGLSQYPYVLSQELGLSYAIGKLPYAVLLDDEGK
FT                   VRAKGLVNTREHLESLFEAKERGVASLQEFVHGKQEHGHEHTHEQDHAGQHA"
FT   sig_peptide     complement(396379..396444)
FT                   /locus_tag="BC1003_3870"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.438 at
FT                   residue 22"
FT   gene            complement(396441..396989)
FT                   /locus_tag="BC1003_3871"
FT   CDS_pept        complement(396441..396989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3871"
FT                   /product="methylamine utilization MauE"
FT                   /note="PFAM: methylamine utilisation MauE; KEGG:
FT                   methylamine utilization MauE"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3871"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59810"
FT                   /db_xref="GOA:E1TJR3"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJR3"
FT                   /inference="protein motif:PFAM:PF07291"
FT                   /protein_id="ADN59810.1"
FT                   /translation="MLDPAILMVCIATLAIVTLASAAPKWRHPERFRSSLAAFALLPSF
FT                   AVSPLVRLLPLLETLAAIALLFPAARAPGAGLLIALFSVFALALAINVARGHTDIDCGC
FT                   AGFLTAAAHTPRIGWWHVVRAALLIALAAATLVSPADRALVWFDYVSAGACTLVAVAAW
FT                   FTLDVLLANLPKLDSLRNS"
FT   sig_peptide     complement(396921..396989)
FT                   /locus_tag="BC1003_3871"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(396999..398168)
FT                   /locus_tag="BC1003_3872"
FT   CDS_pept        complement(396999..398168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3872"
FT                   /product="Aralkylamine dehydrogenase"
FT                   /EC_number="1.4.9.2"
FT                   /note="KEGG: bch:Bcen2424_5062 amine dehydrogenase; PFAM:
FT                   methylamine dehydrogenase heavy subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3872"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59811"
FT                   /db_xref="GOA:E1TJR4"
FT                   /db_xref="InterPro:IPR009451"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJR4"
FT                   /inference="protein motif:PRIAM:1.4.99.4"
FT                   /protein_id="ADN59811.1"
FT                   /translation="MERRRRAVARAASILALSYGLLACHAQAGAAEKPEELTVAKVPPV
FT                   NPHRAFVVDVSFASMTDARVHVFDADTSRFVGQIDAGFAPGFSISPDHKTSYVATTYFS
FT                   RGGHGTRTDVVELIDNATLDIVGEIEIPVKHAQAVPTPYNTTLSDDGSRLYVSNITPST
FT                   SVTVIDTSAKKVLGEIDTDGCVLAYPSGNDRFTALCESGKALTVKLDATGKEVSRKLSD
FT                   AFIDVEHDPAFVNAVRDGQRYLFTTFGGRVCSADFTGDTPVFGEPWSLVTSDERKAGWR
FT                   PGGLQQTAFNAINQRLYVAMHQGSDGSHKDPATEVWVFDTVSKKRVARWKLAAQKIPPL
FT                   LSIQVSADDKPLFYGLTPTSDFVVMDAATGKLRHVDKQLGTTSTLILNP"
FT   sig_peptide     complement(398076..398168)
FT                   /locus_tag="BC1003_3872"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.421 at
FT                   residue 31"
FT   gene            complement(398358..399296)
FT                   /locus_tag="BC1003_3873"
FT   CDS_pept        complement(398358..399296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3873"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bph:Bphy_4195 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3873"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59812"
FT                   /db_xref="GOA:E1TJR5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJR5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN59812.1"
FT                   /translation="MYATYQTFEDADRHAYSLSGWDQQYDQVGEGSFRSSVKQVVTEAV
FT                   QVFQEAANVRVVQRGQLPPGRASFGLMLGGAAPFSFQGVKVDESALILGGGGKEFVLHS
FT                   PAQMSLVGVAIDMALLETVADLEGFDLQPDVLAQQVLSIPSAARARAGRRIVAAVEAAL
FT                   AQPASFDAPAQKQFAHDVTGCIVDLLAFHVPNREDRLTYACRADIVRRSHELLLAQPEQ
FT                   PLSIMDLCMSLRVSRRTIQNSFQSVTQMNPVAYLRAVRLAHVRRLLTSTAQRDVSVREA
FT                   ALRWGFSNLGHFASDYKSHFGELPSQTPRAR"
FT   gene            399686..401044
FT                   /locus_tag="BC1003_3874"
FT   CDS_pept        399686..401044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3874"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcj:BCAM2113 major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3874"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59813"
FT                   /db_xref="GOA:E1TJR6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJR6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59813.1"
FT                   /translation="MNPDAVNPNLSAPPISARPVSRNQSGVRRAVTTAVLGQILEWYDF
FT                   FLYGTAAALVFGKLFFPVGSDPLTGTIAAFGGFTVGFIARPIGGVLCGHIGDRYGRKTV
FT                   MMLTLLTMGCATVLMGVLPTYQQIGIAAPVMLVLLRILQGLAAGGEWSGSILLIHENAP
FT                   QSRRGALAAWSPCGAALGFVLSTGAFLLAQNLPPAAFQSWGWRVPFLGSAALVILGLWM
FT                   RRSVGESAAFAEVKATRHESRMPVIEVLKQCPREVLTVFGLRFGEGAASYIFFAFSIAY
FT                   AQFLGIKSSWVLSGLTISMLLMIPVSLFFGHVTDKVGRKPVYLAGAIAIVLVAWPYFAL
FT                   LGSGEYWKVLAALILANSITLGILEGAQPAFISEMLPVHLRFSGLGIGREVSSVLGGGL
FT                   SPMIATALLAHYRSAAPVAIYLGVLGLITVIATLLARETFPRAMRAAARQQAE"
FT   gene            401080..402273
FT                   /locus_tag="BC1003_3875"
FT   CDS_pept        401080..402273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3875"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   bcj:BCAM2114 putative hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3875"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59814"
FT                   /db_xref="GOA:E1TJR7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJR7"
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /protein_id="ADN59814.1"
FT                   /translation="MQEATQTASIVDSQNDYPEYAGPLSLDTLIDEVERRRDEFDAISH
FT                   VPRDMVGKMKRAGIFRASTPKRFGGDALPPPRFLEILERIAIADGSTAWVAAFGSANTY
FT                   LAALPLETQARIYASGPDQVFAGGLYPLQTAQRAPGGFLVSGQWRFASGCKGADWIGVG
FT                   IGGAPASEAGKDAGKPFTAVFPASEVEIVENWNVVGMQGTGSHDLRLHDKFVDEQWTFV
FT                   RGGTAVIDEPLYRYPAVAYQAQVHAAVNVGLARAALDMLASMSGVTKTTTGAPRLADRA
FT                   YYRSGLAQAEAQLRSARAFFFESAEASWRTVVAGDPVLPAQANLLRLSATHAAHTCADI
FT                   VMQAYKMAGIGAIYRESRMQRLVRDSIVVTQHAFLGEGTYDASGAVFVGIPPVTPYP"
FT   gene            402289..402972
FT                   /locus_tag="BC1003_3876"
FT   CDS_pept        402289..402972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3876"
FT                   /product="Ethyl tert-butyl ether degradation EthD"
FT                   /note="PFAM: Ethyl tert-butyl ether degradation EthD; KEGG:
FT                   bcj:BCAM2116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3876"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59815"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJR8"
FT                   /inference="protein motif:PFAM:PF07110"
FT                   /protein_id="ADN59815.1"
FT                   /translation="MQVCLFLIGESGTRAPLDARALQHAASNVDGLAQLIVHEAIAAQV
FT                   DPRIAEDADTPSCVLQWYFADLALLEAACERGGAIQRALQTACAARISSQQVMAVRSLK
FT                   ASTETVPERCTYLVAYEGAAADFNAWLTHYLQHHPPLMLQLPGLRELEVYTRIDCTSGL
FT                   PFARSNAMQRNKVVFDDPGSLAGALASPVRDAMRRDFHALPPYTGATPHFAMRSIYGTL
FT                   AHQHH"
FT   gene            403031..403951
FT                   /locus_tag="BC1003_3877"
FT   CDS_pept        403031..403951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3877"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bcj:BCAM2117 LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3877"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59816"
FT                   /db_xref="GOA:E1TJR9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJR9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN59816.1"
FT                   /translation="MNKPHPGIADLNLLRVFLAIWDLRSLTAAGDRLGLTQPAVSHALR
FT                   RLRNLFEDPLFLRTPGGMVPTDAAYRLYPPLAQALAIINDAMQQLARFDPATAQRVFRV
FT                   SMSDMSEFYFLPPLVAMLDREARGIRIEVANLPVESVSAAMRAGEVDLALGYVPGLDEG
FT                   CVSQTLFVDEHVCLVRAGHPLRKTKPTREDLSALRYVYASTNATGHRMVEQWLDELDFK
FT                   RDVVLRLPHFVVAPEIVMNTDLAVIFPESIARRFNRGKAFRVLPLPFSLPPIEIKVHSH
FT                   TQFAADPGIAWLRQSLVALFHQPEA"
FT   gene            404117..405424
FT                   /locus_tag="BC1003_3878"
FT   CDS_pept        404117..405424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3878"
FT                   /product="general substrate transporter"
FT                   /note="KEGG: general substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3878"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59817"
FT                   /db_xref="GOA:E1TJS0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJS0"
FT                   /inference="similar to AA sequence:KEGG:BC1002_5116"
FT                   /protein_id="ADN59817.1"
FT                   /translation="MSTVQTSPAAERNTATPDRALKRIVIASVAGNAMEWYDFFVYGTA
FT                   AALVFGQLFFPANADPLIGTLGAFAAFAMGFVARPLGGVVFGHIGDRYGRRASLVWTLL
FT                   IMGFATFGIGLLPTYDHVGLWAPAALVALRLLQGIASGGEWGGGVLMISESAPPEKRGY
FT                   YAAWSQLGVGGGFVLSSAAFLAVQALPHDQFVSWGWRLPFLASILIFALGVYIRRNLPE
FT                   SRDFENADKAGRTSHMPVVEVIKRHPKEILMAMGLRVAENGGAYIFLAFSLVYGKYAGI
FT                   PNSTMLTGVMLAMVVEMIAMLCWGKLSDRIGRKPVYMIGAVSLMAMAFPFFWLLNTHST
FT                   PLIWLALVLGTAVCHGAMIGTLPSLVGELFSTEVRYSGVALGHEVASIFAGGLSPLIAT
FT                   ALLSHYHAYWPVAVFLMALGLVTVVTLKFTHETRQQ"
FT   gene            405579..406547
FT                   /locus_tag="BC1003_3879"
FT   CDS_pept        405579..406547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3879"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3879"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59818"
FT                   /db_xref="GOA:E1TJS1"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJS1"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADN59818.1"
FT                   /translation="MEASVLKVRVDAVREEAHGVRSFSVSRLDGLPFERYEPGAHIDVT
FT                   SPSGVTRQYSLCGDPECLDTQTFAVKKEQQSRGGSRSLHEDVGVGTELSVGAPRNLFRL
FT                   VEGADEHVLIGAGIGITPLLSMAYRLAARKAHFTLHYFARSESHAAFMTLFTRAPFDAH
FT                   VKLHFGVERDALPDALDACLRDASDNAHVYTCGPAPFMDLVVETAQKRLPAESIHLERF
FT                   KAEPAPATETSLDSFDVQLASTGQTVHVDAKTSIVDALASIGIEVDTSCGEGVCGTCMV
FT                   DVVSGEPEHRDHCLSKAERASNSVICCCVSRSRSPVLVLDL"
FT   gene            complement(406551..407471)
FT                   /locus_tag="BC1003_3880"
FT   CDS_pept        complement(406551..407471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3880"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3880"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59819"
FT                   /db_xref="GOA:E1TJS2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJS2"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADN59819.1"
FT                   /translation="MTSIDHIDLNLLRVFQAIVEERSLTRAGERLALSQPAVSYSLGRL
FT                   RTLFDDTLFIRTRAGMQPTPVALELAEIVGRALDTVRQALRYAERFDPLTSTRTFRLSL
FT                   SDAGEMAYLPALCAALQDAAPRVKLFVEPLPVAEIEEALRSSRLDFAIGNLPSLLPRTR
FT                   HSLLFEESYVCMTRKRRDLPAGNTLELEQFLAASHVQVRSLEHSHHALDDALRAQGVGR
FT                   NISLALPHFVALPGVLAATDLLATLPERLAHILNRGNAFRVYSLPVQLPKAAVTMHWHE
FT                   HFHEDEGIAWMRGLISGILADFTKA"
FT   gene            407643..408926
FT                   /locus_tag="BC1003_3881"
FT   CDS_pept        407643..408926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3881"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain;
FT                   Aromatic-ring-hydroxylating dioxygenase, alpha
FT                   subunit-like; KEGG: Rieske (2Fe-2S) iron-sulfur domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3881"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59820"
FT                   /db_xref="GOA:E1TJS3"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJS3"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADN59820.1"
FT                   /translation="MSTPTYQTIDTSALAKRAGSDRIAPSLYYDPQLFEEELERIFYKT
FT                   WIWVAHESELPKPGDFVTTTIGRQPVIVVRDKAGTVNVLQNRCRHRGATVCEEHKGNAK
FT                   GFTCPYHSWSYALDGTLRALPYGDGYEGVCEKGDLPLKKLRVGVYQGLIFASFNESIES
FT                   LEDFLGGAKPWIDLFMKQGAGYPIKANGEHKFKFKGNWKIQLENTTDLYHFPVVHKSWM
FT                   KSIDEETAAAITSFMTSEDAFCRSLGNGHSLAVLMPEIVDLDQDDGAPLPERFSELAAQ
FT                   LAQKHTPQEVRRIVRSLMGVGFNLNLFPNLALSMAFFRVLRPISAEETEIRHVALAMDG
FT                   GPDEANRVRLRIHEHFQGPFGFGSPDDAEAWERVQRGSYAGPDVPILVNRGLNRETTAA
FT                   NGEKTAHATDETGMREAYRQWRVMMEQA"
FT   gene            408937..409437
FT                   /locus_tag="BC1003_3882"
FT   CDS_pept        408937..409437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3882"
FT                   /product="aromatic-ring-hydroxylating dioxygenase beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase beta
FT                   subunit; KEGG: aromatic-ring-hydroxylating dioxygenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3882"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59821"
FT                   /db_xref="GOA:E1TJS4"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJS4"
FT                   /inference="protein motif:PFAM:PF00866"
FT                   /protein_id="ADN59821.1"
FT                   /translation="MMDDRNVLLSDQTFARAIEFIWHEAELLDRRDYHAWLDLWDSKGM
FT                   YVVPIDPNTTDYAATLNYAFDDHHMRELRVQRMTSGYSASASDAARTVRTVSRFTRSSD
FT                   SADIVEVNSSQIIIAYKRGVSTIFAADLTHKISMKNGEPRLVEKVIRLINSTEALNAIG
FT                   FLL"
FT   gene            409493..409867
FT                   /locus_tag="BC1003_3883"
FT   CDS_pept        409493..409867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3883"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bmj:BMULJ_03435 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3883"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59822"
FT                   /db_xref="GOA:E1TJS5"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJS5"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ADN59822.1"
FT                   /translation="MPTLEVYLPHGHADDCKASLIQGLTQATVDAIGAPAESVRILLSE
FT                   LPASNIGLGGKLTPAALPVIIAILIAGRTHPQKEALIARLSETSAAVLNVPLESTRVMI
FT                   KDIPNTDFGLGGKTARALGR"
FT   gene            410064..411221
FT                   /locus_tag="BC1003_3884"
FT   CDS_pept        410064..411221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3884"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   acyl-CoA dehydrogenase type 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3884"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59823"
FT                   /db_xref="GOA:E1TJS6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJS6"
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /protein_id="ADN59823.1"
FT                   /translation="MSLAATLEPQHCPFAFDDVIEEIAQRREEFERLSHVPRDVVEKLK
FT                   QIGIYRAATPKRFGGDALAPGEFLALIERIATADGSAAWVASFGSANIYLAALPLATQA
FT                   EIYADGPDQVFAGGLFPVQQATLEANGYRVDGTWKFASGCKGADWLGVGISAGGTPGEA
FT                   PGKPRTAVFRPQQVEIVENWNVVGMQGTGSHDLRVKNQWVPQEWTFVRGGTPTVDEPLY
FT                   RYPTIAYAAQVLAVVNLGLARAALDVANNMAGGRKTTTGAPQLADRAYYRIELAKAEAQ
FT                   LRSARAFFYESTDSVWQSILAGNDVTPEQVSLLRLCATQIAREGADVVNRAYRLGGTMA
FT                   IYRNHPLQRLVRDAMVVTQHAFLGEGNYDGAGAVFVGVQPIPGYL"
FT   gene            411255..411632
FT                   /locus_tag="BC1003_3885"
FT   CDS_pept        411255..411632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3885"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3885"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59824"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJS7"
FT                   /inference="similar to AA sequence:KEGG:BC1002_5125"
FT                   /protein_id="ADN59824.1"
FT                   /translation="MTDTRNLPLRVLFCCGVTQNFFDLPREQIGEVWQAYGKMLNAIEA
FT                   MPNVRVLGVMDDDRLVVGNADGAPWTFYIMADVADFDTAVAVCNLYRTTPVGQYNLWRY
FT                   GKIEARVGRALTVPPVAVTNA"
FT   gene            411625..412152
FT                   /locus_tag="BC1003_3886"
FT   CDS_pept        411625..412152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3886"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3886"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59825"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJS8"
FT                   /inference="similar to AA sequence:KEGG:BC1002_5126"
FT                   /protein_id="ADN59825.1"
FT                   /translation="MREAMSNEIMERLQARLRSLEAQNAVRKTVARYMALCDVPARMFE
FT                   GESLAALFSEDAVWEGIGPQYANRFGRLQGPSDIVAMLQRYLPPTPHFSTNVHFLTSEH
FT                   IEVHGNTAQGRWIMLQASAYVDAGAELIAARLEIDFRPSSSDEDVWLIQHFRTERLFDA
FT                   PWHVNPAQGVRA"
FT   gene            412149..413291
FT                   /locus_tag="BC1003_3887"
FT   CDS_pept        412149..413291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3887"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3887"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59826"
FT                   /db_xref="GOA:E1TJS9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJS9"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADN59826.1"
FT                   /translation="MSAFLQEFDLVAHARADAPTIAIKDSIDIAGYATTAASRALADAP
FT                   PATRHADVVQRLLDAGWRITGKTNMHELAFGMTGINDFCGTPRNPQDAARIPGGSSSGS
FT                   ASAVGLRLVDAALGTDTGGSVRGPAACCGVIGLKPTFGRVSREGVAPRITTLDCVGPFA
FT                   RDMNTIVDVMQAIDPSFQHNRARGDAANLRIAMPDVEADDAIRNAVAAAVVRSGLSSRN
FT                   VRLAAMRDAFTAGLAVINAETWRAFGHLVDSGKLGADIEARLRTAANTTASDLDSAERI
FT                   RRAFTDEVDSVLQHADVLVLPTMPSVPITIEAARAGNSVIAMSSLIRPFNLSGHPALTL
FT                   PVSIEGTSLKAGLQIVGRKGEDETVCAVAAHIEAMLASNA"
FT   gene            413307..414050
FT                   /locus_tag="BC1003_3888"
FT   CDS_pept        413307..414050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3888"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3888"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59827"
FT                   /db_xref="GOA:E1TJT0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJT0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59827.1"
FT                   /translation="MAKRVVLVTGAARGLGEAVARRFHDAGYKVALGDIAVDAAHALAR
FT                   ELSRDGSSAFAIKLDVTSKADFDAARDALLERWGAIDALVNNAGASKVVPVMEITAEQF
FT                   DEVIGINLRSVLFGCQVFGQYFATQGAGRIVNIASLAGQNGGSATGAHYAAAKGGAITL
FT                   TKVFARDLAAHGVTVNAISPGPLDLPIVHESVPPDRLKNVIAGIPVGRLGSASYVAEVA
FT                   VMLASADAYFANGACWDINGGLFMR"
FT   gene            414207..414752
FT                   /locus_tag="BC1003_3889"
FT   CDS_pept        414207..414752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3889"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase, reductase
FT                   subunit"
FT                   /note="KEGG: 4-hydroxyphenylacetate 3-monooxygenase,
FT                   reductase subunit; TIGRFAM: 4-hydroxyphenylacetate
FT                   3-monooxygenase, reductase subunit; PFAM: flavin reductase
FT                   domain protein FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3889"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59828"
FT                   /db_xref="GOA:E1TJT1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR011982"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJT1"
FT                   /inference="protein motif:TFAM:TIGR02296"
FT                   /protein_id="ADN59828.1"
FT                   /translation="MSTESTPVHTGIDPLRQQFRQAMAHLGAAVNVITTAGVHGRCGIT
FT                   ASAVCSVTDTPPTLLVCLNRSSAMHAVFDGNRNVCVNVLPASLENIARHFAGMTGLSME
FT                   ERFQLPVWDEGDNGVPVLRGALASLQGTIVEAKDVGSHAVMFVETHEIRVRSDGDSLIY
FT                   FDRNFHRVPRAWKAAAGQ"
FT   gene            complement(414804..416231)
FT                   /locus_tag="BC1003_3890"
FT   CDS_pept        complement(414804..416231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3890"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="KEGG: bph:Bphy_5776 PDZ/DHR/GLGF domain-containing
FT                   protein; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; SMART: PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3890"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59829"
FT                   /db_xref="GOA:E1TJT2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJT2"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADN59829.1"
FT                   /translation="MAAPIDFSAIVARYGPAVVHIRATVPFNAAAGGAPASALSADVIE
FT                   HDDPIVPFFRQAVPQSQDSQGVMPRAMSGVGSGFIVSPDGLILTTAHVIGEADEASVRL
FT                   TDRREFNAKVLAVDPQSDIAMLQIDAANLPTVRLGDASRVRVGEQVLTIGSPDSYQNTV
FT                   TAGIVSATSRTLADGSTFPFFQTDVSLNPDNSGGPVFNRAGEVVGIDVQVYADSDRLQS
FT                   LTFAIPINMADKLRSQLQEQAQQVQQAQRVEESEAAPQGSQGLAHGNLGVQTQDVDANL
FT                   ASAFGLPSAAGALVTAVEPGSPAAASNLKTGDVIVQLADRPIDHAADLSAHNLDLQIRR
FT                   SVPLRLIRERKQMTVMVNTGPTSQQVNAAAGGVAGPRSEAGARQRHGLDRLGLAMHPLT
FT                   DDERRTLDLPQGLMVDQVSGTAAAVGIKPGDVVLSLNGTLVASQDELASLAAGAGRQAA
FT                   LLVQRNHARRFVTVDLR"
FT   gene            complement(416833..418362)
FT                   /locus_tag="BC1003_3891"
FT   CDS_pept        complement(416833..418362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3891"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver; KEGG: rcu:RCOM_0237480 two component histidine
FT                   kinase, putative; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3891"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59830"
FT                   /db_xref="GOA:E1TJT3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJT3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADN59830.1"
FT                   /translation="MSQNDNRQDATRETEEQFRILVQGVTDYAIFMLSPAGVVTSWNVG
FT                   AERIKGYRQAEIVGEHFSRFYSDEDKAAGVPALILATAAKEGRAEREGWRVRKDGSRFW
FT                   AHVVVDAIRDEAGSLLGFAKVTRDITERKQAAAALEKANAALFQAQKMEAIGRLTGGVA
FT                   HDFNNLLAVLSNGLEVLAIQSRTPIERKMIEGMRRAIDRGASLTQQLLSFARQQPLQAQ
FT                   VHDLNALIREFAPMLSRARNRNTKVELALQPGDTFALVDAARFEAALLNLVVNAVDAMP
FT                   TGGTVTIGTRTVQSDADLPPGLAGGRYVRISVVDTGTGMPADVLAQAFEPFFTTKQPGK
FT                   GTGLGLSQVYGFIAQSGGDVHLSSEVGKGTKVDLYLPLAQPEAAVSAPQVAKHETVLLV
FT                   DDEPDVLGVASELLMSIGYEVVPASSASEAAQILRERTDIAVVFTDITMAHGISGLELA
FT                   RLVRTEYPAIRVVLTSGYSAAPLRDERNGLGDVIFVQKPYRLADLAKALRA"
FT   gene            complement(418508..418882)
FT                   /locus_tag="BC1003_3892"
FT   CDS_pept        complement(418508..418882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3892"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: ppf:Pput_5150 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3892"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59831"
FT                   /db_xref="GOA:E1TJT4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJT4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN59831.1"
FT                   /translation="MSFICIVDDDASVRNGIGNLLKSVGYTTMLFSSGEDFLASPLADD
FT                   ALCVLLDVRMQGMQGLEVQRRLKEQHRTIPVVFMSAHGEEETVRRALRDGAVSFLRKPF
FT                   AEEALLDSIELAVEQRGKAG"
FT   gene            complement(419220..419699)
FT                   /locus_tag="BC1003_3893"
FT   CDS_pept        complement(419220..419699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3893"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3893"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59832"
FT                   /db_xref="GOA:E1TJT5"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJT5"
FT                   /inference="similar to AA sequence:KEGG:BC1002_5401"
FT                   /protein_id="ADN59832.1"
FT                   /translation="MRYLDESPRDINRRDWRPVHGADISYATGSGLSRASAAEVAKSPV
FT                   PGRWTRRVVIATGVWSVLELPFELWISTSARDALALVTAKLLWLALVGFVLTGHRVARI
FT                   AYGLLCTIGLIAMAFALPAEYRLFPLGFALTSVECVLKATAFVCLVCAGVESDET"
FT   gene            420004..422352
FT                   /locus_tag="BC1003_3894"
FT   CDS_pept        420004..422352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3894"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="KEGG: bph:Bphy_5698 oxidoreductase alpha
FT                   (molybdopterin) subunit; TIGRFAM: oxidoreductase alpha
FT                   (molybdopterin) subunit; PFAM: molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3894"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59833"
FT                   /db_xref="GOA:E1TJT6"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJT6"
FT                   /inference="protein motif:TFAM:TIGR01701"
FT                   /protein_id="ADN59833.1"
FT                   /translation="MAKKTIRIYSDPAGGWGALKATGEALALQGVAVSGAKTLLHMNQP
FT                   EGFDCPGCAWPDPKHTSSFEFCENGAKAVAWEATVNRCTPEFFAQHSVSELAAWDDYDL
FT                   EMAGRLTHPMVYDAASDRYVPIGWDDAFALIATHLNALESPDQADFYTSGRASNEAAFL
FT                   YQIFVREFGTNNFPDCSNMCHEATSVGLPESIGVGKGTVLLEDFAQADAIFIFGQNPGT
FT                   NSPRMMSDLHSASRRGASIVSFNPFRERALERFAAPQDPVEMATLGSTKISSFLYQVRV
FT                   GGDAAVLKGMMKAVMEADDAALAANRPRVLDIAFIEEHTHGIEALFADLRATSWDAIVQ
FT                   QSGLARADIENAAKLYMQANNAILVYGMGLTQHRRGTETVQQVANLALLRGNIGRPGAG
FT                   VCPVRGHSNVQGNRTVGITEKPSPALIDGIERAFGFRPPATHGHDVIGTIESMMRGEAK
FT                   VFVALGGNFAAAVPDWIRVQAAMRKLDLTVHIATKLNRSHLVHGKNALILPCLGRTEID
FT                   IQADGPQSITVEDSMSMVHASAGRNEPASPHLRSEPAIVAGIARATLGSRSHVDWEHLV
FT                   ASYDRIRDKIETVYPIFDAYNERIRVPGGFHLASSARERVWATPTGRANFIVFEGLDED
FT                   PHEHDPDALWLTTMRSHDQYNTTLYSHSDRYRGVFGQRDVVFMNARELHKRGLQAGDRV
FT                   DIHTLASDGMERVIRNFKAIEFSLPDGCCGAYYPEANPLVPLYAFDPKSRTPSYKSVPV
FT                   KIARAATPAADTPRKPATAAATGAQHASE"
FT   gene            422339..423736
FT                   /locus_tag="BC1003_3895"
FT   CDS_pept        422339..423736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3895"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bph:Bphy_5697 cytochrome bd ubiquinol oxidase subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3895"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59834"
FT                   /db_xref="GOA:E1TJT7"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJT7"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ADN59834.1"
FT                   /translation="MHLNDVLDLSRAQFAMTAIFHILWPILTISLSAFLVLIEVLWLRS
FT                   GNVVYYRHARFWSKLLVLNFAVGVVSGIPMEFQFGTNWAGFSRYSGEFFGNILGFEGAM
FT                   AFMLEAGFIGVMLLGWARVPRGVHLFATCMVALGSSISAFWIMVANSWMQTPAGITVQH
FT                   GKIVVTDYTAAIFNPDMVWGVTHMWVAAIETGMFVIAGISAWNMLKRRHPEFFVRSFKI
FT                   ALLVLVFVAPLQIWLGDSSGGSVFATQPAKGAAIEGHWTTNKPGTAASWSLLAWPNQKA
FT                   QRNDWSIEVPGMLSILATHTLHGEVKGLSEFKPADQPPMLPLLYYSFRVMAGIGFAFML
FT                   LAFWTALVLRRTRANLERLLEQRKLLIAWVLCIPLPYVAVEAGWIVREVGRQPWVVYGL
FT                   LRTQDAVSSVAASSVTFSMAMFFAFYVVLLGTFFVLARAWLRAGPDLSLNPPAPVKAEA
FT                   QAAVTEY"
FT   gene            423761..424750
FT                   /locus_tag="BC1003_3896"
FT   CDS_pept        423761..424750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3896"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="KEGG: bph:Bphy_5696 cytochrome d ubiquinol oxidase,
FT                   subunit II; TIGRFAM: cytochrome d ubiquinol oxidase,
FT                   subunit II; PFAM: cytochrome bd ubiquinol oxidase subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3896"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59835"
FT                   /db_xref="GOA:E1TJT8"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJT8"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ADN59835.1"
FT                   /translation="MDSSTHAMLAITWFGLIGLMLAFYVITDGFDLGIGILSLLRKRRE
FT                   DHDVMVQTIGHVWDANETWLVVLGGALFGAFPLAYALLLQDLYLPVMLLIAGLIMRGAA
FT                   IEFRHSVSHGPLWDKVFGIGSLVAALAQGVILGKLITGLAPGAMSGVFVAVSAIGVVAG
FT                   YALLGATYLAKKTVGSLEQWSRRLALLSAFITVAAAVVLTAATWFISEVGHDRWTQPGV
FT                   FHLLSALGVAAALAFAFIMGSLYLGSSNGPFRASVALFLLSFAGLAVSLFPYFVPGKLK
FT                   VIEAASDTPTLVFMLIGIGLIFPVMIGYNLYQYYIFRGKVGAAAHQEG"
FT   gene            complement(424921..425334)
FT                   /locus_tag="BC1003_3897"
FT   CDS_pept        complement(424921..425334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3897"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3897"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59836"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJT9"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_3763"
FT                   /protein_id="ADN59836.1"
FT                   /translation="MLTKAGGNDPWQQTLGLLSTLSGGASRGVGEIAAPSQRASRSGAR
FT                   LTGFSHRSDVQIQVIDRPSRTTATVIWRDSTHCSYGDQTWHASRARNAGVCAMSGRAIQ
FT                   RGDAIYKPRPCRPAPLNAGAMILGSVMNEAAPA"
FT   gene            complement(425444..426400)
FT                   /locus_tag="BC1003_3898"
FT   CDS_pept        complement(425444..426400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3898"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bph:Bphy_5694 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3898"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59837"
FT                   /db_xref="GOA:E1TJU0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJU0"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN59837.1"
FT                   /translation="MTSSSTSYPEPTVAFARRSQLSRIGVEHQWRCPREDALNAQEPGG
FT                   ILVSRWTRHDVQPFEVANPGSARHHCIAMNLKGTSLQFVHAGRTLVRGRVTAGAVQITA
FT                   PEVPCSATFEAPGDVLHLFVSQQVLSECFEDTFGRPHGGEIRLDAPGIVCDPALERLAQ
FT                   ALAVSQSDDAALGKVFTDGVSLAIVSRVIARHFSLPQRQRREASPLPPWRLSRALEFVE
FT                   AHLAESIGLEDIANSTGLTRMHFASQFRRATGMRPHEYLLRRRIEHAQQLLRESKHNVF
FT                   DVALSCGFRSQAHFTTVFKRFVGQTPHCWKMKANAGQ"
FT   gene            complement(426919..427596)
FT                   /locus_tag="BC1003_3899"
FT   CDS_pept        complement(426919..427596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3899"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bph:Bphy_5693 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3899"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59838"
FT                   /db_xref="GOA:E1TJU1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJU1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN59838.1"
FT                   /translation="MSSSSHVEEGAGAMVYVVDDDESMRDALRTLLRSVGLNVQTFGSA
FT                   QEFLSIDMPDVPSCLILDVRLKGQSGLAVQEQITASQLGLPIVFMTGHGDIAMTVKAMK
FT                   AGATDFLAKPFRDQDMLDAVEQALASDAQRRAASRSVADLRRCYESLTPREREVMAFVA
FT                   AGLMNKQIAGELNLSEITVKIHRGQAMRKMGARSLADFVRKAETLGLDLPRRTEAAARR
FT                   SDA"
FT   gene            complement(427586..429436)
FT                   /locus_tag="BC1003_3900"
FT   CDS_pept        complement(427586..429436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3900"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold-3 domain protein;
FT                   PAS fold domain protein; histidine kinase A domain protein;
FT                   KEGG: bph:Bphy_5692 multi-sensor signal transduction
FT                   histidine kinase; SMART: ATP-binding region ATPase domain
FT                   protein; PAS domain containing protein; PAC
FT                   repeat-containing protein; histidine kinase A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3900"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59839"
FT                   /db_xref="GOA:E1TJU2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJU2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADN59839.1"
FT                   /translation="MRRPVDPLVVKTSVHPTLALPLERNVLLSLAAVISVCVFVLDALT
FT                   PLDIAVAVFYVVAVLLVASTGERSSTVAAAWGCVVLTLLGFVISHDDSYSSGAIARCVV
FT                   SLLAIATTSILALRIQAATATLREQVELLNLAHDAIVVHDMNDRITFWNHGAQALYGWS
FT                   AQEALGQSLQELTQTSYPVPDEQVRSELLRADRWHGELQRVRNDGSVVVIASRAALLRD
FT                   EKGNPRAVLATNNDITDRKRAEQALERSEAFLRDAQQLSRTGSIAMRFPAGEMWWSDEA
FT                   YRILGYTRDTRPSIDALLARVHPDDLALVRSAFQHTVGAEPLVDIEHRLTMPDGSIKHV
FT                   HCVAHLAATRSGHKEYVAALMDITDMKRAQEALARTNDELAHVTRITLLGELAASIAHE
FT                   VAQPIAAIAACGSAALRWLNRPTPELEEAAQSLRQIVRDAKRADDVIQKIRSMARKRER
FT                   RPTAVDLDAVIVESIELVQRELQRNRIEPELDLAEPPLAACCDRVQLQQVMINLIMNGV
FT                   QAMAEVAGPRRLSIATRRLDDAQVHVIVQDCGTGISEENAARLFNTFFTTKPEGMGMGL
FT                   SICRSIVEAHGGRIWAEPRAGGGAVFQFVLPIDKGECHEQ"
FT   gene            complement(429846..430286)
FT                   /locus_tag="BC1003_3901"
FT   CDS_pept        complement(429846..430286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3901"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bxe:Bxe_B2373
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3901"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59840"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJU3"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ADN59840.1"
FT                   /translation="MMKAKWAIVLMAVSALGVVSQQASAQVAGAQPIGISVEQTALVVE
FT                   GWSVKKSLLGKSIYNDEGQKVGVLHDIIIAPDNAVSFGIVAAHQFLGVSHHDVAIPMSQ
FT                   LDYVNGKLVWPGATREAVKAIPAFQYAKVRTVPIARKDFGHH"
FT   sig_peptide     complement(430209..430286)
FT                   /locus_tag="BC1003_3901"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 26"
FT   gene            complement(430477..431436)
FT                   /locus_tag="BC1003_3902"
FT   CDS_pept        complement(430477..431436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3902"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   rme:Rmet_4276 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3902"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59841"
FT                   /db_xref="GOA:E1TJU4"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJU4"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADN59841.1"
FT                   /translation="MKTQSILRAAFTLTLLVVAIVLVRLLWLEYMYSPWTRDGRVRAKV
FT                   VQVATDVSGLVSEVRVADNQWVRKGDVLFVLDPARFHYALAQADADLARAQAQMAQAKA
FT                   RMAASAADLAMKRAQAARRANLAGDVISDESRLDSASLASQAASDHSADVAAYSAAEAA
FT                   VKAAVVAQQTAALNLARSEVRAPSDGFITNLNLYPGDFATAGSARMALIDSNSFWVYGY
FT                   FEETKLPRVHVGDRAVVRLLSGGADIEGHVDSLASGIADRDNPTSSGDLLADVNPVFTW
FT                   VRLAQRVPVRVHLDRIPAGVRLATGMTCTVTLRPRAAS"
FT   gene            complement(431501..431701)
FT                   /locus_tag="BC1003_3903"
FT   CDS_pept        complement(431501..431701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3903"
FT                   /product="protein of unknown function DUF1656"
FT                   /note="PFAM: protein of unknown function DUF1656; KEGG:
FT                   rme:Rmet_4277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3903"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59842"
FT                   /db_xref="GOA:E1TJU5"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJU5"
FT                   /inference="protein motif:PFAM:PF07869"
FT                   /protein_id="ADN59842.1"
FT                   /translation="MPGEMDIFSLLVPGLLPILVGCALLFVVLDLVLARFGFYRCTWHP
FT                   SLFRVALFAALFSGASLLLWQ"
FT   gene            complement(431691..433241)
FT                   /locus_tag="BC1003_3904"
FT   CDS_pept        complement(431691..433241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3904"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="KEGG: rme:Rmet_4278 RND efflux system, outer
FT                   membrane lipoprotein, NodT; TIGRFAM: RND efflux system,
FT                   outer membrane lipoprotein, NodT family; PFAM: outer
FT                   membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3904"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59843"
FT                   /db_xref="GOA:E1TJU6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJU6"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ADN59843.1"
FT                   /translation="MKQRFESSSSSSSSSWSMHRRTAWRPATAALASALLLCACIGDGG
FT                   IHTREAPLDAAALDPGVALRATQADAKWPAGGWWRQWNDPQLDQLVADATAGNPGLQAI
FT                   GQRIEVARFQAQIAGAAELPQLNASGSFERRRYARYTTPAPPGGTTVWSNSIEADLSYD
FT                   LDLWGKSRALREGALDNVRAAAADARFAQVELQTAVVRGYVQLSLAYALLDVQSAVQSQ
FT                   QQRTLDIAKRRFRAGVGSGLEVSQAESQLAMSTTRLQQAQQQIALARIGLAGLAGKGPG
FT                   YGDTLRRPGLALSVPVKLPATLPAELLGHRADVVANRWRVQEADKGIAAAHADFYPDIN
FT                   LVALASLGSAATFGGFLNFVDSNGVGHGVGAAISLPVFDGGRRRGNYGVAVASRDAAVD
FT                   AYNQSVVNALQGVAAQVVSLRSLEEQQASVESTLASTRKSFELADAGYRSGITEFLNVL
FT                   AAQNAQLEQQESLAAIQARRLDAWALLMKELGGGFQADELPELPDLPHDLPQGVANAR"
FT   gene            complement(433238..435499)
FT                   /locus_tag="BC1003_3905"
FT   CDS_pept        complement(433238..435499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3905"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: bph:Bphy_5713 fusaric acid resistance protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3905"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59844"
FT                   /db_xref="GOA:E1TJU7"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJU7"
FT                   /inference="protein motif:PFAM:PF04632"
FT                   /protein_id="ADN59844.1"
FT                   /translation="MTLQADTATATLPRWRSELNTYWSDDGPRFRHIAKVAIAMTLAMW
FT                   LCMRLELRTPATAMVSCVIVMMHQQSGMVIARGFYRGLGIVGGSFAGLVLIALFAQQPW
FT                   FFLSALAAWIGVCVFGAAYYRNFQSYGFVLTGYGTAITAIPVWSNPHAVYDNVVFTVSE
FT                   VVIGVVCASVVSAVLLPRPVVPELYASSRKSFTNLLNAMHALLERTATLADFDTFVALI
FT                   RERVGVETLRSGAVFEDPLIRLRNPIYVAFDRGFLDTVGWIHALQQLQARAAAQAHPRA
FT                   LAAVQELLGGLLAVVPNHAPAELVTIEQVKATASRLDAFEAALPAHLARLLQSLADLPP
FT                   HERQFVAATGAALLFSIDDLRRMCDSYVAARSIVRAPWSQSVLEAVARLGRARATRASA
FT                   NRAAATIAGARAAVAVLLVGAAWMASGWVGGATAIVAVAITSALFALAPNPIVASWQVF
FT                   GGCLAGWIAGFGFNFFVLPRIGTFELLAASMAIFVMVGSYVNTFAKTAILGLGFSLYFC
FT                   FIVAITNPTVYNPSGYLDTGFALLCGIAVAAVAFSVLVPRAGEWINAKYIGQIRALIAE
FT                   DARDGELDDLLYRFEAGVRDFMLEVAQAPVDRHLDRERLMAWAFAALEIGRSMILVRIH
FT                   TEQLAGPLRQARGEGHGQPGGENRAPLPPGWRAAQQAWLAALAEAFVAATPQAVDNARA
FT                   ATRRALALLPPEPGIAVGASTLARYRMRALLHLTELTLADDTLAVWRPAPIDPAKRAPA
FT                   "
FT   gene            complement(435734..437455)
FT                   /locus_tag="BC1003_3906"
FT   CDS_pept        complement(435734..437455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3906"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; thiamine pyrophosphate central
FT                   domain-containing protein; KEGG: bxe:Bxe_B2374 pyruvate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3906"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59845"
FT                   /db_xref="GOA:E1TJU8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJU8"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ADN59845.1"
FT                   /translation="MASNTIASYLAATLAAAGVERIWGVTGDSLNGLAYSLDQLGSIRW
FT                   MHTRHEEAAAFAAGADAASSGRLAVCAGSCGPGNLHLINGLFDCHRNHQPVLAIAAHIP
FT                   STEIGLGYFQETHPQELFKECSHYVEVVSSAAQFPRVLARAMRTAIEERGVAVIVLPGD
FT                   IALSEGPAEAPSWTESAPARILPAEEDLDRLAAVLNASDAITIMCGSGTQGAHDEVVAL
FT                   ADTLGAPIVHALRGKQFIEYDNPYDVGMTGLIGFSSGYHAMMSCDTLLLLGCDFPYRPF
FT                   YPTDAKIIQVDWKGSQLGHRAPLALGLVGTVKETVAATLPKLQRKTDRGFIDNARKHYA
FT                   SARKGLDDLATPAGPGRPIHPQYLARMIDEVASDDAIFTADVGTPTVWAARYLTMNGKR
FT                   QLHGSFNHGSMANAMPQALGAQGAHPGRQVVSLSGDGGLSMLLGDLLTARQLDLPIKVV
FT                   VFNNSLLGFVSMELKAGGYLDTNVDLAKTDFAAIAKGAGIFSIRVEQSEDVAAALKQAF
FT                   DHPGPALVDVVTSKHELAMPPKIQLEQAKGFSLYMMRAILNGRGDEIVELARTNLR"
FT   gene            437951..438862
FT                   /locus_tag="BC1003_3907"
FT   CDS_pept        437951..438862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3907"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bph:Bphy_5702 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3907"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59846"
FT                   /db_xref="GOA:E1TJU9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJU9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN59846.1"
FT                   /translation="MDRIFSMRVFSRVAETGNFSAVAKHMDCSAGNISRAVVSLEEHLH
FT                   TRLLQRTTRSVSLTECGERYYRRCKKILAEIDEADAEASNAHMLPRGTLRVHAVPDIGL
FT                   KQLTSTIVEYRHAFPAVSIDLKLLPRMANLIEDEVDVSIISAASLPDSRNVSRLIGRCQ
FT                   RILVAAPSYLARHPVHSVDDLPNHTLMQSRSSFDPPTEWPAGDAAQAGHFVVNNMQALR
FT                   LALLEGAGVGAVPAYSVQDELKEGKLVQLFAHYPLEATNVFVVYPSRQFVDAKIKTFVD
FT                   HLIVSLKQKLDLRAEHATADIA"
FT   gene            complement(438906..439886)
FT                   /locus_tag="BC1003_3908"
FT   CDS_pept        complement(438906..439886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3908"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_B2390 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3908"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59847"
FT                   /db_xref="GOA:E1TJV0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJV0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN59847.1"
FT                   /translation="MAKMQSDVAFCATEQPVGSSMDKFLAVKTLLEVADAGGFSKAAQR
FT                   LGVATSSVTRLMDSLEASLGTALLTRTPRKVSLTDAGIAYVEQVSKVLDDLAEADDSVF
FT                   DSGASPVGALRIAVPSTYGRLCLAPHLAAFLAEHPRVFLDVVVSDHFVDLAVERIDVAV
FT                   RIGPAERDANLIVRKLADNPRHVVASREYLRRHGTPRTPAELAGHECLRFAYGGGYRSR
FT                   QVWTFQRDGEPQPVEVRGRLLSNSLDVLLEAALAGSGIALLPQWQVAAEVHAGRLMRLF
FT                   EPFDARPQAGDAVVYAAYLPNRRQSSKVRALLQFLEPRLQASCAG"
FT   gene            440027..441241
FT                   /locus_tag="BC1003_3909"
FT   CDS_pept        440027..441241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3909"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B2393 major facilitator superfamily drug efflux
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3909"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59848"
FT                   /db_xref="GOA:E1TJV1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJV1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59848.1"
FT                   /translation="MSTQLSAATRAGSPVKLTQSLIALFAFCCGAIVANLYYAQPITEL
FT                   IAPDIHMSGGTASLIVSLTQIGYAFGLFFLVPLGDLLENRKLMIVTALVSIASLTAAAF
FT                   AHQPSAFLVISLLIGFSSVAVQILIPLAAHLAPDESRGKVVGTIMSGLLLGILLARPVS
FT                   SVVAGHFGWRAVFGGAAVLMAIVTSVLALTIPRRRPDHRATYFELIASLGHLLRTMPIL
FT                   RHRSLYQALMFASFSLFWTAIPVELTRHFGLTQTQIGIFALVGAIGATSAPVAGRLADA
FT                   GHTVRATLIALVVGALAYTPALIHPAWGVVGLVVTGIVLDFAVQMNMVLGQREIYALHA
FT                   ASRNRLNALYMTSIFAGGALGSALASPLYEHGGWPLVAAIATAFPLIALAHYLMIGRPH
FT                   AARHG"
FT   gene            441419..442582
FT                   /locus_tag="BC1003_3910"
FT   CDS_pept        441419..442582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3910"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bcm:Bcenmc03_7019 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3910"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59849"
FT                   /db_xref="GOA:E1TJV2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJV2"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADN59849.1"
FT                   /translation="MSSLSPLLDGYDLSGLHLPNRVAMAPMTRSRAPSRGRPTELMARY
FT                   YAQRASAGLIVSEATNVNAASAAFDLTPGIFTAEQIEGWRTVTSHVHAEGGRIFMQLWH
FT                   SGRVSSFALLGGEAPLSPSGVNDDLEQLQVWAQLHNGQYTKIHATPSRAMSLDEIRLTI
FT                   DAFRQGAANAMAAGFDGVEVHAANGYLPHQFLSSTINTREDRYGGSVANRANFLRDIVE
FT                   QIGSVMPLERVGVRISPYAHYNNVRDADPDGTYDYVGRMLGEFGVAYVHAADTNGWSGK
FT                   PDLPRIIGRLRRAYPGTLMVNGGISVSAAEALIRDGQADLVAFARAYIANPDLVERIGN
FT                   GAPLAAPRTTGWYGGDAAGYVDYPFDGSASSHAPAAVAGLPARAGHA"
FT   gene            442650..443936
FT                   /locus_tag="BC1003_3911"
FT   CDS_pept        442650..443936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3911"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="KEGG: bpy:Bphyt_5504 gluconate 2-dehydrogenase
FT                   (acceptor); PFAM: cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3911"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59850"
FT                   /db_xref="GOA:E1TJV3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJV3"
FT                   /inference="protein motif:PRIAM:1.1.99.3"
FT                   /protein_id="ADN59850.1"
FT                   /translation="MTSKSRWLAAGGVVIAAALAAAFLLMWKPALAPISPPAPNAFDAA
FT                   TRLAGARVVALGDCVVCHTAKGGKPFAGGLPLATPFGTIYATNITPDVQTGIGNWSLEA
FT                   FTRALRYGVARDGHLLYPAFPYIHFTRMSDGDIAAAYAYLMTREPVEATAPANQLMFPL
FT                   NFRPLLAFWNVLFLHAGAQQPDASKDAEWNRGKLLVDGLGHCASCHSPLNAIGGEKSGH
FT                   AFDGGIVDGWEAPALNALGAAPRPWTRDQLVAYLRTGRASEHGAAAGPMLPVTRDLATV
FT                   PEADVQAIATYLLSIQKPRPAAAPDTASTREAPRSAEAQRGATLFAASCAQCHGPAAPM
FT                   QSIGERPTLAFSTAVNAATPRNAIQMMLSGNGWHGEDSMNYMPAFGQIYNDQQIADLAS
FT                   YIRAAYSQRGPWTDVEATVTRLRKENNAR"
FT   sig_peptide     442650..442712
FT                   /locus_tag="BC1003_3911"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.673 at
FT                   residue 21"
FT   gene            443933..444445
FT                   /locus_tag="BC1003_3912"
FT   CDS_pept        443933..444445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3912"
FT                   /product="(2Fe-2S)-binding domain-containing protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain-containing protein;
FT                   ferredoxin; KEGG: bpy:Bphyt_5505 (2Fe-2S)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3912"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59851"
FT                   /db_xref="GOA:E1TJV4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJV4"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADN59851.1"
FT                   /translation="MIHLTVNGVQRALDIDPSTPLLYALRNDLQLHGAKFGCGLGQCGA
FT                   CTVIVDGEAVFSCLVPVASLGNKAVRTIESLGTPEHPGPLQKSFIDHQAAQCGYCIAGM
FT                   IMRAQALLERNPRPTERELLEHMEPNLCRCGTHTRILAAIREVAHLPKPDASHDKARLA
FT                   ASHGGAQ"
FT   gene            444442..446754
FT                   /locus_tag="BC1003_3913"
FT   CDS_pept        444442..446754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3913"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bpy:Bphyt_5506 aldehyde
FT                   oxidase and xanthine dehydrogenase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3913"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59852"
FT                   /db_xref="GOA:E1TJV5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJV5"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ADN59852.1"
FT                   /translation="MSRSDEHTDQRTAPGLDQHVDDPVDESRRRFMLGSALLVSFSMFP
FT                   GVNALAQEVIADEGAAVHIGKATQALAGSLKTNPYLDSWIKIDRAGKVTVYTGKVELGT
FT                   GVRTALLQIAAEELAMAPGLITFLTADTGASPDEGLTAGSHTIADSGSALLNVSAQVRA
FT                   LLVEAAAKRFGIQSNLLSTRDSVIKAPDGRSMTYGEAVGFVDLHRMAAPVSPLKDPATF
FT                   SVIGTSLPRVDIPRKVTGGVSYVQDMLMPGMVHARVVMPPVYEARLLRTNTPGILKMPG
FT                   VLKVVQNGSMLAVVAKGEWQAVQAQRALAAGSEWSAGRALPDPATVHSDLRKLCTEHIE
FT                   IANTHTASGAAVKTLGATYTKRYMMHGSIGPSCAVGLFKDGAMTVWTHSQGVYPLRDGL
FT                   AEMLSMPKDTIRCIHVEGSGCYGHNGADDVAAHAALIAREMEGQPVRVQWMREQEHTWD
FT                   HYTPAMVTEVKASLDAGGNIVDWNYALWSSSHNERIVNAGRLIPAQLLDRPFAPAPSVP
FT                   MVQPEGGGDRNGIPLYALPNMQVMNNFSPTMPLHTSAMRSLGAHMNVFSIETFMDELAA
FT                   AAGADPVAFRLKHMQDPRARDVIRLAAEKFGWPRAPRKRNHGVGFGFAKYKNLMAYVAV
FT                   AVEVSVVPETGQVILEHAEAAVDAGQIVNPDGIRNQIEGGVIQSASWTLYEALQFDTSR
FT                   IRSFDWSSYPILRFSAAPRSINVHLIDRPGAPFLGAAEASMGPTAGALGNALFDATGQR
FT                   LRDMPLAGDSLRRRIDA"
FT   gene            446864..448423
FT                   /locus_tag="BC1003_3914"
FT   CDS_pept        446864..448423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3914"
FT                   /product="ABC-1 domain-containing protein"
FT                   /note="PFAM: ABC-1 domain-containing protein; KEGG:
FT                   bpy:Bphyt_4787 ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3914"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59853"
FT                   /db_xref="GOA:E1TJV6"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJV6"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ADN59853.1"
FT                   /translation="MPPLFRRLLLLYHALRYGARLIWLAAPPGRKLHWMIELVGRVHAS
FT                   PDSARSVHGVLPALGPLAGRFAKALLERPELASATLHDAIDAVDHLEAPLPPRESEAAL
FT                   ARAFGRPLATLFSAVDLIPVRSGFAEQTHIARLITPINGHREVAIKLLRAGQLQQIGDE
FT                   LALLRWVARWLEKLSGTARRLRLRALAQTFTDDLLRRFDLRAEAANLSQTGHHFEGDSR
FT                   LVVPNVIWDLCTNHTLTMQRIDTLPASDLRGLHAYGVKLAPLAAHIVEVVTEQAFEHGF
FT                   FHATLDARRVRVSIEADSLGRLVLAEFSIMSSLSTGEREFFVHGASALFEQDYGRLAQL
FT                   HREAGHVPHDTRAEMLEAELRTRAEAHFAAAPHERSAGALFHHLLHAVHPFDGAVSGRL
FT                   ATAQRSFQQAEMLARALHPGVDTWSIARRVVAEIARRDVDHRGWLKRISRELPHLAHML
FT                   PRVPQLAVRYLQHEHDRARTPGQQAQLLVKIGREYRRTRALLWACAVCGGILGAGTVLL
FT                   MR"
FT   gene            complement(448500..449294)
FT                   /locus_tag="BC1003_3915"
FT   CDS_pept        complement(448500..449294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3915"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3915"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59854"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJV7"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1988"
FT                   /protein_id="ADN59854.1"
FT                   /translation="MPDAAGVVDPRRALALRDLFASQVTRRLNVPAAEQRAYAARLQAA
FT                   LREHALGELSGEYVVMVDRNANAQALFIYFRATPADAWEMIGASPVSTGRPGEFDHFVT
FT                   PLGVFEHTPSNMDFRSEGTENQNHIRGYGKRDMRIFDLGWAQAERGWGKGGVSQMRFQM
FT                   HATDPDRLEPLLGVRHSKGCVRIPASLNTFLDHYGILDAEYAALVESGKSLWVLKSDRQ
FT                   ILPWAGRYIVVVDSERKTRPTWSPAPGAKAHARVPTGTDTAD"
FT   gene            449321..450115
FT                   /locus_tag="BC1003_3916"
FT   CDS_pept        449321..450115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3916"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dya:Dyak_GE21820 Salivary gland secretion 3"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3916"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59855"
FT                   /db_xref="UniProtKB/TrEMBL:E1TJV8"
FT                   /inference="similar to AA sequence:KEGG:Dyak_GE21820"
FT                   /protein_id="ADN59855.1"
FT                   /translation="MQRRMTPLTTPRQPATQQPMTPLTTPTPPRRPLSRPTPTARRTTS
FT                   RTAARRQTTPLTTWRQPLTPQTPTARRKASRAQTQHLAPERTRIPPPTTQRPIAQWPTT
FT                   QHRQQPPGCLLLTASPRGSHKPERRARRPKQSSRAPWHSRAWRGLVALPRPMDGTALRS
FT                   SISVGAADGTRAAACGSRAQRLVKELGAPAQAGEAARSSSSRVRTQMCLLFAARRLMRR
FT                   SEPEMLRSTSSSVDGASAGPPRARRPRQSLVRHRVHEQGAEP"
FT   gene            450112..450972
FT                   /locus_tag="BC1003_3917"
FT   CDS_pept        450112..450972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3917"
FT                   /product="NAD+ synthetase"
FT                   /note="TIGRFAM: NAD+ synthetase; KEGG: bpy:Bphyt_4784 NAD
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3917"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59856"
FT                   /db_xref="GOA:E1TK32"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK32"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ADN59856.1"
FT                   /translation="MKHTDPAAVQKDIAAEMHLTARFDANEEIERRVSFLADYLRSNGL
FT                   KTYVLGISGGVDSTTAGRLAQLAMERLRGDSYDAHFVAVRLPHGEQKDEADAQQALAFI
FT                   RADETLTIDIKPAADAMLASLRQSGLPFSDEAQEDFVHGNIKARQRMIAQYAVASTRAG
FT                   VVIGTDHAAESLMGFFTKFGDGGADVLPLAGLNKRRVRAVAKALGASDALAYKVPTADL
FT                   EALRPQRPDEDAYGVPYETIDDFLEGKPVSDEARNIILRFYTVTRHKRALPYTPFDWPA
FT                   PESGQ"
FT   gene            complement(451222..451488)
FT                   /locus_tag="BC1003_3918"
FT   CDS_pept        complement(451222..451488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3918"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3918"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59857"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK33"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3617"
FT                   /protein_id="ADN59857.1"
FT                   /translation="MNLIVRNIAPSCSEQEVREFLERELGHYARHVEVIDAGTPGAYAT
FT                   VELDAQVPYVGEVIARQIHGKHLGGVALEASADLFTDEPPPTQ"
FT   gene            complement(451494..451640)
FT                   /locus_tag="BC1003_3919"
FT   CDS_pept        complement(451494..451640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3919"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_4782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3919"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59858"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK34"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_4782"
FT                   /protein_id="ADN59858.1"
FT                   /translation="MIAFYLSLAALGAAGAALIRQLAAAQARQRAALRPVRVRANGRGS
FT                   RER"
FT   sig_peptide     complement(451563..451640)
FT                   /locus_tag="BC1003_3919"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.532 at
FT                   residue 26"
FT   gene            complement(451959..452324)
FT                   /locus_tag="BC1003_3920"
FT   CDS_pept        complement(451959..452324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3920"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3920"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59859"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK35"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1991"
FT                   /protein_id="ADN59859.1"
FT                   /translation="MIFSRVAAATLAALTLACAAGSSSAFAAAPIGCGKADALQIRGDV
FT                   PAAISFDVYRQLRPLNAQRIALFQSAGEVKHLPDGLAVCEVADDGVDDPSAVLVELPHG
FT                   KNAWWVSAANVQDLGAD"
FT   sig_peptide     complement(452241..452324)
FT                   /locus_tag="BC1003_3920"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(452778..453416)
FT                   /locus_tag="BC1003_3921"
FT   CDS_pept        complement(452778..453416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3921"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: bxe:Bxe_B1992 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3921"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59860"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK36"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1992"
FT                   /protein_id="ADN59860.1"
FT                   /translation="MKAGIADRRRSGCCGDPSGTMFPPHLRASAPLRVRHARVTLMLGL
FT                   TALIALRAGVAHAQDASMLDQRVTQQSIGETICRPGYASAVAPPFDELMARKDRMLAER
FT                   GIDADDAADFALDRRVPVVLGGSPDAPSNLGLLPWAGRQGERRKARAAVMLKRCVCEGK
FT                   LSLAEAQAAIVGDWSVVYSGFSQESCNISRLDVATSVDGGRKAGPGSSP"
FT   gene            complement(453614..455269)
FT                   /locus_tag="BC1003_3922"
FT   CDS_pept        complement(453614..455269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3922"
FT                   /product="peptidase S10 serine carboxypeptidase"
FT                   /note="PFAM: peptidase S10 serine carboxypeptidase; KEGG:
FT                   bxe:Bxe_B1993 carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3922"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59861"
FT                   /db_xref="GOA:E1TK37"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK37"
FT                   /inference="protein motif:PFAM:PF00450"
FT                   /protein_id="ADN59861.1"
FT                   /translation="MTSTEPASVSPQSPQDSEVSAKAAAGGGKHKAGDQPFFDPVAYGN
FT                   GPDDSVTATDENAAITHHSVTIDGKKINYTATVGHLVIVDPSSSEPAARMFYVAFTQDN
FT                   QKEETRPLTFFYNGGPGSSAVFVLLGSFGPRRIKTSMPNFTPPAPYTIEDNPDSLLDRS
FT                   DLIFINPVGTGYSAAIAPKKNRDFWGVDQDADSIAQFIKRFLTRNNRWNSPKYLFGESY
FT                   GTARSCVLAYRLHEGGVDLNGITLQSSILDYAQAGNPVGVLPTAAADAWYHKKLGIAPR
FT                   PTDLGEFAEEVAQFARTDYLAALRKFPTTDAATVEKLAEYTGIDKTTLLAWSLDIASYD
FT                   SRGNSLFLTTLLKPQGLVLGAYDGRVTAIGTGIAGKIDPNSGGNDPTMTAVSGVYTTMW
FT                   NVYLNEQLKYTSNSAFTDLNDQAFQFWDFSHIDPTGAQKGVDDKGNVILYTAGDLAAVM
FT                   ALNPDLKVLSANGFYDFVTPFYQTVLDLQQMPLLSQQVRQNLSARFYPSGHMIYLDGGS
FT                   RTALKADLAQMYDATVANTEALSRIRALQARVAQ"
FT   gene            complement(455357..456916)
FT                   /locus_tag="BC1003_3923"
FT   CDS_pept        complement(455357..456916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3923"
FT                   /product="Peptidase S53 propeptide"
FT                   /note="PFAM: Peptidase S53 propeptide; peptidase S8 and S53
FT                   subtilisin kexin sedolisin; KEGG: bpy:Bphyt_4778 peptidase
FT                   S53 propeptide"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3923"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59862"
FT                   /db_xref="GOA:E1TK38"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK38"
FT                   /inference="protein motif:PFAM:PF09286"
FT                   /protein_id="ADN59862.1"
FT                   /translation="MATKQPLPGSERTVEQGSKLIGACDPAEKLEVFVMLRRQQQAQFD
FT                   ALMSRIEAGDPNVKPLSREALAKDYGAAPEDLAKVKAFAAAHGLAVEREDPAARSVLLS
FT                   GTVAQFQSAFEVKLDKYQHHTAGEFRGRTGAVHVPDDLQDVVEAVLGLDNRPQARPHFR
FT                   IRPPFRPARTHQASFTPLELASLYNFPQGDGKGQCVGIIELGGGYDPADLKAYFASLGV
FT                   PSPTVKSVSVDQARNEPTGDPNGPDGEVTLDIEIVGAIAPGATIAVYFAPNSDAGFIDA
FT                   VSRAVHDTVNKPSVISISWGGPESIWTSQSLKAFNSVLQTAAALGVTVCAASGDSGSSD
FT                   GAGSGDQVDFPAASPYVLACGGTSLSASGTAITHEVVWNDGPQGGAGGGGVSHAFALPA
FT                   WQEGLSVALTAGGKKPLTRRGVPDVAGDASPLTGYTVLVAGTQTVVGGTSAVAPLWAGL
FT                   IARINAAQGTPAGFVNPKLYKAAGVCNDITQGNNGSFAASGGWDACTGLGSPNGQKVAA
FT                   AL"
FT   gene            457220..457729
FT                   /locus_tag="BC1003_3924"
FT   CDS_pept        457220..457729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3924"
FT                   /product="Domain of unknown function DUF1993"
FT                   /note="PFAM: Domain of unknown function DUF1993; KEGG:
FT                   bxe:Bxe_B1995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3924"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59863"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK39"
FT                   /inference="protein motif:PFAM:PF09351"
FT                   /protein_id="ADN59863.1"
FT                   /translation="MSISMYQASLPVLIRGLTNLQAILGKAQAHAAAKQIEPSVFTNAR
FT                   LAPDMLPLVRQVYIASDTAKGCAARLAGVEAPRYEDVEQTFDELHARLQKTIDYLKEFS
FT                   PQQIDGSEERAVTLKMRNGAIEFTGQSYLLGFVLPNFFFHVTTAYDILRHNGVELGKLD
FT                   YLGALK"
FT   gene            complement(457739..458110)
FT                   /locus_tag="BC1003_3925"
FT   CDS_pept        complement(457739..458110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3925"
FT                   /product="protein of unknown function UPF0060"
FT                   /note="PFAM: protein of unknown function UPF0060; KEGG:
FT                   bpy:Bphyt_4776 protein of unknown function UPF0060"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3925"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59864"
FT                   /db_xref="GOA:E1TK40"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK40"
FT                   /inference="protein motif:PFAM:PF02694"
FT                   /protein_id="ADN59864.1"
FT                   /translation="MREHAACCYANTHRLSTMKTLLLYTLTAIAEILGCYLPWRWLKEG
FT                   GSVWLLVPGALSLALFAWLLTLHGTAAGRVYAAYGGVYVAVAIAWLWCVDKVRPTLWDA
FT                   AGVAVTLAGMAIIAFQPRV"
FT   gene            458218..458391
FT                   /locus_tag="BC1003_3926"
FT   CDS_pept        458218..458391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3926"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289; KEGG:
FT                   bxe:Bxe_B1997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3926"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59865"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK41"
FT                   /inference="protein motif:PFAM:PF06945"
FT                   /protein_id="ADN59865.1"
FT                   /translation="MSTASPCIDICKFDSETGYCIGCLRTRDECKSWKKMKDKHRKKII
FT                   DDRSRRERKLNR"
FT   gene            complement(458604..459266)
FT                   /locus_tag="BC1003_3927"
FT   CDS_pept        complement(458604..459266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3927"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bxe:Bxe_B1998 amino acid efflux pump, RhtB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3927"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59866"
FT                   /db_xref="GOA:E1TK42"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK42"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADN59866.1"
FT                   /translation="MISAHLLAVYIAALLVVYAVPGPDMALILQTSIGRDVRSGFAAAG
FT                   GLGVARATHVTLSACGAAALLRNAPWLYDVVRYGGAVYLAWIGIQIFRSPVFALPDAGA
FT                   ARDEAGSPQRARGTGMPELRAAFVKGLLTNLLNPKALLFCSVLLPQFVRPEAGPVALQM
FT                   IELGSVLLAVGLCFDVAYAVGAARIAHWMRAHPLAQTLQRWTFSAALIGFALRLSLD"
FT   gene            459422..459889
FT                   /locus_tag="BC1003_3928"
FT   CDS_pept        459422..459889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3928"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: bpy:Bphyt_4773 transcriptional regulator, AsnC
FT                   family; PFAM: Transcription regulator AsnC-type-like;
FT                   SMART: Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3928"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59867"
FT                   /db_xref="GOA:E1TK43"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK43"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADN59867.1"
FT                   /translation="MTTDLDKTDRAILAALQKDGRMSNAKLAELVGLSETPCARRLKRL
FT                   EHEGYIGQYQAVLARSALGFGVVAFVLVRFAVHDKDLANRFEREVQAIPRIIACHNVSG
FT                   SADYILQVVARDLDDYGTFMRDQMRSLPGVTSVESALSLREVKADSGLPLL"
FT   gene            459956..460198
FT                   /locus_tag="BC1003_3929"
FT   CDS_pept        459956..460198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3929"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3929"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59868"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK44"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3607"
FT                   /protein_id="ADN59868.1"
FT                   /translation="MDNLDHDKARAEETAAMERVLTATLRVKTAFASLQSQFPPAGNGK
FT                   PSQFALQTFDAALQELEDAQAAFDELLGDLLDGNR"
FT   gene            complement(460436..460912)
FT                   /locus_tag="BC1003_3930"
FT   CDS_pept        complement(460436..460912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3930"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bpy:Bphyt_4769 OsmC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3930"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59869"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK45"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADN59869.1"
FT                   /translation="MAYGEHRYKISVQWTGNRGSGTSGYRDYGRDHVIASGNKPAIAGS
FT                   SDAAFLGDADRWNPEDLLVASASACHKLWYLHLCSDAGIVVLDYRDDAEGTMLDSPQQG
FT                   RFSQIVLRPRVLIQAGGDVELARRLHHSAHEKCYIANSVNFPILCEPVIETREA"
FT   gene            complement(461016..461399)
FT                   /locus_tag="BC1003_3931"
FT   CDS_pept        complement(461016..461399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3931"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3931"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59870"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK46"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3605"
FT                   /protein_id="ADN59870.1"
FT                   /translation="MRIATGGVASTVMIAACLCGMSTMVCAQAPGSRAGNGGLSATAPN
FT                   VNPTGGGGAAGATLSPTPGLATPGGAIGGGLGTGTRSGTGLGTGITVNPSRVPNNMRAN
FT                   GTSLNQNPDPRVPSLGGRPAAPR"
FT   sig_peptide     complement(461316..461399)
FT                   /locus_tag="BC1003_3931"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            461610..462335
FT                   /locus_tag="BC1003_3932"
FT   CDS_pept        461610..462335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3932"
FT                   /product="17 kDa surface antigen"
FT                   /note="KEGG: bpy:Bphyt_4766 17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3932"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59871"
FT                   /db_xref="GOA:E1TK47"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK47"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_4766"
FT                   /protein_id="ADN59871.1"
FT                   /translation="MNTNLTPSTSPRSRIHPLIAGAAVAVILASATGIAAMTGLLPTSH
FT                   ALTEPASSPVALAAQQPSAQQAAQPAAQQPAQQPIEQTAQQPAQHMAPAKPPVHRSHTG
FT                   ATPAPRYANNGGYQTANEPTAARPVPADPYAGEVVAINTVQSPEPTTGLGALGGAVAGG
FT                   LVGNQIGGGRGKILTTIAGAVGGGLAGNGIEHAVRKQTTYQVQVRMQDGSYRNFDYQTQ
FT                   PPVQPGERVHVSGDTLTAY"
FT   sig_peptide     461610..461750
FT                   /locus_tag="BC1003_3932"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.439 at
FT                   residue 47"
FT   gene            462466..464469
FT                   /locus_tag="BC1003_3933"
FT   CDS_pept        462466..464469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3933"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SNARE
FT                   associated Golgi protein; KEGG: bxe:Bxe_B2003 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3933"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59872"
FT                   /db_xref="GOA:E1TK48"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK48"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADN59872.1"
FT                   /translation="MEQAYFHLLHLLAGHPEWMLTVVFLAAFLESVAVIGTFVPGSTAM
FT                   FLAGALTGTGSLSLGWVLAWAIAGAIAGDGLSFWLGSRYKSRIVKLWPFSRHPEVLEAG
FT                   YRFFGKHGAKSVVLARFVGPLRAIVPVVAGMLGMSPVRFYAMNVLSALLWAPAHILPGV
FT                   VFGASVLLAGAVSFRLVVILALLLVSIWLSYRAAALLLSHAHAWSVAAGRHLGSWACRH
FT                   PGPLGRVARRMLDPAAPDATSILAASVIVLVCGALFFGVLEDVITGDPITNVDQSVYRF
FT                   MQSVRTPWGDAVLAGLATLGSTGTLAALIATVALWMVWERRWRTIGYWLAAVVFSQMLI
FT                   FALQFAMQRAAPNGLLPDAYVFPSNHVAATVIVYGFLAFLLARRVGMLEGLLVVTVTTL
FT                   IVILVALAGVYFGRYWMSDAIGGAALAYMWVAIVALTAMLRHPQPPPTRRWMPAIVLAV
FT                   VLASVGLQSGLGMMTPPGALAPLPLAQVTRQQWTQTVWKQLPCYRSDMGGDRKEPLTLQ
FT                   WVAHSESLRQQLRRDGWLEGTDLSAHSLLSLASPDVAATALPVLPKLNNGVLSSLVFMR
FT                   PGATRNERDVLRFWPSGYAVGDGAAGVPLWVGSIAHERLAHASWPLNVVQVDKHVSTYD
FT                   IGMKLSADSVASVVATGNCHGVPVALLASVAQ"
FT   gene            complement(464476..465549)
FT                   /locus_tag="BC1003_3934"
FT   CDS_pept        complement(464476..465549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3934"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_3846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3934"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59873"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK49"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_3846"
FT                   /protein_id="ADN59873.1"
FT                   /translation="MKTSAGKPRALARENHCGSHMATVAATLRPSTRAATSLAALRPST
FT                   RAKASRLARAVATLACVYANECVATEGGVGRPVTGQQVSPYAGVVPPTSEWIVSFATIY
FT                   YEGSLGATKTLPVSGTVTQGLNYQVVYTIADLLKPWGVTWGGWNFASLVGVPVQYTHAS
FT                   SFNGILPNDHSTEFADLFFVPVIAGYHLTKTDHVALSVQIFAPTGSYSTSRLANAGENT
FT                   WTFSPTIAYTHLIPSENIELTVNYGIGFYTPNSRTHYHNAPVSVLDLLALKRFQNGWGV
FT                   GVVGGYIQQLSDDSGGIAERIGGARGHAWGLGPMITWSGKVSKTPVSAALRWVNEVEAS
FT                   HRPRGNSVQLSISATFE"
FT   gene            complement(465558..466007)
FT                   /locus_tag="BC1003_3935"
FT   CDS_pept        complement(465558..466007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3935"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3935"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59874"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK50"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A2130"
FT                   /protein_id="ADN59874.1"
FT                   /translation="MKRIAAVVIASASALAYAQKPATYPAHGQSQQQQMSDDGACYAWA
FT                   KQTTGIDPAVVAQTPAPATGPTGSRVRGAARGAAAGALVGEVSGNDAGHGAAVGATAGA
FT                   LAGGVRSRQQHAAQEQAAASSQQSAMNTYWHAYGACMQGKGYTVQ"
FT   sig_peptide     complement(465951..466007)
FT                   /locus_tag="BC1003_3935"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.923 at
FT                   residue 19"
FT   gene            466600..467871
FT                   /locus_tag="BC1003_3936"
FT   CDS_pept        466600..467871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3936"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3936"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59875"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK51"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A2129"
FT                   /protein_id="ADN59875.1"
FT                   /translation="MKRSGAHQRATLIALAILAGSPALFDTAVPAAHAQTAAKISNQQL
FT                   DSLTASVALYPDALLAQVLMASTFQQDVAAAAAWSRANPNVKGDDAVRAVASEPWDPSV
FT                   QSLVAFPQVLATMASKPDWVAQLGNAFLAQPNDVMDSVQRLRRQAQQAGNLKTSEQQKV
FT                   IVEQSTIQIVPANPQVVYVPTYNPTVVYGTWPYPAYPPVYVPPPPGYAVASGLAAGLAF
FT                   GVGVAITSALWSDVNWNNHSVNINVNRYNNINVNRRLDVNSSTTRWNRDTTFNRNASAN
FT                   LGGMQRDAYRGRDLSGSRAQAQQALQNRTGQNLGGSASQRVHGIQHGGTSAPNIQARAQ
FT                   NVNRDNALRGAGNGAAAQQDIQRGQASREAQARARNNLGAGAGAERGGFGGGQPRNLPG
FT                   AGGTVPHGGFGAGGGGQRHFGRQR"
FT   sig_peptide     466600..466704
FT                   /locus_tag="BC1003_3936"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.883 at
FT                   residue 35"
FT   gene            467891..468835
FT                   /locus_tag="BC1003_3937"
FT   CDS_pept        467891..468835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3937"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3937"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59876"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK52"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A2128"
FT                   /protein_id="ADN59876.1"
FT                   /translation="MNRIQSIRACVAKVTALPLSRQLARTALALSALFVSTAPAHAQAV
FT                   YPTPDAAVNAFVDALATNDHAAMQRVLGKYYNRFIPSKDVGEEDIYDFLGAWAAGHHIV
FT                   DDAAPLHGRPSKHLSVGTSGWTLPIPLVQAESGWRFDPAAGSDEILTRRIGRNERAAIM
FT                   TSLAYLDAQRDFRALTGHYAQRLISTPGQHDGLYWPTAEGEAESPLGPLAAAMPKVGSI
FT                   SKDGYHGYHFRILSAQGPHAKGGALDYVENGALTRGYALVAWPAEYGKTGVMSFIVNQE
FT                   GQVYQKDLGRDSSRKAAALRSFDPDPSWQPVMP"
FT   sig_peptide     467891..468019
FT                   /locus_tag="BC1003_3937"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.991 at
FT                   residue 43"
FT   gene            468946..469626
FT                   /locus_tag="BC1003_3938"
FT   CDS_pept        468946..469626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3938"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3938"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59877"
FT                   /db_xref="GOA:E1TK53"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK53"
FT                   /inference="protein motif:PFAM:PF04403"
FT                   /protein_id="ADN59877.1"
FT                   /translation="MNDENLIACHECDALYSKPRLSGKSCARCLRCGAILYRGMSRRLD
FT                   GICALTLASLVTFVIALGSPILELETGGITSRTSLFGALVTLWNEDMQLVAAMVFCSTV
FT                   LFPLTELAALLYVLVAIRHGYVPPAFNRILRAIQFVRPWGMIEVFMLGVLVTIVKMVSL
FT                   ARVVPGAALFAFGALTLMLLLVVMFDPRTLWDLADDISDAARRANKAHAPPPAAHRPAA
FT                   RPTA"
FT   gene            469642..470304
FT                   /locus_tag="BC1003_3939"
FT   CDS_pept        469642..470304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3939"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   bxe:Bxe_A3999 putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3939"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59878"
FT                   /db_xref="GOA:E1TK54"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK54"
FT                   /inference="protein motif:PFAM:PF04403"
FT                   /protein_id="ADN59878.1"
FT                   /translation="MKTLTASHAGLLACHACGRVERRTAGHARQHCGRCGAPLHRRNPA
FT                   SLSRTWALLLAAAILYVPANLLPVMHTASLVGSEDDTIISGVIYFWTSGSWPLAIVVFV
FT                   ASILVPMLKLTVLVLLAASAQRRSPWRPMERVKLYRIVERIGRWSMLDVFVITLTVALV
FT                   RFESLAVVTAGPGALAFGCVVILTMLASMQFDPRLIWDHVEGGNPPTASTATEPPHE"
FT   gene            470297..471925
FT                   /locus_tag="BC1003_3940"
FT   CDS_pept        470297..471925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3940"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bxe:Bxe_A2127 putative paraquat-inducible
FT                   transmembrane protein, PqiB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3940"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59879"
FT                   /db_xref="GOA:E1TK55"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK55"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADN59879.1"
FT                   /translation="MNSPQDPDPRAELPDAPDPGIESRRGWLPSLVWVVPLIAALIGIG
FT                   LVVKSITERGPQVTISFNNAEGLEPGKTQVKYKEVVIGAVKSITLSKDHSHVEVAVQLS
FT                   KQAEDFAVKDTRFWVVRPRIGASGVSGIGTLLSGAYIGVDAGRSKETRDTFVGLEAPPP
FT                   VTADQKGRRFTLHGDSLGSIDIGSPIFYRRVQVGQVYGLSLDKDGKGVTMQVFVAAPYD
FT                   QYVGTNSRWWHASGVNVRLDSSGFVVNTQSVTSILVGGLSFRAPPGQERGPQAADYTSF
FT                   RLASDEDEAMRAPDGPPLRVVMKFNQSLRGLSVGAAVDFRGIVLGQVIDIGVDYDPQTR
FT                   SFTMPVTVELYPDRLKRRTHGAPAPDLGSAESQQLLRHLVERGLRAQLRTGNLLTGQLY
FT                   VALDVFPKAAPVSFDATRDPLELPTIPNSLDALQTQVADIARKLERVPFDQIGANLNNS
FT                   LKNADRLFAQLSTEVMPQARDTLAAARQTFSSAEATLRQDSPLQSDMHQALQELTRTLQ
FT                   SLNALADYLERHPESLVRGKTGDQP"
FT   gene            471922..472620
FT                   /locus_tag="BC1003_3941"
FT   CDS_pept        471922..472620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3941"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   bxe:Bxe_A2126 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3941"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59880"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK56"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ADN59880.1"
FT                   /translation="MNGYASRRTMSGVRSLLAFLAAFGAWAGLTGVAALSACSSPPSGF
FT                   YTLVGGMPLSTGRATAPPPALLIDVAAVDVPAQIARTAFVVHTGANRVNVLEQTRWASL
FT                   PADEIRQALSQELAQRLDTFDVARSPRPAGVPVYRVTVSVQRFESWPGSHALIDAVWSV
FT                   RALADQTVVTCRSVVSEPVSAGNTALVVGHRQALQQISASLADVIRTLDAKARAPRLSS
FT                   TQSAAPCPAT"
FT   sig_peptide     471922..472005
FT                   /locus_tag="BC1003_3941"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.705 at
FT                   residue 28"
FT   gene            472703..474472
FT                   /locus_tag="BC1003_3942"
FT   CDS_pept        472703..474472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3942"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bgl:bglu_2g15530 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3942"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59881"
FT                   /db_xref="GOA:E1TK57"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK57"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADN59881.1"
FT                   /translation="MDNMKVSTRLQAGFGLLTALMLVLAALAFYGLSALDNCLDGIARV
FT                   NNEETRLANELRASIQDRAIAIRNLGLITDPRDVAEEAERIKKQDQIYADAYQKLTRMF
FT                   AEEPSTTAKERSLIDQIKQDEAAAMPPLRRAMELALAQNTALATQEILQNARPPQRVWL
FT                   AHATELAGFEDQLNKDAQKSAAATYSTVRNIVAVIAAIAVLLGIATATLISRSILRQLG
FT                   GEPRAAQEMAAQIAQGNLTVRVHVAPGDRTSLMASLESMREKLTAIVSGIKTSAESISV
FT                   AAGEIAQGNQDLSQRTEEQAASLQETAASMEELTSTVRNNTDNARQGSTLAAAASSTAA
FT                   TGGDVVEQVVVTMRDISSSSAKVTEIISVIEGIAFQTNILALNAAVEAARAGEEGRGFA
FT                   VVAGEVRTLAQRSATAAKEIKDLIEASASHVTSGSQLVENAGKTMSEVVRSVQQVTDIM
FT                   GEIASASSEQTRGIEQVNVAVTQMDEVTQQNAALVEQATAAAQAMADQAENLRAAVSVF
FT                   TVAAGGQAVHSVASTAQAKPRPAAAPQKKTVPLAAKSKPAAASAQPLQPAAAQPRSKER
FT                   ELQDAGADSWETF"
FT   gene            complement(474641..475606)
FT                   /locus_tag="BC1003_3943"
FT   CDS_pept        complement(474641..475606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3943"
FT                   /product="Helix-turn-helix, AraC domain protein"
FT                   /note="SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   bac:BamMC406_3360 AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3943"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59882"
FT                   /db_xref="GOA:E1TK58"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK58"
FT                   /inference="protein motif:SMART:SM00342"
FT                   /protein_id="ADN59882.1"
FT                   /translation="MSTCELTTPVAVRTCHSVEEQAALLDTWNQSYCQISRGAFDGSVT
FT                   TLAIGGFRVHIERLNRTVYQRGEVAAKEIAVGIPFQLEGHALLCGQPSHRDALHVFSGE
FT                   GGFEFLSPDQHLVVNLEICPENISNRAAREHLDLLRPRLTRRAGLIPVASTRLQEFRVA
FT                   LESMLNILTRMPHLTKDANIAETFERSAVFGLADVLDSEPELLTQSASRTSRHWQLVRA
FT                   VRELVEASPDCPLTVAELCVRLRASRRTLQYAFEEALGMNPFLYTRAIRLGKVQRELQS
FT                   AASVTEAATRWGFWHLGNFSAEYREQFGELPSETLRRYRG"
FT   gene            475869..476684
FT                   /locus_tag="BC1003_3944"
FT   CDS_pept        475869..476684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3944"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   smd:Smed_0321 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3944"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59883"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK59"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADN59883.1"
FT                   /translation="MAEYKGFAESDTNASAGRGRLAGKIAIVSGGATGAGGAASRLFAK
FT                   EGAKVAVIDINQSAGEQVVDQIRAEGGIAEFFAADVSKRVAVEDAVGSIASHFGRIDTL
FT                   FNHAGSIVVKPFLETTDDDYDWLMDVNVRSMFMMTRAVLPHMLASGRGSIVCTASISSV
FT                   AATPLEVLYCTTKGACAMFARAIALEYRDRGIRCNAVNPGFIDTPHGRREIDALAKYGF
FT                   DASEAALAVQQGRLCAPEEVAQAALFLASDDASFINGAHLYVDNCFTAA"
FT   gene            476792..478324
FT                   /locus_tag="BC1003_3945"
FT   CDS_pept        476792..478324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3945"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bac:BamMC406_3364 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3945"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59884"
FT                   /db_xref="GOA:E1TK60"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK60"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADN59884.1"
FT                   /translation="MDTKRTTHATEFVDDDVKLLHEMGYAQELSRRMGAFSNFAVSFSL
FT                   ICILSGGITSFQLGLSAAGGASIGLGWPLGSLFALIVAAAMAQIASSYPTAGGLYHWSS
FT                   ILGGKTWGWLTAWLNLLGLVFVVAAINYGTYDPFFRTIIAPMFGVAPESLGWWSQTVFL
FT                   TVITASQAFLNHKGIRMTSRITDLSGYLIFVVTILLVVSLLVYSPVKIDLSRLFTFTNF
FT                   TGVDGGMWPRQTMAMAFLSGLLLTAYTITGFDASAHTSEETHEASRNVPRGIIGSVFWS
FT                   TTFGYVMVCAFVLVMPDVGAAVKQGTGFFQAILAPIPGPLRFVIEILMFFINYVCGLAA
FT                   VTSTSRMMFAFARDGGLPGSRWMRKVNSEHRTPGIAIWVSAILAIVVTLYGDAFSVLSA
FT                   GSAVFLFISYAMPIAAGIFAEGRSWSEKGPFQLGWLSKPFGVLAVFGALVLAYVGIQPP
FT                   NEKVVYVIAALLVLLLAVWYLGGVRKSFAGPPVGGLSKDRERALETIEGQLE"
FT   gene            complement(478445..479782)
FT                   /locus_tag="BC1003_3946"
FT   CDS_pept        complement(478445..479782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3946"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mbn:Mboo_2174 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3946"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59885"
FT                   /db_xref="GOA:E1TK61"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK61"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59885.1"
FT                   /translation="MTAAVQTDHINGTIRKIQWRILPFLIVLYIIAFIDRSNIGFAALK
FT                   MNPDLGITSTQFGIAAGLFTVGYFLFEVPSNILMHRYGARKWIARILFTWGAVAACTGF
FT                   VNNYLQLAIVRTILGIAEAGFFPCVLLYLTYWFPERQRARVVALFMLALPIATLIAGPL
FT                   SGLILDHVHWNGIACWRWVFILEGLPAVLLGFLALRILVDNPRDAKWLTVEEKAWLAGV
FT                   LESEAAAKMKQHGTVSFWSSLGGVRIWLLAFIYYSKSVAVYVLAFYSPQIVKGLSHTLS
FT                   STAVGLVNGLPYAVATLVMVWWARRSDRTGERRWHVALPLFVAGVALVLMAFSAGNLWV
FT                   SIVLLTVITAAIYAPYGPFWAMPSLFLTGSSAAVGLAAINSIANLGGFIGPVAFGALKD
FT                   STGSIYAGLAFVSLTLVAAGILVVRLRFVKEAERRLRAKLRPTVAT"
FT   gene            complement(479929..481608)
FT                   /locus_tag="BC1003_3947"
FT   CDS_pept        complement(479929..481608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3947"
FT                   /product="putative sugar transport protein"
FT                   /note="KEGG: bbr:BB2073 putative sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3947"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59886"
FT                   /db_xref="GOA:E1TK62"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK62"
FT                   /inference="similar to AA sequence:KEGG:BB2073"
FT                   /protein_id="ADN59886.1"
FT                   /translation="MLALKSRTSSSERRKVIIASSLGTMFEWYDFYLYGSLSAIIAKQF
FT                   FSGVNPTAAFIFALLAFAAGFIVRPFGSLVFGVIGDIAGRKRTFLVTIVLMGLPTFIVG
FT                   LLPSYETLGIASPILLIVLRLLQGLAVGGEYGGAVTYVAEHSSAEKRGLHTSWIQTTGT
FT                   LGLLLSLFVILGVRSGVGEDSFGAWGWRLPFLFSIVLLGISLWIRVKLNESPEFKRMQE
FT                   KGEQSKSPLRDTFVNARNRKLVIASLLGCTAGLGVVAYTGQFYIQFFLLQAVKLDGKLT
FT                   NEVLTIALVLCLPFYVLCGWLSDRIGRKPVILTGCAIAALTYFPIYKGIMHYANPALEY
FT                   AQTTSPVRLDTNLSECSFQFNPIGTSTFNKPCDVAKAALAKNAVNYTASQSNGPATVVT
FT                   VGSQVVELGSLQGLGAAQVTERIKLFTESLSAALVQHGYPKSADPSAVNKPMLVLLIMI
FT                   PVIYLTMVYSPAAAWLVELFPPQIRYTATSLPYNIGNGWFGGFLPATAFAMVAATGDIY
FT                   FGLWYPTVVAGAVAVVGFFFLPESRFIKESEEVAADPVRAET"
FT   gene            complement(481718..482359)
FT                   /locus_tag="BC1003_3948"
FT   CDS_pept        complement(481718..482359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3948"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   rso:RS03175 putative transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3948"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59887"
FT                   /db_xref="GOA:E1TK63"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK63"
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /protein_id="ADN59887.1"
FT                   /translation="MSVTNEQIEALKQLGTATIHEAQGQKGAIDGALRPIDPSVRLAGR
FT                   ALTVDIRPSDNLAIHYSLTKAKPGDVLVVDAKGFTEAGPWGDLLTMAAQKLGIAGLVID
FT                   GSVRDANTIIEMGFPTFSRGLSIKGTNKNQPGKVNVPVSIGGVVVNPGDIVVGDRDGLV
FT                   VVAQDEVEDVIRLSRAREDKENGIREGIAAGKSMVELLGLRDKLEQFGMI"
FT   gene            complement(482437..483315)
FT                   /locus_tag="BC1003_3949"
FT   CDS_pept        complement(482437..483315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3949"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: vei:Veis_3257 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3949"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59888"
FT                   /db_xref="GOA:E1TK64"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK64"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ADN59888.1"
FT                   /translation="MNIAIVGLGEVGRCYASALASVAGNKLLLCEQRVSQLAANLARDI
FT                   NVPINEAVGPWLGEADWVFSCVVGTKSLQVAESCFALMKPGASFADFTTASPETKRQGE
FT                   ALAGEQKIAYADVAIMGAIALLGARTPLLCAGDGAASFSTILAEAAGVAPRVLPGSRAG
FT                   DAMSLKILRSVFTKGMEALAVEVLMAAERQGLRPALYEVLQDIDKASLPQFLEMLVTTH
FT                   VIHARRRQHEVEEAERQLAAIGIVSDVLDGVQHRFARTADKLEASPLPTEMPALADALN
FT                   WLSSEPEKVSA"
FT   gene            483569..484282
FT                   /locus_tag="BC1003_3950"
FT   CDS_pept        483569..484282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3950"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: pna:Pnap_0602 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3950"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59889"
FT                   /db_xref="GOA:E1TK65"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK65"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADN59889.1"
FT                   /translation="MEFAYDTMRKRILSGQYEPGTQLKEERLAEELGMSRTPIRAALKK
FT                   LAEDKLVSVEANRGVFVAGWTRWDIEEMFSLRALLEPHAARLAAARATESDIGKLNEIN
FT                   AEMASAIKSRADDAVLRIQAANRAFHMHLLDCAKSQRLKSMLVTLIDMPVITRSFFLYS
FT                   APDFARSLQQHEDIAYAVQTHDGELACNLMESHIRLSYRRFMKERIDSGHVPAENNQAA
FT                   RGASTQAADSDLPEK"
FT   gene            484316..485179
FT                   /locus_tag="BC1003_3951"
FT   CDS_pept        484316..485179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3951"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: pam:PANA_0080
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3951"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59890"
FT                   /db_xref="GOA:E1TK66"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK66"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADN59890.1"
FT                   /translation="MTPFSAGECRPTVALPDNSCDCHMHVFDDTRLPVAGATVTPPTAT
FT                   VDDYRKLQERLGTRRHVLVQPSTYGTDNSLMVSTLVENRTNARGVAVVNDKVPDEELVA
FT                   LNDAGVVGIRFNQVQAGATSLAMLESLAPRIQTLGWHIQLHVTVQQLIDYAEVLLRPGV
FT                   PLVLDHYARLHHVPSLANAVTERLMRLMDSGRVWLKLSAPYLSSQATHPPYIDLGHSLE
FT                   SLTRNFPERLVWGSDWPHATEADKPDDAQMLDWLTSQIPSRKLRESIFVENAASLYRFP
FT                   VAREAL"
FT   gene            485378..485566
FT                   /pseudo
FT                   /locus_tag="BC1003_3952"
FT   gene            complement(485521..486372)
FT                   /locus_tag="BC1003_3953"
FT   CDS_pept        complement(485521..486372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3953"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bxe:Bxe_B0323 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3953"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59891"
FT                   /db_xref="GOA:E1TK67"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK67"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN59891.1"
FT                   /translation="MLDLDLLNTLICVVDEGSFTRAGERVHRTQSTVSQQVRRLEELVG
FT                   RTLLLRDRTGNQVTATEHGELLAQYARRLLALAQEAQDALTSDVAVTPLRIGVPEDFDA
FT                   RRMSAMLSGFVKTKPGVRLETVAGMSADLQRRLSSGEIEIALVKREPASGECLAAWPES
FT                   LVWVQGANAQAPEPSSDEPIPLALFPQGCVYRQRAIRGLDKAHRRWRVAFGSHSLTGIQ
FT                   AAVSSGLGISVLPTTAVLPEHRLCNGFPPLPPTELALVSSGGVLNAHQRALVDFLVEEM
FT                   SA"
FT   gene            486497..487201
FT                   /locus_tag="BC1003_3954"
FT   CDS_pept        486497..487201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3954"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="KEGG: bxe:Bxe_B0322 HAD family hydrolase; TIGRFAM:
FT                   haloacid dehalogenase, type II; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 2 (HAD-like); PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3954"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59892"
FT                   /db_xref="GOA:E1TK68"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK68"
FT                   /inference="protein motif:TFAM:TIGR01428"
FT                   /protein_id="ADN59892.1"
FT                   /translation="MSLDNTARPHCLTFDCYGTLIQWDEGLQAAVRDILQTKGADQVDP
FT                   AKLITVYDRHEHALEQTAPHRPFREVAATALRLALAELGLPGDAQDIRTLTDRISAMPP
FT                   FPEVVDTLRRLKHDGYRLCIVSNTDDDIIAGNVAQLGGLIDRVITAQQAGAYKPDRRLF
FT                   DYAHAQLGVTREEVVHICASPHLDHAAARDVGFRCVWIDRATGRKLLPDYTPDATLSTL
FT                   DQVPALFASLGW"
FT   gene            487219..488016
FT                   /locus_tag="BC1003_3955"
FT   CDS_pept        487219..488016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3955"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bxe:Bxe_B0321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3955"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59893"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK69"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADN59893.1"
FT                   /translation="MAHTLSAAGSSASSSSTAALQLDSDAVNEARIQLAACFQLAAQHG
FT                   LEEGICNHFSAMVPGHDNLFFVNPYGYAFSEITASRLLICDFDGQVLAGEGKPEATAFF
FT                   IHARLHRLKPRVKAAFHTHMPNATALCLLEGPPLLWLGQTALKFYGRTAVDEHYNGLAL
FT                   DDSEGDRIAAATGDADIVFLKNHGVMVMGESIAEAWDDLYYLERAAQVQLKAMSSNHAL
FT                   KAVPHEIAQRTYEQMRAADKESAQAHLESGMRELRRRGIGFDQ"
FT   sig_peptide     487219..487275
FT                   /locus_tag="BC1003_3955"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.723 at
FT                   residue 19"
FT   gene            complement(488019..488858)
FT                   /locus_tag="BC1003_3956"
FT   CDS_pept        complement(488019..488858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3956"
FT                   /product="Transcriptional regulator TetR"
FT                   /note="PFAM: Transcriptional regulator TetR ; regulatory
FT                   protein TetR; KEGG: vap:Vapar_1742 transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3956"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59894"
FT                   /db_xref="GOA:E1TK70"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK70"
FT                   /inference="protein motif:PFAM:PF09209"
FT                   /protein_id="ADN59894.1"
FT                   /translation="MPTKRATIAAKITDRSAEAKTARKPTAASARAARTEQAKQAKQAK
FT                   QAKQAKEPKPRARAEESVRVKRASRPDGAATRQHLLDTAGQVFAARGFADATSKEICER
FT                   AGTPMASVNYHFGSREALYEAALVEAHRQVVSLDELSALTEAPGDARDKLRAVISRFVG
FT                   LSTSTSAPWGFMLMLREVLSPSPAMPALIEKAVRPKAAVLLRLIGEVLQLNPHEPAVQR
FT                   ALMFSVLPCIALMIAPRQVQATLLPAVAKDRAALVEDFTRFVMAGLDAVAAAHKVRK"
FT   gene            488944..489912
FT                   /locus_tag="BC1003_3957"
FT   CDS_pept        488944..489912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3957"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bph:Bphy_4329 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3957"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59895"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK71"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADN59895.1"
FT                   /translation="MKHLVTSIRRLTCALLAGALLTACSHREENTYQGYVEGEFVYLGS
FT                   SQAGKLVQLQVARGQTIKADAPLFALESVDETAALQQAQQQLAAARSQLADIQTGKRAP
FT                   EVNVNRAQLAQAAANARKAALQLVRDQAQYNAGGISKAQLDDSRANAEAASAQVRELTN
FT                   QVAVARLPGRAQQITAQQAQVAAAEAVVTQARWKLDQKRVAAPADGLVYDTLYRNGEWV
FT                   PAGNPVVQMLPPQNIKVRFFVPETLVGALSPGRAVSIHCDGCAADLPARITYVSSKAEY
FT                   TPPVIYSNESRAKLVFMIEAHTSVADATRLHPGQPVAVTLK"
FT   gene            489909..490853
FT                   /locus_tag="BC1003_3958"
FT   CDS_pept        489909..490853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3958"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bph:Bphy_4328 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3958"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59896"
FT                   /db_xref="GOA:E1TK72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK72"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADN59896.1"
FT                   /translation="MSADAPEYVIDVHGLNKHFGDKHVVNDVSLQVARGEIFGFLGPNG
FT                   SGKTTSIRLMCGLLTPDSGTGTCLGYDIRRESAQIKRNVGYMTQRFSYWEDLTIRENLD
FT                   FVARVYQMPNRREVVDKSLEALGLQSRANQLTGSLSGGWKQRLALAACMLHEPKLLLLD
FT                   EPTAGVDPTARRDFWEELHRLAARGISVLVSTHYMDEAERCHKLAYIAYGKLLAQGTSK
FT                   EVIDSQDLATWSIQGENLSELSEKLRATPGVDQTVVFGAALHASGRDHAALERALRQAT
FT                   AGTNLRMEPIEPGLEDVFIYLMSHSQDNFGARS"
FT   gene            490850..491992
FT                   /locus_tag="BC1003_3959"
FT   CDS_pept        490850..491992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3959"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bam:Bamb_3689
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3959"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59897"
FT                   /db_xref="GOA:E1TK73"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK73"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADN59897.1"
FT                   /translation="MSAVTAFSLTRWWSVVLKEFLQLRRDRVTFAMIVGVPIVQLALFG
FT                   FAINTDPKHLPTAVIVHDQSQFSRSFIAAMTNSAYFDIVETLPDEEAGHRALAQGRVQF
FT                   VMTIPVDFSRRLLRGEHPSLLVEADATDPTATHAAVAALPNLVQPVADKDIKGPLAHLN
FT                   GGQSAFGVQVHNLYNPEGITQYNVVPGLMGVILTMTLVMMTGLAVTRERERGTMENLLA
FT                   TPVLPVEVMTGKIVPYVAIGLIQASIILIATRFVFHVPFVGSPLAIYLAALLFIAANLT
FT                   VGITLSSLAQNQLQAMQLTVFYFLPNILLSGFMFPFAGMPQWAQFIGNLLPLTYFNRLI
FT                   RGIVLKGDGWADLWPSVWPLALFTAVVMAIALRFYRRTLD"
FT   gene            492003..493463
FT                   /locus_tag="BC1003_3960"
FT   CDS_pept        492003..493463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3960"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="KEGG: bph:Bphy_4326 RND efflux system outer membrane
FT                   lipoprotein; TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3960"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59898"
FT                   /db_xref="GOA:E1TK74"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK74"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ADN59898.1"
FT                   /translation="MKALLVVCAIALSGCAVGPDFKAPGAPDTQTYTPNALPERTVSSD
FT                   GPNGASQTFDTARGVMPMWWHEFKSDALNRLVDEALHQNPTLAQARARLIQAQQNYTAL
FT                   AGTTQFPGIDATLSGARQKVDPAAFGIPHVESAGPFSLFGASVSVSYVFDIFGGNRRAL
FT                   EASMAQVDYESYELDAARLSIAGNIVSTAVQRASLREQIALTERLADAQAQQLSITEAR
FT                   FAAGGVSQLDVRSQRTLLAQTRALLPPLATQLAAADHQLAILLGRAPSQADFEHLTFDS
FT                   LQLPLHIPLTLPSALARARPDIKAAEALLHEASANVGVATANLYPQFALSAGIGSQRTR
FT                   VGDIVNGLNIWNVGLNLTQPIFHGGELHAKKRAAEAAHDGAFANYRQVVLQALQQVADS
FT                   LSAVQNDARELQARTEAAQEAQASLNVATERYAAGGISQLALLDAERQSLQTTLDRTRA
FT                   QANRFSDTAALFQALGSSVTETSVGSIP"
FT   gene            complement(493487..493873)
FT                   /locus_tag="BC1003_3961"
FT   CDS_pept        complement(493487..493873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3961"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   mlo:mlr2224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3961"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59899"
FT                   /db_xref="GOA:E1TK75"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK75"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ADN59899.1"
FT                   /translation="MTQPDLSDIYRGYIACLNRQDWQKLPQFVHDDVYYNDQRIGYSGY
FT                   RAMLERDFREIPDLHFDIELLLADPAYVAARLRFNCSPKGKFLGLDVNGRTVSFTENVF
FT                   YEFRGERIGQVWSIIDKAAIEAQL"
FT   gene            494064..494573
FT                   /locus_tag="BC1003_3962"
FT   CDS_pept        494064..494573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3962"
FT                   /product="phasin family protein"
FT                   /note="KEGG: bxe:Bxe_B0319 phasin; TIGRFAM: phasin family
FT                   protein; PFAM: Phasin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3962"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59900"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK76"
FT                   /inference="protein motif:TFAM:TIGR01841"
FT                   /protein_id="ADN59900.1"
FT                   /translation="MNAIVLNQPDVPQQSHPIAAYEFAAKAVAGLEKVVELNVQTVKTS
FT                   LSEQQALVDAALSAASMDQIIDLQFQQVPAAVKKTCAYWGHVEDIAVDMHNDFTNVVQD
FT                   SLQGYLSNLFSFLDSAASFGMASSGRTNITSPLAIEQPPAPRNEPVVIVDSSGNVVLSS
FT                   PRTDLH"
FT   gene            complement(494622..494945)
FT                   /locus_tag="BC1003_3963"
FT   CDS_pept        complement(494622..494945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3963"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3963"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59901"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK77"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3324"
FT                   /protein_id="ADN59901.1"
FT                   /translation="MSEQLWCVHIEGPDDFLAAESKEAAEREASAINAYIEQSGEGRRD
FT                   APVRAVAMEWPFAPESHARALESDWADVQRMPHRKQQPASSPNLLTNIARRVKELIDVA
FT                   RGA"
FT   gene            complement(494942..495994)
FT                   /locus_tag="BC1003_3964"
FT   CDS_pept        complement(494942..495994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3964"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3964"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59902"
FT                   /db_xref="InterPro:IPR039523"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK78"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3323"
FT                   /protein_id="ADN59902.1"
FT                   /translation="MKKVGQYAFHQVHGAQAKRVLRLLQKKYGPPDPVNLKLADTYARD
FT                   VFGNAIYAPWLRVYAAFTGTFKEGWIPDNYYGGVVVPSMKGGYGRISNLKPMSRVIFGC
FT                   DAFPDIAYFANGLFFTDRNVVVPEQELENVVFRECERIVFKLDGSAQGKGIHFFDRASF
FT                   DCARIKLLGNGVIQKFIVQHPLLSTFAPNSVATLRLTTTVDDLGRASLRAAFLRLGRAR
FT                   HTHISVDDEVCVPVDLMTGELARQGFLTDWGATEEHPDSRVRFAGLKMPAFDACVETVL
FT                   DLHRKVPFARCIGWDVTVDNDSKVQVMEWNGEHNDVKFSEATQGPCFSDLKWELLNSGP
FT                   LRQYSARKIA"
FT   gene            complement(496107..497519)
FT                   /locus_tag="BC1003_3965"
FT   CDS_pept        complement(496107..497519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3965"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /note="KEGG: undecaprenyl-phosphate glucose
FT                   phosphotransferase; TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3965"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59903"
FT                   /db_xref="GOA:E1TK79"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK79"
FT                   /inference="protein motif:TFAM:TIGR03023"
FT                   /protein_id="ADN59903.1"
FT                   /translation="MVVNQSAFEGSAMRLITGLLARLFDVAMILGGAVAASHIRFDDLA
FT                   QHNFYLAFVAFAAAFSLAVFPALGVYQSWRGRSKRVLVGQVALGWLIVQACALALMFSL
FT                   HRLDLVSRLWFAYWTGIAGGAMIAGRMVTHVLLGRVRNAGLNLQKVAVAACGDHCDEIL
FT                   RKMEKEPAAGFRPSAVYNLRPARESTSSVPVFEQRAAFAKYVREQHVDEVWLALPLSEE
FT                   RAILELVDEFRNDLINVRFMPDVRALALFDGSVTELLGFPTINLAASPLPPNAMVKKEL
FT                   FDRVFALVALIAVSPILLACAIAVKLSSPGPVFFKQCRKGADGRVFMIYKFRSMRLHQQ
FT                   KQGVLEQATRGDPRITRVGRFLRRTSLDELPQFFNVLRGDMSVVGPRPHALEHDDLYQG
FT                   IVSGYIHRYRIKPGITGWAQINGFRGETDRIEKMEGRVAHDLYYLRNWSFALDVKIICA
FT                   TIFKGLHHPNAY"
FT   gene            complement(497523..499037)
FT                   /locus_tag="BC1003_3966"
FT   CDS_pept        complement(497523..499037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3966"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; KEGG:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase type II;
FT                   Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3966"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59904"
FT                   /db_xref="GOA:E1TK80"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK80"
FT                   /inference="protein motif:TFAM:TIGR01479"
FT                   /protein_id="ADN59904.1"
FT                   /translation="MDKVFATAGEMATEARIEVSQQCPPLAQVILAGGSGTRLWPVSRE
FT                   QFPKQLIDVIGDKTLLQATMSRMDNFSPSWTVTPEPVIVCGAEHYFATFEQARESGVNA
FT                   RIVVEPGRRDTAPALTLAALAAASGGDDVILVAMPADHAIENLPALHEAIQTAAVHADA
FT                   GAIATLGVPPTGADTGFGYIRLGAALEDGAYRIERFVEKPAPELAAQYVESGNYWWNSG
FT                   MFVVRASVWLALIKQFQPQIHDACVRAYAGAKVTEGCVVPDAEAFLQSPSDSIDYAVME
FT                   HLGKSDSQVAGIVVPLQAGWSDLGSWDAVWQAMEKDECGNAASGRVLFEGATATYARSQ
FT                   GGRLLACVGTHDLIVVETDDAVLVADRSHVQDIKGLVSRIKAEKSPEAEAHRKVRRPWG
FT                   FYDSIDHGDRFQVKRIVVMPGARLSLQMHHHRAEHWIVVSGTALVTRGDEQFLLGENES
FT                   TYIPLGIRHRLENPGCVPLQIIEVQSGAYLGEDDIVRFDDKYGRAG"
FT   gene            499687..500934
FT                   /locus_tag="BC1003_3967"
FT   CDS_pept        499687..500934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3967"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: O-antigen
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3967"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59905"
FT                   /db_xref="GOA:E1TK81"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK81"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADN59905.1"
FT                   /translation="MAYISLLALFLTVTNFVPVSAVGLVPIFLYSWRFFGRRYPAFITP
FT                   LTALTALIVVSTLLYDPKSFAEFEFYRRDGNFFISYAPIFAGCLYVHRLDLNKVLRTFF
FT                   IFAVGINIPPYALYIVGTGLLGIFTNPDNSFGSYFIARNAAGGFFAMLFCLGVGCYLQK
FT                   RSMLLLGLLAMNALMLFSTYSRGSLLGAAAVLPYLYFGRKRWLLAVLMGGLIVGSLAVA
FT                   VYHTDPTVDYMGYPFSIHNQDAKVANLNIRYEWLWPRALAYFEQSPILGLGFGSFDDHI
FT                   GRVVSYFHLFGAPSDVLVEHSDSHAHNSYLNFLAETGVIGLFLMLSFFWKLVEWSKLGA
FT                   AAGALVGGGQNFAAFRFVEISSVCLLVMAATEHRLVSPSNVLILSLVISLLLASQSANA
FT                   IFAEFRRRNSLVRSRV"
FT   gene            501010..501645
FT                   /locus_tag="BC1003_3968"
FT   CDS_pept        501010..501645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3968"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   bph:Bphy_3727 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3968"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59906"
FT                   /db_xref="GOA:E1TK82"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK82"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADN59906.1"
FT                   /translation="MWTVFTNIGDAAVTLPVAAVCACWIAFFDIRLACRWMLMLAVGIA
FT                   IVGASKVVYAGWGISFPASHFRVISGHAMLSTSVWMVAIALQLKWWRLPPLLGIAAGLV
FT                   IGALTGISRLMDLSHTVPEVVSGWMLGALVGLLFLHKALHAEFERARPAWSAASVLCVC
FT                   VLAYGHQAPLQRLIETRSPQLHSHAHSIMALAGRVKYRIQSYEGTLAR"
FT   gene            complement(501621..502808)
FT                   /locus_tag="BC1003_3969"
FT   CDS_pept        complement(501621..502808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3969"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: glycosyl
FT                   transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3969"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59907"
FT                   /db_xref="GOA:E1TK83"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK83"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN59907.1"
FT                   /translation="MKVAIVHDWLVVSGGAEKVLKSIIECFPKADIFSIVDFLEDRDCV
FT                   KGKPVNTSFIQKMPFARKRYRAYLPLMPIAIEQLDLSAYDLVISSSHAVAKGVLTGPNQ
FT                   IHISYVHSPIRYAWDLQHQYLRESHLNKGLKSIMARALLHYIRGWDSRSANGVDHLLAN
FT                   SHFIARRIRKAYQRDATVIYPPVDLDNMTVCTQKENFYVTASRMVPYKRIDLIVRAFSQ
FT                   TPERRLVVIGDGPEMKRIKAIAGPNVTILGHQPLEVLVDHLRRARAFVFAAEEDFGISV
FT                   VEAQACGTPVIAFGRGGALESVIGLPLEQPTGVFFDEQTAESLLEAVTRFERNASLFDP
FT                   LNCRQNAERFSTENFKTALTDFIDARLLRSSIEQLRPYLVRERTAQERHLASVPS"
FT   gene            complement(502861..504177)
FT                   /locus_tag="BC1003_3970"
FT   CDS_pept        complement(502861..504177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3970"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bph:Bphy_3729 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3970"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59908"
FT                   /db_xref="GOA:E1TK84"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK84"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADN59908.1"
FT                   /translation="MERKDSASVIAFVYGGYLMRYVYLIIVVPFYGRILGVAEYGRVLA
FT                   SMSLMNVIWMLVSYGFSLVGMREVAKAQSAKECNAIYSLHVSARLILAVLGGCIGVIAT
FT                   LCSPTLSERPLIGILATLLGIVSAMNLGWLFQGRQRFRTPIMIEVFGFAVSLVLVLSLV
FT                   RVPADSVWVLASLLIAGVASSIISYGITTSQLGLPRLTVQGVMPLIRGSTMLFCYSSGS
FT                   VVLTASSTYLLTLLSTPDQVGYFGAAERFATIALSLMGPASQVFVPTISRQLAHGDKEG
FT                   AHATTRRGAALLLGYGLLVFCGAIVLPPVLLPLILGAEFEPAARILQCFAWMFPFVAFN
FT                   EFVAFYVIVPRKKDRLLAFAGLASGAFNLAAALILAPRFGAMGMAFARVFGEATLAVIL
FT                   MVMMVRLELVGLVPGARRAAGMLGLAWGARAQAGAAKDE"
FT   gene            complement(504205..505215)
FT                   /locus_tag="BC1003_3971"
FT   CDS_pept        complement(504205..505215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3971"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3971"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59909"
FT                   /db_xref="GOA:E1TK85"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK85"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADN59909.1"
FT                   /translation="MNQVTVVICNYNYERYLAAAIDSALDQDYPGTQVVVLDDGSTDGS
FT                   RAIIEQYGSRITAIFQENGGQVSAYNHAISALQTEYAILLDSDDILYPSAVSEVMKIFS
FT                   SGQWAKVQFRLDVMDATGRHTGAYVPNTEPPANCGELLQAGWLYPSPPASGNAYRVSAL
FT                   RQVFPVPAPGINRYGADFFAIYGAALVGPVATLRKSLGGYRVHNADGGTVSFANSEQIS
FT                   KAPKALGMRWAILRNIAKSRLGIELSPTFHDFGHEKAIFCSSVYRATLAHRWRWMMRDS
FT                   RGYFHAILANPFWSVKKKFGTLVLSGLCLVPYSPLSDFVVRYISNPLARQRVAQR"
FT   gene            complement(505258..506544)
FT                   /locus_tag="BC1003_3972"
FT   CDS_pept        complement(505258..506544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3972"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3972"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59910"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK86"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3316"
FT                   /protein_id="ADN59910.1"
FT                   /translation="MIGANGWAGASRDVEMWRQMGISWGRDSVGPGQPDSPTEPVRVDK
FT                   TGSQFDNDLAPALLLNNRNGIKSLLLLGYTAPWNATVPGDSNSAPRDVRAWTRYVEAAV
FT                   RKYSAPPFNLRYFQIWNEAAGKLSGGAQQATFWHGPNFNKDDRKVKPYERAMQDYVERV
FT                   HLPAARIIRKYNAFVVYGGWPDQGGLSNYYKWLEYRSPASNERMLDWVDYLDTHYLGVS
FT                   DIDQLYERYVKNGPARGIWQTEIGDAYMKDPHYLPEYFFDFAVWALDHNWDDPNKYVSM
FT                   IYHWDGYEPFRLTHRGPPTRTYNVSGRSLVVLCHTVSGPLASLPNALKFGPGASGSGLR
FT                   SGNDIVLQVKAAAGGRSVALAGLRRPASREVRVEFIDALTGTVSAPGTVTTTWNDDGLQ
FT                   LNFKVPERVNGAGNDPPTHLAYIAVRSLA"
FT   gene            complement(506722..507837)
FT                   /locus_tag="BC1003_3973"
FT   CDS_pept        complement(506722..507837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3973"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bph:Bphy_3732 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3973"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59911"
FT                   /db_xref="GOA:E1TK87"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK87"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN59911.1"
FT                   /translation="MAFAINGKFTSQPVTGVQRVAYELTRAMQMRVPPGEQLEVYVPRD
FT                   TREPGARLKWQRRFPWLRGTLWEQITLPLVSRGVRLLNLCNTNPLFKRRQVVMVHDMAV
FT                   YDVPGGFSKKFVLWYRLCFFVLPRMQPMILTVSKFSRSRICHHLKVDESRVAVVHPAAD
FT                   HLDRVASDPAVLERLNLVKDVYCVVVGSLDPRKNLQRVLEAIEKLGHLDHVKFVVVGGK
FT                   NARIFNSDLSEQQPRSERVVWAGFVTDGELKALYENAGCLVFPSLYEGFGLPPLEAMYC
FT                   GCPVVASSRTSIPEVCGDAALYCDATSANDIAEKISLMMTDDVLRQRYKAMGYERAREF
FT                   RWDMTAQAVLELLKGQAGVRVSGVPASASAG"
FT   gene            complement(507884..510202)
FT                   /locus_tag="BC1003_3974"
FT   CDS_pept        complement(507884..510202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3974"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="TIGRFAM: capsular exopolysaccharide family; KEGG:
FT                   capsular exopolysaccharide family; PFAM: lipopolysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3974"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59912"
FT                   /db_xref="GOA:E1TK88"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK88"
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /protein_id="ADN59912.1"
FT                   /translation="MDYYPLNSLPGSASTERGQLSARAMLRLMRDHVWEIVLTTVVVFS
FT                   LAAAYLLIASPIYSADVLIRVDPPEPNALGLALQNQENLPPPAPSPVTEMGVIRSRSVL
FT                   QPVIERFRFDVSVTPRKLPLLGDIAEKFATPGEPSRPWLGLKSYAWGGEQVKIGVLDVP
FT                   KDLEEEKMTLVAGEDNTYELRGPQDQVFLHGTVGKPVSANGISMRVDELVARPNTEFTV
FT                   IRWNEVDAIKRFDNTIKVGDKLKDSGLVQIEYTDKSATKAAEVANALGQQYLATAIASR
FT                   QANDTTTLAFINGELPRLLGDLRKAEEALKAFRANSQSMQPTAEAQAYLQGGLDIDRQI
FT                   ATLQLQRTQLLERYTPQSRWVQSVDTQLAQLNSAKANFNGHFNGMPASERESVDLLRAQ
FT                   KVAETIYLGMVQKAEQLQVRRASTTGGAHIVDQAITPHRPVKPQPMLVLPGGLALGIVS
FT                   GIVLVFMRRHVLTGVTDPRYVERSMSMPVFGEILFSQQQSLLDRTNPGAKSLPGAAARA
FT                   GLPQPATGGVSEIQVPSGGTRILAERFPNDSSVEALRAVRTSLARDLAHSRNNILMVIG
FT                   PTPSAGKSFVAANIATLQAEIGARVLLIDADMRRGHLASLFNQSNRGGLSEVLSDRMPL
FT                   RNALRHTGIENLSFLSCGSRPDNPAALLARPRFKEVLERLSAQFDLVIFDTPPFLAVTD
FT                   ASIIASEAGASLLVLRSGMQSEEEIEDTIKKMERAEGRIAGAVFNGIPLRRSTRTYGYA
FT                   TNYASDYGDAEPTGGPLRT"
FT   gene            511319..512200
FT                   /locus_tag="BC1003_3975"
FT   CDS_pept        511319..512200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3975"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: transcriptional regulator, AraC family; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3975"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59913"
FT                   /db_xref="GOA:E1TK89"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK89"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADN59913.1"
FT                   /translation="MATAGAIGDAFRLANELSDGATDDSPYRLSVLSESGGLVTSSSGI
FT                   SIWTQSIDRNRLGDFHALFVACRDAARVLESNDRLLSWIARQGSIASFDIQQGANLVVV
FT                   CKDPLHSTVPIFLFDDAPTTARANSATPTDLALAQIERDIGTEVARKIADMLQTTYVES
FT                   DRFELDDASITTTTEKIRESARWIKENYSNPISVAKAAECAAMSKRNYQRRFKFEFGMT
FT                   PLEYLLRTRFEVVRAMLRNTDLPVDKIARRCGMGDGNRLGRLFKERYGMSPTQFRAQQR
FT                   LEVAERCVAIDD"
FT   gene            512312..513256
FT                   /locus_tag="BC1003_3976"
FT   CDS_pept        512312..513256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3976"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_3735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3976"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59914"
FT                   /db_xref="InterPro:IPR029465"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK90"
FT                   /inference="similar to AA sequence:KEGG:Bphy_3735"
FT                   /protein_id="ADN59914.1"
FT                   /translation="MTTTKSVQFSHDATSHHHKQRHESPARRLKEAVKSMLPAPLFLSL
FT                   LHHKEIGRYPNLLRPTTFNEKILQKNLRPDPWFVELTDKLTVREYVATKLGEEHVIPVL
FT                   AVPDAFTKEVFDALPDQFVMKANHGSSYVEVVRSKSATTFERLRDLANYWLSLDFYKIA
FT                   RERHYRQIKPRIFFEQLLLDHSGKIPADYKLHCFNGRSGRPTIYILVISDRFGGNTRGD
FT                   VYDVDWNHLDIAIGYYKRSPIPAPRPDNLEAILHAATKLCEDFDYVRVDLYAPDNKVYF
FT                   GELTFTPGAGVLPFTPDRIDYEWGKLVPDTFCR"
FT   gene            complement(513380..514708)
FT                   /locus_tag="BC1003_3977"
FT   CDS_pept        complement(513380..514708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3977"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_3736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3977"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59915"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK91"
FT                   /inference="similar to AA sequence:KEGG:Bphy_3736"
FT                   /protein_id="ADN59915.1"
FT                   /translation="MVKRRQFLGGLTALAGTYLLSACGGGGSEDGSASASAKASASPVA
FT                   KVTSAAASASGTAMPPAASITDGYGDVWTLANGVIYRNGSTVGNTYNVSLVLWYGGKIW
FT                   HCGTGGQFYVNADVAEQWLPCSDPRIDVASTAGSFFGINGHADYTYTPEQVVSFLKSMN
FT                   CTSYRVGVTDDPKDLDAVIKLAKAFQSAGLTLLALIDQGVYETGGIMASESIAYDRGRV
FT                   VGSTVANALKPYGVTIYECGNELTRQDATVVDFTSAGSKASDFNNHNWPIMRGVMRGMI
FT                   DGVKSAQPDAKCGINFCVADVGAADALWDGMQPDGSGGYPKVRWDITTWHNYEVYGDLF
FT                   NVGTDGAGPGFDLATYCKARYGVPLIVTEWNTGPEKSESYRGTYISDRLNAFYNARKTH
FT                   NIQSVMYYVLDSGDNTYGIMVNGKVIDAPYNAFTSFTSSHADT"
FT   gene            515974..516977
FT                   /pseudo
FT                   /locus_tag="BC1003_3978"
FT   gene            complement(517055..517387)
FT                   /locus_tag="BC1003_3979"
FT   CDS_pept        complement(517055..517387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3979"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="KEGG: bac:BamMC406_1974 cytochrome o ubiquinol
FT                   oxidase subunit IV; TIGRFAM: cytochrome o ubiquinol oxidase
FT                   subunit IV; PFAM: cytochrome C oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3979"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59916"
FT                   /db_xref="GOA:E1TK92"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK92"
FT                   /inference="protein motif:TFAM:TIGR02847"
FT                   /protein_id="ADN59916.1"
FT                   /translation="MAHMQSLSAESGHGSTGGYVCGFVLSVVLTAAAFWLVMRGALPAQ
FT                   TAMIALSVLAFVQIVVHLVFFLHIDMSAGQRWNVMALAYTALAALFLIGGTVWVMHNVS
FT                   MNMMSR"
FT   gene            complement(517387..517995)
FT                   /locus_tag="BC1003_3980"
FT   CDS_pept        complement(517387..517995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3980"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /note="KEGG: bph:Bphy_3647 cytochrome o ubiquinol oxidase,
FT                   subunit III; TIGRFAM: cytochrome o ubiquinol oxidase,
FT                   subunit III; PFAM: cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3980"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59917"
FT                   /db_xref="GOA:E1TK93"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK93"
FT                   /inference="protein motif:TFAM:TIGR02842"
FT                   /protein_id="ADN59917.1"
FT                   /translation="MSHKTLSIPLDGGHGNHGSSDTVFGFWLYLMTDCVLFASLFAVFA
FT                   VMSNQFAGGPSGKELFDISGVAVETAALLLSSITYGFAMLAARRGKSAAVLGWLAVTFA
FT                   LGLAFLVLEMREFSHLIAEGAGPGRSAFLSAFFTLVGTHGLHVTVGLVWMAVLAVQVVR
FT                   APKLSERELTRLACLSLFWHFLDIVWICVFSFVYLGSVL"
FT   gene            complement(517999..520005)
FT                   /locus_tag="BC1003_3981"
FT   CDS_pept        complement(517999..520005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3981"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /note="KEGG: bpr:GBP346_A2895 cytochrome o ubiquinol
FT                   oxidase, subunit I; TIGRFAM: cytochrome o ubiquinol
FT                   oxidase, subunit I; PFAM: cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3981"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59918"
FT                   /db_xref="GOA:E1TK94"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK94"
FT                   /inference="protein motif:TFAM:TIGR02843"
FT                   /protein_id="ADN59918.1"
FT                   /translation="MLGNLTLSAIPFDQPIIMGAGALMLVMVLAVVATLTRLHKWKWLW
FT                   HEWLTSVDHKKIGVMYIVVAVLMLVRGFVDAVMMRLQLALAYHSPGYLPPHHYDQIFTA
FT                   HGVIMIFFMAMALMVGLFNLVVPLQIGARDVAFPFLNSLSFWMTAISAILMNLSLVIGE
FT                   FAQVGWLAYPPLSELQFSPGVGVDYYIWSLQLSGVGTLITAINFFVTIVRMRAPGMTLM
FT                   KMPVFTWTALCSNVLIMATFPILTVALALLGLDRYMGMHFFTNEAGGNAMLYLNLIWAW
FT                   GHPEVYILVLPAFGIYSEVIATFSKKPLFGYRTMVYATCAIMVLAFLVWLHHFFTMGSG
FT                   ADVNAFFGIMTMVIAIPTGVKIFNWLFTIYRGRLEFSAPVLWTIGFMITFTIGGMTGVM
FT                   MAIPGADFVLHNSLFLIAHFHNAIIGGVVFGYLAGFHYWFPKAFGFKLNEKLGKCAFWC
FT                   WFVGFYASFMPLYVLGFMGMTRRLNHYDNPAWHPWLIAAACGVALIALGVVFQVAQVWV
FT                   SVVNRNKPQYRDVTGDPWDGRTLEWATSSPPPAYNFAIIPTVHELDAYAHMKETARTEA
FT                   KAPAYSDIHMPSNTSAGLFIGVFSLALGFAGVWHITWLAVAALLAIVATLIARSFGNND
FT                   GYYISADTVREIESKRGPAAAAVNNRELEAVEA"
FT   gene            complement(520009..520899)
FT                   /locus_tag="BC1003_3982"
FT   CDS_pept        complement(520009..520899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3982"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="KEGG: bvi:Bcep1808_2823 ubiquinol oxidase, subunit
FT                   II; TIGRFAM: ubiquinol oxidase, subunit II; PFAM: COX
FT                   aromatic rich domain protein; cytochrome c oxidase subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3982"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59919"
FT                   /db_xref="GOA:E1TK95"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK95"
FT                   /inference="protein motif:TFAM:TIGR01433"
FT                   /protein_id="ADN59919.1"
FT                   /translation="MVNKTFERVLIPLGAGLVACLSGCSNLEVLNPKGSVGMAEKSLIS
FT                   TATMAMLIVVVPVIIMVLVFAWRHRASNRNATYAPKWAHSTAIETVVWTVPTLIILFLG
FT                   ILTWNTTHELDPYRPIQSAVKPIKVEVVALDWKWLFIYPELGVASVNQLAFPVGTPVDF
FT                   RITSDSVMNSFFIPQLGSQIYAMAGMQTQLHLIADHAGDYAGISANYSGKGFSDMKFRA
FT                   LAVTPAQFDAWVEKVKASPRRLDMNAYNTVAQPSEKEPVGYFSSVDSRLFNNVIAKYNN
FT                   GNVLDLQNSNCRTKG"
FT   gene            complement(521199..522266)
FT                   /locus_tag="BC1003_3983"
FT   CDS_pept        complement(521199..522266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3983"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: bph:Bphy_5388 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3983"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59920"
FT                   /db_xref="GOA:E1TK96"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK96"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADN59920.1"
FT                   /translation="MPNKEPPATASAAAPDAVSPARRLRGGPKGLRITDVAAQAGVAPI
FT                   TVSRVFNSPETVAPETLERVRQVVQKLGYVPNRLAGGLSSSRSRLIAAIVPTIAHSLFS
FT                   ETVQVFSETMSRAGYQVLLALSGYDDSSEETLLDAVLSRRPEGVLLTGVAHTDSLRERL
FT                   ANVGIPIVETWDMTDQPIDMLVGFSHYQIGFAVAGHFLQRNVRKPGLVSANDQRALARR
FT                   RGFRERLAQAGIDEIPEVLVAPPSSVALGKSALPRLLDEAADLDAVFCGSDLLAIGALS
FT                   AARQLRLSVPSQLAICGFGDLEFATETTPQLTSVRVDGTRIGLTAARCLLDRIAGSAQN
FT                   KVTDVGFEIVQRGTT"
FT   gene            complement(522428..523756)
FT                   /locus_tag="BC1003_3984"
FT   CDS_pept        complement(522428..523756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3984"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bph:Bphy_5387 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3984"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59921"
FT                   /db_xref="GOA:E1TK97"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK97"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59921.1"
FT                   /translation="MKITTPAIDESRLINRLALRLMPLLGLLYLVAYIDRSNISFAKLQ
FT                   MLGSLGLSEVAYGLGASLFFIGYLIFEVPSNVMLHKYGAPRWMARIMLTWGVVTILLAF
FT                   TTNATMFYVLRFLLGASEAGLYPGVIYYLTLWFPARHRVRMLGYFTLGSSLGNMLGAPI
FT                   CGWLLDKGGFAGLQGWQLVFIVTGLPSVLLTVVVLFMLPASPKEARFLSADEKAWLSST
FT                   LEAERAQIRASVASHGSLLSVLTEPRVIGMALYYMMLSISVYGVSYWLPTLVKGFGVSN
FT                   TTNGLLNIVPWLMATVVLAWLPSRLRGAGDRALIAMLVSALLGVTCFASAVFLPTNTLR
FT                   FVALCFGAPCMYLLLPCFWTLPPKFLTGARAAAGIAAINSLGNIGGFIAQNLVPWVRQT
FT                   TGSVKAPMLIPATCLLLFAAITVFILRRERNVRSTRGAMAVTE"
FT   gene            complement(523849..524583)
FT                   /locus_tag="BC1003_3985"
FT   CDS_pept        complement(523849..524583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3985"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   bph:Bphy_5386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3985"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59922"
FT                   /db_xref="GOA:E1TK98"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK98"
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /protein_id="ADN59922.1"
FT                   /translation="MSATEVVVSEATLEQLRHVSTATLTTQLFKRGLRNVFLQGVAPLV
FT                   KPAPGAANVVGPAFTLRNIPAREDLDHVGVFQDPEHPQRKAVETAPAGSVLVQDCRGER
FT                   AAASVGSILALRLAKRGVAGMVSDGPVRDSGTIAALGLPIWCAGASAPLNLAKHHAVDM
FT                   NVPIACGGVAVYPGDIVVADVDGVVIVPREMAAEVARDAAEQEQLEAFIAQRIEEGRPL
FT                   RGTYPPNEETMAAYAQWRAQQQ"
FT   gene            complement(524600..526378)
FT                   /locus_tag="BC1003_3986"
FT   CDS_pept        complement(524600..526378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3986"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: bph:Bphy_5385 dihydroxy-acid dehydratase;
FT                   PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3986"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59923"
FT                   /db_xref="GOA:E1TK99"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:E1TK99"
FT                   /inference="protein motif:PRIAM:4.2.1.9"
FT                   /protein_id="ADN59923.1"
FT                   /translation="MANRKTPEQLRSYRWYGVNDLRSFGHRSRTAQMGYHPSDYMGKPV
FT                   IAVVNTWSEINSCHTHFKQRVEEVKRGIWQAGGFPVEMPVMTLAEPFQKPTTMLYRNFL
FT                   AMETEEILKSYPFDGCVLMGGCDKTTPGLLMGAISMNLPAIYLPAGPMLRGNWNGRTLG
FT                   SGSDTWKYWAELRAGKISEDEWKGIESGIARSPGHCMTMGTASTMTSAAEALGLTLPGF
FT                   SSIPAVDSRHAQFASLTGQRIVEMVWTDLKPSDILTAKSFDNAVTTVLAMSGSTNAIVH
FT                   LVAVARRAGIDLTTARFDELSRITPVIGNVRPAGEYLMEDFFYAGGLRALLVELGELID
FT                   GSQLTVNGSTLGENISGAEIFNDDVIRRRSNPIVASDGLAVLTGNLAPDGAVIKPAAME
FT                   AHLLKHRGPAVVFKDYADMAARIDSEELEVSADSVIVLQHAGPVGAPGMPEWGQLPIPQ
FT                   KLLKQGVRDMVRISDARMSGTSYGACVLHVAPESFVGGPLALVKDGDMIELDVAARRLH
FT                   LDVSDEELAARKAAWQAPKLPFERGFGVMHQLHVLQANKGCDFDFLEEPMKAAAAAPVR
FT                   QEPATPGAKHGEPEIH"
FT   gene            526600..527448
FT                   /locus_tag="BC1003_3987"
FT   CDS_pept        526600..527448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3987"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: rpf:Rpic12D_4151 transcriptional regulator,
FT                   IclR family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3987"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59924"
FT                   /db_xref="GOA:E1TKA0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TKA0"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADN59924.1"
FT                   /translation="MARSSDTARTPQGVTSSGIDVLDRAASILFAFRRNDEPLTLTELS
FT                   ERTGLYKSTLSRLAQALCHHQLLIRHDDGRFWIGSAAMHLSAVYEAGFDLRDVLLPAMK
FT                   ELSAETGEAVSFHVRERDHRVCLYRIASRHSIRAEVQQGDTQPLERGAGGRVLLAFSGE
FT                   PGEPYDTVRSRYVYLSMGERDRETSGISAPVFRVGQELVGALGIVGPSARMGMEEMERY
FT                   RPRLLDFAARVTKLLGGDPEPLLTAAGALDTASGQAASERPGPQQKQPDATGQTQENEN
FT                   A"
FT   gene            527441..528757
FT                   /locus_tag="BC1003_3988"
FT   CDS_pept        527441..528757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3988"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpt:Bpet3200 putative transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3988"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59925"
FT                   /db_xref="GOA:E1TKA1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TKA1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59925.1"
FT                   /translation="MLKWYTELTKPEKRTYWACFSGWGLDAMDTQMYALAIPTLIALWG
FT                   MTRGQAGVLGTTVLIMASLGGWIAGILADRYGRVRVLQITILWFSAFTLLSAFTNSFGQ
FT                   LMVTRGLQGLGFGGEWAVGAVLISETIRPQVRGRAVGSLQAGWAVGYGVAVLLSTLIFS
FT                   SLQPEWAWRVLFAIGIVPTLLVLWIRRHIKEAPVFAQIRREHAADRPSIWAVFDRSTRV
FT                   TTFKAILLTFGIYGGNYVMITWLPAYLKLVLHLSITNIGGYLAINILGSFAGAFLNGWM
FT                   ADRFGRRRTFIVIAFLQAIAVATYTLAPITLPVTLVLGFVLGTLQSGTAAGTGAYIAEL
FT                   FPTRIRASAQGLCGNAGRAIGAIMPAMVGVLSAKLELGAAMGMCACASYALVVIAALML
FT                   PETRGRDLSDVKVSAASSTDEARQQEDITAQRADTALPR"
FT   gene            528796..529821
FT                   /locus_tag="BC1003_3989"
FT   CDS_pept        528796..529821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3989"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bph:Bphy_6375
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3989"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59926"
FT                   /db_xref="GOA:E1TKA2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1TKA2"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADN59926.1"
FT                   /translation="MIIDIHGHYTTAPKALENWRNRQIAALGNPTDAPRPSELQISDDE
FT                   LRESIETNQLRLMRERGLDLTVFSPRASFMAHHIGDFNVSSTWAAICNELCYRVSQLFP
FT                   ENFIPAAMLPQSPGVDAATCIPELVKCVEQYGNVAINLNPDPSGGHWTSPPLSDRYWYP
FT                   VYEKMVEYDIPAMVHVSTSCNACFHTTGAHYLNADTTAFMQCLTSDLFRDFPALKFVIP
FT                   HGGGAVPYHWGRFRGLAQEMKKPLLEEHLLKNIFFDTCVYHQPGIDLLTKVIPVDNILF
FT                   ASEMIGAVRGVDPQTGHYFDDTKRYVEAADMNPEQRDKIYEGNARRVYPRLDAALKAQG
FT                   R"
FT   gene            529824..530507
FT                   /locus_tag="BC1003_3990"
FT   CDS_pept        529824..530507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3990"
FT                   /product="4-carboxy-4-hydroxy-2-oxoadipate
FT                   aldolase/oxaloacetate decarboxylase"
FT                   /note="KEGG: bmj:BMULJ_05489 hypothetical protein; TIGRFAM:
FT                   4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate
FT                   decarboxylase; PFAM: Dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3990"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59927"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR014165"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:E1TKA3"
FT                   /inference="protein motif:TFAM:TIGR02798"
FT                   /protein_id="ADN59927.1"
FT                   /translation="MYELGVVYRNVARADSRIADGLGALGSATVHEAMGRVGLMKPYMR
FT                   PIYTGAHAFGTAVTVLLHPGDNWMLHVAAEQIQPGDAVVAAVTADCTDGYFGDLLATSF
FT                   KARGARALIIDAGVRDVSVLTEMNFPVWSKAISAKGTIKATLGSVNIPVVCAGALVAPG
FT                   DVIVADQDGVVVVPSAKAQETLEKASAREANEAQKREKLASGVLGLDMYQMREPLKQLG
FT                   LRYID"
FT   gene            530564..531466
FT                   /locus_tag="BC1003_3991"
FT   CDS_pept        530564..531466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3991"
FT                   /product="Phosphogluconate dehydrogenase, NAD-binding,
FT                   putative-like protein"
FT                   /note="PFAM: Phosphogluconate dehydrogenase, NAD-binding,
FT                   putative-like; NADP oxidoreductase coenzyme F420-dependent;
FT                   KEGG: pna:Pnap_2165 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3991"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59928"
FT                   /db_xref="GOA:E1TKA4"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TKA4"
FT                   /inference="protein motif:PFAM:PF09130"
FT                   /protein_id="ADN59928.1"
FT                   /translation="MSQSPQQSAARIAIIGFGEVGPIFARAFTEAGRAVSTFDIKLADP
FT                   ATRSAIVERAQQSGAQLADDLASALRDAQLVFSAVTASQAEAVASAAAAHLVKGQVFID
FT                   LNSVSPAVKQRNSVTVQRSGADYVEAAVMAPVPPQGIRVPMLLGGRVAAQTAELLNGLG
FT                   MRPEAVAQEVGLASAIKLCRSIMIKGMEALCVQSMLAARQFDVDGRVLASLAASFPGVG
FT                   WDAGYEAYLIGRVVEHGQRRSEEMREAASMLESLGMSGTLASAVADVQEQLAARALPLV
FT                   EKLDNKGALPEWRTLLKPA"
FT   gene            complement(531540..532457)
FT                   /locus_tag="BC1003_3992"
FT   CDS_pept        complement(531540..532457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3992"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3992"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59929"
FT                   /db_xref="GOA:E1TKA5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TKA5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADN59929.1"
FT                   /translation="MRKLLEPSLYYFSVVAQTGSLTSATEKLGLTVSALSRHIAKLEGD
FT                   IGVPLFERHARGMVLSHAGRLLFRHAQRTLADAQAVFDEIQGDERRRARTLTIACTEGF
FT                   AFDFLPVSLGAFCAQQPDVAIRLEVVPAERASQMLLSGEASIGLAFTFKPEPGVLVQFT
FT                   QRAPVMALMHDDHPLASRPQIALKDLPAYPVLLQDKGTTNRQLFDIACSVEGIEIEPMM
FT                   TSRYVAALYRFAQAVPNAIMPSGYVSVAKRLAVDHLTAIPFDNPLLAQRRLQVITLAGR
FT                   QLDDLAQECLDWIVEDLKRTSERA"
FT   gene            532644..534032
FT                   /locus_tag="BC1003_3993"
FT   CDS_pept        532644..534032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3993"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3993"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59930"
FT                   /db_xref="GOA:E1TDA2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDA2"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ADN59930.1"
FT                   /translation="MSRQSALTLARTHFDSGEFLAVLSRRVGLATESQRADAAPLLRRY
FT                   LSDEIEAALSALGFICEIVENPVPGMPPFLIGERLESPSRPTVLLYGHGDVIDGDAANW
FT                   SNERSPWQVRVEGERWYGRGIADNKAQHSINLAALAAVFAERGELGFNAKIVFEMGEEV
FT                   GSPGLDAICANLRERLSADLLIASDGPRQRAASPTMFLGSRGALHFRLSVTNAFGARHS
FT                   GNWGGVLANPATVLANALASLVDGHGRIRVNGLLPPPIPPQVRERVAHLQIGADADDPP
FT                   LSPNWGEPGLTPAERVFAWNTLEVLAMQSGNVANPVSAIPRSAQAVCQLRFVVGTDWRR
FT                   AKELIEAHLAREGFTGIEVTIEASGNATRLDPNDPWVAFTERSIEASTGKPVTLLPNLG
FT                   GTIPNECFADTLGLATIWIPHSYPGCRQHAPDEHVLAPVMQEALQLMTGVFWDLGEPDV
FT                   PHRR"
FT   gene            534088..535380
FT                   /locus_tag="BC1003_3994"
FT   CDS_pept        534088..535380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3994"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3994"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59931"
FT                   /db_xref="GOA:E1TDA3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDA3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59931.1"
FT                   /translation="MNSTVIEDRVQQTSGTPMRRLIVATSVGNALEWFDFAAYGFFAVT
FT                   LSKLFFPAHDETVSLLLTFGTFGLSYVFRPLGALLLGRYADRHGRKAALLVSLALTTIG
FT                   TLICAVIPTYASIGLAAPIGLMTARILISFSTGGEFGSGTALMIEQKSKRKAFLASWQF
FT                   SSQGMSTVLASCAGLALSTQLSPAQIESWGWRAPFIFGLLVAPVGLYIRKHIDDTLPAA
FT                   GHATARNAPVRELLAHSKGRILIAAGIMAVSTAASYLMILYMPTYAVKQLHLPASTGFA
FT                   ATVVTGTILMVFTPLMGHLSDRYGRSRMMVISAIATLVTIYPCFVWLIKSPSFAVLMAI
FT                   MSLAGALKAIYFGPLAAVLSSLFPTSVRSTGLGFSYNIGVMVFGGFTPWLVTAMIGATH
FT                   DPLSPAFYLMACAALSLACIALYHFKLVKHI"
FT   gene            535420..536559
FT                   /locus_tag="BC1003_3995"
FT   CDS_pept        535420..536559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3995"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG:
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3995"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59932"
FT                   /db_xref="GOA:E1TDA4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDA4"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADN59932.1"
FT                   /translation="MHQPAPADDFSGWFMYHSVGVYPCHREAMTAALAGFAASWCAPDD
FT                   RRWDAALAARARLLSDWAELIGAQPANVFGAQNVTDTFARYLDGLADQTLRGRTVLVAA
FT                   DCFPSLHFLLSGLAQARGFTLRTVALREGQAYVRDEDFLEAWTGDVALALVTWVSSLTS
FT                   RRVNLAAICEHARRRGSRVALDVTQGIGILPFDVNTTPFDFVCGSTLKWLCGAPGTGLG
FT                   YIAPHALAQEATPAVRGWFSQQNPFNWDIDAFAYASDARRFDTGTPSVLPFVASQPGMT
FT                   WMRSQPAGSVREHNLALCHQLIAMLDEKRYRLLSPRNDDERGGSIMAEAPAHLDAAQLV
FT                   VKLNEAGVFVDSRSRTLRFSPGVCTTPAGLERLAQCLPR"
FT   gene            536683..537807
FT                   /locus_tag="BC1003_3996"
FT   CDS_pept        536683..537807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3996"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3996"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59933"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDA5"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADN59933.1"
FT                   /translation="MNSSTHGCADSDAAIAGIHGFVVPMKCTDLPATMQFFIERLGFRL
FT                   DAIFPADGPRTAILSRDGFRIQLGLDTPDGLRDLYVLCDDPLQLRGEARELIAPNGVTV
FT                   RLVHADPPMKLPPTRQQLVLAQANGDAHWSVGRAGMRYRDLLPERHGGAFIASHIRILQ
FT                   GGPVPDYVHYHKIRFQTIFCRKGWVRLVYEDQGEPFVLEAGDCVLQPPEIRHRVLESSA
FT                   GAEVIELGSPAEHITMADHELTLPTPFSRPEREFNGQRFVRHIGKNASWKPWTSPGFDV
FT                   TDTGIGAATGGLAGVRVVRASGNAEPQVRRHDTEFCFFFVLTGSLEVTHGEQRWQLLAD
FT                   DSIAIPGELPYTFSQYSADLELLEVTLPADVLLS"
FT   gene            538027..539208
FT                   /locus_tag="BC1003_3997"
FT   CDS_pept        538027..539208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3997"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bph:Bphy_2684
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3997"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59934"
FT                   /db_xref="GOA:E1TDA6"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDA6"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ADN59934.1"
FT                   /translation="MLTTRKALSGAAILAACGISSAHASSVTLYGLIDYGVNYQSKSGG
FT                   GRVIGGSSGIMQGSRWGFKGVEDLGGGLSAIFTLENGFDLGKGTSLQGGNLFGRQAFVG
FT                   LSSDAYGTLTLGRQYDSLVTFVESRMNSANFGGGTTAHPGDLDNLNNSKRVNNSVKYTS
FT                   PKMGGFTIGGVYGFGGQAGDFARNQIWSAGVGYEYGGFSAGAAFMNVRNPNQSYFTSTP
FT                   TNVAGANLNNMSSSPVYSGYASAHTYQAIAAAGRYTLGPATFGLVYSNVQFKNLGDTSS
FT                   GSNPLHLSGTAKFDTAEFNLTYYWTPLLLSELVYSYTRGSGVGTIGSSRYNNVSLSLDY
FT                   YLSKRTDVYVIGSTEFAGGTDSTGKAARATLNALSASSSNRQTFVQLGIRHKF"
FT   sig_peptide     538027..538101
FT                   /locus_tag="BC1003_3997"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(539309..540991)
FT                   /locus_tag="BC1003_3998"
FT   CDS_pept        complement(539309..540991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3998"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_3739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3998"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59935"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDA7"
FT                   /inference="similar to AA sequence:KEGG:Bphy_3739"
FT                   /protein_id="ADN59935.1"
FT                   /translation="MVKRREFLGLLTAVGGSYMLSACGGGGGSGGDSKGTSTGTTTNAN
FT                   SSSPGGATGATGTGTATTGSTGGTQGNATSSGSTGNNGASNSSTPASADGTSIPPAASI
FT                   VDNQSAVWTLVGGSVYRNGVKAGNTYSVSLLLWYGGIVYHAGTGGQFYGWSGSAWYACA
FT                   DPRFGATSADGTTIPGASRIIDKVGAVWTVASGVVLRNNATVGVTSNVALLLWYGGKLW
FT                   YRATGGQFYVCNDIDQWLPCTDPRISVAATSGTFHGINGHYDYRYTPAQVVSIMQNMGC
FT                   STYRVGVTDDSTELAAVVALAQAFQSAGLTLFVLIQIGMRDANGALLASEAAAYSRGHS
FT                   CGVTVAAALAPYGVVMYECGNELTRDPAIILDSTNAGTKAVDFSNANWPIMRGLMRGML
FT                   DGVKAAQPAAKCGINFCVADVGAADALWDGTQPDGTSGYPTVRWDMTTWHNYEVYGDIF
FT                   DIGSDGSGPGFDLPTYCKARYGMPFLLTEWNTGPEKTLAYRADYISSRYASYYEARKTK
FT                   NIQSTMYYELDSGNTTYGVMIDGVTVNLTYNAFVSAVASHPDH"
FT   gene            complement(541386..542534)
FT                   /locus_tag="BC1003_3999"
FT   CDS_pept        complement(541386..542534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_3999"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="PFAM: protein of unknown function DUF1501; KEGG:
FT                   bpy:Bphyt_5025 protein of unknown function DUF1501"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_3999"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59936"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDA8"
FT                   /inference="protein motif:PFAM:PF07394"
FT                   /protein_id="ADN59936.1"
FT                   /translation="MSSRRQFLRVAAAGAGAILVSPRIAFARVVTQRRFVFVIQRGAAD
FT                   GLNIVVPYAEPAYSTLRGALAIDPASAHRLDGTFALHPALTQMAEMYAQRQALFVHAVA
FT                   SPYRDRSHFDGQNVLETGGVSPYQVKDGWLNRLATLLPAARETAIAFAPTVPMALRGAA
FT                   AVTSYAPSALPAAPDDLLMRVSQLYDDDAQLRPLWESAMTARGLAGDAGARQDPASLGK
FT                   LAAGFLARDDGPRIAMIETGGWDTHSAQNARLGNQLKALDTMLAALRDGMGAAWSETTV
FT                   LVATEFGRTAAANGTEGTDHGTGSVAMVLGGAVAGGRVLADWPGLAPRDLYEARDLKPT
FT                   ASLDALIAGVTSEGLGLDPQRTARTLFGRTARVKPMNGMVRA"
FT   sig_peptide     complement(542451..542534)
FT                   /locus_tag="BC1003_3999"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.991 at
FT                   residue 28"
FT   gene            complement(542537..544090)
FT                   /locus_tag="BC1003_4000"
FT   CDS_pept        complement(542537..544090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4000"
FT                   /product="protein of unknown function DUF1800"
FT                   /note="PFAM: protein of unknown function DUF1800; KEGG:
FT                   bpy:Bphyt_5024 protein of unknown function DUF1800"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4000"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59937"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDA9"
FT                   /inference="protein motif:PFAM:PF08811"
FT                   /protein_id="ADN59937.1"
FT                   /translation="MAVSPNLTPAAIALNRFGLGARADDTPPAAPKAWLLAQLEQYEPR
FT                   PAAWADQPDSLALSSELEQQRLQLREQRQRKPGDAGGASMVDTQANTRVNTDANTQANT
FT                   QANTQSEQTAAAQSTAKQAKDAERKAMHVEIRDRYRSAVNARVTSALSTPTPFVERLVH
FT                   FWANHFAVSTEKPAVAALAGSFEAEAIRPHVLGRFEDMLVAVERHPAMQVFLDQTRSVG
FT                   PDSMAALRAAARNPQSRRGLNENLAREIMELHTLGVRSGYSQSDVTEFAQALTGWSVAN
FT                   TPVGAGTSRMSGTAPAPGTFAFREALHEPGVRTVMGRRYDQRGEEQALAILHDLATAPA
FT                   TAQHIGGKLARHFIADTPPAGASDKLADAFQTSGGDLPTVYRALLDLHEAWSPTAVKFK
FT                   TPWEWAISSMRGLGWQDLGKLQAAPLFAQLGQPVWRPGSPSGYDDVAASWAAPDALVRR
FT                   VEVAQRFAARVGDRLDARSLGEVLLPGSLGAPTTVAIARAESASTAIALLLVSPDFQRR
FT                   "
FT   gene            complement(544166..544687)
FT                   /locus_tag="BC1003_4001"
FT   CDS_pept        complement(544166..544687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4001"
FT                   /product="putative membrane-associated protein"
FT                   /note="KEGG: bpy:Bphyt_5023 putative membrane-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4001"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59938"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDB0"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5023"
FT                   /protein_id="ADN59938.1"
FT                   /translation="MNSRAWKIVLVVSLVLNVFLLGAIAGGAYRWYAAREAAAPLSAQQ
FT                   RALRFAAQTLSPERQKAFADSLKNGRRDGREFAREAREGRREVLRLLAAPQLDRAALDA
FT                   ALARTRAADSELRAKVEGSVADFAATLSPQERIEFAESLRLRGQWREPQANPKGAGPAN
FT                   PASLNAASGQ"
FT   sig_peptide     complement(544610..544687)
FT                   /locus_tag="BC1003_4001"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.702 at
FT                   residue 26"
FT   gene            complement(544684..545100)
FT                   /locus_tag="BC1003_4002"
FT   CDS_pept        complement(544684..545100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4002"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59939"
FT                   /db_xref="GOA:E1TDB1"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDB1"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3824"
FT                   /protein_id="ADN59939.1"
FT                   /translation="MTPERFHQIVEAYGADPRRWPEEERAAAQAWTQTHRQQADAWLAQ
FT                   AAGLDAWLAADRLAPPDAALQRRIVASAPVRRPHAQRRAWWWSGAAVAGVGLLGGVAGA
FT                   LAVSLFVLSEAVPPVHDSYLTSSFGGASADWSGE"
FT   gene            complement(545097..545657)
FT                   /locus_tag="BC1003_4003"
FT   CDS_pept        complement(545097..545657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4003"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: bxe:Bxe_B1629 sigma-24 (FecI); TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4003"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59940"
FT                   /db_xref="GOA:E1TDB2"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDB2"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADN59940.1"
FT                   /translation="MSERDPDAELLEQVGRRDAAAVRTLVARKLPRLLAFATRMLGDRM
FT                   EAEDVAQEVFVRIWKHAARWREGEAKFDTWIHRVALNLCYDRLRGRREQVRDELPDEID
FT                   PAALPDARLEARSRDARIREALAALPVRQREALVLCYYQEMSNIDAAALMGITVDALES
FT                   LLARARRNLRAQLADSGLSKDKP"
FT   gene            complement(545769..545870)
FT                   /locus_tag="BC1003_4004"
FT   CDS_pept        complement(545769..545870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4004"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59941"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDB3"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5020"
FT                   /protein_id="ADN59941.1"
FT                   /translation="MKTLVILLLAATLAGCVVYPARPVYYRPAVVVY"
FT   gene            complement(545901..546221)
FT                   /locus_tag="BC1003_4005"
FT   CDS_pept        complement(545901..546221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4005"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bxe:Bxe_B1630 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59942"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDB4"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1630"
FT                   /protein_id="ADN59942.1"
FT                   /translation="MTSTKSLRIGSLMLVAALACTAALSSSPASAQAVIVAPLAPPPPR
FT                   VEVVPAPRAGYVWDQGRWRWHHGRYVWVPGHWQVVRPGYHWVPGHWVQRGPNWRWVEGH
FT                   WA"
FT   sig_peptide     complement(546126..546221)
FT                   /locus_tag="BC1003_4005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 32"
FT   gene            546725..547843
FT                   /locus_tag="BC1003_4006"
FT   CDS_pept        546725..547843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4006"
FT                   /product="alanine dehydrogenase"
FT                   /note="KEGG: bph:Bphy_5016 alanine dehydrogenase; TIGRFAM:
FT                   alanine dehydrogenase; PFAM: alanine dehydrogenase/PNT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4006"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59943"
FT                   /db_xref="GOA:E1TDB5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDB5"
FT                   /inference="protein motif:TFAM:TIGR00518"
FT                   /protein_id="ADN59943.1"
FT                   /translation="MRVGVPKEIKNHEYRVGLTPSSVREMVAHGHTVTVETGAGNGIGV
FT                   SDAVYEKAGAKIAARAQDVFATAELIVKVKEPQAGERAMLRDGQILFTYLHLAPDPQQC
FT                   ADLVQSNAVCIAYETVTQAAGGLPLLAPMSEVAGRMSIQAGAFCLERAHGGKGILLGGV
FT                   AGVPSAKIVILGAGVVGSNAAQIAVGTGAQVVVIDRNLEALRRMDRQFGARVMTVFSNQ
FT                   DNVEKHVLEADLVIGGVLIPGAAAPKLVTRQMVQAMQPGAAIVDVAIDQGGCCETARPT
FT                   THAEPTYMVDDVVHYCVANMPGGVPRTSTYALNNATLPFALQIADKGWRKALQNDPHLR
FT                   NGLNVAFGKVTCREVAEALDYMWESPESVMAM"
FT   gene            547857..548138
FT                   /pseudo
FT                   /locus_tag="BC1003_4007"
FT   gene            complement(548143..549399)
FT                   /locus_tag="BC1003_4008"
FT   CDS_pept        complement(548143..549399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4008"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_1341 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4008"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59944"
FT                   /db_xref="GOA:E1TDB6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDB6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN59944.1"
FT                   /translation="MTASTNTNARATPAAAHDSRGRSIALAASLALIAFSLRTPITSVG
FT                   PILVEAVRATNLSRTGASILTTLPSLCFGLFGPLAPMLARRLGSERALLALLLLLTAGT
FT                   ALRIVPAWPVLYIGQIVACFAIGLMNVLMPGVVKRDFPHHVALMTGIYSAAMCAGAAAA
FT                   AAATVPAANALAHVLGGAGGNAWAWALALWALPVGLATLVWGVQLPAKSTHAGKRVHVV
FT                   RGLWRDPLAWKVTLFMGSQSSLAYIVFGWLPTVLRTRGMSAVDAGFMLSISVVTQAVAS
FT                   LLLPFLLARLRDQRMVNVSALLLTGVGLMGCFFAPLSTVWVWALLLGMAQGASFTLALT
FT                   VIGLRSYDSHVAAQLSSMAQGIGYLIASCGPFIAGSLLHATGSLNSLAALCGGVGAVSA
FT                   WFGYAAGRPEHVKAEAHVE"
FT   gene            complement(549740..550906)
FT                   /locus_tag="BC1003_4009"
FT   CDS_pept        complement(549740..550906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4009"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bph:Bphy_3709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4009"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59945"
FT                   /db_xref="GOA:E1TDB7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDB7"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADN59945.1"
FT                   /translation="MAIPLSYIARNLWTRRLTTALTAGGLALVVFVFSTVLMLDAGLKK
FT                   TLVSTGEENNVVVIRKGAETEVQSAIDRNQANVIEMHPAVAVGGDGRRLASKESVVLIS
FT                   LAKIGSGKPSNVVIRGVSQAGIGLRPQVRLAAGRLFTPGSSEIVAGSSIAKGFAGTQPG
FT                   EHLRFAQREWTVVGTFDAGGSGFDSEIWGDADQLMQAFRRTSYSSMVVRLAQGDQFERF
FT                   KSDIDVDPRLADEAKRERTFYSDQSRALSTFLNILGFTLSAIFSIAAMIGAMITMYASV
FT                   ANRVAEIGTLRALGFKRANVLAAFLVEAMLLGLVGGLAGLGCAAFMQFASFSTTNFQTF
FT                   ADLSFRFILTPAIVGKTLAFSVTMGLVGGFLPALRASRMNIVDALRAR"
FT   gene            complement(550913..552067)
FT                   /locus_tag="BC1003_4010"
FT   CDS_pept        complement(550913..552067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4010"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bph:Bphy_3710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59946"
FT                   /db_xref="GOA:E1TDB8"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDB8"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADN59946.1"
FT                   /translation="MHALKLITRNALRHKLRTALTVLGLTIAVLAYGLLNTVVDAWYAG
FT                   AAAASNARLVTRNAISLSFSLPLSYENRIRGVEGVTLVARSSWFGGVYREPKNFFAQFA
FT                   VSDNYLDLYPELVVPAQQRSDYQRDRKGCLVGRQLATQFGFKVGDVIPIKGTIYPGTWE
FT                   FVVRGIMDGRDESTITRQLIFHWDYLNESVRKMPGRRADQVGVYVLGIEAPEEAAAISR
FT                   NVDDVFRNSLAETLTETEQAFQLGFVAMSNQIIAAIRVVSYVVIVIIMAVMANAMAMSA
FT                   RERTVEYATLKALGFGPGFLALLMFGESLTLCIAGGGLGMLLTPPAASIFRQATGGVFP
FT                   VFHVSRETMLLQAACAGVVGVAAAIIPAIQAARVRIVEGLRAIG"
FT   sig_peptide     complement(551966..552067)
FT                   /locus_tag="BC1003_4010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.764) with cleavage site probability 0.357 at
FT                   residue 34"
FT   gene            complement(552089..552793)
FT                   /locus_tag="BC1003_4011"
FT   CDS_pept        complement(552089..552793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4011"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bph:Bphy_3711 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4011"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59947"
FT                   /db_xref="GOA:E1TDB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDB9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADN59947.1"
FT                   /translation="MNRANGAAPLVEILHLVKSYRRGAQIVPVLSDITLSIGEGDFIAL
FT                   MGPSGSGKSTLLNLIAGIDRPDGGVLRVGGLDITQLSEGALAEWRAANVGFIFQFYNLM
FT                   PVLTAFENIELPLMLTRLTRKERRERVELVLEMVNLANRAHHYPSELSGGQQQRVAIGR
FT                   ALITDPTLIVADEPTGDLDRASAEEVLAMLQRLNRELGKTIIMVTHDANAASAANALVH
FT                   LDKGELSDGNTR"
FT   gene            complement(552813..554159)
FT                   /locus_tag="BC1003_4012"
FT   CDS_pept        complement(552813..554159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4012"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: bph:Bphy_3712 RND family efflux transporter
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4012"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59948"
FT                   /db_xref="GOA:E1TDC0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDC0"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADN59948.1"
FT                   /translation="MHGGTTCGGVMIYRARGFAREPRRYTGCPIYIASSRAARASPRRT
FT                   DKKLAEHDLKKLRIDRAPVTARRRRNWTGYGVAALVLVGALVAGLRFASPRTVQTTSVV
FT                   SAYPSQSYTLLNATGYVVPQRKAAVASKAQGRLEWLGVLEGTRVKKDEVIARLESADVE
FT                   ASLAQAKAQVKVAQANLALQVAELKNAELNLRRSAVLVPGGAMPATQYDADLARYDKAK
FT                   ASIDNSRAAIVSAQANAQAAQVAVDQTVIRAPFNGVVIEKHANVGDNITPFSQASDSKG
FT                   AVVTIADMDTLEVEADVAEANIAKIAVDAPCEIQLDALPELRLAGRVSRIVPTVDRSKA
FT                   TVLVKVRFVDRDARVLPDMSAKIAFLSKPVPPQDRRPVVAAQPAAVVQRDGRIVVFVIK
FT                   DETVHQVPVTTGAKLGDLIALDGVHAGDLLVRAPDAQLKDGAKVNVAKP"
FT   gene            554261..554578
FT                   /locus_tag="BC1003_4013"
FT   CDS_pept        554261..554578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4013"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: transcriptional regulator, ArsR family; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4013"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59949"
FT                   /db_xref="GOA:E1TDC1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDC1"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADN59949.1"
FT                   /translation="MKRTPIAPDIDAIHKALANPVRREILGWLREPHAHFADQELPLDH
FT                   GVCAGKIDARCGLSQSTVSAHLAALQRAGLVTSKRVGQWVFFKRNEPVIQAFLEHMNSK
FT                   L"
FT   gene            554674..555735
FT                   /locus_tag="BC1003_4014"
FT   CDS_pept        554674..555735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4014"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bxe:Bxe_B2018 putative N-ethylmaleimide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4014"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59950"
FT                   /db_xref="GOA:E1TDC2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDC2"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADN59950.1"
FT                   /translation="MPTLFDPLQIGDLTLPNRIIMAPLTRQRAEEIRVPNALMAKYYAE
FT                   RATAGLIISEATSVTPQGVGYAETPGIWSQEQVEGWKLVTNAVHAAGGKIFLQLWHVGR
FT                   ISDPLFLDGELPVAPSAIAAKGHVSLVRPERPYVTPRALELDEIAGIVQAFRKGAENAK
FT                   AAGFDGVEVHGANGYLLDQFLQDSTNKRTDAYGGPIENRARLLLEVTDACIDVWGAQRV
FT                   GVHLAPRRDAHDMGDSNPAATFGYVARELGKRKIAFIAAREALGEDRLGPQLKKEFGGP
FT                   YIANEKFTKESAQQVLDAGEADAVAWGQLFIANPDLVRRFALNAPLNKPNPATFYARGE
FT                   AGYVDYPALETVE"
FT   gene            complement(555894..556418)
FT                   /locus_tag="BC1003_4015"
FT   CDS_pept        complement(555894..556418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4015"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59951"
FT                   /db_xref="GOA:E1TDC3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDC3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADN59951.1"
FT                   /translation="MQPVDVTFRLAAPHEAETIRLIEFEAGARFASVGMAGIADAPPMS
FT                   VELVARKIAAQEIIVAVDGDDVCAGFVMFEPQAERIYVQELDVLTSHAGRRIGAALIDE
FT                   VARLARSRKLLQLVLSTYREVPWNAPYYRRLGFREIAEAELDPALVARRNAHIARGLDE
FT                   SRRVFMRRDLG"
FT   gene            complement(556461..556715)
FT                   /locus_tag="BC1003_4016"
FT   CDS_pept        complement(556461..556715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rcu:RCOM_2117160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4016"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59952"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDC4"
FT                   /inference="similar to AA sequence:KEGG:RCOM_2117160"
FT                   /protein_id="ADN59952.1"
FT                   /translation="MHWKTKSALLAVSIAALTTGMSGCKKVDDTSKDTTSSASSGVMSN
FT                   SAGANGTSGESDAARRASDAAAGASGQAGGAASAASASQ"
FT   sig_peptide     complement(556635..556715)
FT                   /locus_tag="BC1003_4016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.615 at
FT                   residue 27"
FT   gene            556973..557392
FT                   /locus_tag="BC1003_4017"
FT   CDS_pept        556973..557392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4017"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59953"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDC5"
FT                   /inference="similar to AA sequence:KEGG:BC1002_1223"
FT                   /protein_id="ADN59953.1"
FT                   /translation="MLLSDEELARLDGVAPFLESEAKTSLNFAPDYEVTAELAAHLQPG
FT                   LRLRAPAPDTSAPDAGDKDVPPYPLNLFVGLPLEELRKLAHADDSEREALIARFGASFT
FT                   PRLLRAIETETPGAVNLDAGVQNESGTLSVMLAAL"
FT   gene            complement(557537..557755)
FT                   /locus_tag="BC1003_4018"
FT   CDS_pept        complement(557537..557755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4018"
FT                   /product="Protein of unknown function DUF2795"
FT                   /note="PFAM: Protein of unknown function DUF2795; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4018"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59954"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDC6"
FT                   /inference="protein motif:PFAM:PF11387"
FT                   /protein_id="ADN59954.1"
FT                   /translation="MASNSNSNGGPIRKFIDVQKALKGASYPADKASLLDTAKGNGADD
FT                   EVLDALERLPEQEYGSPAEVSKGVGNE"
FT   gene            557959..560124
FT                   /locus_tag="BC1003_4019"
FT   CDS_pept        557959..560124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4019"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold-3 domain protein;
FT                   GAF domain protein; histidine kinase A domain protein;
FT                   response regulator receiver; KEGG: psa:PST_0267
FT                   hypothetical protein; SMART: ATP-binding region ATPase
FT                   domain protein; GAF domain protein; PAC repeat-containing
FT                   protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4019"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59955"
FT                   /db_xref="GOA:E1TDC7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDC7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADN59955.1"
FT                   /translation="MSTADREAILVNQQAILARFGELALRSDDLDEILTEACRLVAEAL
FT                   QTDMAKVMELQKDRMTLLVRAGVGWPPGIVGKATARAERGSSEGYALQTGKPAMSPDIA
FT                   LEKRFRYSQFIVDAGVKALINVVILGGKDRPAYGVLQVDSRTPRDFNDVDIEFLRSYAN
FT                   LLAAAVERLRIAAETRKHATWLRESEERYRMLATQIPQLVFTCTSSGERTWDSPQWIEY
FT                   TGLTERISRGIGWLDAIHPDDRDATMIAWSTGEVKGEYAVEHRIRRADGAYRWFQTRAR
FT                   PVRPEGRTVTWLGTSTDVEDQARIREALERSGEELERRVSERTAELQRALDTLHQETRE
FT                   RSRAEERLRHSEKLKAIGQLTGGIAHDFNNMLQAIMSALSLIRVRLQQGRPTDVVTLVE
FT                   RAEKGAVRAATLTHRLLAFGRQQTLEPRLVSLDAIAHDMEDMIRRVVGSGINVELKLGD
FT                   GMWLVQCDPNQMESALVNLCVNARDAMPEGGWLTITTSEVILAEAEVADFEDALPGRYC
FT                   CIAVSDTGTGMSPKVMEHAFEPFFTTKPSGQGVGLGLSQIYGFVRQSGGIVQMETALGK
FT                   GTTVRLCMPASVQREDVEDEHNVPAKTIMLVEDEEIVREVTAEQLRELGYRVLEADSGA
FT                   AALRLLHAGARFDLLISDVALPGALNGRQVAESVRQRYSWMPVILVTGYAPGDALADME
FT                   VIRKPFSPEVLAQRVRSKLEQSQTDVD"
FT   gene            560181..560393
FT                   /locus_tag="BC1003_4020"
FT   CDS_pept        560181..560393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4020"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="manually curated; TIGRFAM: regulatory protein, FmdB
FT                   family; KEGG: bph:Bphy_3107 FmdB family regulatory protein;
FT                   PFAM: Putative regulatory protein FmdB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59956"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDC8"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ADN59956.1"
FT                   /translation="MPVYDYTCAECGHFETVRRIAERDEPAPCPQCGNEAARVVIGAPS
FT                   LGGGTAQASEETGSYGMRHRGCSCC"
FT   gene            560480..561019
FT                   /locus_tag="BC1003_4021"
FT   CDS_pept        560480..561019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_4800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4021"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59957"
FT                   /db_xref="GOA:E1TDC9"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDC9"
FT                   /inference="similar to AA sequence:KEGG:Bphy_4800"
FT                   /protein_id="ADN59957.1"
FT                   /translation="MRSAEARSSSDSMETVPPTSSPAYAASNPVTRAFDAFASSVTRVA
FT                   GSPIAFGLAIITVIVWGVTGPLFHYSDAWQLVINTGTTIITFLMVFLIQQSQNKDSVAM
FT                   HLKLNELLASHRAANNQLIGIEDASEDDLRRLAAAYLRLASRVGAHGRESVDVDACVEK
FT                   PAPDKGKRNATENEGA"
FT   gene            complement(561171..561767)
FT                   /locus_tag="BC1003_4022"
FT   CDS_pept        complement(561171..561767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4022"
FT                   /product="Putative ParB-like nuclease"
FT                   /note="PFAM: Putative ParB-like nuclease; KEGG:
FT                   bpy:Bphyt_2350 putative ParB-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4022"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59958"
FT                   /db_xref="InterPro:IPR014956"
FT                   /db_xref="InterPro:IPR016932"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDD0"
FT                   /inference="protein motif:PFAM:PF08857"
FT                   /protein_id="ADN59958.1"
FT                   /translation="MKMLEIERLRPTQVTHGMREVREKTHAYQALSGHDLEMAIAEKPI
FT                   PVVLGPGGEAFATDHHHVAAALWHVDIKSVPFVLVRDLSTCSQAEFWLALENNRWTFPY
FT                   DQHGQRVPFTDMPRHVWDMIDDEFRSLAAAVRDAGGYRKTNVPLAEFRWADLFRKMLPR
FT                   PSNDAEYKALVGRAMELAKSEAALGLPGYVGAEGN"
FT   gene            complement(561828..562121)
FT                   /locus_tag="BC1003_4023"
FT   CDS_pept        complement(561828..562121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_4171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4023"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59959"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDD1"
FT                   /inference="similar to AA sequence:KEGG:Bphy_4171"
FT                   /protein_id="ADN59959.1"
FT                   /translation="MVRRKLHFQNTSLRAHASPAGIPATADDYRIYPTYRRTATGTFTG
FT                   DLKVVRTTDDRVIFPYDGAPVIGPFETALEAREAAARKGAELVEADLLNPEP"
FT   gene            complement(562289..562414)
FT                   /locus_tag="BC1003_4024"
FT   CDS_pept        complement(562289..562414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4024"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59960"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDD2"
FT                   /inference="similar to AA sequence:KEGG:BC1002_6456"
FT                   /protein_id="ADN59960.1"
FT                   /translation="MSDPKQSNTQPGNPKNAGKQSGQQQQNQQKTPQHQGGQRQP"
FT   gene            complement(562475..562930)
FT                   /locus_tag="BC1003_4025"
FT   CDS_pept        complement(562475..562930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4025"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: bpy:Bphyt_2041 glutathione-dependent
FT                   formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59961"
FT                   /db_xref="GOA:E1TDD3"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDD3"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ADN59961.1"
FT                   /translation="MSTESAAGRSREAGGAAEAPEAPEQTGGCACKAVRFRVKAQPRRV
FT                   SLCHCMTCRRIHGSAFGAYAMFARDAVEFSGPVQVWQSSAEGRRYFCPTCGSVAFMEYV
FT                   GSDELDVPLGAFDNVGLYEPTYELWCCRKEPWLPQGVRTEYEQDSPE"
FT   gene            complement(562973..563125)
FT                   /locus_tag="BC1003_4026"
FT   CDS_pept        complement(562973..563125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4026"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59962"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDD4"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3285"
FT                   /protein_id="ADN59962.1"
FT                   /translation="MPLKRGTSKETMSRNIKTETKHGKPHKQAVAIALNQARKSGAKIP
FT                   KKSEK"
FT   gene            complement(563305..563850)
FT                   /locus_tag="BC1003_4027"
FT   CDS_pept        complement(563305..563850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4027"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59963"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDD5"
FT                   /inference="similar to AA sequence:KEGG:BC1002_6363"
FT                   /protein_id="ADN59963.1"
FT                   /translation="MKKMTVIAVACGCFSLVPVAANAQTEAASTTAANPLAQVDKDFVQ
FT                   AASMSSSTEIDASKLATSNSSDKDVKSFAHHMMLDHTKLTVQLKMAAPHGVEVPKDNSD
FT                   TSVLDALKPLKGKQFDQMYIQKVALEGHKKTIAAFEKEIAEGQNAKLKEAAQKALPTIK
FT                   EHYQRAQQLASKKGVSEQ"
FT   sig_peptide     complement(563779..563850)
FT                   /locus_tag="BC1003_4027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 24"
FT   gene            564049..564219
FT                   /locus_tag="BC1003_4028"
FT   CDS_pept        564049..564219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_6251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4028"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59964"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDD6"
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_6251"
FT                   /protein_id="ADN59964.1"
FT                   /translation="MATRPNDPAESAQNGSADESGEATFETDVSETGDDGTTVRQAEVK
FT                   ESDLSEVKKDK"
FT   gene            564315..565415
FT                   /locus_tag="BC1003_4029"
FT   CDS_pept        564315..565415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4029"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bxe:Bxe_C1281 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4029"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59965"
FT                   /db_xref="GOA:E1TDD7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDD7"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN59965.1"
FT                   /translation="MSRPPVRIAQVAPLYESVPPFAYGATERVVSYLTEELVRRGHELT
FT                   LFATADSTTRARLVPICERGLWRDSAVWDTLTHHVRQLARVADLAHEFDVVHFHGDPLH
FT                   FPLTRSLPCKSLTTLHGQLLPMDHGPLFREFSSAPLVSISDDQRKPVPSANWQATIHHG
FT                   LPTDEFQFQPLPGDYLLFLGRLMPGKRPDLAVEIAKRAGLTLKMAGKVHPGEREYFAQQ
FT                   IEPLLERSRDFTDYLGEVGGTLRKELIANARALLFPVEWAEPFGMVMIEAMACGTPVVA
FT                   FGRGAVPEVLEHGVSGFIVNDVQEAVKAVAQIGTIDRAQCRRAFETRFTAARMADDYLR
FT                   VYQRLIAGSRTAVPASDSDANAQLFG"
FT   gene            complement(565503..565910)
FT                   /locus_tag="BC1003_4030"
FT   CDS_pept        complement(565503..565910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4030"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: bxe:Bxe_B2397
FT                   putative heat shock HSP20-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59966"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDD8"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADN59966.1"
FT                   /translation="MNDTTEVVQKEQQPVARTEREQAEPRTTLTPPVDVIENAHGVTLW
FT                   ADLPGVSKEKLEVRVHDGNLHIEAEASVPTRAGLRLQHAEIRAPHFSRSFTLGAEFDTS
FT                   KIEANLQDGVLKLVIPRREEARPRRIEVNVG"
FT   gene            complement(565934..566374)
FT                   /locus_tag="BC1003_4031"
FT   CDS_pept        complement(565934..566374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4031"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: bxe:Bxe_B2398
FT                   putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4031"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59967"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDD9"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADN59967.1"
FT                   /translation="MSDLYFATDLFSQFDRLQQQMSALFGGFPSSIRSSRLSAFPQINI
FT                   GTTDDSIEIIAFAPGIDPSQLEVSIDKGLLTIAGERKRVAPEADESTRQYAQERFTGSF
FT                   RRVIELPQQADPDKVEARYNNGCLSISVGKRESSKPRAITIQ"
FT   gene            566636..567070
FT                   /locus_tag="BC1003_4032"
FT   CDS_pept        566636..567070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4032"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59968"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDE0"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2399"
FT                   /protein_id="ADN59968.1"
FT                   /translation="MEFDSDWLTLGRHRVCLRSPGGFPTESMRTAVDVIRIAIENNMSA
FT                   RARLVDVAVREEKSYDISVGTTFAEDRLCAPQLESAIATVLGLLPAQVRIFVTVVTQEE
FT                   VDLHFGVYERMLAEKISGLPPIRRNGDALSAHLDADALTR"
FT   gene            complement(567091..569544)
FT                   /locus_tag="BC1003_4033"
FT   CDS_pept        complement(567091..569544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4033"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver; KEGG: bxe:Bxe_A1835 PAS/PAC sensor hybrid
FT                   histidine kinase; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS domain
FT                   containing protein; PAC repeat-containing protein; response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4033"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59969"
FT                   /db_xref="GOA:E1TDE1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDE1"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADN59969.1"
FT                   /translation="MAHAYEPDDIVQNWTNIWVQSLRDYAVIGLSEDGRIRSWNPGGEA
FT                   IHGFREDEILGKPLDVLYTAEERAQGVPQTALATARREGRFESEGWRLRKDGKVFWASA
FT                   VLTALTSPEGVLLGFGEIVRDMTDKKTVHDAVLESERRFRLLVDGVTDYAIFMLSPEGR
FT                   VTNWNSGARRIKGYAASEIIGSHFSRFYTPEDAAKGLPQRGLTAAARDGRFESEGWRVR
FT                   KDGSKFWAHVVIDAIREGGTLVGFAKITRDINEKMEATRLLEETRVALVQSQKMEAIGK
FT                   LTGGVAHDFNNVMQILRGNLELLESRHKRDGWTRERLDKAIDAVERGAKLASQLLAFGR
FT                   QQPLRPLVINLASAIRGMDDLLRRALGETVQIETVVAGGLWNTFVDVHQMENVVLNLAI
FT                   NARDAMNEGGKLTMEVSNAMLDDQYVVGFPDVPPGQYVMLAVTDTGTGMPPEVVQRAFD
FT                   PFFTTKPEGQGTGLGLSMAYGFVKQSGGHIRIYSEVGHGTTVKIYLPRSTEEAIETPAS
FT                   PPVTLLGGTETILVVEDDKDVQSTVVDTLSGLGYSVLKANDAEQALAVVRSGVHIDLLF
FT                   TDVVMPGPLRSPAMVAQAVQLLPRLKVLFTSGYTQNAIVHGGRLDPGVELLSKPYSREQ
FT                   LAYKIRQILGVPPLARSGPVAQTQSAQPAPNVPNSPNTPDTPSASNAPNAPNAPNAPNA
FT                   PNAPAADASLRLLLVDDDVETAEAVGELLKLVGHNPTITGSPQEALRLLEAQPFDVLLT
FT                   DLSMPAMPGLELAERATQMRPTLRVIFASGHEMPAVSTLPFRWGALRKPYSIDELDAML
FT                   RGFDQ"
FT   gene            569862..570944
FT                   /locus_tag="BC1003_4034"
FT   CDS_pept        569862..570944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4034"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="KEGG: bph:Bphy_4792 cytochrome c oxidase, subunit
FT                   II; TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4034"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59970"
FT                   /db_xref="GOA:E1TDE2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDE2"
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /protein_id="ADN59970.1"
FT                   /translation="MHIGQAPQRRRTKTAGTGRPGARSLWAAACCSSLASTASAAPAQD
FT                   ALSPAGVQASHIFSLWTLTLTVCSLVFAAVLIALLIAMTRAPRAGRDARADLGPLEHPE
FT                   RRVSRVVGGASIVSVLLLFGLLVADIATDRALSRLPVANAVQLEMTGHQWWWEARYADD
FT                   TPGSGFAVANELHVPVGRPVVISLKADDVIHTFWVPNLHGKKDMIPGRESTIEFRADRA
FT                   GTYRGQCAEFCGLEHALMAFTVVAEPAAEYDAWLARQRAPARQPANALQARGEHLFTTG
FT                   NCAGCHTVRGTLAQGVLGPDLTHVMSRPMLGAGTFANTPANLESWIKAPGSMKPGTTMP
FT                   PSQLSAQDLNALVAWIETLQ"
FT   sig_peptide     569862..569984
FT                   /locus_tag="BC1003_4034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.978 at
FT                   residue 41"
FT   gene            570941..572890
FT                   /locus_tag="BC1003_4035"
FT   CDS_pept        570941..572890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4035"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /note="KEGG: bxe:Bxe_C0168 putative cytochrome c oxidase
FT                   subunit I; TIGRFAM: cytochrome c oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4035"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59971"
FT                   /db_xref="GOA:E1TDE3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDE3"
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /protein_id="ADN59971.1"
FT                   /translation="MSEPQSAAARPVEHLVDGPAAGADVAQALARTWSDPPGWLGRLSA
FT                   INHKTVARRFVITTFVFFLLAGLLALAMRLQLARPGNRLVGPELYNQLFTIHGTTMMFL
FT                   FAVPVMQAVAGWLVPLMIGARSVAFPRMNAYAYWVFLFGGATLYVAFILGAGPDAGWFS
FT                   YVPLAGPDYSTGKGVDIWAQMITFTELSGLLEAVVLITTIFKMRAPGMSLNRMPLFVWA
FT                   TLITQFMVLFAMPAVMLSSTALILDRLVGTHFYNAARGGDVLLWQHLFWFFGHPEVYLI
FT                   FIPPLGFLSSIIPTFARRPVFGYPAMVLALIATAFLAFGLWVHHMFATSIPALGKSFFT
FT                   AASLMIAIPSGVQIFCWIATLWTGRLNLKTPLWFALGFFFILVLGGMTGVMLGSVSLDL
FT                   QVHDTYFVVAHLHYVLLGGAVFPLFGAFYYWYPKATGRLMNETLGRLQFWLFFIGFNVT
FT                   FFPMHILGLHGMPRRVWTYPPGMGWDSLNLIATIGAVTIGASVLVFIVNALYSYRHGAL
FT                   AGPDPWGAGTLEWSTASPPPPHNFDALPVVHGRDPLWEPGAEPAYVSGLAAESREVLST
FT                   TVLDARPDLRLLFPSPSIWPFISAVATTVLFIGSIFSPWAVVWGSVPVIVAMIGWFWPN
FT                   RGQNKRALQLEQRP"
FT   gene            572887..573537
FT                   /locus_tag="BC1003_4036"
FT   CDS_pept        572887..573537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4036"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   bxe:Bxe_C0168 putative cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4036"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59972"
FT                   /db_xref="GOA:E1TDE4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDE4"
FT                   /inference="protein motif:PFAM:PF00510"
FT                   /protein_id="ADN59972.1"
FT                   /translation="MTELRKVPVEAAVREDGAAPALMLDVRHLPSFGFGHRSLMWWGTM
FT                   CLMLIEGTVFAIAAMMYFYLRSLTARWPLNAAPPELLWGTANTVILLVSMWPNQLAKQA
FT                   ADRQQRARARLWLIICLLFAVVFLVLRGFEFAALNVSWYTNAYGSVVWLLLGLHTTHLI
FT                   TDAIDTAVLGVLLFTGPFEGKRFVDVSENAMYWYFVVLSWLPIYAVIYLAPRL"
FT   gene            573550..573882
FT                   /locus_tag="BC1003_4037"
FT   CDS_pept        573550..573882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4037"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_4794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4037"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59973"
FT                   /db_xref="GOA:E1TDE5"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDE5"
FT                   /inference="similar to AA sequence:KEGG:Bphy_4794"
FT                   /protein_id="ADN59973.1"
FT                   /translation="MRTWLALLGAPSAVLGALSAHYALVTPACAWRTVLPLGSVTGTAL
FT                   LFSLVATLLAWHRWREAGVIAPASTPALPARPAMLACAATGVGMISTLALVAMWIPQWL
FT                   ISPCVQ"
FT   sig_peptide     573550..573627
FT                   /locus_tag="BC1003_4037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.344 at
FT                   residue 26"
FT   gene            573879..574883
FT                   /locus_tag="BC1003_4038"
FT   CDS_pept        573879..574883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4038"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="PFAM: Cytochrome c oxidase caa3-type, assembly
FT                   factor CtaG-related; KEGG: bxe:Bxe_C0170 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4038"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59974"
FT                   /db_xref="GOA:E1TDE6"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDE6"
FT                   /inference="protein motif:PFAM:PF09678"
FT                   /protein_id="ADN59974.1"
FT                   /translation="MKRTGYRLLALAAHVAHFVHVARIGYVAGIACATCACGNVQAHVL
FT                   SSAERSAPPVLRWTFEPWVVALLIASLALYVAGYRHLRARSKRGRRIRMRQLGAFGLGW
FT                   LTLVIALASPLDALSAALFSAHMVQHELMMIVAAPLLVLSRPPGVWLWAFPPALRHRIA
FT                   AAVRTPALRGLWRTLCAPAVAWLLHAAALWAWHMPRLFEAALASSSIHTLQHASFLLSA
FT                   LLFWWTVFGESAAREQSGYAMLSLFTTMVHTGALGALLTLAPGLWYPAYIEPTSALGFD
FT                   PLQDQQLGGLVMWVPGGLAYLVAALSTGARWLMHRAPATLMPRPFAVRRDSNS"
FT   gene            574880..576172
FT                   /locus_tag="BC1003_4039"
FT   CDS_pept        574880..576172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4039"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="KEGG: bph:Bphy_4796 gluconate 2-dehydrogenase
FT                   (acceptor); PFAM: cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4039"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59975"
FT                   /db_xref="GOA:E1TDE7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDE7"
FT                   /inference="protein motif:PRIAM:1.1.99.3"
FT                   /protein_id="ADN59975.1"
FT                   /translation="MTSRLKRAALAAAAVLSILPAQAARAQQPDAQAALVARGDYLAKA
FT                   SDCAGCHTAVGGQAYGGGLGLTSPFGTIMSSNISPDRRYGIGAFSYEEFARSVREGVSP
FT                   GNKRLYPAMPYASFSKMSDDDMRALYAYFMHAVKPVPEPAPPTKIPFPFNQRWVLFFWQ
FT                   QAFAPREPYRPKPGRDTQWNRGAFLVQGPGHCGACHTPRGPGFQERGYDETSPTYLTGG
FT                   VNDNWFAPNLTSDPGSGLGRIGEKDLASFLKTGHGAGLAAFGSMVEQVEDSSQYLTDED
FT                   ALAMAHYLKSLPAQKPSGRYEPHAVPDLSARNGNRVDAPQSVGARVYSSFCAQCHGVDG
FT                   TGVPNVFPRLAGNPSVLTEDTTSLIRLMVEGGNSPATTSGPPRQAMPGFAQTLTNAQMA
FT                   NVLSWIRASWGNDAGPITANDVQSLRQKLHK"
FT   sig_peptide     574880..574960
FT                   /locus_tag="BC1003_4039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.735 at
FT                   residue 27"
FT   gene            complement(576229..576738)
FT                   /locus_tag="BC1003_4040"
FT   CDS_pept        complement(576229..576738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4040"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cac:CAC2539 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59976"
FT                   /db_xref="GOA:E1TDE8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDE8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADN59976.1"
FT                   /translation="MMFPTIVVNREAPSSIDALTLLDELSATLAVFTGDGGQSRFSIHD
FT                   VMLERSRFLVARSDCATPLGCGAFRPLGEHIAEIKRLYARPGADGVGAAILARLEKEAA
FT                   ELGYQALWLGTHMNNRRAIEFYEKHGFHRIAPYGPYVSKSDACCYEKRLDGQAPDNQRK
FT                   ETMRDA"
FT   gene            577048..577563
FT                   /locus_tag="BC1003_4041"
FT   CDS_pept        577048..577563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4041"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: bxe:Bxe_C0164
FT                   competence/damage-inducible protein CinA"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4041"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59977"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDE9"
FT                   /inference="protein motif:PFAM:PF02464"
FT                   /protein_id="ADN59977.1"
FT                   /translation="MNIPRSVVGFLSSRGLVIATAESCTGGLIASLIADVPGSGACLDV
FT                   GLVVYSPSGKCGVLNVQASTIEEYGLTSEEVAREMATGVLALEACSAHIAVANTGIAGP
FT                   PPAGEDLAPGTQCFAWRYKRRDGEYMFSETRVFDGDRTTIRQNAALYALSRIEHYFNEL
FT                   PKARRRTP"
FT   gene            577560..579608
FT                   /locus_tag="BC1003_4042"
FT   CDS_pept        577560..579608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4042"
FT                   /product="NAD+ synthetase"
FT                   /note="KEGG: cti:RALTA_A0735 NAD synthetase; TIGRFAM: NAD+
FT                   synthetase; PFAM: Nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4042"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59978"
FT                   /db_xref="GOA:E1TDF0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDF0"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ADN59978.1"
FT                   /translation="MTRSFFNLYSHDFARVAVAVPVCRVADPQFNAQETLRLAQEAAQQ
FT                   GAALVVFPELGISAYSCDDLFHQRALLDACKAAIADIVAASTNIPAILVIGAPLAVEHK
FT                   LFNCALVISNGKLCGVVPKSYLPNYGEFYEARQFSAAENASTSEITLCGQQVPFSASLL
FT                   FEVPQAPLFRFHVEICEDVWVPVPPSSFAALAGATVLVNLSASNIVIGKSGYRHQLVGQ
FT                   QSARCLSAYLYSSAGRGESTTDLAWDGQALIYENGEMLAESERFLDTSHIIYGDVDLER
FT                   LSRERMRQTTFGQSTRRHAQEVARFQVISVPVSLPAAQHLPLMRAINRFPYVPSNPATR
FT                   DERCAEVYNIQVQGLLQRLGAAKISKVVIGVSGGLDSTQALLVCAKAMDRLKLPRSNIL
FT                   GYTMPGFATSSRTLQQAKDLMQAVGCSMEEIDIRPSCMQMLKDLHHPFAEGEKQYDVTF
FT                   ENVQAGERTSHLFRLANFHQAIVIGTGDLSELALGWCTYGVGDHMSHYSVNASVPKTLI
FT                   THLVRWVAESGQVGDAGSRVLEQILATEISPELVPGKEEKVIDQKTESIIGPYELQDFN
FT                   LYYLLRFGFTPSKVAFLAHSAWADRERGVWPAGRHVTRNEYTLADIKRNLAIFAERFFH
FT                   TSQFKRSCIPNAPKVGSGGSLSPRGDWRAPSDSEATVWLRDIEKIPD"
FT   gene            579734..580321
FT                   /locus_tag="BC1003_4043"
FT   CDS_pept        579734..580321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4043"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4043"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59979"
FT                   /db_xref="GOA:E1TDF1"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDF1"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ADN59979.1"
FT                   /translation="MPDSTSSMSPTITAMIRLDHMHVLTAFHRYHADSPWWRKRAIVNS
FT                   VCAALEIHAQLEEEIFYPALSGVLGDDQTLEKSRPEHDEMRATIAKLRASGPEDAAFDG
FT                   LFQQLMREVMHHVADEETVLLPTAERALKNELRSLGAKMTRRRLQLLGERPREIAVNTA
FT                   GTFPIATFLLGSLLVIGATHCLPKTRRMRYAD"
FT   gene            complement(580385..582691)
FT                   /locus_tag="BC1003_4044"
FT   CDS_pept        complement(580385..582691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4044"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; KEGG: bph:Bphy_4774 oxidoreductase alpha
FT                   (molybdopterin) subunit; PFAM: molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4044"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59980"
FT                   /db_xref="GOA:E1TDF2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDF2"
FT                   /inference="protein motif:TFAM:TIGR01701"
FT                   /protein_id="ADN59980.1"
FT                   /translation="MKEKDTTKDYPFASGGWGSLRAVTTILAQEHVSVKDSAALAKQNK
FT                   PDGFMCVSCSWAKPADPHVFEFCESGAKATAWDLTSKRMTPEFFQLHTVTELLSWHDHD
FT                   LEEAGRLTAPLRYDPATDKYVQIEWQQAFDEIGRELNQLDPDSVVFYASGRASLETSYM
FT                   YQLLARMYGTNNLPDSSNMCHESTSVGLKEAIGVGVGTITLEDFEKTDLMFFFGQNVGT
FT                   NSPRMLHQLQDARKRGVPIITFNPLREPGLVRFANPQSPVQMLTPDNTQISTQYHQLKT
FT                   GGDTAAILGICKAVIAADDLALEQARPRVIDVDFVREHTTGYEAFANYAREVSWADIES
FT                   VSGLPRDAMEAAAAEYIKANAVMIHYGMGLTQHRLGVQNVRMVCNLLLLRGNIGKPGAG
FT                   PSPVRGHSNVQGQRTVGITEKPELAPLDKLASQFSFEPPRKKGLNTVEAFEAMLKGEVK
FT                   GVFNLGGNLVRSVPDRLRIEPAWRGLRLNVNVATKLNRSHLVHGEVSYILPCLSRIEID
FT                   RQASGEQAVSMEDSTSCMHGSRGVAEPASENIRSEPYIIAGIAKATLGSRFNVDWDGWR
FT                   DDYSIVRNEIAKTYPEIFHDFNQRMWQPGGFPKPLPARERQWKTKSGKAEFMVPKALGE
FT                   DPDMPERGPDALRLMTLRSDSQFNTTIYGLDDRFRGVKGSRMIVLMNKDDMAANGLSEG
FT                   DRISLQTIADDGFDRRVSGLTVKEYDIPAGCIGGYYPECNPLLPLWHYAEESKVPGAKS
FT                   IPVRIVDKPGASASA"
FT   gene            582928..584379
FT                   /locus_tag="BC1003_4045"
FT   CDS_pept        582928..584379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4045"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: gbe:GbCGDNIH1_0136 cyanide-insensitive cytochrome
FT                   bd-type quinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59981"
FT                   /db_xref="GOA:E1TDF3"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDF3"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ADN59981.1"
FT                   /translation="MPPSVDALFLARTQFGFTIAFHIIFPAMSIGLASYLAVLEGAWLV
FT                   TGKPVYLAVFRYWLTIFAVVFGVGVVSGLVMSYEFGTNWAGFAYRAGPVVGPLMGYEVL
FT                   TAFFLESGFLGVMLFGMKRVGPKLHFLATVLVAVGTLMSAFWILAVNSWMQTPQGFTVV
FT                   DGRFFPADWLSIIFNPSFPYRLVHMVLAAYLSVAFIVGAVGAWHLLRDPGNEPARLMAS
FT                   MALWMACIVAPIQIVAGDQHGVNTLKHQPAKIAALEGDWESKPGQPLILFGMPNMKTET
FT                   TDYALEIPHLGALILTHTWNGSIKGLKEFTPADRPYSPLIFWAFRIMVGLGVLMALTGF
FT                   ASLALRARHSLYRARWLHRLMVAMGPSGLIALLCGWTVTEVGRQPYTVYGHLRTVDSVS
FT                   PIAAPGVAVSLAAFGVVYLIVFGAAMVFLLRLMARPPSLSTEGPAKDKPHRSAGITPGP
FT                   AQRQPASVSNDHSLSQDPRHDSRHD"
FT   gene            584360..585376
FT                   /locus_tag="BC1003_4046"
FT   CDS_pept        584360..585376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4046"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="KEGG: gbe:GbCGDNIH1_0137 cyanide-insensitive
FT                   cytochrome bd-type quinol oxidase subunit II; TIGRFAM:
FT                   cytochrome d ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome bd ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4046"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59982"
FT                   /db_xref="GOA:E1TDF4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDF4"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ADN59982.1"
FT                   /translation="MTAATIDLPLIWAAILAFAVLAYVLLDGFDLGVGILFAVERNRED
FT                   RDLMVNSIAPVWDGNETWLVLGGGGLFAVFPLAYSVILPALYPPIIAMLLALVFRGVAF
FT                   EFRFRATGSGRAWWDIAFFTGSAVAALCQGLVLGGLLQGIHVEGVSYSGGWWDWLTGFT
FT                   VLCGLAVIVGYALLGSCWLIWRTEGALHERCRRYARTMAVAVLALIVVVTLWTPMLQSS
FT                   LAERWFRWPAVALTAPVPVLLVLLAVGFWRSLAARRHVLPLLFAYGIFILCYAGLLISL
FT                   YPYLVPPAISFREAAAPHASLLFLLVGAAITVPMILGYTVYAYSVFKGKMRPGEGYH"
FT   gene            complement(585650..588322)
FT                   /locus_tag="BC1003_4047"
FT   CDS_pept        complement(585650..588322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4047"
FT                   /product="membrane-bound PQQ-dependent dehydrogenase,
FT                   glucose/quinate/shikimate family"
FT                   /note="TIGRFAM: membrane-bound PQQ-dependent dehydrogenase,
FT                   glucose/quinate/shikimate family; PFAM: PQQ-dependent
FT                   enzyme-like; Pyrrolo-quinoline quinone repeat-containing
FT                   protein; KEGG: membrane-bound PQQ-dependent dehydrogenase,
FT                   glucose/quinate/shikimate family; SMART: Pyrrolo-quinoline
FT                   quinone beta-propeller repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4047"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59983"
FT                   /db_xref="GOA:E1TDF5"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDF5"
FT                   /inference="protein motif:TFAM:TIGR03074"
FT                   /protein_id="ADN59983.1"
FT                   /translation="MSKPHRFPPALAVPAVVFIILGLALAAGGVPLVRLGGSWYYVVTG
FT                   VAIALTGVLLSIRRRSALWLFALILFGSTIWAVAEARFDFWQLLPRLWVWLVLALWLLL
FT                   PPVTRKLVFGPPAAHREGVVPLAAAVIVTVLLGIGTAFNHPYDHPGTLASTAATPSTPL
FT                   VGDANRQAGDWTDYGGSPLGQRYSPLTQITPENVRQLKVAWQFETGDKPGPNDPTETTA
FT                   ENTPIKVGNKLFLCTPHSIVIALDPASGKELWRYDPHIQSPVGFKHWEHMTCRGVSYHD
FT                   DAMYPANAPAAAPAAASDSAAGASAAASESGAGLAGNAASDAVSSVASSVTADASSSAV
FT                   AASAAAPASAAVADAASTSTAAAAAASGATAASDASTATQQTASAAASAECPRRIFLPT
FT                   ADARLIALNADTGQPCTHFGNNGQIDLRTNIGPFTPGGYYSTSPPAVTRNLVIISGHVT
FT                   DNESNNEPSGVTRAFDVHDGHLVWNWDAGNPDATQPIAPNQTYVRNSPNMWSVFSVDEK
FT                   LGMVYLPLGNQTPDQWGGARTPASEKVAAGVVALDLSNGRMRWNYQFTHHDLWDMDVGG
FT                   QPSLIDLQTPSGVQPALIASTKQGSIYVLNRETGKPIVPITEEPVPQGAATGDHTSPTQ
FT                   PFSALNFKPPKVRERDMWGTNPFDQLWCRVKFKSLRYDGMFTPPSEQGSLVFPGNFGVF
FT                   DWGGVAVDPVRQILIANPSYMAFTSKLIPRSQIPVDNGEKKGSETSGIKLARGTPYGFE
FT                   INAFLSPLGIPCQAPPWGYVAGVDLRTNQIAWQHKNGTIRDSAPLPIPMPLGVPSLGGM
FT                   VTTAGGVAFLSGTLDYYVRAYDVRTGDRLWQARLPAGGQATPMTYADSNGKQYLLVTAG
FT                   GHGSLGTKQGDYVVAYTLP"
FT   gene            588343..588906
FT                   /locus_tag="BC1003_4048"
FT   CDS_pept        588343..588906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4048"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bph:Bphy_4759 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4048"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59984"
FT                   /db_xref="GOA:E1TDF6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDF6"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADN59984.1"
FT                   /translation="MIQIELQKIARCARLASAALRVAFVVPGRAAGRHIACFVRSPLFA
FT                   GYVIKHRATVLCVRANRILLVARSNGRWALPGGRCKAGEPISAAAVRELVEETQLNDLA
FT                   LHYIFEFWGVRTRHYVFAARIPDDMEPVPSHEIRRCRWVRAKDIQSAWVSVSTRGIVQV
FT                   LFEKNSPVGPARQASPLRPFFERT"
FT   gene            588980..589204
FT                   /locus_tag="BC1003_4049"
FT   CDS_pept        588980..589204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_7581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4049"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59985"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDF7"
FT                   /inference="similar to AA sequence:KEGG:Bphy_7581"
FT                   /protein_id="ADN59985.1"
FT                   /translation="MAGDNSFKPGEIVRTSGIYAVVHEDGKDTFEVTCVEGEHFPPTRS
FT                   GKGAHFELKYAATHAHRHGELKGTEARQA"
FT   gene            589259..589780
FT                   /locus_tag="BC1003_4050"
FT   CDS_pept        589259..589780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4050"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59986"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDF8"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A1838"
FT                   /protein_id="ADN59986.1"
FT                   /translation="MPKTSITPFALAERAIISLYDGGVLSPAVLERLLGTFAAAKPDWD
FT                   TEPTERSVDGRSLHEVVALTMLPGESLRAARKSFKSVIEHIAGATRTEKTSRASRKTEE
FT                   VEQEKDEPAEDDESAELAEQLTGSTRGAPSSRKRGATKANKPDTSAERPARTAGFNPLV
FT                   NAAAPRKSRS"
FT   gene            589876..590388
FT                   /locus_tag="BC1003_4051"
FT   CDS_pept        589876..590388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4051"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: bxe:Bxe_B2480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4051"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59987"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDF9"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ADN59987.1"
FT                   /translation="MPEKQPTPNTTDALELLIADHRAVEKLFTAFEKAEEDDLEAKATL
FT                   AQRACEELTIHTIIEEELLYPAASQALPESDVVDVEEAYVEHFLVKTLISKFETLKAGD
FT                   KGFDATFKVMSEMVQHHVEEEESELFPELRKANLDVNALGEKIAKRKMELQSKLDQVGS
FT                   HAVGDKT"
FT   gene            complement(590532..591032)
FT                   /locus_tag="BC1003_4052"
FT   CDS_pept        complement(590532..591032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4052"
FT                   /product="protein of unknown function DUF892"
FT                   /note="PFAM: protein of unknown function DUF892; KEGG:
FT                   protein of unknown function DUF892"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4052"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59988"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDG0"
FT                   /inference="protein motif:PFAM:PF05974"
FT                   /protein_id="ADN59988.1"
FT                   /translation="MTQRKTVDDLFVHMLSDIYSAEKQLTKALAKLSRAASDPQLSEAF
FT                   KIHLEETQGQVERIDKVVETSGVKLKRMKCVAMEGLIEEGQELIDEIEKGAVLDAGLVA
FT                   AAQKVEHYEIAAYGSLCAIGKQLGFTEAVNLLKETLEEEKATDLKLTEFAERAGNEKAK
FT                   QQK"
FT   gene            591202..592077
FT                   /locus_tag="BC1003_4053"
FT   CDS_pept        591202..592077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4053"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: bxe:Bxe_B0318 non-heme catalase KatN; PFAM:
FT                   manganese containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4053"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59989"
FT                   /db_xref="GOA:E1TDG1"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDG1"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADN59989.1"
FT                   /translation="MFVHNKRLQYTVRVAAPNPGLANLMLEQFGGPQGELAAACRYFTQ
FT                   AVAEDDPGRKDLLFDIATEELSHLEVIGSIVAMLNKGAKGQLAEGVEQEAELYRSLTGG
FT                   GNDSHTTALLYGGGPALTNSAGVPWTAAYIDTIGEPTADLRSNIAAEARAKIVYERLLN
FT                   VTDDPGIKDALGFLMTREIAHQKSFEKALHSIQPNFPQGKLPGVPEFTNVYYNMSAGEG
FT                   DARGPWNEGPEWEFVEAPQPAVDGGDGLPSVNVTQADVEVLGALASRTASNTATDPVTG
FT                   ADLGSGQQPG"
FT   gene            complement(592184..593422)
FT                   /locus_tag="BC1003_4054"
FT   CDS_pept        complement(592184..593422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4054"
FT                   /product="phosphatidylserine decarboxylase-related protein"
FT                   /note="PFAM: phosphatidylserine decarboxylase-related;
FT                   KEGG: bxe:Bxe_C0076 putative phosphatidylserine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4054"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59990"
FT                   /db_xref="GOA:E1TDG2"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR022237"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDG2"
FT                   /inference="protein motif:PFAM:PF02666"
FT                   /protein_id="ADN59990.1"
FT                   /translation="MTDKNTAERRRLGGWLPSNEEHLARYRTDLAEKARARAAHAPRTE
FT                   AVTHLAALLNGDPVLRMDMTRAINQALDEGYVLGYSSIEELMTIIDYLMTYAPPFSETS
FT                   LIHCPLNAVLDWPMCMPSGYALFRDPALNQRLKHVLDCWCGFLSGPHSREHLNASAPNG
FT                   WFSPEADKKINLSQFCCDPDKPYWGFSSWNDFFTRRFREGARPVDEPDNHKIIVSACEA
FT                   APYNIESDVKLTDSFWIKAQPYSLLDMFSASQRELAQRFVGGSIYQCFLSAFDYHRWHA
FT                   PISGVIKKAYALDGTYYSDADAEGRDPGGLNDSQGYITAVAARAVIVIESDDPAIGQVG
FT                   CVFVGMADVSSCMIEALPGQQVAKGDEIGFFQYGGSTCCLVFEPGVIDRFVPQPPFDNA
FT                   PPVKVKTHIATAK"
FT   gene            complement(593511..594752)
FT                   /locus_tag="BC1003_4055"
FT   CDS_pept        complement(593511..594752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4055"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59991"
FT                   /db_xref="GOA:E1TDG3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDG3"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADN59991.1"
FT                   /translation="MEYETCQASKSRAWLASRLAAFAWNALCFFIAIVFYVCRLVSKAK
FT                   NPFNPSNSSIAAVPIEVRRGQVTEQLPRDIFRERFMARFYDPAFRAEDEALARLEAIAW
FT                   DAYSQSRKSPVTAKAGDGYADPDYDLSVEWRAAKERIDAAQARQRDPASRSRVLIVNAS
FT                   SRNDYTCPSEMSKSFRLAKIAQGTLERRAFDVDFLDLSRLNSDRDLHIHPCKGCVSTAM
FT                   PLCHWPCSCYPNHSLGLVNDWMNEIYERFAAAHGVIFVTPVYWYQVTSPLKLLMDRLVC
FT                   ADGGNPDPTSTHGKKAEEAKRLELAGWDYPKHLAGRAYGMVVHGDVAGIEGSRRALSDW
FT                   LGWMGLIECGPKSRLDRFIGYYEPYATSHATLDRDEDMQQEVVNVAQAVAECVEQIRSG
FT                   YKQPGDALPTPRAK"
FT   gene            594772..595482
FT                   /locus_tag="BC1003_4056"
FT   CDS_pept        594772..595482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4056"
FT                   /product="LmbE family protein"
FT                   /note="KEGG: LmbE family protein; manually curated; PFAM:
FT                   LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4056"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59992"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDG4"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ADN59992.1"
FT                   /translation="MMQSRDRLLVISPHLDDAVLSCGLLLSANPSAIVCTVFTAPPREN
FT                   MSTEWDRKSGFKDAFEAMQARQREDAAALEMLGVQPVHLPFCDAQYEQTPLLDELAEAL
FT                   RDTVQVHRPEKVIVPLGLFHSDHTLVSDACLQLVTQMRDTAFHAYEDVPYRQMDQAVPQ
FT                   RIEELTKRGYLLSPVDDLPATVSQSVSHEQMKREAISAYTSQLRAFGPGAETTLYSTEK
FT                   YWQLTKRQAKTQAV"
FT   gene            595543..596487
FT                   /locus_tag="BC1003_4057"
FT   CDS_pept        595543..596487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4057"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bgl:bglu_1g15050 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4057"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59993"
FT                   /db_xref="GOA:E1TDG5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDG5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADN59993.1"
FT                   /translation="MEKKPLSRRISVVVLTHNRADELVATLERLLALPENPPVFVADNG
FT                   SSDNTVALVKALFPTVCIVECNANLGAAGRNRAAACVGTDYVAFCDDDTWWEPGALERA
FT                   VQLLDAWPNVGILSGRVVVGEEQITDPMCSIMRASPLGSEGLPGPALIGYMAGASVFRT
FT                   SLFRKLGGYEPRLFIGGEEELVALDVLASGHAIVYCDQLTVHHHPSPSRDSGLRRRTLA
FT                   RNAAWIAWLRLPWPEACRATAQALATFSREGTLARDGLPFMRGLAWALRNRKPVPPHVL
FT                   NLRERVRTGEREMAAPAPSTRTKPAVGKADVST"
FT   gene            complement(596532..599210)
FT                   /locus_tag="BC1003_4058"
FT   CDS_pept        complement(596532..599210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4058"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: response regulator receiver protein; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; SMART: response regulator receiver; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4058"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59994"
FT                   /db_xref="GOA:E1TDG6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDG6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADN59994.1"
FT                   /translation="MPNPATLPRSQLTRRIAADLMRAVWRYRNQTLAALLLMVSAKLST
FT                   VLMPLVLKHVVDELGHPVAQALFPVFLVLTYALLRFLGDALNEARDVVFSIVTQRTVAA
FT                   FTERTFAHLHRMSARFHTKRETGAIVRDVQKGADGIGFLLGVALFTIVPTAFEIVTIVA
FT                   IMVHNYAREFMIAIAATFVCYAVYTFIFTRRRVAFQRAVNALEAQSDGRLVDSLLNYDT
FT                   VKYFATEETETRRLSAVLEKWVHARTANQRALTALHVGQSAVIAVGIGAIMLLAAQHVV
FT                   SGTMTVGDLILVNAYIIQICMPLNTLGFVFRETNDAMVNVERMFEILAARGRVGEDIDE
FT                   PAARPLVVSAGQISFEHVDFGYDPARQILRDVDFHAYPGKTLAIVGGSGSGKSTLVKLL
FT                   FRLYQPNSGTIRIDGQDIGQVTQKSLREAIGIVPQDTVLFNETIAYNIAYGRPSATRAD
FT                   VVRAARAAQLDEFIERLPDHYDTRVGERGVRLSGGERQRIAIARAILKDPRIIVFDEAT
FT                   SALDTRSERAIQTELTRLAQGRTSIVIAHRLSTVVDADWILVMEHGRVVEQGTHRELLA
FT                   RDGVYAKMWSLQWQQGELEHAQRKLTAQSVSLAALMAGVIDALHDEIAAQRVTLYPQIS
FT                   DNDLRVTGDPSVLQPLIAELCRNEIVHAKPGQRIELRVERHNNQVWVTVLGMSEKPAEL
FT                   SQAAARYMEEALAAAGGSFTLMPLNGRLAYVAMLPLRPVADTAAQTQVVPPADENGAAP
FT                   LEGLFVMAIDDQEDALDALEAVLTASGARVRTASSGKEALDWLAQTPTLQWPHALLCDI
FT                   VLADEDGYDVLRRLRRLEAERQLPLQDRVPAIALTGYAQSEDRMRAKMAGFQAHLTKPV
FT                   APEKLIGEIRNLAMASARAGA"
FT   gene            599696..600991
FT                   /locus_tag="BC1003_4059"
FT   CDS_pept        599696..600991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4059"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: glycosyl
FT                   transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4059"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59995"
FT                   /db_xref="GOA:E1TDG7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDG7"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN59995.1"
FT                   /translation="MKIALISEHASPLAVAGGVDSGGQNIYVANVARELTEMGHQVDVF
FT                   TRRDRALLPLVSDMEGVRVIHVPAGPSMQLPKELLLPFMDEFAAFLIEFFRREKQPYDV
FT                   MHANFFMSGLAAMKVKAALGVPLITTFHALGRVRRIHQGANDGFPDERFAIEDDLVAQS
FT                   DVVIAECPQDEADLIQHYQADPARIEIVPCGFDADEFHPMDRATAREALGWEQDQFTVL
FT                   QLGRLVERKGIDNVVRGVGVLKKAFRTSAQLYVVGGNSDAPNEKATPEIARLRGIAREC
FT                   GVAEQTHFVGRRGRAQLRYYYSAADVFVTTPWYEPFGITPVEAMACGTPVIGADVGGIR
FT                   YSVADGVTGFLVPPRDPAALAARLNQLRRDPALARRMGEAGLERARKEFTWRGVGESLA
FT                   HIYMRTARLMPAKSAEERVEVRLRAAAGASFR"
FT   gene            601101..601706
FT                   /locus_tag="BC1003_4060"
FT   CDS_pept        601101..601706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4060"
FT                   /product="hydrolase, HAD-superfamily, subfamily IIIA"
FT                   /note="KEGG: hydrolase, HAD-superfamily, subfamily IIIA;
FT                   TIGRFAM: hydrolase, HAD-superfamily, subfamily IIIA;
FT                   histidinol-phosphate phosphatase family protein; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase;
FT                   trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59996"
FT                   /db_xref="GOA:E1TDG8"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDG8"
FT                   /inference="protein motif:TFAM:TIGR01662"
FT                   /protein_id="ADN59996.1"
FT                   /translation="MLQPAVFLDKDGTLLDDVPYNVDPSLMRLAPGAREALTLLASQPF
FT                   ALFVISNQSGVALGKFQRAALKDVEAELARMFGECGATLAGAYWCPHHPDGSVAPYATA
FT                   CDCRKPAPGLLLRAAREHRLDLARSWFIGDILDDVEAGNRAGCRTILLDNGHETEWIEG
FT                   PQRVPHARAADLHEAARIVMASAETALRSAPAGEEAAQ"
FT   gene            601703..602965
FT                   /locus_tag="BC1003_4061"
FT   CDS_pept        601703..602965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4061"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG: glycosyl
FT                   transferase family 9"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4061"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59997"
FT                   /db_xref="GOA:E1TDG9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDG9"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADN59997.1"
FT                   /translation="MNAPLLIAQPMLAHARVPDSPQLAHWGEDIKRILCVRLDNLGDVL
FT                   MTTPALHALRESGPGRHIALLGSRSGAALAPYLDDVDDVIEYEAPWVANPSTSSRSLAD
FT                   DQRMQERLRRGNFDAAVIFTVYSQSPLPAAMLCYLAGIPRRLAHCRENPYALLTDWLRE
FT                   PEPQQRTRHEVERQLDLVRQVGAHAPDTRMRFAVHESDRRTLTKQLAARGLQVDANGSA
FT                   RCIVLHPGATAASRRYPPERFGQVATRLAQETGASILITGGASERDLVEAVIAAAAPRV
FT                   RAQLHDMSGALTLGELAALIERTSVLVSNNSGPVHLASALGTPVVDLYALTNPQHTPWQ
FT                   TPHRVLFRDVECRWCYRSVCPQHHHACLLGVTPGEVVTAALELRAEAQSRAASPRCASN
FT                   KESAADHTDAAPPCAGQPVVP"
FT   gene            602991..604736
FT                   /locus_tag="BC1003_4062"
FT   CDS_pept        602991..604736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4062"
FT                   /product="Carbamoyltransferase"
FT                   /note="PFAM: Carbamoyltransferase; KEGG:
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4062"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59998"
FT                   /db_xref="GOA:E1TDH0"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDH0"
FT                   /inference="protein motif:PFAM:PF02543"
FT                   /protein_id="ADN59998.1"
FT                   /translation="MYTLGINAVYHDSAAALLRDGLVLAAAEDERFTHVKHAKRPVPFS
FT                   TWQLPFDAIDYCLKAAGITLADVDHVAYSYDPSLFSGMPKRPGATIELPFDPANTRLSD
FT                   PSASPWDPLFLSYIANAKGQLLDGAPHHLRKRFQGVDRDNGFKWHFVEHHLAHEASAFL
FT                   AAPYDNTAVLTMDGRGEGVTTSMGQFVDGEYTRLKQVELPHSLGLLYEAVTDWLGFLHS
FT                   SDEYKVMALASYGKPEYVDVFRDIVRYRGDGSYTVDAPRLVKRFGPARERGGPLEQRHF
FT                   DIAHSLQRVLEETVLQLAGWLHEKTGLRKLSMAGGVALNCVMNSKLRDAGPFDEVWVQP
FT                   AAGDAGTALGAALWIDYRERCEAGDRKRHWTMDHAYLGPEYPEEEIEQFLKWSKVPYRR
FT                   LDDIASETADLLASGKVIGWYQGRTEFGPRALGARSILASPVDPHMQAKLNEIKDREDF
FT                   RPVAPVVMEEHASEWFVNGNVAPFMLFVFDVRADKAARIPAVRHVDGTARVQTVNRSQH
FT                   PLYYDLLAAFNQRTGVPILVNTSFNTRGEPMVNSPRDAVESFWTSPLDALVIGPFLIDK
FT                   TRGSA"
FT   gene            604733..605812
FT                   /locus_tag="BC1003_4063"
FT   CDS_pept        604733..605812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4063"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4063"
FT                   /db_xref="EnsemblGenomes-Tr:ADN59999"
FT                   /db_xref="GOA:E1TDH1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDH1"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADN59999.1"
FT                   /translation="MSSSATGPLDVRGSFGQPHSEAEPVVAGYPGALLAHLDISVVVPT
FT                   YRRPDMLAACLRALTEQEFPPDRYEIVVCDDGPDEATRACVARIAAEQAERGLAVRYVP
FT                   VTRTQGPAGARNAGWQQARSPVIAFTDDDTLPDRHWLQEGLAAIRQGAAAAAGRIVVPL
FT                   PASPTDYEFDASGLERAEFATANVFVARSFLTMTGGFDERFTAAWREDSDLQFTLLQAG
FT                   GKIVRANEALVVHPVRPARWGVSISQQKKSQFDALLYKKHPELFRTRIRSSPPVLYYLI
FT                   LCAACGALIGALAGDATTFTLGLLAWFLLTAYFCVMRLRGRDRSWRHIAEMAWTSIPIP
FT                   FLSIYWRLYGAVRYKVLFL"
FT   gene            605809..606948
FT                   /locus_tag="BC1003_4064"
FT   CDS_pept        605809..606948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4064"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG: glycosyl
FT                   transferase family 9"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4064"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60000"
FT                   /db_xref="GOA:E1TDH2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDH2"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADN60000.1"
FT                   /translation="MNAGSLLASLAPQRIAVFRALQLGDMLCSVPALRALREAAPQAHI
FT                   ALIGLPWAQSFVERYADLVDELIVFPGAEGFPEQRESNDGLPAFHEQMRARRFDLAIQL
FT                   HGSGGVANDLLLQFGASSNAGFVQPQEQARDGVFIDWPDDLPEPERYLALMSALGAETR
FT                   DRQLWFPLSERDGEEYASLVAAHGIEAQRLVLIHPGAQLPSRRWPAARFAEVADRLAAG
FT                   GWQIAITGTAAEASLTGEVLGAMTAPALHLAGATSLGGLAALVAHARLVVCNDTGISHI
FT                   AAATATASVVIASGSDTQRWAPLDHALHRVLADYPPCRPCMFRECPYGHPCALNIGVDL
FT                   VVETALAQLAGVHGAHPAAPYALHTQAGTGPFEELNHAA"
FT   gene            606938..607894
FT                   /locus_tag="BC1003_4065"
FT   CDS_pept        606938..607894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4065"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: glycosyl
FT                   transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60001"
FT                   /db_xref="GOA:E1TDH3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDH3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADN60001.1"
FT                   /translation="MLRNCRRLRVLTWHVHGNYLYYLTQAPHDFYLVTKPGNPPGYAGK
FT                   VGVLPWGDNVHEINADDVPDQEFDVVLYQHRTHWEHDREHVLSEAQRRLPRIYIEHDPP
FT                   QENPFQQWHWVDDPDTLLVHVTHFNQLMWDCGVTPTRVIEHGVVVPEGVRYSGELERGI
FT                   VVVNHLAQRGRRLGADVFADLRTRVPLDLVGMDAQRLDGIGEIGNLDLAAFTARYRFFF
FT                   NPIRWTSLGLAIVEAMTIGMPIVGLATTELATVIRNGENGFVHTDINALVDAMHELLRD
FT                   PAQARRLGEGARRTALERFHIDRFAQDWHDALLQVTA"
FT   gene            607929..609020
FT                   /locus_tag="BC1003_4066"
FT   CDS_pept        607929..609020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4066"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4066"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60002"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDH4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADN60002.1"
FT                   /translation="MKELTRKRILVTGGAGFLGSHLCERLVTQGHDVLCVDNFYTGTKD
FT                   NIAHLLDCANFELMRHDVTFPLYVEVDEIYNLACPASPIHYQHDPVQTTKTSVHGAINM
FT                   LGLAKRVKAKIFQASTSEVYGDALVHPQKEDYWGHVNPIGPRSCYDEGKRCAETLFMDY
FT                   RRQHGLSIRIARIFNTYGPRMHPADGRVVSNFMMQALRGEPLTLYGDGSQTRSFCYVDD
FT                   MIDAFIRLMNCADDPGGPVNLGNPHEVSMREIAERIVAITGSNSPLELHPLPTDDPWHR
FT                   QPDISRARELLGWQPQTSLDEGLEQTARYFRARIEAGFGTSSDVGPEARTGAGTEGGSR
FT                   ARSAAGSNAGTVASFAPQRPALT"
FT   gene            complement(608999..610747)
FT                   /locus_tag="BC1003_4067"
FT   CDS_pept        complement(608999..610747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4067"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="SMART: DEAD-like helicase ; helicase domain protein;
FT                   manually curated; TIGRFAM: ATP-dependent DNA helicase, RecQ
FT                   family; KEGG: bpy:Bphyt_6329 ATP-dependent DNA helicase,
FT                   RecQ family; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4067"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60003"
FT                   /db_xref="GOA:E1TDH5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDH5"
FT                   /inference="protein motif:TFAM:TIGR00614"
FT                   /protein_id="ADN60003.1"
FT                   /translation="MTLDQRLRSMRKTMRDMFGIARLRAGQEDIIRSVLEHRDTLATMP
FT                   TGAGKSLCYQLPALHLEGTTLVVSPLIALMKDQADKLLAAGIDCTLVNSTLKSRAEREA
FT                   LQRIAAGDSGIVFVTPERLAQPAFIETLRSRPENRVGLVVVDEAHCVSHWGHDFRPAFL
FT                   EIAAAVKLLGQPPVLALTATATPRVIDDIVRSLALREPRVVRTGTYRENLHYRVVQVST
FT                   AGGKDGAARAMAAKREQLSTLIASLAGTGIVYAATVRDVDRIYGWLAEAGESVSRYHGR
FT                   MAAAAREQAQEQFMSGATRLMVATNAFGMGIDKADIRFVIHYHIPGSLDAYYQETGRAG
FT                   RDGEPADCVLLFDLNDKRIQQFFLAGRYPSVELAQRVYDTLTTLVDQDPKGATLKALKD
FT                   ALPDVGAGKLEVALNMLVDARVAGRDRQRRYRLRSRDDARQPARDSVAQAAAQFEQMSA
FT                   HDRETLQAMIDYAQTGQCRWRAILDYYGDTPAVERCGACDNCVRPPQIDVTPQDIVASA
FT                   TSEHEVAPRRKNTPREPRVWAPGDAVRVPRYGAGEVALASGEQVAVQFPDGSTRTFLAS
FT                   YVRAGR"
FT   gene            610896..611153
FT                   /locus_tag="BC1003_4068"
FT   CDS_pept        610896..611153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_4765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4068"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60004"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDH6"
FT                   /inference="similar to AA sequence:KEGG:Bphy_4765"
FT                   /protein_id="ADN60004.1"
FT                   /translation="MNQEPSDPVERADQRREQLRDGDVKVKSDGKVEQRPHGNMDATLI
FT                   PKGKDHPEEGPYTPEHDHVDPDLEPGGAKGHPTSKDDLEA"
FT   gene            complement(611249..611857)
FT                   /locus_tag="BC1003_4069"
FT   CDS_pept        complement(611249..611857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4069"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60005"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDQ3"
FT                   /inference="similar to AA sequence:KEGG:BC1002_6447"
FT                   /protein_id="ADN60005.1"
FT                   /translation="MDSRGDFKEGARALKERLPQADSVARGLGWFSIALGVAELVAPRT
FT                   MARVAGVETGAGAMRFYGLRELACGVGILASRNPRPFLWARVGGDALDLGTLALSSNRL
FT                   SARERQRAGVAALNVACVTALDVYAAKCASSAPRAPSADYGDRSGFAQSPEQMRGAALA
FT                   DFEIPRDMRTPEALAPYTRSDASAMRAGAGRAGNATNGA"
FT   gene            complement(611988..613157)
FT                   /locus_tag="BC1003_4070"
FT   CDS_pept        complement(611988..613157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4070"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   bph:Bphy_4801 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60006"
FT                   /db_xref="GOA:E1TDQ4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDQ4"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADN60006.1"
FT                   /translation="MKALRWHGKKDIRCDTVPDPKIEHPRDAIIKVSSCAICGSDLHLY
FT                   DGFMPGMESGDIMGHEFMGEVVEVGKENTALKVGDRIVVPFTIICGECDQCKRGNFSVC
FT                   ECSNRNKDVADKVFGHTTAGLFGYTHLTGGYPGGQAEFVRVPYADKTHVKIPDGLTDEQ
FT                   VLFLGDIFPTGWQAAVQCDIEPTDTVAIWGAGPVGQMAIRSAVLLGAKQVIAIDCVPER
FT                   LSMARAGGAVTIDFKEESVLERLKELTGGKGPEKCIDAVGMESHATRSLDAMYDRAKQA
FT                   VMLETDRPHVLREMIYVCRPAGTLSVPGVYGGLVDKIPFGASMNKGLTWRMGQTHVNRW
FT                   TDDLLRRIQQGQIDPSFVITHTVSLDEGPRMYKTFRDKEDGCIKVVLKP"
FT   gene            complement(613323..613625)
FT                   /locus_tag="BC1003_4071"
FT   CDS_pept        complement(613323..613625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4071"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60007"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDQ5"
FT                   /inference="similar to AA sequence:KEGG:BC1002_1226"
FT                   /protein_id="ADN60007.1"
FT                   /translation="MKHDPRRHQEHRAVILERMAMTRAQLLSANLALRTPHRAIRAGVP
FT                   AVNVMTSLADTPYVALVLAAGLAAVLLGPRKAIGTLARTSVMAWLTRSARSVFQR"
FT   gene            complement(613622..613996)
FT                   /locus_tag="BC1003_4072"
FT   CDS_pept        complement(613622..613996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4072"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60008"
FT                   /db_xref="GOA:E1TDQ6"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDQ6"
FT                   /inference="similar to AA sequence:KEGG:BC1002_1225"
FT                   /protein_id="ADN60008.1"
FT                   /translation="MSIHTKVSQWRNVARFCSSRAVDYAELLALELDEAKARLVREVIA
FT                   MVVLAVAAMFTLSFLCVAIIVTAWNTPYVVAVAWGVAGAWLLISIATFAMMKMQKPVEP
FT                   LHVLRDEVSSDLEALKDALK"
FT   gene            complement(614105..614389)
FT                   /locus_tag="BC1003_4073"
FT   CDS_pept        complement(614105..614389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4073"
FT                   /product="CsbD family protein"
FT                   /note="KEGG: CsbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4073"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60009"
FT                   /db_xref="GOA:E1TDQ7"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDQ7"
FT                   /inference="similar to AA sequence:KEGG:BC1002_3414"
FT                   /protein_id="ADN60009.1"
FT                   /translation="METGKVEGKVKEIGGKLEQTAGDMLGDTGTQMAGTARELSGKAQQ
FT                   VWADLADVVRETTTERPFTALAIAAAAGFILGALRSATARDVRGDRDYR"
FT   gene            complement(614772..615020)
FT                   /locus_tag="BC1003_4074"
FT   CDS_pept        complement(614772..615020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4074"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60010"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDQ8"
FT                   /inference="similar to AA sequence:KEGG:BC1002_0825"
FT                   /protein_id="ADN60010.1"
FT                   /translation="MRQTYPTGALGSMRQAMIERDLAHIEHVLLSCPAGARENSALPLS
FT                   YWQDRLRRIKDGGQLWGVHLRKIDSLQRILNGAMPPG"
FT   gene            615344..617383
FT                   /locus_tag="BC1003_4075"
FT   CDS_pept        615344..617383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4075"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor plug; TonB-dependent
FT                   receptor; KEGG: bph:Bphy_5030 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60011"
FT                   /db_xref="GOA:E1TDQ9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDQ9"
FT                   /inference="protein motif:PFAM:PF07715"
FT                   /protein_id="ADN60011.1"
FT                   /translation="MALTPRASYSITHRLVAYSVAGLATLCSPAAFAGNEWDENITVPP
FT                   DTAELAAMPLEALMQVTVNTASRFDQFVTDAPAAVVVLTAEDIRQFGWRTLSDALASLP
FT                   GLYVTNDRTYEYLGSRGFQRPGDYNSRFLLLIDGIRTNDGVYGQAPIGSDFPLDMDLVK
FT                   RIEYVPGPGSSMYGANALFGVINVITKSGSDLAGAEAAVAAGSFGEKKARASYGWHGAH
FT                   GADILLSATAYGRNGQDLYYPEFDTPGQNRGIANRLDYERAQDFLARAAYGDFRLSFIY
FT                   GNRTKGIPDAPYGAVFNAPFSVSDTHSYLDLSYQHALSDSVLLSSQVYWGHYDYRMPAI
FT                   IGAEPYVMNVDGSHALWYGADVHATISSFARHRIVIGTDFARDGRLDQYNYNVAPSSQF
FT                   LDDHHSGNRGGVYIEDEITLPAHFTLNAGLRYDQQTAAGGNLSPRIGLIYKLTPRDTFK
FT                   LLYGEAYRAPNAYEMYYAINGPDGQIGNRSLKAEHIATTELVYERAVSATGRATLSLFQ
FT                   YNARDLISETQDSSGLFMFRNVNRATARGAELAYEQRFARARLRASYSYQIAHDSDTGA
FT                   ALQNSPRHLAKLNLAAPFFANALMTGLEVQCTSSRLAQTGEAGGFCLANLTLSSSRLIR
FT                   GAELSFSIYNLTDKRYADPVGPGFTQETVAQQSRTFLFKAVYGF"
FT   sig_peptide     615344..615445
FT                   /locus_tag="BC1003_4075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.835) with cleavage site probability 0.835 at
FT                   residue 34"
FT   gene            617385..617915
FT                   /locus_tag="BC1003_4076"
FT   CDS_pept        617385..617915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4076"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: bph:Bphy_5029 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4076"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60012"
FT                   /db_xref="GOA:E1TDR0"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDR0"
FT                   /inference="similar to AA sequence:KEGG:Bphy_5029"
FT                   /protein_id="ADN60012.1"
FT                   /translation="MERVRIRIIAAYVLFASPLIVHTSVDAQVDLPALEAAYIFNFAQF
FT                   AEWPAGRPTDNMLSVCADPESPLGQALARLDGKRGGKQAWRVRPLPRAEKAADCQLAVL
FT                   TAGTAVSSAIKALLASDAPVVIVSEADVTERGWVIRLVREGDHLKFDINVTEASRRRIT
FT                   LSSKLMRLARTVL"
FT   gene            617912..619855
FT                   /locus_tag="BC1003_4077"
FT   CDS_pept        617912..619855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4077"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   bph:Bphy_5028 diguanylate cyclase/phosphodiesterase; SMART:
FT                   EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4077"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60013"
FT                   /db_xref="GOA:E1TDR1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDR1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADN60013.1"
FT                   /translation="MKSIRLWRTFAWPREHVNLVGVAIALLISSVVLLVYQALSLRTSL
FT                   TEDVSMQASVLAENLTASAMFGDRDATAEVLGSLRKVPHVESASVYTPAGDLFVRYTRP
FT                   GLNRVESEEGTLANIGSSPRLSLEDIFVAAPIIHNDRLLGSIVIVATTDAIRMQLVQYG
FT                   CFLVGASLCSVWIASLVMRRMRERVSRAEKDLEYLASTDPLTDLPNRRAFYDELKARLH
FT                   RASAADKRVALMMVDLDNFKTVNDTLGHGAGDELLKQVAEALRNVVRPNDLVSRIGGDE
FT                   FAVVIGPDASRVRARATAGRIARNLSRPFVLHGSDSAVTASVGFSVYPEDTGEMAELVS
FT                   NADIALYSAKSRGKSIAVEFQSEMTAEAQRRARIEAELRRAVDQDGLEIVYQPQFDCLS
FT                   GRLLGAEALVRWTHPSEGPISPAEFVPIAENSDLIVALGRWVLWRACRDAASWNAGREA
FT                   SVHVAVNISARQLRDEGFTREVCDALQKSGLPASLLELELTESQLMSNMSVGIQAMQEL
FT                   RAAGVRLSLDDFGTGYSSLSYLQSFPVHSIKIDRSFICPLPNGGQPIVTAIISMAHSFG
FT                   LLVVAEGVEYPAQLEWLCDARCDVVQGFLTGRPMSLQQLLATIRAEQAPEQDKPAGRRA
FT                   PLEVRPQRAPTA"
FT   gene            619928..620380
FT                   /locus_tag="BC1003_4078"
FT   CDS_pept        619928..620380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4078"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: bxe:Bxe_B2020 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4078"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60014"
FT                   /db_xref="GOA:E1TDR2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDR2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADN60014.1"
FT                   /translation="MSKNDPPLDPDSLHVLAEDLRVLTGKLRRRLREEAHLGDFTPSQI
FT                   QVLGLLERDGPATVTELARAQGMRSQSMSETLSVLKAAGLVSGAPDPNDGRQTVLSLTP
FT                   AFRKKVKASRAAREDWLFRTIQTRFSAAEQKQLATSVALLKRLIES"
FT   gene            620413..620982
FT                   /locus_tag="BC1003_4079"
FT   CDS_pept        620413..620982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4079"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   bpy:Bphyt_5812 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4079"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60015"
FT                   /db_xref="GOA:E1TDR3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDR3"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADN60015.1"
FT                   /translation="MALTTLDAKTALVVIDLQQGIVAMPTAHPTAEVVQRAAALADAFR
FT                   RHGLPVVLVNVAGGAPGRAEQARPTGNFPPGFTDLVPELNRQASDHLVTKHTWGAFTNT
FT                   DLEAYLREQGVTQIVLTGVSTSIGIESTARFAHELGLNIAFAVDAMTDLHLDAHTNSLT
FT                   RIFPRLGETGTTQEVLNMLEQTRASA"
FT   gene            621059..622399
FT                   /locus_tag="BC1003_4080"
FT   CDS_pept        621059..622399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4080"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B2022 major facilitator superfamily multidrug
FT                   efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60016"
FT                   /db_xref="GOA:E1TDR4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDR4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN60016.1"
FT                   /translation="MSSTFRSLRNFNYRMWASGAIVSNVGTWMQRTAQDWLVLTELTQH
FT                   NATSVGIVMSLQFGPQMLLLPLTGYAADRFDRRKLLLVTQAAMGGLALGLGLLTITGLV
FT                   ELWHVYVFAGLLGCVTAFDAPARQTFVSDLVGESDLSNAVALNSTSFNAARMIGPAVAG
FT                   LLIASVGTGWVFLINALSFIAVLGALRMLRVRELHAKPLTVRSRGSFVEGFKYVWKRPD
FT                   LKAALLMQFLIGTFGLNFPIFISTMSVSAFHAGAGEYGVLSSTMAVGSVTGALLAARRA
FT                   RPRMALLLGAAAIFGVGCTAASLMPNYVLFGMVLVFIGVSTQTFNTSTNSLVQLSTEPA
FT                   MRGRVIAILLAIALGGTPLGAPVVGWVADRFGPRWALGVGAASGFAAALVGLLYLVRYR
FT                   GLRVFVDAGRLRYSIDEPRQAPPYVSPATAVQNAVLDEAEEESSSGV"
FT   gene            complement(622575..624098)
FT                   /locus_tag="BC1003_4081"
FT   CDS_pept        complement(622575..624098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4081"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="KEGG: bxe:Bxe_B2023 acylating
FT                   methylmalonate-semialdehyde dehydrogenase; TIGRFAM:
FT                   methylmalonate-semialdehyde dehydrogenase; PFAM: Aldehyde
FT                   Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4081"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60017"
FT                   /db_xref="GOA:E1TDR5"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDR5"
FT                   /inference="protein motif:TFAM:TIGR01722"
FT                   /protein_id="ADN60017.1"
FT                   /translation="MNAVNEQDKLSVQQLGHYIGGAVVAPTSGRFKDVFNPATGKVTGA
FT                   VALASVEEVDAAVQAARAAFAAWSETAPLKRARILFRFKELLNQHHDELAMLITREHGK
FT                   VFTDAQGEVVRGIEVVEFACGIPNLLKTDFTDQIGGGIDNWNLRQPLGVVAGITPFNFP
FT                   VMVPMWMFPVALACGNTFVLKPSERDPSASLRIAELLKEAGLPDGVFNVVNGDKVAVDA
FT                   LIEHPDVAALSFVGSTPIAEYIHTEASKRGKRVQALGGAKNHLVVMPDADLDQAVDALI
FT                   GAAYGSAGERCMAISVAVAVGNVADKLIEKLVPRVKSLVIKNGENLDAEMGPLVTAEHK
FT                   AKVAGYIASGVEEGATLIVDGRAHPVAQEEGFFIGGTLFDNVGTQMKIYKEEIFGPVLA
FT                   VVRVPDFASAVELINAHEFGNGVSLFTSDGGVARAFGRQIQVGMVGINVPIPVPMAWHS
FT                   FGGWKKSLFGDHHAYGEEGVRFYTRYKSIMQRWPDSIAKGAEFTMPVAK"
FT   gene            624431..625840
FT                   /locus_tag="BC1003_4082"
FT   CDS_pept        624431..625840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4082"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_5816 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4082"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60018"
FT                   /db_xref="GOA:E1TDR6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDR6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADN60018.1"
FT                   /translation="MATNTAASSRKHRGQAGKATASGWIGSALEYYDFFIYAQAAALIF
FT                   PQLFFPSGNPKIAIVASLATYGVGYVARPIGAFVLGHWGDTHGRKNVLLLCMFLMGFST
FT                   MAVGLLPTYQHAGLLAPTLLVVLRLIQGFAVAGEISGASSMILEHAPFGRRGYYASFTL
FT                   QGVQAGQILAAAVFLPLAYYMEESSFNSWGWRIPFLLSALVLVAGYIIRREVDETPAFT
FT                   QEDKSGGVPRSPIADAFRYNWPDVLRVVGCSLMNVIPVVATIFGAAYAVQASYGIGFSK
FT                   SVYLWIPVIGNIVAVLVIPYVGNLSDRIGRRLPIIVGALGAGLLSFAYLYAISIHNVAL
FT                   AMVMSILMWGVIYQGYNATFPSFYPELFPTRSRVSAMAIGQNIGTTITALLPALFAYVA
FT                   PPGSHNVPVTIGAITFGITIIAAVTAWSARENYRVRLGDLGQPDAVPLDKTSYDQLRAE
FT                   TLAHAKKTAAS"
FT   gene            complement(625868..626938)
FT                   /locus_tag="BC1003_4083"
FT   CDS_pept        complement(625868..626938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4083"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60019"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDR7"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5819"
FT                   /protein_id="ADN60019.1"
FT                   /translation="MPLSPEADATSKSTLKKAIFLHTGWRSAGTWVWSRLRALDGATGF
FT                   YEPLSNVLADLSLAEVAASRPTLTSGHPPLEAPYFDEYKAFLREGTRGVSGYRRTFSTD
FT                   RFSEQPDAGFPALQSYLRSLCEHSAQQGRVPVLKFCRSSGRVQWLRHAFADAMHVGVLR
FT                   NPASQFASGWLLNQQWRNPFFVAAPFRVLGLNRTEPLVRQIIELCDVKLPPAAPASDDT
FT                   YALACEHYARSAEGNNAYRAFVALWVLGAYRMGQGVDLVVDMDLLGQSREYAAGLRAGF
FT                   EAHSALSPDFSSARDLLEETRRSAARMSAIDGQAMRSVHSAALKFLKMQSGVDAAFVER
FT                   VREKMVLANELTAQWR"
FT   gene            complement(627032..627484)
FT                   /locus_tag="BC1003_4084"
FT   CDS_pept        complement(627032..627484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4084"
FT                   /product="homoprotocatechuate degradation operon regulator,
FT                   HpaR"
FT                   /note="SMART: regulatory protein MarR; manually curated;
FT                   TIGRFAM: homoprotocatechuate degradation operon regulator,
FT                   HpaR; KEGG: bxe:Bxe_B2027 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4084"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60020"
FT                   /db_xref="GOA:E1TDR8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDR8"
FT                   /inference="protein motif:TFAM:TIGR02337"
FT                   /protein_id="ADN60020.1"
FT                   /translation="MSSSASTRVLHRNLPMLLLRAREKMMERFRPLITAHGLTEQQWRV
FT                   IRALNEHGPMEPRHISDICTISSPSMAGVLARMESMELITKERFAEDQRRVLVSLTDAS
FT                   VELVRVLSKDLEAQYRELERKVGPEIVERVYRAVDDLLAGLEQEED"
FT   gene            627633..628406
FT                   /locus_tag="BC1003_4085"
FT   CDS_pept        627633..628406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4085"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bxe:Bxe_B2028 putative 5-oxo-1,2,5-tricarboxilic-3-penten
FT                   acid decarboxylase/isomerase (HpaG)"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60021"
FT                   /db_xref="GOA:E1TDR9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDR9"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADN60021.1"
FT                   /translation="MFALADHLLHPEGDALPRDVDAHAAAALLARGIACRPPVSGSVYA
FT                   TLLNDRAALAALGDAMHAAPYKAPPKAPVLYLKPRNTLAGHCAKVAVPDNDVGVEVGAS
FT                   LGIVIGRTATRVSAARALDYIAGYTVVADLSVPHASVYRPSVRFRARDGFCVVGPAVVA
FT                   ARHVADPDELPIAVSLNREQTFAASTASSVRKVAALLADVTDFMTLAPGDVLTTGVPHG
FT                   SPIAHIGDEATLSIGGLPPLRVSFVGATQAHGDQP"
FT   gene            628403..629161
FT                   /locus_tag="BC1003_4086"
FT   CDS_pept        628403..629161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4086"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit"
FT                   /note="KEGG: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase,HpaG2 subunit;
FT                   TIGRFAM: 4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4086"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60022"
FT                   /db_xref="GOA:E1TDS0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDS0"
FT                   /inference="protein motif:TFAM:TIGR02303"
FT                   /protein_id="ADN60022.1"
FT                   /translation="MMRARVAYAGAIHEAYPHAQGVQLADGRVCREDEVVWLAPIEVGT
FT                   MFALGLNYAEHAKELQFSKQEEPLVFLKGPGTVLGHRGFTRRPADVTFMHYECELAVVI
FT                   GRTARNVQRDNAMEHVAGYMIANDYAIRDYLENYYRPNLRVKNRDGATVLGPWFVDAAD
FT                   IRDIAQLELRTFVNGTLQQRGNTRDLVTDIPALIEYLSGFMTLAPGDVILTGTPEGVVN
FT                   VNAGDEVVCEIDGLGRLVNTIASDADFGRT"
FT   gene            629209..630666
FT                   /locus_tag="BC1003_4087"
FT   CDS_pept        629209..630666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4087"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /note="KEGG: bpy:Bphyt_5826
FT                   5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase; TIGRFAM: 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4087"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60023"
FT                   /db_xref="GOA:E1TDS1"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDS1"
FT                   /inference="protein motif:TFAM:TIGR02299"
FT                   /protein_id="ADN60023.1"
FT                   /translation="MRIDHLINGKTAGAKDYFETVNPATQQVLAEVARGGAEEIHAAVR
FT                   AAKEAFPAWAAKSASERAKLVRKLGELIAKSVPDISETETKDTGQTISQTRKQLVPRAA
FT                   DNFSYFAEMCTRVDGHTYPTDTHLNYTLFQPVGVCALISPWNVPFMTATWKVAPCLAFG
FT                   NTAVLKMSELSPLTASMLGALALEAGIPAGVLNVVHGFGKETGEPLVAHPDVRAVSFTG
FT                   STATGNRIVQTAGLKKFSMELGGKSPFVVFDNADLERALDAALFMIFSNNGERCTAGSR
FT                   ILVQKSIYAEFAQRFVERAKRLTVGDPLAESTIIGPMISQGHLAKVRSYIELGPKEGAT
FT                   LACGGLDAPDLPDALRKGNFVMPTVFVDVDNRMRIAQEEIFGPVACLIPFDDEAHAIRL
FT                   ANDISYGLSSYIWTENTGRAHRVAAAVEAGMCFVNSQNVRDLRQPFGGTKASGVGREGG
FT                   TWSYEVFLEPKNVCVSLGSHHIPRWGV"
FT   gene            630728..631591
FT                   /locus_tag="BC1003_4088"
FT   CDS_pept        630728..631591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4088"
FT                   /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
FT                   /EC_number="1.13.11.15"
FT                   /note="TIGRFAM: 3,4-dihydroxyphenylacetate 2,3-dioxygenase;
FT                   KEGG: bpy:Bphyt_5827 3,4-dihydroxyphenylacetate
FT                   2,3-dioxygenase; PFAM: Extradiol ring-cleavage dioxygenase
FT                   class III protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4088"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60024"
FT                   /db_xref="GOA:E1TDS2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011984"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDS2"
FT                   /inference="protein motif:TFAM:TIGR02298"
FT                   /protein_id="ADN60024.1"
FT                   /translation="MGKLALAAKVTHVPSLYLSELDGPHKGCRQPAIDGHHEIGRRCRE
FT                   LGVDTIVVFDVHWLVNSEYHINCAPSFEGVYTSNELPHFIKNMPYAYPGNVGLGHLIAE
FT                   VANEMGVKSRAHSETTLELEYGTLVPMRYMNSDQHFKAVSVAGWCMWHQLETSARFGLA
FT                   VRKAIEERYDGTVAILASGSLSHHFAENGTAEQFMHKVWSPFLEQMDRRVVELWQAGDW
FT                   KTFCAMLPLYNEKCWGEGGMHDTAMLLGALGWDRYEGKVEVVTPYFGSSGTGQINAIFP
FT                   VTPLPV"
FT   gene            631625..632026
FT                   /locus_tag="BC1003_4089"
FT   CDS_pept        631625..632026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4089"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /note="PFAM: 5-carboxymethyl-2-hydroxymuconate isomerase;
FT                   KEGG: bpy:Bphyt_5828 5-carboxymethyl-2-hydroxymuconate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4089"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60025"
FT                   /db_xref="GOA:E1TDS3"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDS3"
FT                   /inference="protein motif:PFAM:PF02962"
FT                   /protein_id="ADN60025.1"
FT                   /translation="MPHLTLEYSANLADNESIGRLCKTLAQCLAEQRENGQPVYPLGGI
FT                   RVRALRCERYCIADGRADAAFLHANLKIAAGRSDAVKKATGNAIFTLIKEHFADEFEQS
FT                   GLALSLELNEFSEAGTWKHNNLHARLNAH"
FT   gene            632069..632872
FT                   /locus_tag="BC1003_4090"
FT   CDS_pept        632069..632872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4090"
FT                   /product="2-oxo-hepta-3-ene-1,7-dioic acid hydratase"
FT                   /EC_number="4.2.1.80"
FT                   /note="TIGRFAM: 2-oxo-hepta-3-ene-1,7-dioic acid hydratase;
FT                   KEGG: bxe:Bxe_B2033 putative 2-oxo-hept-3-ene-1,7-dioate
FT                   hydratase(HpaH); PFAM: fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60026"
FT                   /db_xref="GOA:E1TDS4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012690"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDS4"
FT                   /inference="protein motif:TFAM:TIGR02312"
FT                   /protein_id="ADN60026.1"
FT                   /translation="MLDIQTIRDLAAQLDHAEKTRTQLRHFSAAYPQMTVEDGYAIQRE
FT                   WVKLKLAEGHAIKGRKIGLTSRAMQRSSQIDEPDYAPLLDSMFIENGQDIRADRFIAPR
FT                   VEVELAFVLNRPLKGPGVTLFDVLDATAYVTPAVEIIDARIEQFDRETRAPRKVYDTIS
FT                   DFAANAGVVLGGRPVRPLDVDLRWVGALLYKNGAVEESGLAAAVLNHPATGVAWLANKI
FT                   APYDEMLNANDVILSGSFTSPIAAKAGDTFHVDYGPLGGIALNFI"
FT   gene            632881..633684
FT                   /locus_tag="BC1003_4091"
FT   CDS_pept        632881..633684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4091"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /EC_number="4.1.3.39"
FT                   /note="TIGRFAM: 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase; KEGG: bpy:Bphyt_5830
FT                   2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; PFAM:
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4091"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60027"
FT                   /db_xref="GOA:E1TDS5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR012689"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDS5"
FT                   /inference="protein motif:TFAM:TIGR02311"
FT                   /protein_id="ADN60027.1"
FT                   /translation="MSLPQNTFKQALREGKPQFGLWAALADAYVTELLATAGFDWLLID
FT                   NEHAPNDVRSTLAQLQAVAAYASHPVVRPVRSDSALIKQLLDIGAQTLLLPMIDTADEA
FT                   AAAVAATRYPPHGIRGVGSALARASRWNRVPDYLHRAADELCVIVQAETVQSMQNLPEI
FT                   AAVEGVDGVFFGPSDLSASMGLLGKPGDASVRAAIRDGIQTVQRAGKAAGVLAPDRAIA
FT                   EEYLAAGAVFIAVGTDTGLLSRAAGELAASYKRGAGSDSAIAGGY"
FT   gene            complement(633810..636143)
FT                   /locus_tag="BC1003_4092"
FT   CDS_pept        complement(633810..636143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4092"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   bxe:Bxe_B2035 diguanylate cyclase/phosphodiesterase; SMART:
FT                   GGDEF domain containing protein; EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4092"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60028"
FT                   /db_xref="GOA:E1TDS6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDS6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADN60028.1"
FT                   /translation="MLLTLPQQSADAGLRERFHRRSLEHQRPLSTVTMAFTVVAFLCLV
FT                   VARGLAGEPAKPLAYRLGCALVLALLVLAIPRTRSTWTFGAIGVAFSLTLVVGLALNVA
FT                   GVQQPLLWSLPALVVIPVCAAPLWLTPTHFFVGSAFFYAAAAGLLLGAPRTAELNIVVW
FT                   MWVAAIGMPTAVVFHFGFYWFRRNHFLLEDRLAQLAATDPLTGLQNRRAFVTQAERRLA
FT                   DVAQGGQVSAIFLDIDNFKSLNDRFGHAVGDLALRQVAQVLLDGTSRTDSVSRIGGEEF
FT                   AVLSSNGLRGALELAEQLRGAIAALERPDGNLTASFGVAEHRTGENIMVLLDRADEALL
FT                   RAKHSGRNRVCAERPLPDAPLQLLIEDACGAAGTAGLRHKWEDYYLTSHFQPLFSLSHQ
FT                   KQIGFEALLRGELEDGTLLPPAVLFAPKPSSDEGVLDRASHAVHLANARASLPGEGWLF
FT                   LNILPATFVAEGYADELAGIVQRVGLAPEQLVLEILESHGGSVDDMSRAAALYREHGFV
FT                   IAVDDFGAGQSNLDRLLRIRPDIVKLDGELIRATGHGTGQPILPKLVSLLHQAGMLVVV
FT                   EGVETTEELILAVESNVDFAQGYLLGRPAPEITPPGSVHVRIDDAFDVIAQGRAHQHAL
FT                   FESEVEPYRVALREAAAALQAGADMTRAFATLATYERSVSCFILDDSGRQVGPEVPGPA
FT                   WVKDGASLQPVANPRDARWDHRPYYRNAVLLPGVPVASNPYLSLASGRPCIAVTLAVQF
FT                   ADERSVIGVELDWSAQGLPWPAGE"
FT   gene            636738..637193
FT                   /locus_tag="BC1003_4093"
FT   CDS_pept        636738..637193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4093"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60029"
FT                   /db_xref="InterPro:IPR022798"
FT                   /db_xref="InterPro:IPR038470"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDS7"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5833"
FT                   /protein_id="ADN60029.1"
FT                   /translation="MAAILDYLLERQLSPQWRGMLSALASEFEAQIGPAELRQLMHRVG
FT                   SRFAAAHPLPACDSTADLARTLNARWQAIDWGYVELADERESLRIVHYCAPLPAFGDSA
FT                   LAWTPAFLEGAYQTWLSALGAQGLSVVQTGDYADDTALEFRLGRHAL"
FT   gene            637343..638116
FT                   /locus_tag="BC1003_4094"
FT   CDS_pept        637343..638116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4094"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60030"
FT                   /db_xref="InterPro:IPR024487"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDS8"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2038"
FT                   /protein_id="ADN60030.1"
FT                   /translation="MSSSSDIEKLFDHFGGDANAYQEIGRENEAHTARTRWPLLVTLDL
FT                   RQPPIPAIGPHAQTSAKPEPADDEPAAAAPAAARQDAAPKDAVSVMRAKAPLFTRSPRR
FT                   DIPPVVAAVAAPAGPRGAARFGAVDTSGTTARVSPSGSVDAVPPVAADLPPVSAFTSAS
FT                   ASAPAPAPAATPKFEPAPAATHTSAPPSTSILGKLFSRQDDSAPTRAAAPAAQPVALQS
FT                   LFDRLRGTPHGTAASARAPEAAAPNSWLLNGPRRS"
FT   gene            638113..638901
FT                   /locus_tag="BC1003_4095"
FT   CDS_pept        638113..638901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4095"
FT                   /product="cellulose synthase operon protein YhjQ"
FT                   /note="TIGRFAM: cellulose synthase operon protein YhjQ;
FT                   KEGG: bxe:Bxe_B2039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60031"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDS9"
FT                   /inference="protein motif:TFAM:TIGR03371"
FT                   /protein_id="ADN60031.1"
FT                   /translation="MKVIAVVSAKGGVGKTTLAANLASVLAASGRRVIALDLDPQNALR
FT                   LHFGVPLDSIDGLSRATLTGDAWQSVMFDGVDGVTVLPYGAVLEEDRRRFEAHVDQDPL
FT                   WLAHALRSLRLDASDVVIVDTPPGSSAYVRAGLCAATFALNVVLADAASYAAIPQMERL
FT                   IDTYAAPRAEFGGVGYVVNQIDQSRQLTKDVLKVLRQMLGDRLFPGVIHLDEGVSEALA
FT                   CDTTLIHYDPLSQAAADFRACGTWLMAAVDAIAVPPRNVA"
FT   gene            638898..641102
FT                   /locus_tag="BC1003_4096"
FT   CDS_pept        638898..641102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4096"
FT                   /product="cellulose synthase catalytic subunit
FT                   (UDP-forming)"
FT                   /note="KEGG: bpy:Bphyt_5836 cellulose synthase catalytic
FT                   subunit (UDP-forming); TIGRFAM: cellulose synthase
FT                   catalytic subunit (UDP-forming); PFAM: glycosyl transferase
FT                   family 2; type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4096"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60032"
FT                   /db_xref="GOA:E1TDT0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDT0"
FT                   /inference="protein motif:TFAM:TIGR03030"
FT                   /protein_id="ADN60032.1"
FT                   /translation="MSTPQSQPIEAVEPSRLERFVDARFWNSRIVTALVTLLALVTLYF
FT                   VFTVPLAFYEQLTFATCCFVAALLFRRLQGRYATMVMIMLSVVTSGRYMYWRLTATTYW
FT                   EHPLDAAWGLLLVSAEVYSTLVLMLGYFQTAWPLKRKPMPLPASRDAWPTVDVFIPTYN
FT                   EPLSVVKPTIYAALALDYPADKLSIHVLDDGRRPEFKAFCEEVGVNWTIRTHNRHAKAG
FT                   NINEALKITSGEYLAIFDCDHIPTRSFLQIGLGWFLRDKLLSMLQTPHHFFSADPFERN
FT                   LGTFRKVPNEGELFYGLVQDGNDLWNATFFCGSCALLRRSMVEEIGGIAVETVTEDAHT
FT                   ALKLHRLGYTTAYLAIPQAAGLATESLSGHIGQRIRWARGMTQIFRIDNPLTGKGLKLG
FT                   QRLCYLNAMMHFFYGIPRLVFLTAPLSYLFFGAHVIEAAASTIAIYALPHMMHASITNS
FT                   RMQRSFRHSFWAEVYESVLASYITAPTLLALINPKLGKFNVTAKGGQIEKNYFDWAISR
FT                   PYLFLLLLNLIGFCVGIAHIYLNWHTRSVVQTTLLNLGWTVYNMLILGASVAAARERRQ
FT                   IRAVHRVAMEMPVMLKFSTGRTLACRTIDYSEGGVGVALPAAIQVPMHERVTVSLFRGD
FT                   EEYAFPATVGFTAPGRVGLRFSAMTREQEYEFVKTTFARADAWTGWAEGRQQDTPLRGL
FT                   SHVLTVGARGIAGLFEHLYSDLRSSLKSRPVDVKKLKTKD"
FT   gene            641106..643646
FT                   /locus_tag="BC1003_4097"
FT   CDS_pept        641106..643646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4097"
FT                   /product="Cellulose synthase BcsB"
FT                   /note="PFAM: Cellulose synthase BcsB; KEGG: bxe:Bxe_B2041
FT                   cellulose synthase regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4097"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60033"
FT                   /db_xref="GOA:E1TDT1"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDT1"
FT                   /inference="protein motif:PFAM:PF03170"
FT                   /protein_id="ADN60033.1"
FT                   /translation="MRNRMAKGSTKRSKHERNDTRSNTDGQRRGAQRSRASRLARGLAC
FT                   WLALQTAISAPLASVAQAAAAAASPTSGAAVATGMGNVAPPSPAVPYDSSMIAQAPLAM
FT                   PTPALAASAVKALGVKTPTTAEPGTLVPGGRRQTLTFADLGALDPLQLRGTDGQNGVAF
FT                   SVRGDEVVTGAVLHLIYSYSPALLPNLSQLKVLVNGEVAATLPVPREQAGMTVARDVSI
FT                   DPRFVTEFNHLNIQLIGHYTTNCEDPANSSLWATVSNASSLDLTYASLASKPDLAALPQ
FT                   PFFDRRDVRRLELPFVFPQKPSAGTLEAGGIVASWFGALAGYRGAVFPAQQDNVPLSGN
FT                   AVVFATDDQRPAGVKIPPISGPTVAVVERDAPARGKLLLVLGRSDAELKIAARALGIGR
FT                   NMLTGQSATITGLTELAKRVPYDAPNWLPTNRPVRFGELAEASDLTVSGYDADAVHVNL
FT                   RVPPDLFMWHTKGAPIDLRYRYTPRPLRDRSSLNVSVNKGFVQSLPIPAESSSMFELSH
FT                   YFARVLPDKTAEARRTVHIPPLLVTPRAQLRLHFYYDIPNTGECHGRLLQNVVGAVDPN
FT                   STIDLSSFPHYMALPDLAAFANSGFPFTRMADLSETAAILPQDADSSDYSLFLLTMGRM
FT                   GASTGYPVAGVTVGTADDVDKYADKDLLIFGAPGKQPLLQRWAKSMPFSSNGDSHTFQI
FT                   SDIVFKLEDWWHGERGVERLPARADLTLVSSNGDALLTGFESPLRKGRSAVALISAAGQ
FT                   SDADLSAALLDADMLPEIQGAMAVIHGRTVTIASNGEAYYVGHLSPQEYLRWALSSHPL
FT                   LLMLGGVLAALIIAGLFYRMLRSIAARRLKDSQD"
FT   gene            643648..644841
FT                   /locus_tag="BC1003_4098"
FT   CDS_pept        643648..644841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4098"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="KEGG: bxe:Bxe_B2042 endo-1,4-D-glucanase; PFAM:
FT                   glycoside hydrolase family 8"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4098"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60034"
FT                   /db_xref="GOA:E1TDT2"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDT2"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADN60034.1"
FT                   /translation="MRFRINRKQGLALALGLTLGLTASAGFARLVKAAQPAAAPGACGD
FT                   WSGYRTFVERFVQADGRVIDYSTPTQQTTSEGQSYGLFFALVANDRATFDRLLNWTRMN
FT                   LAGNQFDPQNVRLPAWLWGRKADGSYGVLDPNSASDSDLWIAYDLLQAGRLWHEPAYTQ
FT                   LGQALAARIARDEMTNLPGVGPMLLPGPQGFKDGGVTRLNPSYLPLPVLRALAQELPNG
FT                   PWAKLAESAYRLIRTTAPQGFAPDWAAWQNGQFVVDPKSGDTGSYDAIRVYLWAGLAAP
FT                   ADPLAKPWLAALGGMRARVAQNGFPPEKVSSTSGNASGEGPLSYWGALAPYFKAQGDAH
FT                   GLGLARTHLAALDASVPGHEPVYYDRVLGLFGTGFIDGRYRFDESGRLVPNWRNACD"
FT   sig_peptide     643648..643749
FT                   /locus_tag="BC1003_4098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.813 at
FT                   residue 34"
FT   gene            644832..649772
FT                   /locus_tag="BC1003_4099"
FT   CDS_pept        644832..649772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4099"
FT                   /product="cellulose synthase operon C domain protein"
FT                   /note="PFAM: cellulose synthase operon C domain protein;
FT                   Tetratricopeptide TPR_1 repeat-containing protein; KEGG:
FT                   bxe:Bxe_B2043 putative cellulose synthase operon protein C"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4099"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60035"
FT                   /db_xref="GOA:E1TDT3"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDT3"
FT                   /inference="protein motif:PFAM:PF05420"
FT                   /protein_id="ADN60035.1"
FT                   /translation="MRLSALAWSLRFALSAPLVCCLAAAAPDALAQASKDPMSVLIDQG
FT                   KYWQSHQRGDLAEQAWLKVLRIDPKQPDALFGMGMVLADRKDGAGAQQYLSRLKAVAPD
FT                   YPRLDDLGRRLGESSLRDQTVNDARRLAQSGQSASAVQEYQRALTGKPATPELQLEYYQ
FT                   ALSATPQGWDQARRGLEQLARDNPDDPRYALAYAQHLTYRDVTRRDGIARLQKLAGDST
FT                   VGASAKKSWRQALLWLDARPSDAALYQAYLQGASDDAAVKARFDSMVQQDKAARERAQE
FT                   NASVDARGRLIADGFAALDHDDPASARAKFSSVLANSPNDTDALGGMGIAALKQEHFAE
FT                   ARNYLERASRNGNPARWKTALDSATYWTYTSDAIGARSNGEFAKAKALFERAIALNPSD
FT                   VTAQVLLGEMLLANHDAAGAEQAYRMALRRQADNPDAIRGLVGALAAQGRGDEALQFAN
FT                   QLNAEQQSKAGGINRLRGEAQAAQARAAEARGDLGSARSLFEDALLNTPDDPWLRLDLA
FT                   RIYVRQGAVANARSMMDGLLAAHPDMTDALYASALLSAETQDWSTGLAQLERIPAAQRT
FT                   DAMASLQHRLWVHQQAELATRMAHAGQTQQALATLRAAEPVAGNSPELIGVLAAGYQQA
FT                   GDPNRALTLVRGAMSAAPGNTDLLLQYAGILSATQQESELGMVMRRLASMPLTPQQRTD
FT                   FGNLNVGIVIKQCDLVRRRGDLASAYDVIAPWLAAMPDNPDLQAALGRLYATAGDDRNA
FT                   LESYRVALRRKPDDLNLLQAAISAASGAKQFDYAEALAKDALKAAPDDPGVLATIGRMY
FT                   RAEGKLSLASTYLQRSLVAANTPLMANAPRTSATSNVPRGWETAMRRIGATPLPGTNPF
FT                   EGKTATVAPTDADNAALGFNASANAARASLPYSQSSLPTQTVPNYPPPTQPAPYVAPYV
FT                   APYGSSSVVPYAAPAQPYMQPASQQTSQPTSQPYLQPRTQPYAPNGAPAALPYNAPRQN
FT                   ADAGGYGQESNGSSQSGAPLQPYPGQGREAGASQMPGAAPMQQMQQMQQMQQMQQMPQM
FT                   PASAPMQQPYNPAYAQQQAPYAQQYGQQQAPYPQQQYGTPDGYVPTPWPMSPAARAAQA
FT                   NAGAMQPYGAPTSGAANGKRTTGKKQSASKNSRSAAGYAQQQPYYGQQGYGQQAYQPYP
FT                   QQAYAQQQPYAQQPYQPYPPQQQAYGNQGYYAQQQPYIPQPPTGYAQAYYPQQGGMSGN
FT                   GANYAQPNVANAQTLGVAEELAQVNREQASTVSGGIVFRNRSGEDGLSTLTDIEAPVQG
FT                   RIKAGNGHVVVTATPVTLDAGTAAGNVSTLARFGAGLSNSTSAAAAVAGTNNYGSQTAS
FT                   GVGLSVGYEGRSLSGDIGVTPIGFRETNLVGGAQYNGGISDKVSYSLAVARRAVTDSLL
FT                   SYAGTRDAASGLEWGGVTSTGGLASLAWDDGTNGLYVNAAYQYYQGHNVASNNAVKGGG
FT                   GVYTRLLKDADQTLTVGVNTTLMRYNKNLSYFTYGQGGYFSPQQYVILNLPIEWTGRNG
FT                   AFTYDVKGSIGVQHYRQDASNYFPLGDSGGLQAAAAANATLIGNSVDSNAQYPGQSKTG
FT                   VSYSLSAVGEYQLAPQLAFGATASLGNAYQYREWLAAVYMRYSFTKQTGLQPFPPTPLS
FT                   SPYLSLSN"
FT   gene            650116..652773
FT                   /locus_tag="BC1003_4100"
FT   CDS_pept        650116..652773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4100"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; response regulator receiver;
FT                   KEGG: bpy:Bphyt_5841 PAS/PAC sensor hybrid histidine
FT                   kinase; SMART: ATP-binding region ATPase domain protein;
FT                   PAC repeat-containing protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60036"
FT                   /db_xref="GOA:E1TDT4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDT4"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADN60036.1"
FT                   /translation="MPFPAHDHGCPGWSGEMAQRIGEFDWSATGIGAIADWPRSLTATV
FT                   QLLLASPVPLVLLWGKSGYMIYNDAYAVFAGGRHPYLLGCPVERGWPEVADFNRHVMQT
FT                   CLAGGTLSYRDKELVLLREGKPEDVWMDLYYSPVADDSGAPAGVLAVVVETTERVLTER
FT                   WRQRAEADLHETNERLQLALNTGAVLGTCVADMQTGKITGDERFARTFSFSVEEAARGV
FT                   DHSAATRMIHPDDQSLLERLRSEALQPGRPFRAEYRIRRPDGAYVWVQANGQCEFDEHG
FT                   QPTRFPAVLIDIHERKIAEQSLRQLTETLEQRVADAVAARAIAEEQLRQAQKMEAIGSL
FT                   TGGVAHDFNNVLQVINGNLQMMAADAGDNPATLRRLSAATEAVKRGAKLAAHLLAFARR
FT                   QPLSPTVLNPRRLLAGMSEMLHRALGETVRIETVLSDNLWHVQVDRNQLENALLNLAIN
FT                   ARDAMKTDGTLTVCAANRVLDAGFCSDKPELTPGEYVVFSVTDTGAGMPPEVLEHVFEP
FT                   FFTTKPHGHGTGLGLSMVFGFVRQSGGHTLIESTVGQGTTVSLFFPRCCEPETAETADE
FT                   TSAPVGGGETVLVVEDDADVRLTAVEMLVQLGYKVLTASSGDAALEFIHSDVPIDLLFT
FT                   DVVMPGKIKSVELARRAAARSPAVPTLFTSGYTRDEIVHHGKLDAGITLLSKPYRRDDL
FT                   ARKVRGVLRAARAPAAGAASVGKMTDREIAACVPSVAYDPPRSEMNDSEVTVERELQRE
FT                   AAPQAAPTRAPAHVLLVEDDADSREALSLLLGTLGLDCTSVGSAEEALPLVPAQRYDIL
FT                   CTDITLPGMSGDNLARAVLHAQPDVHVLLVSGYGAHASIGESIPGARILGKPFDLAQLR
FT                   HELARWVDPIEAAS"
FT   gene            653053..653319
FT                   /locus_tag="BC1003_4101"
FT   CDS_pept        653053..653319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4101"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60037"
FT                   /db_xref="GOA:E1TDT5"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDT5"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2057"
FT                   /protein_id="ADN60037.1"
FT                   /translation="MPAQHDPAPAASPSPAKARRKELSITVRNVLMVAVGVIVFAIVAG
FT                   VVLYQPIVYGDQIPNFGIILMLTVPVIAGVAFRVGLDAWLDRQ"
FT   gene            complement(653408..654763)
FT                   /locus_tag="BC1003_4102"
FT   CDS_pept        complement(653408..654763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4102"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: bpy:Bphyt_5848 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4102"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60038"
FT                   /db_xref="GOA:E1TDT6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDT6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADN60038.1"
FT                   /translation="MRRPLLRSLLPRTLLARNIALLIALVMLSQVCSLGVLLHYVQRPR
FT                   VERAAAVFATYVKTLDDLLQTTPNAARDALTARLYAHAQLPDSARTEPPPGLMHAYRSY
FT                   QRKVFLESLRMHLPADMEARWQTEGGQRLWIRMHAPVGATAPSAPYWIALPIPEDAQGN
FT                   GLDAAILLSLGLAALAALTGYAIQLHLSRPLQELTDAARRLSAGETPPPLPTDGPVEIA
FT                   AVSSAFNQMTQALQQAEATRALMLAGISHDIRTPLTKLRLSMAMAMPESSDSSFVVAAE
FT                   SYLDQIETILQQFMDYAGSGEREPAEPGNLNALIERLAGDFAGLGHEFELSLARLPLVD
FT                   YRPVSMMRLLMNLMQNAIVYGGSGLAVRSWASGEFVYVAVGDRGKGLSAEELEQLKAPF
FT                   QRGPNARSHSGGTGLGLAIVERIARLHGGRVEFHARAGGGLEVWVVLPAKAG"
FT   gene            complement(654760..655473)
FT                   /locus_tag="BC1003_4103"
FT   CDS_pept        complement(654760..655473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4103"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: bxe:Bxe_B2059 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4103"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60039"
FT                   /db_xref="GOA:E1TDT7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDT7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADN60039.1"
FT                   /translation="MDRPAKIIVLDDEIELRNMLQRFLRGHGFDVRAAEDSKRLDRYLE
FT                   REPFDLLVLDLMIGEEDGLAICSRLRAQGQTLPILMLTAKGDPLDKVLGLETGADDYLA
FT                   KPFLPRELVARINALLRRQKIASGDVTVTSQRVRFGEFTLDVGKQQLTRGGALLDIHSA
FT                   QMLLLVALASSPNRPVSRDNLLARARGRDHDALDRSIDVQVLRLRQIIEDDPSKPRFIK
FT                   TVWGVGYMLIADVGS"
FT   gene            complement(655491..658622)
FT                   /locus_tag="BC1003_4104"
FT   CDS_pept        complement(655491..658622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4104"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="KEGG: bpy:Bphyt_5850 transporter,
FT                   hydrophobe/amphiphile efflux-1 (HAE1) family; TIGRFAM:
FT                   transporter, hydrophobe/amphiphile efflux-1 (HAE1) family;
FT                   PFAM: acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4104"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60040"
FT                   /db_xref="GOA:E1TDT8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDT8"
FT                   /inference="protein motif:TFAM:TIGR00915"
FT                   /protein_id="ADN60040.1"
FT                   /translation="MIRFFVERPVFANVIALIVMLLGAVALINLPVAQYPPITPPTVQV
FT                   VAHFPGASAATVIDRVALPIETQVNGVENALYMQSTSTNDGTYTLTVTFAVGTDVDKAQ
FT                   VLVQNRVSAATAQLPQAVQQQGVTVRKRSTAILQLYTLQSPDPKYDSLFLSNYAVIYLR
FT                   DTLARLPGVGDVTVFGTGQYSMRVWLDPQKLSERNLSAADVMQAIQSQSKDVSAGQLGS
FT                   EPNAGGQAFQLTVSMRGALSTPREFDDIIVKADSNDGGHFVRIRDVGHTELGSSSYSQF
FT                   FNLDGKPAAGIAIYQLPEANALEVGNAVKATMARLAKDMPKGVTYQLPFDTTTFVRQSV
FT                   IDVYKTLFEAALLVLAVILLFLQNWRAMLVPATTIPVTIIGTFGAIYMMGFSINLLTLF
FT                   AIVLAIGIVVDDAIVVVEGITQHIEQGKTPKQAAIDAMHELLGPIVGITLVLVSVFLPS
FT                   AFLGGVTGQMYRQFALVVVATTVISAINAVTLKPVQSVRWLRHQRPGKPNVVYRGFDRA
FT                   YARVEKGYVSVVSWFVARCKLALVIALVLGAASAYLLTRVPTSFIPLEDQGYMLIAAQI
FT                   ADAASLRRTREASTEIEKRIGAIPGVSHVVSIGGISPLDNNASLANAALIYVTLDDWSK
FT                   RGKGEDLRSLYLRMNSELAKLPDVRAVVIVPPPIQGLGNSAGVQMQVMLTDGSQNYQRL
FT                   QSATDALIASMSKRPELQRVFSPFRAAVPTVELTLDRAKAESLQVPVGNVFDLLQDYVG
FT                   SSYVNQFTTFNHTFPVFVQADGTFRRETDDIRRLQIRSNSGHMVELGTFIDARTSVGPA
FT                   VASLYNLAPAAAINGNPASGYSTGDAIRAFEQEAARILPTGVGYEWTAMSYQEKLVGNS
FT                   AYWVFAVGVLLVFCVLAAQYESWLLPVAVVLAVPLALLGTAGTLALLGAANNLYTQIGL
FT                   VLLIALSAKNAILIVEFARHLRLQGVDIPQAAIEAARLRFRPIMMTSFAFILGVVPLVI
FT                   ATGASASARRSLGIAVFSGMLASTCIAVLFIPSFYVLLQRIAERQAARKAQQKA"
FT   gene            complement(658619..659767)
FT                   /locus_tag="BC1003_4105"
FT   CDS_pept        complement(658619..659767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4105"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: bpy:Bphyt_5851 efflux transporter, RND family,
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60041"
FT                   /db_xref="GOA:E1TDT9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDT9"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADN60041.1"
FT                   /translation="MARRTGTSGWSANARRHETPRSLAYRMPLRALSALALLAVLSGCH
FT                   ESNAPAAQNAPLPQVSVMRPEPREVREQLDLMGSVAPSATVTLVARVQGVLKQIGFTDG
FT                   ANVRQGQLLFRIEPDTYRAQLVYDQAALDNAEQELTRQKQLTSDNATSESSLQKAQTTR
FT                   DQALAKRDMSRINLGYTEIRAPFAGRIGARAFDVGNVVGASDSTRLATLDRIQPVYVNF
FT                   TLNERDANRIGLFTQAPHTVRVNLPGAPPQQAQDAALEFVDTRVDPASGAIKLRADIAN
FT                   RDSRLIPGMSVEVHIPASAPQNVLLVPDTALLREQAGASVLVVNAANVIEKRGVTTGGL
FT                   YGSLRAITAGLAATDRVVTGGGLAVAPGIKVQTVDAAVQGRS"
FT   gene            complement(659787..661358)
FT                   /locus_tag="BC1003_4106"
FT   CDS_pept        complement(659787..661358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4106"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="KEGG: bpy:Bphyt_5852 RND efflux system, outer
FT                   membrane lipoprotein, NodT family; TIGRFAM: RND efflux
FT                   system, outer membrane lipoprotein, NodT family; PFAM:
FT                   outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4106"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60042"
FT                   /db_xref="GOA:E1TDU0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDU0"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ADN60042.1"
FT                   /translation="MKPATSRRLRLARASIVVSMSAALAACISVGPDFAEPELTLEKQW
FT                   LESLPPLAQAAPPAQAAWWKAFNDPVLSALEERAYQRNLSLQVAGLHIFKARAQLAISA
FT                   ENLLPQTGSVSVGANHINTSGVGPLPPTHLWAEHFHANAGWELDFWGKYRRQIEADRAQ
FT                   LRVSEAAYDNALVSMFADVANAYIDLRALEQRIVVAQQNLKSVQDSLALTQARYKRGAS
FT                   SQLDVEQAATLVAETEAQIPPLIKARAQDRDTLAVLLADPPDAVDAQLKGSSAIPVAPT
FT                   QIDVGIPADLLRRRPDVREAALNAAAQSALIGAAKAKLYPSLSLTGLFGLSSGEQHGIG
FT                   LSQWGSKTIGLFSAGISLPIFDRGQLKNAVRIQDASFQEAVLDYQNTVLQAQKEVEDAI
FT                   AALRTSLDALAASVRASDASQRALRLANAQYRSGSVTYDSVLDASRSALRDGDALAQNQ
FT                   GIAALAAVSLYRALGGGWEVAQGQQVVSERIAEEMARRTDWGRLLNPPAGSALARAGAD
FT                   SRPDVK"
FT   sig_peptide     complement(661251..661358)
FT                   /locus_tag="BC1003_4106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.772 at
FT                   residue 36"
FT   gene            complement(661479..661769)
FT                   /locus_tag="BC1003_4107"
FT   CDS_pept        complement(661479..661769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4107"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60043"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDU1"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5853"
FT                   /protein_id="ADN60043.1"
FT                   /translation="MKKLLAAILLCCATTVTFAQAAPQGANPQRVQRMVAQLQSRFANA
FT                   NTTHDGKLTKEQAAAGMPMVASHFDEIDTQKAGYVTLPQIEEFMRERAATR"
FT   sig_peptide     complement(661704..661769)
FT                   /locus_tag="BC1003_4107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 22"
FT   gene            662128..662370
FT                   /locus_tag="BC1003_4108"
FT   CDS_pept        662128..662370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_5855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4108"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60044"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDU2"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_5855"
FT                   /protein_id="ADN60044.1"
FT                   /translation="MSYQNLDREIAHLELVFGRLSVNDSLPLSYWDSRLRELSDAPLMP
FT                   AQRARVARLAATLAALREPEEAVCDMPPSRWKEAR"
FT   gene            662370..663278
FT                   /locus_tag="BC1003_4109"
FT   CDS_pept        662370..663278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4109"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   bph:Bphy_1210 putative transport protein, YfdC-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4109"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60045"
FT                   /db_xref="GOA:E1TDU3"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDU3"
FT                   /inference="protein motif:PFAM:PF01226"
FT                   /protein_id="ADN60045.1"
FT                   /translation="MTEATRDKPRQPSAEAAHSQAPRAEDAGADSPHLNEGEQDQAAHH
FT                   TAPHALVLHEIVRAEGEAALERTLGALIWSSLAAGLSMGFSFLTQAVLEAGLPDTSWRH
FT                   LVSSFGYSMGFVLVIMGRQQLFTESTLTVVLPVLTRRDPGTLLRAMRLWAVVLFFNLVS
FT                   TWIFAAMLRIPDVFAPAVVDALGEVSRAAVGSEQMLPTMVKAVFAGWLIALMVWLLPSA
FT                   RSGRLLTVLLITYVVAVSHLSHIIAGSTEVAYAFLSGDASLRDYFLRFLVPTLVGNTVG
FT                   GMSLVALLNHAAIAPEINGPR"
FT   gene            complement(663359..664669)
FT                   /locus_tag="BC1003_4110"
FT   CDS_pept        complement(663359..664669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4110"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; KEGG: bxe:Bxe_B2062
FT                   arsenite-antimonite efflux pump, ArsB"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60046"
FT                   /db_xref="GOA:E1TDU4"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDU4"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADN60046.1"
FT                   /translation="MGYPAHRALPAYNHPFKVFVVTSIFLSWGIAAFATAGVITRPFKW
FT                   PEAVWAVAGAVLLVALGLLPLNLAMEAVGKGTDVYLFLFGMMLLSEVGRREGLFDWVAV
FT                   LAVNHAQGSPRKLFMLVYLVGVVITAFLSNDATAVVLTPAVFAAAKKAKTDPLPLLFVC
FT                   AFIANAASFVLPISNPANIVLYGNHTPALGPWLMRFALPSLLSIGATYVLLRWTQREAL
FT                   AGTCEANLEPLRLSSSGRVALAGIAVTAIVLLAVSAFDVPLGLPTAILGALTAVVVLVQ
FT                   ERKSPVPMIREISWSVLPLVAALFVLVEMLDHTGVINLLAALTRDAAAHNEAGTAGWAG
FT                   AAIAIGSNLMNNLPAGLIASSTVMQAHSPERVIDALLIGVDLGPNLSITGSLATILWLN
FT                   AIRREGEDVSFMKFLKVGVVVMLPALVLALGARILIG"
FT   gene            664942..665517
FT                   /locus_tag="BC1003_4111"
FT   CDS_pept        664942..665517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4111"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: bpy:Bphyt_5859 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4111"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60047"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E1TDU5"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADN60047.1"
FT                   /translation="MRTTMKTLLQHTVLAGAAALALLGTSLAHADVDTSKSTVIATTKQ
FT                   MNVPVDGKFRKFSAQLSFDPAKPTAGSANVSIDTRSYDLGADDYNKQAQGKEWFDSATY
FT                   PAATFVSSAITPAGGNQYKITGKLTIKGKSQTVVVPVTIASQGSTQTFDGSLPIRRSQF
FT                   DVGTGEWKDTSVVADEVVIKFHLVASKN"
FT   sig_peptide     664942..665034
FT                   /locus_tag="BC1003_4111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            665603..666181
FT                   /locus_tag="BC1003_4112"
FT   CDS_pept        665603..666181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BC1003_4112"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: bpy:Bphyt_5860 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BC1003_4112"
FT                   /db_xref="EnsemblGenomes-Tr:ADN60048"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_x