(data stored in ACNUC7421 zone)

EMBL: CP002219

ID   CP002219; SV 1; circular; genomic DNA; STD; PRO; 2770676 BP.
XX
AC   CP002219;
XX
PR   Project:PRJNA40831;
XX
DT   11-NOV-2010 (Rel. 106, Created)
DT   10-OCT-2011 (Rel. 110, Last updated, Version 4)
XX
DE   Caldicellulosiruptor hydrothermalis 108, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Caldicellulosiruptor hydrothermalis 108
OC   Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales;
OC   Thermoanaerobacterales Family III. Incertae Sedis; Caldicellulosiruptor.
XX
RN   [1]
RP   1-2770676
RX   DOI; 10.1128/JB.01515-10.
RX   PUBMED; 21216991.
RA   Blumer-Schuette S.E., Ozdemir I., Mistry D., Lucas S., Lapidus A.,
RA   Cheng J.F., Goodwin L.A., Pitluck S., Land M.L., Hauser L.J., Woyke T.,
RA   Mikhailova N., Pati A., Kyrpides N.C., Ivanova N., Detter J.C.,
RA   Walston-Davenport K., Han S., Adams M.W., Kelly R.M.;
RT   "Complete genome sequences for the anaerobic, extremely thermophilic plant
RT   biomass-degrading bacteria Caldicellulosiruptor hydrothermalis,
RT   Caldicellulosiruptor kristjanssonii, Caldicellulosiruptor kronotskyensis,
RT   Caldicellulosiruptor owensensis, and Caldicellulosiruptor lactoaceticus";
RL   J. Bacteriol. 193(6):1483-1484(2011).
XX
RN   [2]
RP   1-2770676
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Davenport K., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Chang Y.-J., Jeffries C., Kyrpides N., Ivanova N.,
RA   Mikhailova N., Blumer-Schuette S.E., Kelly R.M., Woyke T.;
RT   "Complete sequence of Caldicellulosiruptor hydrothermalis 108";
RL   Unpublished.
XX
RN   [3]
RP   1-2770676
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Davenport K., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Chang Y.-J., Jeffries C., Kyrpides N., Ivanova N.,
RA   Mikhailova N., Blumer-Schuette S.E., Kelly R.M., Woyke T.;
RT   ;
RL   Submitted (23-SEP-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 0af9dd70f507baa0e3f0f91bf99c595a.
DR   EnsemblGenomes-Gn; Calhy_R0001.
DR   EnsemblGenomes-Gn; Calhy_R0002.
DR   EnsemblGenomes-Gn; Calhy_R0003.
DR   EnsemblGenomes-Gn; Calhy_R0004.
DR   EnsemblGenomes-Gn; Calhy_R0005.
DR   EnsemblGenomes-Gn; Calhy_R0006.
DR   EnsemblGenomes-Gn; Calhy_R0007.
DR   EnsemblGenomes-Gn; Calhy_R0008.
DR   EnsemblGenomes-Gn; Calhy_R0009.
DR   EnsemblGenomes-Gn; Calhy_R0010.
DR   EnsemblGenomes-Gn; Calhy_R0011.
DR   EnsemblGenomes-Gn; Calhy_R0012.
DR   EnsemblGenomes-Gn; Calhy_R0013.
DR   EnsemblGenomes-Gn; Calhy_R0014.
DR   EnsemblGenomes-Gn; Calhy_R0015.
DR   EnsemblGenomes-Gn; Calhy_R0016.
DR   EnsemblGenomes-Gn; Calhy_R0017.
DR   EnsemblGenomes-Gn; Calhy_R0018.
DR   EnsemblGenomes-Gn; Calhy_R0019.
DR   EnsemblGenomes-Gn; Calhy_R0020.
DR   EnsemblGenomes-Gn; Calhy_R0021.
DR   EnsemblGenomes-Gn; Calhy_R0022.
DR   EnsemblGenomes-Gn; Calhy_R0023.
DR   EnsemblGenomes-Gn; Calhy_R0024.
DR   EnsemblGenomes-Gn; Calhy_R0025.
DR   EnsemblGenomes-Gn; Calhy_R0026.
DR   EnsemblGenomes-Gn; Calhy_R0027.
DR   EnsemblGenomes-Gn; Calhy_R0028.
DR   EnsemblGenomes-Gn; Calhy_R0029.
DR   EnsemblGenomes-Gn; Calhy_R0030.
DR   EnsemblGenomes-Gn; Calhy_R0031.
DR   EnsemblGenomes-Gn; Calhy_R0032.
DR   EnsemblGenomes-Gn; Calhy_R0033.
DR   EnsemblGenomes-Gn; Calhy_R0034.
DR   EnsemblGenomes-Gn; Calhy_R0035.
DR   EnsemblGenomes-Gn; Calhy_R0036.
DR   EnsemblGenomes-Gn; Calhy_R0037.
DR   EnsemblGenomes-Gn; Calhy_R0038.
DR   EnsemblGenomes-Gn; Calhy_R0039.
DR   EnsemblGenomes-Gn; Calhy_R0040.
DR   EnsemblGenomes-Gn; Calhy_R0041.
DR   EnsemblGenomes-Gn; Calhy_R0042.
DR   EnsemblGenomes-Gn; Calhy_R0043.
DR   EnsemblGenomes-Gn; Calhy_R0044.
DR   EnsemblGenomes-Gn; Calhy_R0045.
DR   EnsemblGenomes-Gn; Calhy_R0046.
DR   EnsemblGenomes-Gn; Calhy_R0047.
DR   EnsemblGenomes-Gn; Calhy_R0048.
DR   EnsemblGenomes-Gn; Calhy_R0049.
DR   EnsemblGenomes-Gn; Calhy_R0050.
DR   EnsemblGenomes-Gn; Calhy_R0051.
DR   EnsemblGenomes-Gn; Calhy_R0052.
DR   EnsemblGenomes-Gn; Calhy_R0053.
DR   EnsemblGenomes-Gn; Calhy_R0054.
DR   EnsemblGenomes-Gn; Calhy_R0055.
DR   EnsemblGenomes-Gn; Calhy_R0056.
DR   EnsemblGenomes-Gn; Calhy_R0057.
DR   EnsemblGenomes-Gn; Calhy_R0058.
DR   EnsemblGenomes-Gn; Calhy_R0059.
DR   EnsemblGenomes-Gn; Calhy_R0060.
DR   EnsemblGenomes-Gn; Calhy_R0061.
DR   EnsemblGenomes-Gn; EBG00001028768.
DR   EnsemblGenomes-Gn; EBG00001028769.
DR   EnsemblGenomes-Gn; EBG00001028770.
DR   EnsemblGenomes-Gn; EBG00001028771.
DR   EnsemblGenomes-Gn; EBG00001028772.
DR   EnsemblGenomes-Gn; EBG00001028773.
DR   EnsemblGenomes-Gn; EBG00001028774.
DR   EnsemblGenomes-Gn; EBG00001028775.
DR   EnsemblGenomes-Gn; EBG00001028776.
DR   EnsemblGenomes-Gn; EBG00001028777.
DR   EnsemblGenomes-Gn; EBG00001028778.
DR   EnsemblGenomes-Gn; EBG00001028779.
DR   EnsemblGenomes-Gn; EBG00001028780.
DR   EnsemblGenomes-Gn; EBG00001028781.
DR   EnsemblGenomes-Gn; EBG00001028782.
DR   EnsemblGenomes-Gn; EBG00001028783.
DR   EnsemblGenomes-Gn; EBG00001028784.
DR   EnsemblGenomes-Gn; EBG00001028785.
DR   EnsemblGenomes-Gn; EBG00001028786.
DR   EnsemblGenomes-Gn; EBG00001028787.
DR   EnsemblGenomes-Gn; EBG00001028788.
DR   EnsemblGenomes-Gn; EBG00001028789.
DR   EnsemblGenomes-Gn; EBG00001028790.
DR   EnsemblGenomes-Gn; EBG00001028791.
DR   EnsemblGenomes-Gn; EBG00001028792.
DR   EnsemblGenomes-Gn; EBG00001028793.
DR   EnsemblGenomes-Gn; EBG00001028794.
DR   EnsemblGenomes-Gn; EBG00001028795.
DR   EnsemblGenomes-Gn; EBG00001028796.
DR   EnsemblGenomes-Gn; EBG00001028797.
DR   EnsemblGenomes-Gn; EBG00001028798.
DR   EnsemblGenomes-Gn; EBG00001028799.
DR   EnsemblGenomes-Gn; EBG00001028800.
DR   EnsemblGenomes-Gn; EBG00001028801.
DR   EnsemblGenomes-Gn; EBG00001028802.
DR   EnsemblGenomes-Gn; EBG00001028803.
DR   EnsemblGenomes-Gn; EBG00001028804.
DR   EnsemblGenomes-Gn; EBG00001028805.
DR   EnsemblGenomes-Gn; EBG00001028806.
DR   EnsemblGenomes-Gn; EBG00001028807.
DR   EnsemblGenomes-Gn; EBG00001028808.
DR   EnsemblGenomes-Gn; EBG00001028809.
DR   EnsemblGenomes-Gn; EBG00001028810.
DR   EnsemblGenomes-Gn; EBG00001028811.
DR   EnsemblGenomes-Gn; EBG00001028812.
DR   EnsemblGenomes-Gn; EBG00001028813.
DR   EnsemblGenomes-Gn; EBG00001028814.
DR   EnsemblGenomes-Gn; EBG00001028815.
DR   EnsemblGenomes-Gn; EBG00001028816.
DR   EnsemblGenomes-Gn; EBG00001028817.
DR   EnsemblGenomes-Gn; EBG00001028818.
DR   EnsemblGenomes-Gn; EBG00001028819.
DR   EnsemblGenomes-Gn; EBG00001028820.
DR   EnsemblGenomes-Gn; EBG00001028821.
DR   EnsemblGenomes-Gn; EBG00001028822.
DR   EnsemblGenomes-Gn; EBG00001028823.
DR   EnsemblGenomes-Gn; EBG00001028824.
DR   EnsemblGenomes-Gn; EBG00001028825.
DR   EnsemblGenomes-Gn; EBG00001028826.
DR   EnsemblGenomes-Gn; EBG00001028827.
DR   EnsemblGenomes-Gn; EBG00001028828.
DR   EnsemblGenomes-Gn; EBG00001028829.
DR   EnsemblGenomes-Gn; EBG00001028830.
DR   EnsemblGenomes-Gn; EBG00001028831.
DR   EnsemblGenomes-Gn; EBG00001028832.
DR   EnsemblGenomes-Gn; EBG00001028833.
DR   EnsemblGenomes-Gn; EBG00001028834.
DR   EnsemblGenomes-Gn; EBG00001028835.
DR   EnsemblGenomes-Gn; EBG00001028836.
DR   EnsemblGenomes-Gn; EBG00001028837.
DR   EnsemblGenomes-Gn; EBG00001028838.
DR   EnsemblGenomes-Gn; EBG00001028839.
DR   EnsemblGenomes-Gn; EBG00001028840.
DR   EnsemblGenomes-Gn; EBG00001028841.
DR   EnsemblGenomes-Gn; EBG00001028842.
DR   EnsemblGenomes-Gn; EBG00001028843.
DR   EnsemblGenomes-Gn; EBG00001028844.
DR   EnsemblGenomes-Gn; EBG00001028845.
DR   EnsemblGenomes-Gn; EBG00001028846.
DR   EnsemblGenomes-Gn; EBG00001028847.
DR   EnsemblGenomes-Gn; EBG00001028848.
DR   EnsemblGenomes-Gn; EBG00001028849.
DR   EnsemblGenomes-Gn; EBG00001028850.
DR   EnsemblGenomes-Gn; EBG00001028851.
DR   EnsemblGenomes-Gn; EBG00001028852.
DR   EnsemblGenomes-Gn; EBG00001028853.
DR   EnsemblGenomes-Gn; EBG00001028854.
DR   EnsemblGenomes-Gn; EBG00001028855.
DR   EnsemblGenomes-Gn; EBG00001028856.
DR   EnsemblGenomes-Gn; EBG00001028857.
DR   EnsemblGenomes-Gn; EBG00001028858.
DR   EnsemblGenomes-Gn; EBG00001028859.
DR   EnsemblGenomes-Gn; EBG00001028860.
DR   EnsemblGenomes-Gn; EBG00001028861.
DR   EnsemblGenomes-Gn; EBG00001028862.
DR   EnsemblGenomes-Gn; EBG00001028863.
DR   EnsemblGenomes-Gn; EBG00001028864.
DR   EnsemblGenomes-Gn; EBG00001028865.
DR   EnsemblGenomes-Gn; EBG00001028866.
DR   EnsemblGenomes-Gn; EBG00001028867.
DR   EnsemblGenomes-Gn; EBG00001028868.
DR   EnsemblGenomes-Gn; EBG00001028869.
DR   EnsemblGenomes-Gn; EBG00001028870.
DR   EnsemblGenomes-Gn; EBG00001028871.
DR   EnsemblGenomes-Tr; Calhy_R0001-1.
DR   EnsemblGenomes-Tr; Calhy_R0002-1.
DR   EnsemblGenomes-Tr; Calhy_R0003-1.
DR   EnsemblGenomes-Tr; Calhy_R0004-1.
DR   EnsemblGenomes-Tr; Calhy_R0005-1.
DR   EnsemblGenomes-Tr; Calhy_R0006-1.
DR   EnsemblGenomes-Tr; Calhy_R0007-1.
DR   EnsemblGenomes-Tr; Calhy_R0008-1.
DR   EnsemblGenomes-Tr; Calhy_R0009-1.
DR   EnsemblGenomes-Tr; Calhy_R0010-1.
DR   EnsemblGenomes-Tr; Calhy_R0011-1.
DR   EnsemblGenomes-Tr; Calhy_R0012-1.
DR   EnsemblGenomes-Tr; Calhy_R0013-1.
DR   EnsemblGenomes-Tr; Calhy_R0014-1.
DR   EnsemblGenomes-Tr; Calhy_R0015-1.
DR   EnsemblGenomes-Tr; Calhy_R0016-1.
DR   EnsemblGenomes-Tr; Calhy_R0017-1.
DR   EnsemblGenomes-Tr; Calhy_R0018-1.
DR   EnsemblGenomes-Tr; Calhy_R0019-1.
DR   EnsemblGenomes-Tr; Calhy_R0020-1.
DR   EnsemblGenomes-Tr; Calhy_R0021-1.
DR   EnsemblGenomes-Tr; Calhy_R0022-1.
DR   EnsemblGenomes-Tr; Calhy_R0023-1.
DR   EnsemblGenomes-Tr; Calhy_R0024-1.
DR   EnsemblGenomes-Tr; Calhy_R0025-1.
DR   EnsemblGenomes-Tr; Calhy_R0026-1.
DR   EnsemblGenomes-Tr; Calhy_R0027-1.
DR   EnsemblGenomes-Tr; Calhy_R0028-1.
DR   EnsemblGenomes-Tr; Calhy_R0029-1.
DR   EnsemblGenomes-Tr; Calhy_R0030-1.
DR   EnsemblGenomes-Tr; Calhy_R0031-1.
DR   EnsemblGenomes-Tr; Calhy_R0032-1.
DR   EnsemblGenomes-Tr; Calhy_R0033-1.
DR   EnsemblGenomes-Tr; Calhy_R0034-1.
DR   EnsemblGenomes-Tr; Calhy_R0035-1.
DR   EnsemblGenomes-Tr; Calhy_R0036-1.
DR   EnsemblGenomes-Tr; Calhy_R0037-1.
DR   EnsemblGenomes-Tr; Calhy_R0038-1.
DR   EnsemblGenomes-Tr; Calhy_R0039-1.
DR   EnsemblGenomes-Tr; Calhy_R0040-1.
DR   EnsemblGenomes-Tr; Calhy_R0041-1.
DR   EnsemblGenomes-Tr; Calhy_R0042-1.
DR   EnsemblGenomes-Tr; Calhy_R0043-1.
DR   EnsemblGenomes-Tr; Calhy_R0044-1.
DR   EnsemblGenomes-Tr; Calhy_R0045-1.
DR   EnsemblGenomes-Tr; Calhy_R0046-1.
DR   EnsemblGenomes-Tr; Calhy_R0047-1.
DR   EnsemblGenomes-Tr; Calhy_R0048-1.
DR   EnsemblGenomes-Tr; Calhy_R0049-1.
DR   EnsemblGenomes-Tr; Calhy_R0050-1.
DR   EnsemblGenomes-Tr; Calhy_R0051-1.
DR   EnsemblGenomes-Tr; Calhy_R0052-1.
DR   EnsemblGenomes-Tr; Calhy_R0053-1.
DR   EnsemblGenomes-Tr; Calhy_R0054-1.
DR   EnsemblGenomes-Tr; Calhy_R0055-1.
DR   EnsemblGenomes-Tr; Calhy_R0056-1.
DR   EnsemblGenomes-Tr; Calhy_R0057-1.
DR   EnsemblGenomes-Tr; Calhy_R0058-1.
DR   EnsemblGenomes-Tr; Calhy_R0059-1.
DR   EnsemblGenomes-Tr; Calhy_R0060-1.
DR   EnsemblGenomes-Tr; Calhy_R0061-1.
DR   EnsemblGenomes-Tr; EBT00001631864.
DR   EnsemblGenomes-Tr; EBT00001631865.
DR   EnsemblGenomes-Tr; EBT00001631866.
DR   EnsemblGenomes-Tr; EBT00001631867.
DR   EnsemblGenomes-Tr; EBT00001631868.
DR   EnsemblGenomes-Tr; EBT00001631869.
DR   EnsemblGenomes-Tr; EBT00001631870.
DR   EnsemblGenomes-Tr; EBT00001631871.
DR   EnsemblGenomes-Tr; EBT00001631872.
DR   EnsemblGenomes-Tr; EBT00001631873.
DR   EnsemblGenomes-Tr; EBT00001631874.
DR   EnsemblGenomes-Tr; EBT00001631875.
DR   EnsemblGenomes-Tr; EBT00001631876.
DR   EnsemblGenomes-Tr; EBT00001631877.
DR   EnsemblGenomes-Tr; EBT00001631878.
DR   EnsemblGenomes-Tr; EBT00001631879.
DR   EnsemblGenomes-Tr; EBT00001631880.
DR   EnsemblGenomes-Tr; EBT00001631881.
DR   EnsemblGenomes-Tr; EBT00001631882.
DR   EnsemblGenomes-Tr; EBT00001631883.
DR   EnsemblGenomes-Tr; EBT00001631884.
DR   EnsemblGenomes-Tr; EBT00001631885.
DR   EnsemblGenomes-Tr; EBT00001631886.
DR   EnsemblGenomes-Tr; EBT00001631887.
DR   EnsemblGenomes-Tr; EBT00001631888.
DR   EnsemblGenomes-Tr; EBT00001631889.
DR   EnsemblGenomes-Tr; EBT00001631890.
DR   EnsemblGenomes-Tr; EBT00001631891.
DR   EnsemblGenomes-Tr; EBT00001631892.
DR   EnsemblGenomes-Tr; EBT00001631893.
DR   EnsemblGenomes-Tr; EBT00001631894.
DR   EnsemblGenomes-Tr; EBT00001631895.
DR   EnsemblGenomes-Tr; EBT00001631896.
DR   EnsemblGenomes-Tr; EBT00001631897.
DR   EnsemblGenomes-Tr; EBT00001631898.
DR   EnsemblGenomes-Tr; EBT00001631899.
DR   EnsemblGenomes-Tr; EBT00001631900.
DR   EnsemblGenomes-Tr; EBT00001631901.
DR   EnsemblGenomes-Tr; EBT00001631902.
DR   EnsemblGenomes-Tr; EBT00001631903.
DR   EnsemblGenomes-Tr; EBT00001631904.
DR   EnsemblGenomes-Tr; EBT00001631905.
DR   EnsemblGenomes-Tr; EBT00001631906.
DR   EnsemblGenomes-Tr; EBT00001631907.
DR   EnsemblGenomes-Tr; EBT00001631908.
DR   EnsemblGenomes-Tr; EBT00001631909.
DR   EnsemblGenomes-Tr; EBT00001631910.
DR   EnsemblGenomes-Tr; EBT00001631911.
DR   EnsemblGenomes-Tr; EBT00001631912.
DR   EnsemblGenomes-Tr; EBT00001631913.
DR   EnsemblGenomes-Tr; EBT00001631914.
DR   EnsemblGenomes-Tr; EBT00001631915.
DR   EnsemblGenomes-Tr; EBT00001631916.
DR   EnsemblGenomes-Tr; EBT00001631917.
DR   EnsemblGenomes-Tr; EBT00001631918.
DR   EnsemblGenomes-Tr; EBT00001631919.
DR   EnsemblGenomes-Tr; EBT00001631920.
DR   EnsemblGenomes-Tr; EBT00001631921.
DR   EnsemblGenomes-Tr; EBT00001631922.
DR   EnsemblGenomes-Tr; EBT00001631923.
DR   EnsemblGenomes-Tr; EBT00001631924.
DR   EnsemblGenomes-Tr; EBT00001631925.
DR   EnsemblGenomes-Tr; EBT00001631926.
DR   EnsemblGenomes-Tr; EBT00001631927.
DR   EnsemblGenomes-Tr; EBT00001631928.
DR   EnsemblGenomes-Tr; EBT00001631929.
DR   EnsemblGenomes-Tr; EBT00001631930.
DR   EnsemblGenomes-Tr; EBT00001631931.
DR   EnsemblGenomes-Tr; EBT00001631932.
DR   EnsemblGenomes-Tr; EBT00001631933.
DR   EnsemblGenomes-Tr; EBT00001631934.
DR   EnsemblGenomes-Tr; EBT00001631935.
DR   EnsemblGenomes-Tr; EBT00001631936.
DR   EnsemblGenomes-Tr; EBT00001631937.
DR   EnsemblGenomes-Tr; EBT00001631938.
DR   EnsemblGenomes-Tr; EBT00001631939.
DR   EnsemblGenomes-Tr; EBT00001631940.
DR   EnsemblGenomes-Tr; EBT00001631941.
DR   EnsemblGenomes-Tr; EBT00001631942.
DR   EnsemblGenomes-Tr; EBT00001631943.
DR   EnsemblGenomes-Tr; EBT00001631944.
DR   EnsemblGenomes-Tr; EBT00001631945.
DR   EnsemblGenomes-Tr; EBT00001631946.
DR   EnsemblGenomes-Tr; EBT00001631947.
DR   EnsemblGenomes-Tr; EBT00001631948.
DR   EnsemblGenomes-Tr; EBT00001631949.
DR   EnsemblGenomes-Tr; EBT00001631950.
DR   EnsemblGenomes-Tr; EBT00001631951.
DR   EnsemblGenomes-Tr; EBT00001631952.
DR   EnsemblGenomes-Tr; EBT00001631953.
DR   EnsemblGenomes-Tr; EBT00001631954.
DR   EnsemblGenomes-Tr; EBT00001631955.
DR   EnsemblGenomes-Tr; EBT00001631956.
DR   EnsemblGenomes-Tr; EBT00001631957.
DR   EnsemblGenomes-Tr; EBT00001631958.
DR   EnsemblGenomes-Tr; EBT00001631959.
DR   EnsemblGenomes-Tr; EBT00001631960.
DR   EnsemblGenomes-Tr; EBT00001631961.
DR   EnsemblGenomes-Tr; EBT00001631962.
DR   EnsemblGenomes-Tr; EBT00001631963.
DR   EnsemblGenomes-Tr; EBT00001631964.
DR   EnsemblGenomes-Tr; EBT00001631965.
DR   EnsemblGenomes-Tr; EBT00001631966.
DR   EnsemblGenomes-Tr; EBT00001631967.
DR   EuropePMC; PMC3008241; 20971878.
DR   EuropePMC; PMC3067630; 21216991.
DR   EuropePMC; PMC3416521; 22636774.
DR   EuropePMC; PMC6307998; 30404970.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02033; HEARO.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP002219.
DR   SILVA-SSU; CP002219.
DR   StrainInfo; 823174; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4087032
CC   Source DNA and organism available from Robert M. Kelly
CC   (rmkelly@eos.ncsu.edu)
CC   Contacts: Robert M. Kelly (rmkelly@eos.ncsu.edu)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Caldicellulosiruptor hydrothermalis 108
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Russia
CC   environment         :: Hot spring
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 18901
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi07642
CC   Type Strain         :: Yes
CC   Isolation Site      :: Terrestrial neutral geothermal spring;
CC                          Russia, Kamchatka
CC   Cell Shape          :: Rod-shaped
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Hyperthermophile
CC   Temperature Optimum :: 79C
CC   pH                  :: 7.0
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2770676
FT                   /organism="Caldicellulosiruptor hydrothermalis 108"
FT                   /strain="108"
FT                   /mol_type="genomic DNA"
FT                   /country="Russia:Kamchatka"
FT                   /isolation_source="terrestrial neutral geothermal spring"
FT                   /db_xref="taxon:632292"
FT   gene            111..1475
FT                   /locus_tag="Calhy_0001"
FT   CDS_pept        111..1475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   ate:Athe_0001 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05768"
FT                   /db_xref="GOA:E4Q8U7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q8U7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADQ05768.1"
FT                   /translation="MVEYDVNEVWEKIKEAVKKEINPSPTDISYNTWFESLVPLCFDDN
FT                   DTLILKAFADFHRDIVINRYSLVILNALRQLFSPHLSIKVILPEEVEKYKKFLKPKQDE
FT                   KPEIVTQLNPKYTFETFVVGNNNRLAHAAALAVAETPPGERTYNPLFIYGGVGLGKTHL
FT                   MHAIGHHVLKLYPGTKVMYVTSEIFTNELIAAIRDEKTDEFRLKYRNVDVLLIDDIQFL
FT                   GGKERTQEEFFHTFNTLYEANKKIILSSDRPPKEINTLEDRLRSRFEWGLITDIQPPDF
FT                   ETRIAILSKKCQLEGTPVPQHILEFIASKIETNIRELEGALNKILAYSKLMAPDKEITL
FT                   ELAEKALKEFIDTNTKKELTIEDIQAEVASYFGIRLEDFKSSRRSRNVAYPRQIAMYLA
FT                   RELTNVSLPKIGEAFGGKDHTTVLHACEKIKELINTDSNTRNAVETIKKRLIHRE"
FT   gene            1693..2799
FT                   /locus_tag="Calhy_0002"
FT   CDS_pept        1693..2799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: ate:Athe_0003 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05769"
FT                   /db_xref="GOA:E4Q998"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q998"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADQ05769.1"
FT                   /translation="MRFVVDKEVLQDNISKVIPAAASTKVTSILECVLIEAEDSIVFTT
FT                   NDMKMQMQTEFEAEILERGAALVKAKLFSDIVKKLPSGEVEVIREDSEVKIRSQKIEFR
FT                   LPTLDPLDFPKMDKKPSESFCEFVASDFVDGVDKVIFATSKDETRPTFTGVLFEKEEDD
FT                   FVNLVGMDGHRLAICKIKPIAVEGNFSKIVPAENLDDITKVVDIEEAEKVRVSFFENQA
FT                   TFEIGSTTVILTLIAGKFFDYKGAIPTEYSTKISISSDVLESTLERASIVSKDEKTNIQ
FT                   AVIFETNGMMFTVKSMSADGRYEEDVLCSVEGKDIRVGFNVKYFLDVLKELDGEINLFI
FT                   TSQTSPSIVQKPDDPNYIYLVLPIKMPE"
FT   gene            2825..3886
FT                   /locus_tag="Calhy_0003"
FT   CDS_pept        2825..3886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: ate:Athe_0004 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05770"
FT                   /db_xref="GOA:E4Q999"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q999"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADQ05770.1"
FT                   /translation="MKIKNIYIENFRGYKQRFFEFKDKMNLIVGNNASGKTSLLEALYF
FT                   CICGKSFKSRDVDAINFDSYYFKLEMSAEVGNIEYNVFCYVDKALDKRIMINDKKINRL
FT                   SELISLFKFVFFEPDTTRLIKHQPKLRRRFLDMEVAKLYPYMTKVYSEYQRALHSRNAF
FT                   LKSYDKKDIIDVYDVQISQLGFLIFQKRQEVIDRLSIEAQKIFSYVFENKSLLELKYMP
FT                   SINASSEEEYYKEMKKHLVKDLSLGYTTKGIHRDDFEILIDGKPAIDFASEGQIKLAAV
FT                   SVVLSSALLYTEPVLILDDVFSELDKFKRRNLIKFLSQYQSFVTSAEDLSTLQSEGILE
FT                   FDSANVIFLERSI"
FT   gene            3913..4197
FT                   /locus_tag="Calhy_0004"
FT   CDS_pept        3913..4197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05771"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9A0"
FT                   /inference="similar to AA sequence:KEGG:Athe_0005"
FT                   /protein_id="ADQ05771.1"
FT                   /translation="MFAHIGEDYVINSAELLVILSWDSFVRSKDNLKILENLKLHDRIV
FT                   VINDDIKKSIIILEVDGRMYGIISPVSPGTIAKRLLNFNHYFDNYLDQD"
FT   gene            4234..6147
FT                   /locus_tag="Calhy_0005"
FT   CDS_pept        4234..6147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: ate:Athe_0006 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05772"
FT                   /db_xref="GOA:E4Q9A1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9A1"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADQ05772.1"
FT                   /translation="MDRIQNGSQQYSASEIQVLEGLEAVRKRPGMYIGSTSQRGLHHLV
FT                   YEIVDNAIDEAMAGFCKNIEVVIHKDNSVTVIDDGRGIPVDIHPKLQKSGVEVVFTVLH
FT                   AGGKFNERVYKVSGGLHGVGASVVNALSRYLEVEVYRDGKVYYQRYERGKPTCELKVIG
FT                   TTDRTGTKVTFLPDDEIFETIEFDGDVILQRLRELAFLNKGIRIVFVDEREKNVKPIEL
FT                   KYNGGIAEFVKFLNRNKEVLHQEPIYIEGEKNDILIEVAVQYTEDFGENIYSFANNIAT
FT                   IDGGTHLIGFKTAVTKAVNEYAKKYNFIKGDTQLLGEDIRDGMTAIVSVKIHEPQFEGQ
FT                   TKTKLGNSEARWAVENLVSEKLAAFLEENPDVSKKIIDKAILAAKAREEAKKARELVIK
FT                   RKSALDSSNLPGKLADCSEKDPAKCEIFIVEGDSAGGSAKQGRDRRYQAILPLWGKMLN
FT                   VEKASQDKIYSNDKLLPLIQALGVGIGNDIDLKKLRYHKIIIMADADVDGSHIRTLLLT
FT                   FFYRYMRPLIENGHIYIAQPPLYKITKGKQVRYAYNDKELQKILQEMKDAQVQRFKGLG
FT                   EMNAQELWETTMDPARRILLRVELEDAVMAEEIFTILMGDKVEPRREFIEKNAKYVRNL
FT                   DI"
FT   gene            6165..6341
FT                   /locus_tag="Calhy_0006"
FT   CDS_pept        6165..6341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05773"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9A2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ05773.1"
FT                   /translation="MEVAKKIYEEVIKLPEETQREVLDFIEFKKMKWKKNIEEIIDKVI
FT                   EENYEILKELADK"
FT   gene            6338..6720
FT                   /pseudo
FT                   /locus_tag="Calhy_0007"
FT   gene            6950..8413
FT                   /locus_tag="Calhy_0008"
FT   CDS_pept        6950..8413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0008"
FT                   /product="transposase"
FT                   /note="KEGG: ate:Athe_0076 transposase; TIGRFAM:
FT                   transposase ; transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05774"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9A3"
FT                   /inference="protein motif:TFAM:TIGR01765"
FT                   /protein_id="ADQ05774.1"
FT                   /translation="MVTVQAKLTFDSSEDKQKVLDLMRRWSSCMRYAYNRLLEGWDRNT
FT                   LKRELQGIFNLNSRYVDDALIKAKSILNSCKEKGENPEKVIFGGRQLFKKLQKRHINGE
FT                   AYKELQRKWREKRKGNLYSRGDRSKKGNLNTRIETDGVFTMIRINVGERKYVYATIQSG
FT                   WKTKGKTYTDRNQLLQAISSSGEPYSVELKLKNGVVYAYFTVEEVFPKPGITRANGVIG
FT                   IDTNAYPRHIAWVETDERGQFLSYGRIPMPKLESGSLSKKEYYRWQYAHMIVQMAKGKQ
FT                   KAIVIENLSIQDRGRRGDFSGRKSRRIRHYFGYRLLLEKVKLLAKREGIEVIEVDPAYT
FT                   SVIGMLKYAPQYMVSKDVGAAYVIARRGLGLRERIPHNYMQLLGRLDENELDKLKEYVQ
FT                   KVVKNTCLRKKQLKEIERVKKFLQSPESEPERASEPLDGTSSDVCGKVCNLWRVLRVAV
FT                   VTPLSPGRVLRDMSVLKSFLVSGQVGRPG"
FT   gene            8571..11000
FT                   /locus_tag="Calhy_0009"
FT   CDS_pept        8571..11000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0009"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: ate:Athe_0008 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05775"
FT                   /db_xref="GOA:E4Q9A4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9A4"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADQ05775.1"
FT                   /translation="MEELDFRIIPVEIQEEMKRSYIDYAMSVIVSRALPDVRDGLKPVH
FT                   RRILYAMNEIGLTPDKPYRKSATVVGHVLAKYHPHGDAAVYESLVRMAQDFSMRHPLVD
FT                   GHGNFGSVDGDPPAAMRYTEARMSKIAIEMLRDIEKETVDFMPNFDESAKEPKVLPSRF
FT                   PNLLVNGSQGIAVGMATNIPPHNLAEVIDAIVYLLDNENAGLDDIMKIIKGPDFPTGGY
FT                   IIGKKGIRDAYATGKGKIIVRAKATIEQTSKGRQRIVVTELPYMVNKARLIEKIAELVH
FT                   EKRIDGISDIRDESDKEGLRIVIEIKKDADANVVLKQLYKNTQLQDSFGIIMLALVDNQ
FT                   PKVLTLMDMLNLYIEHQKEVIVRRTKYDLKKAEERAHILEGLKKALDHIDEIISIIRSS
FT                   KTVNEAKERLISKFQFTEVQAQAILDMRLQRLTGLERQKIEEELAELIKMIEYYKNVLA
FT                   SDAMVKEIIKKEILEIKEKYKDERRTKIVQDEHEDFEEEELIQEQETVITLTHFGYIKR
FT                   LPLDTYKSQKRGGRGITGISTREEDFVEDVFVTTTHHYILFFTDKGRVFRLRAYEVPEG
FT                   SRQAKGTAIVNLIQIGKDEKITATMAVKDFKEGYLMMCTKNGTIKKVLLSEFENTTKAG
FT                   KKAITLADDDSLVDVKLTSGNDEIVLVSSNGYCVVFNENDVRSMGRTAQGVKGMTLEDG
FT                   DFIVGMEKASDGKYLLCVTENGFGKRSEIEEYRKTKRGAKGVLTYKVTDKTGSIVDIKM
FT                   VNDDDEIMICSTEGIFIRLEVSQVPVQGRNTQGVKLMRIDSDNIKVSSIARIKVDE"
FT   gene            11294..13204
FT                   /locus_tag="Calhy_0010"
FT   CDS_pept        11294..13204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0010"
FT                   /product="Beta propeller domain protein"
FT                   /note="PFAM: Beta propeller domain; KEGG: ate:Athe_0009
FT                   secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05776"
FT                   /db_xref="InterPro:IPR014441"
FT                   /db_xref="InterPro:IPR019198"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9A5"
FT                   /inference="protein motif:PFAM:PF09826"
FT                   /protein_id="ADQ05776.1"
FT                   /translation="MLRKYLLGVLVVLFIVSFSDINFVMSDQSKPKSFLQKVGTFSNFK
FT                   KLIDDAIRKNPYMGSSENFLSESIPQNSVKGENKTGSEYSYSQTNVQVMGVDEADIAKT
FT                   DGQYIYIAKPYPKIKDNGIVIVKAYPPEEMKIFSKIKLSDELYPEEFYVDSRYLVVICE
FT                   KAKIVDKKPIIQKNVFPDIDSNKVRVFVPYQLLIETYCIVYDISDKSNPKEIRRVSIAG
FT                   KYLISRKISTNLYIVTEKQFPYEIYVKKAYSEQDFKPYFTDSITGDSKKIYIGFDKIKY
FT                   IPDFINCSITIVGSFNIESKDEICVECVLGGGDIVYCSQENLYLCSEVIKKVYLTEKLE
FT                   DNTRLWRYFIRKTMVCRFELSKGKATLMAAGVVNGKVLNQFSMDEQDSYFRIATTGERP
FT                   YFPEEGYDYFNAVYVLDKNLRVVGKIDNIAKGERIYSARFIGKRLYLVTFKALDPFFVI
FT                   DLEDPHNPKVLGYLKIPGYSTYLHPYDEIHIIGFGMDAEDLNERYAIPLGLKIAMFNVE
FT                   DVKNPKELFKVIIGEKGSYSELLNNHKALLFDKNKNIFAFPVEVYDKKGHNFTGAYVYS
FT                   IDLKEGFVLRGKISHEIDGRYCEKIDRLLYIGDVLYSVSNSMIKASSLENLKEIAKVRL
FT                   D"
FT   gene            complement(13340..14284)
FT                   /locus_tag="Calhy_0011"
FT   CDS_pept        complement(13340..14284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0011"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ate:Athe_2221 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05777"
FT                   /db_xref="GOA:E4Q9A6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9A6"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADQ05777.1"
FT                   /translation="MTKNIKAQNKKFLKLLFVIKKVTEVLSRKIKQNRRGRPRKFNLFQ
FT                   IIACLVYKVKKGIKSFRELEYRINQDTEFKQVVGIEESPDYSYFAKLSRKIEKEYMQDI
FT                   KDILIAKIEPDMSIAIVDSTPLRSAKNDSEAKIGIHITIGFFRGYKLHLLCTGKEEVIP
FT                   LFWILTGANEHDSRQEELLYRAWGYNCEIVLADAGYDCSRWFNIANELKVKFVAGINKR
FT                   NMKDKNNVKNVFRSKNIRFLETEEGKKLYKQRTKIERLFSKLKGEYNLENVRLKGFRNY
FT                   KRYIDWILITFLFEQLLRKLEGKKFSFAYEWNQ"
FT   gene            14504..15166
FT                   /locus_tag="Calhy_0012"
FT   CDS_pept        14504..15166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0012"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: ate:Athe_0023 alkyl hydroperoxide
FT                   reductase/thiol specific antioxidant/Mal allergen; PFAM:
FT                   alkyl hydroperoxide reductase/ Thiol specific antioxidant/
FT                   Mal allergen; Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05778"
FT                   /db_xref="GOA:E4Q9A7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9A7"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADQ05778.1"
FT                   /translation="MENTSRIPLLGEKFPSMTVKTTHGMKKLPDDYAGKWFVLFSHPGD
FT                   FTPVCTTEFVAFAKRAEEFKKLNAELIGLSVDQVFAHIKWIEWIEEKLGVKIPFPVIAD
FT                   ELGKVATTLGMLHEAKGTNTVRAVFIVDDKGILRLMMYYPQEVGRNIDEILRALKALQT
FT                   SDQNGVATPENWPNNGLIGDKVIIPPAATEDLAKERLQKAKDGEIECFDWWFCYKKL"
FT   gene            15408..15989
FT                   /locus_tag="Calhy_0013"
FT   CDS_pept        15408..15989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0013"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ate:Athe_0024 protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05779"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9A8"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADQ05779.1"
FT                   /translation="MFLPKKEEIYTYEDYLNWPNDQRIELIDGKVYLMAPPSTIHQRIL
FT                   RELFINFAMYLKGKQCEVFSAPFGVRFPSANEKNNKEIKTVVEPDIVVVCDKSKIDNEG
FT                   LKGAPDLIVEITSPSTASKDKIEKFNLYEKHGVKEYWIVEPENKIISVFTLQENGRYGR
FT                   PDVYTVGNKIKVSIFEDLIINLDEIFGVVE"
FT   gene            complement(16033..16165)
FT                   /pseudo
FT                   /locus_tag="Calhy_0014"
FT   gene            16295..16534
FT                   /locus_tag="Calhy_0015"
FT   CDS_pept        16295..16534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0015"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   ate:Athe_0025 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05780"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9A9"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADQ05780.1"
FT                   /translation="MIVNATEFKMRVGKYLKMAEKEEIIITKNGKEVAKIVPIKKQGTP
FT                   NADFLYGFMENYPNKEVTIKQIRGERIRKYESSY"
FT   gene            16518..16940
FT                   /locus_tag="Calhy_0016"
FT   CDS_pept        16518..16940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0016"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   ate:Athe_0026 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05781"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9B0"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADQ05781.1"
FT                   /translation="MKVLIDTNIILDVILKRSPFEKDSYKVLKYAEEGLIEGYIASFVV
FT                   TDLYYFIAKELGNDKATKAIKALLNIVKLVSVTKKDIEKAMENSTINNLEDALQIQCAK
FT                   KIKADFVITRDNKLKKLIIKAISPSEFVEKFQSDNF"
FT   gene            complement(17011..17598)
FT                   /locus_tag="Calhy_0017"
FT   CDS_pept        complement(17011..17598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0017"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: csc:Csac_0014
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05782"
FT                   /db_xref="GOA:E4Q9B1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9B1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADQ05782.1"
FT                   /translation="MDQTIKYYDENAIEFFMNTKDANMENLYKLFLKYIPEGGKILDLG
FT                   CGSGRDTKYFLGKGYDVVAVDGSIEMVKLSTEYTGKKTLHMTFQEIDFDEEFDGIWACA
FT                   SLLHVRRDEISSILYKIHRALKPNGVLYASFKYGDKEEYRDDGRFFNYYDEKSFSELIK
FT                   KLGYFDILEILITNDVRKGKENEKWLNVILKK"
FT   gene            complement(17582..20239)
FT                   /locus_tag="Calhy_0018"
FT   CDS_pept        complement(17582..20239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0018"
FT                   /product="type III restriction protein res subunit"
FT                   /note="KEGG: csc:Csac_0015 type III restriction enzyme, res
FT                   subunit; PFAM: type III restriction protein res subunit;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05783"
FT                   /db_xref="GOA:E4Q9B2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9B2"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ADQ05783.1"
FT                   /translation="MHKIEEYLNQVEFHEIKDVYRKIEQRYKALSQQAGIQNVKCFTGD
FT                   NEDFLTELRRAIKRAVEINFIVSFLLESGVRLIIEDLIEAKKRGSKIRIVTGRYLNITQ
FT                   PSALYLIRQTLGNYVDLRFYKFEEKSFHPKAYIFEYENDNGEVFIGSSNLSEQALCGGI
FT                   EWNYKIEKKTNCDDFLFFKNEFLNIFHNQSIEITDKVLKEYSRKWKKPKIQLEKEIFNE
FT                   ADGDISEHEEKDQNISSDLLKVAQEVAEYSVQSFIKSKVNNGKVIPFYYPRGAQIEALY
FT                   ELKKSREEGFNKGLVVLATGVGKTFLAAFDSMEFQKVLFVAHREEILNQAKKTFEKVRP
FT                   NSSMGFFNAEIKDTNKDIIFASVQTLGKGEYLNESYFPPDYFDYIVIDEFHHAVAKSYS
FT                   NIISYFKPKFLLGLTATPERLDNKDVFELCDYNVVYELRLKDAINKGFLVPFHYYGIYD
FT                   ETDFSNIPIINGKYKEDELERVLMIHKRADLILKNYLKFNKKRTLAFCTSRNHAEFMAE
FT                   YFNQNGVKSCAVYSGEQGKNAAFRGQAIEKLRKGEINVIFTVDMFNEGVDIPEIDMVMF
FT                   LRPTESPTVFLQQLGRGLRKAKDKYYLTVLDFIGNYKKANLIPFLLSGKRYDIEKIKKT
FT                   RFVHDEFDFPDDCIVDFDFRIIDIFRKQAEAVKRIEELIYEEYLRIKNFLGYRPMRQDF
FT                   FKYVDDAIYDNMKRYSDPNINILRDYISFLYKNNELTESEKTLYATVAHEFIRCIENTR
FT                   MTKSYKMPLLLAFYNNGELKLVATPDDIYRSFKEFYSNPSNAVDLARHKSTQGYKEWTK
FT                   EDWLDLSRRNPEEALLNDNEFSKFLKRDDQFLYLSKDLEPFIKNQDFTRHFKDVIDYRV
FT                   KRYYKERIENGSDD"
FT   gene            complement(20354..21829)
FT                   /locus_tag="Calhy_0019"
FT   CDS_pept        complement(20354..21829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0019"
FT                   /product="KWG Leptospira repeat protein"
FT                   /note="KEGG: ate:Athe_0032 KWG Leptospira repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05784"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9B3"
FT                   /inference="similar to AA sequence:KEGG:Athe_0032"
FT                   /protein_id="ADQ05784.1"
FT                   /translation="MKKVKIFICFLLVLILSISILTLTNAQQASSRNFVYIKPQFENVM
FT                   FWENGWISYLQGGKWGILSSSGNILLKPQFDKIEPIVYDGASIMGIEDKFYKDIFVIWQ
FT                   NWKAGFIDTNAKIIVKPELDSLDVINPWINIYVCKKDNKYGFLNLDKKIYVTPQFEKMC
FT                   FVHYMRNPDNKKEFSLNTVDLKDAVWPDSYLEYILVSKDGKCGAIDTNGNVVVEFKYNS
FT                   FKEALADSKFAEAVQAMLANESNSAPSSDKNKLAELSPNYVSYEIENNKYYLIFGRHTN
FT                   RGYVYTKSKEGYENAKVVEANKLVAVYKNKKWGIVDINGNFVVKPQFDDIKELSEGFIA
FT                   FKQNGKWGFMDKNFKVAIKPQFDKAENFSEGYAAVMKSNLWGYINPSGKFVIKPQYTKA
FT                   GPFFAQMAAVATKDYVGLIDTKGSFVIKFSTKNSQYMFVDTETYRFRYAPDSILNSSGY
FT                   SIYKYTLIFPKFGYAVIDKKTNKVGLVLRGQGK"
FT   sig_peptide     complement(21749..21829)
FT                   /locus_tag="Calhy_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.690 at
FT                   residue 27"
FT   gene            22076..22501
FT                   /pseudo
FT                   /locus_tag="Calhy_0020"
FT   gene            22620..23031
FT                   /pseudo
FT                   /locus_tag="Calhy_0021"
FT   gene            23024..24274
FT                   /locus_tag="Calhy_0022"
FT   CDS_pept        23024..24274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0022"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="manually curated; TIGRFAM: transposase, IS605 OrfB
FT                   family; KEGG: csc:Csac_2648 IS605 family transposase OrfB;
FT                   PFAM: transposase IS605 OrfB; putative transposase
FT                   IS891/IS1136/IS1341 family"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05785"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9B4"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADQ05785.1"
FT                   /translation="MDKTYILPIPEEYQVLARELSKQSGKIYSKAVSFLKRMNKKGIKI
FT                   SQKTFDRYMEWWIHQKDFVLHSQSKQAAYQQVWINYIATFRKIQKAKKKGKDTSRIRLP
FT                   YKNKKYNKVVFKESALRLKNNILILSNGKEHEAIVLRDVVIKTAPKYAELIYHHSKKKY
FT                   YLHVVIEVDEMKSEKGKGVLAVDLGVIHPMVCFDGQNVLIYNGGVLNSKLRYRNKKIAE
FT                   FQQKLSLCQKGSKRFRKLENAKRKVLRKLNNQIRDVLEKYTSHLIGYCVKNNIGTIVLG
FT                   DLKGIRNRAKHGKVSNQKIHQWMFRKVARRIEEKAGFAGIDIVYVKENGTSQVCPVCGS
FT                   KNKPRNRNYECSKCGFRYHRDGVGAINIYKKYTGTKSLVVGRLACPAGVRFKSHLCCPV
FT                   EWNTHLWEKDHSTEKTA"
FT   gene            24655..25230
FT                   /locus_tag="Calhy_0023"
FT   CDS_pept        24655..25230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0023"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ate:Athe_0036 protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05786"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9B5"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADQ05786.1"
FT                   /translation="MEEMQKSDVNTYSDLKRISENQVYSLIDGTLFLHAAPSWQHQKVL
FT                   KELMLIFGNYLKDKDCEIFSAPFDVFLEAKDEHEIESATTVVQPDLTIICDKSKLAKTG
FT                   YIGAPQMIIEITSPSTVRLDRVLKFNKYEAAGVKEYWIVEPENKIITCFVLEPDGRYGR
FT                   PKMFSEGDIIKVAIFPDLEINVDEIFKI"
FT   gene            complement(25297..25929)
FT                   /locus_tag="Calhy_0024"
FT   CDS_pept        complement(25297..25929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0024"
FT                   /product="proton-coupled thiamine transporter YuaJ"
FT                   /note="KEGG: ate:Athe_0037 proton-coupled thiamine
FT                   transporter YuaJ; TIGRFAM: proton-coupled thiamine
FT                   transporter YuaJ; PFAM: thiamine transporter YuaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05787"
FT                   /db_xref="GOA:E4Q9B6"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9B6"
FT                   /inference="protein motif:TFAM:TIGR02357"
FT                   /protein_id="ADQ05787.1"
FT                   /translation="MSYFASIFKDFEKIKWYSLTIVIVLIFISIFLYLAQKRQKFSTKA
FT                   LVYGGVVIALSFILSFIKLYRMPQGGSITPASMLPLFAYAYMFGPFAGIVAGMAYGILQ
FT                   LIQDPYVVHWAQLLLDYPLAFGALGFAGFFRKNLPLGILAGGFGRFVFHFISGVVFFAS
FT                   YAPKGTSPVVYSAIYNATYLGPDLAVCLIIAFIPGLRSAIDRLKSQA"
FT   gene            26084..27364
FT                   /locus_tag="Calhy_0025"
FT   CDS_pept        26084..27364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0025"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: ate:Athe_0046
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05788"
FT                   /db_xref="GOA:E4Q9B7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9B7"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADQ05788.1"
FT                   /translation="MQQIRAIVGTQWGDEGKGKIVDFLAKEADVVVRAQGGNNAGHTVE
FT                   AFGKVFKLHLIPSGILYKDKLNIIGNGVVIDPESLIQEIESLEKEGISTENLKISDRAH
FT                   LVMPYHKILDEEQERQRGDESLGTTKRGIGPAYTDKTERTNLRVCDMLDEEEFVQKLRN
FT                   VYERKNQILTHVYHKTPMKFGELLEQFMKYGEILKPYITDTIKLLNDSIKAGKKVLLEG
FT                   AQATMLDLDYGTYPYVTSSHPTVGGFCIGAGIAPKYIQEVIGVVKAYTTRVGKGPFPTE
FT                   LLDEIGDSIREKGREYGTTTGRPRRCGWLDLVVVRYAVLINGIDKIALTKLDTLSGLPK
FT                   IKVCVGYKYEGKVLDLFPASLRVAMECEPVYEEFEGWSEEEIKGAKEYEALPKSARRYI
FT                   EFIEKETGAKVFLIGTGPAREDIIIKD"
FT   gene            27529..29271
FT                   /locus_tag="Calhy_0026"
FT   CDS_pept        27529..29271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0026"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0047 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05789"
FT                   /db_xref="GOA:E4Q9B8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9B8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ05789.1"
FT                   /translation="MDYLKRLMKYLDDCKLLVAVGLILALAGIFCSMAVPKVSKHIIDD
FT                   VLVARHFEKLYYFALILAGLVLSKAILNYFQSYIFEYTSQKAIYKLREQLYTKLQYQSF
FT                   EYFDKASTGAIMNRMVGDLEAIRNFLNQGFVQVISIVITLILALSIMLSMNVLLSFLSL
FT                   ATTPLIYFNVKSLAKKLQPTFRAIRVAFEKLTSKVQENITGIRVVKAFGNEELEKKSFE
FT                   KVAFEFTSKNIQAADIRSVHNPLANFLNGLNSVIILVVGGYLAINGKITIGTLFAFVSY
FT                   VNLFSAPIGNIQNLVNQWQNAFASLEKVFEVLDSEVLIKSPKNAIHLKNIKGDIKFENV
FT                   YFKYKDKFVLKGINIHIEPGEVVAILGQAGSGKSSLINLLARFYDPTSGRVLIDDVDVK
FT                   NVKLCSLRRNIGIIMQETFIFSDTIAANIAFGKPDAKEEEIKWAAKLARADEFIERLPE
FT                   GYSTVVGERGIGLSGGQKQRIAIARALIYNPKILVLDDATSSLDFETEAEIQNTLKEVI
FT                   KGRTTIIITHRISQLVVSANKIYYMQDGRIVEQGTHEELMRLKGRYYTTFKKQLLERAN
FT                   SLPA"
FT   gene            29301..31097
FT                   /locus_tag="Calhy_0027"
FT   CDS_pept        29301..31097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0027"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0048 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05790"
FT                   /db_xref="GOA:E4Q9B9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9B9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ05790.1"
FT                   /translation="MADPVAKKPMFSQEETNYELKIPYLKRLFKFLLPYKKWLVLTLVF
FT                   MFVATVADLVSPYLLKQAVDHYIPKKDFKGILIIGALLVLMLFINKECSKNKIRLANRT
FT                   GQMVLFDIRKALFDHVQGLSFSFFDKNSTGRIIVRIVNDVNTLNNLFTNGIVNVITDMS
FT                   SLVLAAIIMFSINPRLAMVTFAVVPIFLVVLFTTRNAIKRNWRAVRRKIANLNAYIHEN
FT                   ISGIRVIQAYVRQKVNRAIFKDVIDDVFLSWMRAVRINGIFSPAVEVCSMIGTLIIYFY
FT                   GVKLLKINGVTVGTLIAFVSYLDRFWRPVVTLSNFYNQLLVASASSERIFEVLSVQPEI
FT                   KEDKNPVEISTFRNSIEFKNVWFAYKDEEYVLKDVSFEIKKGMMVALVGATGSGKTTIV
FT                   NLLSRFYDPQKGSILIDGIDLKKISFKSLRKLIGIVQQEPFLFSGSILDNILYGKPDAK
FT                   FEEVIEVCKFLGAHDFISQFEDGYFTQVNERGTRLSTGQKQLICLSRLLLQNPQILILD
FT                   EATASLDTHSELMVQNALNRIMKDRTSIVIAHRLSTIKDADLIIVMDKGRIAEMGTHES
FT                   LIRKKGIYYELCASQIRFVKAG"
FT   gene            31189..31264
FT                   /locus_tag="Calhy_R0001"
FT                   /note="tRNA-Lys1"
FT   tRNA            31189..31264
FT                   /locus_tag="Calhy_R0001"
FT                   /product="tRNA-Lys"
FT   gene            31288..31362
FT                   /locus_tag="Calhy_R0002"
FT                   /note="tRNA-Glu1"
FT   tRNA            31288..31362
FT                   /locus_tag="Calhy_R0002"
FT                   /product="tRNA-Glu"
FT   gene            complement(31543..32118)
FT                   /locus_tag="Calhy_0028"
FT   CDS_pept        complement(31543..32118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0028"
FT                   /product="protein of unknown function DUF95 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF95
FT                   transmembrane; KEGG: ate:Athe_0049 protein of unknown
FT                   function DUF95 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05791"
FT                   /db_xref="GOA:E4Q9C0"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9C0"
FT                   /inference="protein motif:PFAM:PF01944"
FT                   /protein_id="ADQ05791.1"
FT                   /translation="MKFVVQTFKAEKRLILISFLIFTLSCILGIVAGLYFGDEMQKFIN
FT                   QYIRKLFESILKNAKSPYLLFLAILKNNMKVYLIIITAGTLTFGLVSVFVLLSNGFIVG
FT                   AVATISAKQTSLAKTLLLILPHGIFEIAAFIIGSAASAIFLEAAVSSKERPKPNIAFKR
FT                   FLTLAVCGAFLVVFAAFLEAFVTSSFAK"
FT   sig_peptide     complement(32005..32118)
FT                   /locus_tag="Calhy_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.685) with cleavage site probability 0.636 at
FT                   residue 38"
FT   gene            32292..32924
FT                   /locus_tag="Calhy_0029"
FT   CDS_pept        32292..32924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0029"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: ate:Athe_0050 Zn-dependent hydrolase of the
FT                   beta-lactamase fold-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05792"
FT                   /db_xref="GOA:E4Q9C1"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9C1"
FT                   /inference="similar to AA sequence:KEGG:Athe_0050"
FT                   /protein_id="ADQ05792.1"
FT                   /translation="MKITYLAHASFLIETKSGVKILTDPYDSSVGYTVFELSPDVVLTS
FT                   HKHFDHGYTGSLKGDYVLVDKEGEFNVKGVKIKGIKTFHDKEKGQKRGENIVFVIEDEF
FT                   CVAHLGDLGHELAAPELEKMGKVDILLIPVGGVYTIDAKEAFNVAKAVNPRVIIPMHYK
FT                   TEKLKFDLGKAEEFTKHFEDVEVLNSCEIEINNLPEKQKVMLLKYKG"
FT   gene            32940..35147
FT                   /locus_tag="Calhy_0030"
FT   CDS_pept        32940..35147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0030"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: ate:Athe_0051
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05793"
FT                   /db_xref="GOA:E4Q9C2"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9C2"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADQ05793.1"
FT                   /translation="MPKKSEKKSISQRANKFGESEISIFPGKTLAIYKAFVLFAFCVLV
FT                   LMSPYYRGLYFDYELSVFQAIMAGIFILFAIYLYLSKEGFLVNSKLELMLLLFMVAYIV
FT                   PYFFAANRRLALGEFFKYAFYFAVFYVASRISKGKAEKLAILNSLSLSTVGVAFFGYQA
FT                   AVKLIPETARPLGMAMNGLWVGNMINSTLQYHNTAGTVLAFGFIISLMLAIYSENKLLK
FT                   SFYFAFSSFIFTAFFFTYSRGSYITLLLALLVFFLLLPREKRISLIFNIAIVGAFVIAF
FT                   LNKVGANLNEHGKVKLWLVLLFQMLLVFVLTYAFGFVERRLYSLSNNIYIAGAIAVGIL
FT                   AIIGFAVALKMHLIPSDMVAKIKSIAMFWKERNFVERMVFYKDGLKIFLKSPVFGYGGG
FT                   AWVSLYFMYQSYLYFTTQSHNYFLQVLLDTGLLGFSILIVFLWLLFSSSLKAWFKKDGK
FT                   NNILIAGIVAAAVQLYLHSILDFDFSLASVQVLLFAALGVLVSTSLQILQKHKQEKVIY
FT                   TSRKTNFVPALLAIFYLFVIVISLNFRLGNYYANIGQQALQTGNLSAAYSFLSKAVTYD
FT                   PLSSNALSDYAVALYRIGDQNKDANLIAKADGYFKQAIVNDRFNAKIRFKYAIYLLAHG
FT                   AVDSGLSQIEEGIKLQPLQPANYELKADAYAKVGDYYLGKGDKEKAKKYYEVVLKIPEE
FT                   IERVKKEKEKMPEVVKQDPNSHKFGITDRTLQIVNEVKKKI"
FT   gene            35210..36286
FT                   /locus_tag="Calhy_0031"
FT   CDS_pept        35210..36286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0031"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   csc:Csac_2572 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05794"
FT                   /db_xref="GOA:E4Q9C3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9C3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADQ05794.1"
FT                   /translation="MLCVVDCRCINLERNHGISRYTYEIIRNAPKNIKQHLILLSDKEN
FT                   FDVLAKAFDQEVREIVQIKSPFLSSFENIEIPSILIKIQKRTKEQIAYFSPSFSSPPIV
FT                   DKRIKKYITIHDLMHLDFYSSLKNKVYYSTLVKYYINTAVYVFTVSNYSKEKIIKYYGN
FT                   SEKIKVIYPGIDVNTFRKLKDEEIERLKDVYSYLPEKFFLFIGNNKKHKNFSYAYELYK
FT                   CLKRFYPAHKFVSNVWDNESDKDIIRLEKIDDNLLCFLYNRCEAFLYPSLYEGFGLPPL
FT                   EAIACGAKVIASKCASLPEVLGEHAIYIDVFKSPEENIFEVIEKLNQPKPEFEVISRYI
FT                   SKYNWQDLSRKIFDFIFS"
FT   gene            36332..37660
FT                   /locus_tag="Calhy_0032"
FT   CDS_pept        36332..37660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05795"
FT                   /db_xref="GOA:E4Q9C4"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9C4"
FT                   /inference="similar to AA sequence:KEGG:Csac_2571"
FT                   /protein_id="ADQ05795.1"
FT                   /translation="MLQQLTKELWQEGKIKTMFSTAGIILYVFYILTGNFSRIIKLSFF
FT                   PRSISLIEVSILAFVGIFFIYELTLLREDKNLLKKVSLNDLDTVEVLLSLMLLSILVNY
FT                   IIYKFNILPLLYYLRFFSLVYFAFIIYLFLNFKRNISKIEWFYTQIGLLLCIIGWIIYF
FT                   IEPDTERLNKFFEQQGIYLNLDPHKFRLIGNIFDPNFFGNILVMFISITMISFLSESLQ
FT                   DKKSLIQKVILLIFFNVTLLKTVSRSSILGLFLVVFFNTALIGSWSFAKKKIEIFKKLI
FT                   LVDSILLFTTLLDKDFYKIFERIKSIPVDNSAHARIQSWNSALDYIEKTPIKLLIGDGY
FT                   GFLNIKYGLQFIGFDSSFLNLILYCGLLGTVFFLVWLFKKIYKVYQNIRYEELDVKLHF
FT                   VNLFSLLLTYFVISWFNNLLFYQFWLVLFLPYYYFLTDYGRKG"
FT   gene            37663..38700
FT                   /locus_tag="Calhy_0033"
FT   CDS_pept        37663..38700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0033"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   csc:Csac_2570 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05796"
FT                   /db_xref="GOA:E4Q9C5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9C5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADQ05796.1"
FT                   /translation="MNIGVDARPLGKIKTGIGFYLYNLLKVLPEKCSDINFFLFSDREI
FT                   SLDFNYPNVKTVVESDYKLLKGTLWYMRRTDYLIKKYNINVFWGTQNILPFIRNKNVKK
FT                   ILTVHDLVCYKYPQTMEKLNYFINKAFIPHSIKSADKIVAVSNSTKEDILSYFNVDPKK
FT                   ICVIYNPVIVTDMGNINEEEYLSKYNLAKNKYILYVGTIEPRKNTEILFKVCKEIYNKT
FT                   GMPTVLAGKIGWKSNEIIQCIKEYSKVGCLKYLEYVSDIEKNLLMRNCFIFVFPSFYEG
FT                   FGMPVVEALKNGALVLVSDTSSLKELITIDELKFDPLDCKQLSEKIINFYVDNEAYTKY
FT                   RKKMQ"
FT   gene            38782..39873
FT                   /locus_tag="Calhy_0034"
FT   CDS_pept        38782..39873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0034"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   csc:Csac_2569 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05797"
FT                   /db_xref="GOA:E4Q9C6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9C6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADQ05797.1"
FT                   /translation="MKVLFVPPPLAFQNIGGGEIQMLKTKKYLEKLFKLEIAIFDVVNT
FT                   KLADYDIIHFFGSEYILFPLVNAAKNLKKKVVISPIFFDNKHYLSYKIATFIGKILPFR
FT                   SSVLDRLELLKLADCLLPNSFLEAGYLRKAFNVLPEKIHVIPNGIDVEEITGYLDTITP
FT                   EDEEDFKKEYNINTPYFLYVARFDKRKNQLNLIKAFNKLIARENNIKLILIGSPNLDEI
FT                   EYYDQCKREALKSKGKIIFLPALKHSDKKLWIAYKCATAHIMPSLFETPGLASLEAAFC
FT                   GCRLIVTTGGATREYFKDNALYVNPNDIDDIREKMLAILKDTKTRELHRKSEMLKQEIL
FT                   KIYNWKQIAESTYKIYEMIGGVQ"
FT   gene            39870..40994
FT                   /locus_tag="Calhy_0035"
FT   CDS_pept        39870..40994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0035"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   csc:Csac_2568 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05798"
FT                   /db_xref="GOA:E4Q9C7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9C7"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADQ05798.1"
FT                   /translation="MKVAIVHEWLTTMGGSEKVILELKKLFPEAPIYTLVYNRRKLGKY
FT                   FDKYLIITSNLQKNPLAHIKHQLFFKYMPRAFESFDLSDFDLVISSSSAFAKGVITSPN
FT                   SVHICYCHTPPRYLWDLTHEYLKDYNLIIRRYLERNFHYLRIWDTIAANRVDYFVANSN
FT                   YVANRIKKFYKRDCKVIYPPVDTEYFTPAKDKNIEDYYLIVSRLVPYKRVDLAVEAFNQ
FT                   ISKKLVIVGDGPEYKKLKSIAKPNIEFLGYQPDETVRDLYQRCKALIFPGVEDFGIVPV
FT                   EVQACGRPVIALKKGGAVETVEEGKTGVFFERQDVESLKEAVYKFEQDIERFDKDYIRS
FT                   HAEKFSAERFRVEFKDFILKVTEYERGEGMGGKV"
FT   gene            40991..41764
FT                   /locus_tag="Calhy_0036"
FT   CDS_pept        40991..41764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0036"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   csc:Csac_2567 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05799"
FT                   /db_xref="GOA:E4Q9C8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9C8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADQ05799.1"
FT                   /translation="MIKNITCVILTKNSARNIENIRNVYHLFEKIVIVDDYSEDDTVKK
FT                   IEEIDTEKRVKICRRKLDNFSSQRNYASSLAETDWVFHLDSDERIDDMLIRELHMIDGN
FT                   INNTYFIAFKVKRKNYFIDMHIGTEDKIRLFNKKKLYFRGEVHEDLDIKSEDKIGIIKG
FT                   AILHKSYQSIQDYFRKLDLYMKLEEERLKQSEKGWFYILGRLVKRTFEHFKTLIKNVIA
FT                   NKSFLKPLLWFCLCEAYDLLYFSIFLYVKYFKISK"
FT   gene            41814..43190
FT                   /locus_tag="Calhy_0037"
FT   CDS_pept        41814..43190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0037"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; KEGG: csc:Csac_2566
FT                   undecaprenyl-phosphate galactose phosphotransferase; PFAM:
FT                   sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05800"
FT                   /db_xref="GOA:E4Q9C9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9C9"
FT                   /inference="protein motif:TFAM:TIGR03023"
FT                   /protein_id="ADQ05800.1"
FT                   /translation="MHNLGRLYIKIAKIIDIPAILLSFILSWFIKFNSGLFNKPASLDI
FT                   QTYLLIVALHVPLYLFFLTVSGKEGKRSNFELFSDFIRILRSNIFALLIIVMIFYTLKL
FT                   IDFSRIFLFIFVILNFLMSILQRLILRRILFSPNSKIISKERVLFVGQNEISERLSNIF
FT                   ERNNYQIIGFVVNESDPMNERVVGKIKDIESIVSNNHVDEIIIVLPLNQEKEINYIVDI
FT                   CEKYGIRTYLVPDYFKFIPSKAEIEKIEEIPLINIRYSPLDEWPNRFLKRTFDIVVSLL
FT                   GLILCLPLFIIIAILIKLTSEGPIFFTQERVGYNRRIFKMHKFRTMFVQDPDEEKIRWT
FT                   TKDDPRRTPIGKILRRLSLDELPQLWDVLVGNMSLVGPRPERPYFVEKFKEEIPKYMIK
FT                   HRVRPGITGWAQIHGLRGDTSIEERIKYDIWYIENWSFWLDIKIILATIFGGKFMENAY
FT                   "
FT   gene            43222..44253
FT                   /locus_tag="Calhy_0038"
FT   CDS_pept        43222..44253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0038"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: csc:Csac_2565 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05801"
FT                   /db_xref="GOA:E4Q9D0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D0"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADQ05801.1"
FT                   /translation="MSMHVPVIHNDLKCGDNLLELLYAEANEHLRENDKKRDQILIVIA
FT                   TLSGAIFGFYEKLKGLPLGYKITMMLLVLMLSIFEPFILITYRKWHIVYHLGAKVLQQI
FT                   MYIGVERVSVQLIKRLLEDNIKKPTLTRFITTTETMIYNLSLFMNISNMYILFYSYGKF
FT                   HPGFIVSMFMGYLILYNYIHFRNIKELLSKILTEKGYQEIWLLDFIKDLSADIYENKYL
FT                   KIIVDDKNVVKVINKNNGCVVVPITSANKIILIEIFRDTVNRNVLELPRGFAEESESTE
FT                   KAALRELEEEIGGQCSRIIKIGSFYPDTGLYKAEIDVFLALDTKYAIRKHSLAENIRDQ
FT                   VVE"
FT   gene            complement(44285..45232)
FT                   /locus_tag="Calhy_0039"
FT   CDS_pept        complement(44285..45232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0039"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   csc:Csac_2323 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05802"
FT                   /db_xref="GOA:E4Q9D1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D1"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADQ05802.1"
FT                   /translation="MSNFIKTQKQKFLKILMTIEKVIKALGLKIKSSRRGRPKKFKLSH
FT                   IIACFVYKVKNKINSFRELEYKINEDEEFKKAIGIEKSPDHSYFSKWAKVIEEGYIEGI
FT                   ARILVREIVPQTKVCAIDSTPLRSSRGDKEAEVGVCVSLGFYNGYKLHVLATVEDEVIP
FT                   IVWWLTRANIHDSKVVELLYEAKIFGPEVILADAGYDCAKWFEVADRLEIKFVAAVNKR
FT                   NSKDFSNVKNILRVKNMEFLRSEEGQRLYKQRTKIERLFGKLKGEYNLEQIRLRGFRTY
FT                   KRHVDWIMITYLIEVYIQKIENCKFSFKYTWNNL"
FT   gene            45469..45687
FT                   /pseudo
FT                   /locus_tag="Calhy_0040"
FT   gene            45781..46320
FT                   /locus_tag="Calhy_0041"
FT   CDS_pept        45781..46320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05803"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0063"
FT                   /protein_id="ADQ05803.1"
FT                   /translation="MSEMEMLEKIVLGIEELKTDMKEVKIRLDRVEERLDRVEERLDRV
FT                   EERLDRVEERLDKLEVRLDRLEERVGELEEKVDALEREVSIVKNDIRNMQAEMQSLKQA
FT                   ILENTGCIDTLFNAFGGVMQFKADIENFKAEINRFKEEASTKVENLVEVTNKIKEEYGR
FT                   HDIDLRIMKEKIGILI"
FT   gene            complement(46392..46937)
FT                   /locus_tag="Calhy_0042"
FT   CDS_pept        complement(46392..46937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0042"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="KEGG: ate:Athe_0064 Appr-1-p processing domain
FT                   protein; PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05804"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D3"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ADQ05804.1"
FT                   /translation="MSTKEIFQKITIKKGDITKENVDAIVNAANSHLRHGGGVALAIVK
FT                   AGGQEIQKESDEIINKIGFLPTGNAVITNAYNLPCKFVIHTVGPIYGEGNEDEKLSRAI
FT                   YNSLYLAHLYNLKSIAFPAVSSGIFGFPKDRCAKILIDTAIDFLSSIKTSIEKVVFCLF
FT                   DDETYGHFEEYYKNLLKE"
FT   gene            complement(46958..47332)
FT                   /locus_tag="Calhy_0043"
FT   CDS_pept        complement(46958..47332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05805"
FT                   /db_xref="GOA:E4Q9D4"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D4"
FT                   /inference="similar to AA sequence:KEGG:Athe_0065"
FT                   /protein_id="ADQ05805.1"
FT                   /translation="MKVSLIFVLGLLFGIGLIIIYNKLLFLFRKKKPLIKISPEKKSFD
FT                   ELVQVYNSVSQDIKRNLDEYSSFPTTDCGKILAASLFTQVTVCLSILSSLEKFGIDTKA
FT                   VFDEIISKNKAQQPTQQKNF"
FT   gene            47580..49010
FT                   /locus_tag="Calhy_0044"
FT   CDS_pept        47580..49010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05806"
FT                   /db_xref="GOA:E4Q7K4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q7K4"
FT                   /inference="similar to AA sequence:KEGG:Csac_0656"
FT                   /protein_id="ADQ05806.1"
FT                   /translation="MFNTKPKQLSFIDLFSHLKASALYKPESLLGLFNKFIDLSHYIPS
FT                   SFYNAYYKYFGKHRYFSLESMLCCFLVQKLLKLNTLTQLRAVLLNSFELRSFCNLHGNV
FT                   PSISTLSRFRKIFASEIHKLFQNISIHAHNISIQQCPQDSSILIFDTTGIVPKVRENNP
FT                   KFIHLLLKNTSKANPELPSEKVYSLVYSSLPKTANANSNIRLMFVNGHFCWALKFAVIT
FT                   NALGIPLALVPLFNYDSPSSDPQEAKAISDSKGLIPSLETLFSYIPKNFSTFIADSALD
FT                   SHNIYSTLKNTFNFSKIVIPLNTRASKNTTPTSDPNIVISEDGIPICKKFNKPFKPEGK
FT                   CQGKNRSLRLKWTCPMSQYKDGKRICSCPQPCTTSKSGRMFYTYPDNFRSFPGINRNSQ
FT                   EFFDLYKKRVAVEQTIYHLKSYMGSDTISTYDHISIFSDFLLSAITFSLLFILAHNIKL
FT                   YCSKLTIKKLNKLKKLIA"
FT   gene            complement(49308..49601)
FT                   /locus_tag="Calhy_0045"
FT   CDS_pept        complement(49308..49601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05807"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D6"
FT                   /inference="similar to AA sequence:KEGG:Csac_0640"
FT                   /protein_id="ADQ05807.1"
FT                   /translation="MSQNNWLFEEATKLAQEYGFKCYEIHSNLVRVRTICDEWLIEYVQ
FT                   SSKKPFYLHHYKDKPHLQRKFYDLPFLFKSLFQHDRFVLNGRTTVPIKKISA"
FT   gene            49864..50040
FT                   /locus_tag="Calhy_0046"
FT   CDS_pept        49864..50040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05808"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ05808.1"
FT                   /translation="MYSFRRGVAVIAIFAFIFSFIFPVTFVQAAFKDVNSNYLGKRPYR
FT                   KVEQYISGCKRIF"
FT   sig_peptide     49864..49953
FT                   /locus_tag="Calhy_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.929 at
FT                   residue 30"
FT   gene            50309..55189
FT                   /locus_tag="Calhy_0047"
FT   CDS_pept        50309..55189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0047"
FT                   /product="transglutaminase domain protein"
FT                   /note="KEGG: ate:Athe_0077 S-layer domain protein; PFAM:
FT                   transglutaminase domain protein; S-layer domain protein;
FT                   SMART: transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05809"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D8"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADQ05809.1"
FT                   /translation="MLSAFKDADEISSWSRNYVAALVQKNYIKGYPDSTFKPKKFITRA
FT                   EALSILDNIIGLLLHKEGYYTSKEVKGNLVINKSGVRINGFSVNGNVIIAEGVAKGSVR
FT                   IENSNINGSIIIRGGGEHSITLENVKAQKVRVDNIQAATRVVVSGNSNIEKVEVKENAI
FT                   IENLSKLPIKSIVISSNESSSISVSVKGNAESVEIISAKAEVNITQGNINKVIIQNQAN
FT                   LKVETNSKIQELTVNSQNVKILSQGMIEKIQVNEEKVYVNNNEVTKGQIVTVIDGKMEK
FT                   IRNQQQTSSQSNTSSTSSPTTSNSTASLSEEGSQTSVGSIESTTLSGSGQTGGTPSGPT
FT                   GSLPSGSTGVSSSGNVASVSVDKETILVAQDNTVSVTVKDAQGNPLSGKLVTIDGKSSY
FT                   TNSNGVATISLNVSESKELIINVDGKNYAGLLYAIKPTEGVIKLKLKTGADIYENQFNV
FT                   KIVGQSSQFSQIFQANTTELGVIVPVGNDYKILAWKYATEKGLIYALISSVNVVNGMNR
FT                   IVVDTTTSEFVNATISFSYENKMLTDYEFSVANSTYSDVFTTDDVKVNLQNNQINIIAN
FT                   KGTYTIKIAKEINGEKLYFVRTCQLNTSGATLKFAFTSLKKLTFTFNGLSNLTSVAESV
FT                   YVKLNNQRYQLSDDLSVYLPKGTYTLDAVEVETFDTNNSHLKYTFAVDENRLPLSIDLT
FT                   LPDEEVTKQVDFNINENESDLVVCNINDERITGLKSGSVAVLYENIKTHSGYSLDVVID
FT                   GAYPNFLGLEIPYGTNITLQDGIQLQSLSVLATKILENKVCATLFYVPSDTADGNYNLM
FT                   IQKDLGPLYENLVLEKSYSFEISSNGDASGYAEKTSNVSEIVEKVSYKIDSTADDVIFI
FT                   SLPANLQIADYNQLCQNIFMNLMRNYPLALDYGVNDVIGIRFFTGSAEDVMMFIIPYIY
FT                   EKQERIARRQAVLQKAQEIVQTVIDQTYNDYDKVLALHDYLILHTRYDIESYLNHSGPF
FT                   DIHTAYGALINGLAVCDGYAKAMYVLLNTAGIETIVVYGEAGDVASKVGHAWNMVKLDG
FT                   DWYQLDVTWDDRDSLGGVEIDYSYFNVTDDDISSDHWWDRNLYPTCTATNYKYGNYYKA
FT                   EIVPEVVYYNLPNIVQIVVKDYKGNPQPERLVTVTYYDFTTQTDEVAFVGYTDQDGKVA
FT                   FNVTPTEFTAYKIYVTPRMELKGYIDVIEKLKPVTIKFNLNGTEVTQFGLVRNGMELFY
FT                   TNDGQISVDMSVYFDNDVTLFGEGFVVKRSLSFDGYDSEEVTVFNDIYYDASVQLHVYD
FT                   GTADIVGASIYIIDKDTYKELFVGTTDAAGRLPLIITKGEYVAKIVYGDGDEDVKNYAY
FT                   AKLNIFEDSQIDLDLAKFSTVQFIPHFTEGGLGLNDRLYIGFETSASYAKIATFIGKRR
FT                   EAKFAPGDYGYVWVFAHNPYYDDPRSLGYKPTEKLVISPYPQIITYDLGIDARKIAIKS
FT                   VYKFNKDTWEFEPTTLDSIYQGDVLKLDIYIPTYSHYIIGETGVCMEMVQENQRSIYFV
FT                   ASAIPYPVTAVIKAQDLNEYNLEEFFLGFDDKADTWSIILAGVNGDLNSTLIINLPFAP
FT                   YDGNYTLQSPIKVYQAQNSSSGGSPRRIFIKMLQLKNNFKQINSIKK"
FT   gene            55395..57020
FT                   /locus_tag="Calhy_0048"
FT   CDS_pept        55395..57020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0048"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="TIGRFAM: CTP synthase; KEGG: ate:Athe_0078 CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05810"
FT                   /db_xref="GOA:E4Q9D9"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D9"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ADQ05810.1"
FT                   /translation="MEKQVKYIFVTGGVVSGLGKGITAASIGRLLKARGLKVTMQKFDP
FT                   YINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDENLTKNSNVTTGKIYWSVIQR
FT                   ERRGDFLGGTVQVIPHITNEIKERIYRLGKSNSTDVVITEIGGTVGDIESLPFLEAIRQ
FT                   VATDIGKENVLYVHVTLVPYLSKSGELKTKPTQHSVKELRSIGIQPDIIVCRTEKPLSQ
FT                   DLKAKIALFCNLKPEYVIQNLDAESLYEVPLMLEKEGLGEIICEKLGFACTKPDLSDWI
FT                   EIVEKEKNLKKNVTIALVGKYVELHDAYLSVAEALKHAGIANDSHVEILWINAEEVTYE
FT                   NASEKLKRADGILVPGGFGDRGIEGKIAAIRYARENKIPFFGICLGMQCAVIEFARNVL
FT                   GLNRANSTEFDEETPYPVIDIMPEQKDIFTKGGTMRLGLYPCKLEEGTLAHRIYNDELV
FT                   YERHRHRYEFNNEFKERFKQAGMVFSGISPDRRLVEIIELKDHPWFLGVQFHPEFKSRP
FT                   QRPHPIFTDFIRASLEHKAKKEGV"
FT   gene            complement(57070..57558)
FT                   /locus_tag="Calhy_0049"
FT   CDS_pept        complement(57070..57558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05811"
FT                   /db_xref="GOA:E4Q9E0"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9E0"
FT                   /inference="similar to AA sequence:KEGG:Athe_0079"
FT                   /protein_id="ADQ05811.1"
FT                   /translation="MENRNVAFEIFLWLLIYLCFFAGTNLFSSSSMLLLAWSSICLLVI
FT                   FLITIVLRLYTTSTLLLLPGFIISCILAILFMFNVRFPNFLILLLQVFSIHLMGFVEFA
FT                   RESSKMVILQRPLYIYIHVGLNLVLFLIHLFVIYLISELPRQQRPKTLDLTYTRRRRR"
FT   gene            57752..58444
FT                   /locus_tag="Calhy_0050"
FT   CDS_pept        57752..58444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0050"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: ate:Athe_0080 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05812"
FT                   /db_xref="GOA:E4Q9E1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9E1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ05812.1"
FT                   /translation="MSKAHILVVDDEKPIVDIIKFNLEKEGYKVTASYDGEDALNRIKS
FT                   ENFDMVLLDVMLPKIDGFSVCKKVREFSDVPIIMITAKADEVDKVLGLELGADDYITKP
FT                   FGIRELIARIRANLRRTAQSSTQDGKVLKAGALTLNPETFEVKKNGKVIELTVREYELL
FT                   KFLMSQKGQVFSREELLEKVWDYEYYGDVRTVDVTVRRLREKIEDNPSEPTFILTKRGI
FT                   GYYFNPNI"
FT   gene            58468..60168
FT                   /locus_tag="Calhy_0051"
FT   CDS_pept        58468..60168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0051"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ate:Athe_0081 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; PAS fold
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; histidine
FT                   kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05813"
FT                   /db_xref="GOA:E4Q9E2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9E2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADQ05813.1"
FT                   /translation="MTRSIESRLILVFGLLILMVMFISSFFIIDRTKNYFYEDVQKKIE
FT                   FMVSSSLIRLLEDKNLTQERIQTIVDQSMKESQYGFMIQKLIVTDSRGKVLASFPRMDI
FT                   SFFPSDEILTSLAGYKVVKREVEDQAMVFAFPIKSGRSVERALYLEVSVQNILATVTDI
FT                   KNILLMAYIVAMIFSLFIGFLFAKTLSNPLRKLTKQALEMAEGNLDVKIEISSQDEIGK
FT                   LASAFKVMATNVKKYISELEFEKQKLERILQNMSDGVLAVNSKNEIIHINESAKKFLKG
FT                   DVERFLEHVQSDKDWGVTQHIYEVDGWTLEISTAAFIDSYQGTGTIFILHDITQQAKLD
FT                   QMRKQFVADVSHELRTPITTIKTYSETLLDVDDEAVKREFLGVIIKECDRMTRLISDLL
FT                   YLSRLDSGENILKIEEVNVSELVRFVCEKMRIHAKKKNQKLLCSAEENVVIEADRDRLE
FT                   QVLINLINNAVVYVQEGGQIEVGLEKDEEHVKITVKDNGPGIPEDDLPRIFERFYRVDK
FT                   ARSRSLGGSGLGLSIADEIVKAHGGRILVESKEGVGTTFTVVLPVKRGV"
FT   gene            60268..60756
FT                   /locus_tag="Calhy_0052"
FT   CDS_pept        60268..60756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_0082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05814"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9E3"
FT                   /inference="similar to AA sequence:KEGG:Athe_0082"
FT                   /protein_id="ADQ05814.1"
FT                   /translation="MKKLGLVLAMILILSIGTVAFADSSKTSAKAKNINSVEIDGNKVT
FT                   ATASSLVEIAEYDVELSTPVFVLSGKGSEGVEICIYTKKDKKEAFSQSNLVEKFTVGKS
FT                   GYFAKKISVNEGTTYILVVATKDSDTQLSLLKVSYEKKESFLAKVEKAISNFISSLGK"
FT   sig_peptide     60268..60336
FT                   /locus_tag="Calhy_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            60775..62073
FT                   /locus_tag="Calhy_0053"
FT   CDS_pept        60775..62073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_0083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05815"
FT                   /db_xref="GOA:E4Q9E4"
FT                   /db_xref="InterPro:IPR009996"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9E4"
FT                   /inference="similar to AA sequence:KEGG:Athe_0083"
FT                   /protein_id="ADQ05815.1"
FT                   /translation="MRKSKVEVIKSIVLSILVILSIYLYYKVYFDYKVEDIVKAVDIYQ
FT                   NSQSDQELLKKARKILASPKEMYLNISKNVAVRILSNQAQYSQVVLKFIEGIEKSLVKK
FT                   EFEISLRNISANFFKQKRVLILSYGYQIDFNTFVYELTKRNIGNAAQGFEFNRIFIEEN
FT                   GTGTVLYFFNSQKQRAVVMRFSQFGFMPLEDSIEKDLKLVYSWSDSLGFTEIANKDILI
FT                   PVEFSDVQFSEIKTRESSYKKELIVRRLFPDTILTRKNILKNGDVVITDERRTLQLKND
FT                   GRFVFEYSESVFGEKVDSISDALMFYLKTFYTEEDLRICKVELQKEGDFKVYLTTRANG
FT                   IDVVAGDEEFCAKIEVQGGRLQEISGHLFDILKVRTSQIKVDGIAAIDTIKERKGDIFI
FT                   EEIDLEYISGGASSYPYWKIKTQSGVVYVETIK"
FT   gene            62097..62825
FT                   /locus_tag="Calhy_0054"
FT   CDS_pept        62097..62825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0054"
FT                   /product="Protein of unknown function YycH"
FT                   /note="PFAM: Protein of unknown function YycH; KEGG:
FT                   ate:Athe_0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05816"
FT                   /db_xref="GOA:E4Q9E5"
FT                   /db_xref="InterPro:IPR018604"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9E5"
FT                   /inference="protein motif:PFAM:PF09648"
FT                   /protein_id="ADQ05816.1"
FT                   /translation="MNWAKAKTTAIVVFFLISVFLVIKYLNLFPKEETLTDQQINMAKS
FT                   ILSQNSIKLSCSIDRKIYYVSKLGVAIESKYDNIVTKLFGKRVDRYQNEFESSIYHLKI
FT                   VNQTLFLESKYYQDPFELFDIKRGDYIKDYDGSFVQVYKGYPIFDGRLTVKEQGSSTLY
FT                   IFTRVNPRRFEIKRSRAISALEAIFNLLNQQRGIKEIQNIKFGFYLKDFNIIQGQAIPV
FT                   WRIVADGNVYYINGFTGMLE"
FT   gene            63045..64001
FT                   /locus_tag="Calhy_0055"
FT   CDS_pept        63045..64001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0055"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0085
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05817"
FT                   /db_xref="GOA:E4Q9E6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9E6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05817.1"
FT                   /translation="MESAISANKQRSRQSGFRRFLHKLNEQKYLQAMAIPGVIWMIIFN
FT                   YIPMYGIIIAFKEYDITLGFNKSPWVGLANFREFFADERFWLIIKNTVGISFFKLLVGF
FT                   PLPILFAVLLNELVSVRFKRTVQTISYLPHFISWVVLGGILMNWLSETGLINIILTKIG
FT                   ILKQPIAFLAEPKYFWGITVVSEVWKELGWNAIIYLAAIAGIDPELYEAATVDGAGRFT
FT                   KMFKITIPCISGTIAIMFILAVSGLMNSNFDQIFVLRNPLNADASDVIDIYVYRMGIEA
FT                   FRFSYATAIGLFKSIIALILLLTANGVTKKLTDKSLF"
FT   gene            64050..64934
FT                   /locus_tag="Calhy_0056"
FT   CDS_pept        64050..64934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0056"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0086
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05818"
FT                   /db_xref="GOA:E4Q9E7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9E7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05818.1"
FT                   /translation="MKIKSSVGDKIFNIFNVTLMLIICFLTLYPIWYIIVYSFNEGKDA
FT                   MLGGIYFWPRKFTLDNYKTVFSNSDITTAFMVTVARTVITTTLHVFFTAMVAYAFLRKE
FT                   LMGRKIYMAMGTITLFFGGGLIPYFLLIKSLGLYNTFWVYVIPGMFNFYNLIIFQAFFR
FT                   ELPIELEESAKIDGANDFIIFTRIILPLSTPVLATIALFVGVYNWNDYFMGVIFINNPK
FT                   LQPIQTFLYKVIAQTTSNQMLAYAPGGIATRNVTSQSLKMATMVITTLPIVCVYPFLQK
FT                   YFVKGLLIGAIKG"
FT   gene            65030..66643
FT                   /locus_tag="Calhy_0057"
FT   CDS_pept        65030..66643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0057"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2552 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05819"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9E8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ05819.1"
FT                   /translation="MKKLKFKRLFAVLVVIAFVASLIPFAIGSAASSVKPGWKEDSKKP
FT                   ITFDWYINFSWFGTKWGGNAVSDYITKKTGVKINFIVPAGNENEKLNVMIASNTLPDFI
FT                   TLGWWEEAVRKMISGKLVYALDELAKKYDPYFFTVANKQRLGWYTQPDGHVYGYPNASY
FT                   TPDDFKNPKLKIYSNQTFLVRKDMYEALGKPDMRKPDTFLKALADAKKKFPTVNGQPLI
FT                   PIGFHEFTDTGCYSLESYLWNFLALPREKNGKLYDIVTNPEYIRWLKTFNEAYRRGLIA
FT                   KDVFIDKRAQMEEKIAQGRYFSMIYQRTDFVAQQQELYKKNPNMVYIAVDGPANSKLEK
FT                   PKLAGPGIAGWTLTMISKNNKDPKRAIRFMSYWLSPEGQKDFYLGPKGVTWDVIKGKEQ
FT                   FKPEVVKLMQTDRPTFDKKYGAELTYWMLGDWPYVSQWDPGMPPYLQQMADWTIGKTVS
FT                   YAQYDGLEPPADSPEGIIARKVALKWGQTLPKLIMAKSSAEFDKIFNEFQNYKKQVGYD
FT                   KVLAYQQKKLEENKKKLGIK"
FT   sig_peptide     65030..65128
FT                   /locus_tag="Calhy_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.275 at
FT                   residue 33"
FT   gene            66809..68635
FT                   /locus_tag="Calhy_0058"
FT   CDS_pept        66809..68635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0058"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: csc:Csac_2551 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: histidine kinase
FT                   internal region; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05820"
FT                   /db_xref="GOA:E4Q9E9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9E9"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ05820.1"
FT                   /translation="MDSSKIKQLVRSIFKLNIRQKLILTYVLIVALPLSILQVNAFYRV
FT                   RIMTEKEYINNVNFEVSKLKNDIVKNVEQFIKATQFILNNQEFIEFVSTYQERSIDEIF
FT                   SFKVNVLDKIEYLQYVNFNINRIRFFTNNYFIPEMWPTLYQIERLKSFKFTDRFLSDTK
FT                   QTSLWKLNNTDILGPPLNNEEKVVSLYTKVTDSVGNLIGIIEVNMKVDEFFASELSRES
FT                   DNSVTIVISDDGDVIFSKQTPAFLKRLNISSKKLVEILEKKSTAKKDEGIVHLKINRNS
FT                   AAFVYTHIPVLVIKLYKLILFDELAQKINGITLQMLGQVLILIIASSILIFILITLILK
FT                   KLRQVILSMRAVENGNFDVSIDIKGDDEIDELAQHFLNMVERLKILIGEMVRREVAQKD
FT                   AQIKALQSQINAHFIYNVLENIKMMAEYSENYDVSDAITKLGKMMRYNMSWKKKFVTLK
FT                   EEIENIQNYISLMNIRYDKEIKLLVNVDNEILNIEVPKLILQPIVENAINYGIEPKGEG
FT                   GSIFIDGSIIGNYIVISIIDDGLGIEEEKLVAIQTALENDTEAECYHGQGIALKNVNER
FT                   IKLAYGKEFGIKIDSKFGEFTKVTITLPYTRF"
FT   gene            68670..70217
FT                   /locus_tag="Calhy_0059"
FT   CDS_pept        68670..70217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0059"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: csc:Csac_2550 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: response regulator receiver; Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05821"
FT                   /db_xref="GOA:E4Q9F0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9F0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ05821.1"
FT                   /translation="MRKVLIVDDEKLIRKGIRTILERNVADLDEIKEASNGKEALDLLF
FT                   SEKFDILIIDIRLPQIDGISVLKKIQNLSHKPKIIVISGYDEFSYAKECMQYGARGYIL
FT                   KPVDKKELIEIVEKVKNELQEEENNLRLISLQKIMRAKMFESEINNIIFSGMDIDRFKE
FT                   RLKDMEIPADEKVMAVYFLLPGSNPDQNDFSAEEDKLKLSKILPEGSHVSTIYNQRKDI
FT                   LIFTRTAFCYEDIKKSYESLTGRKVYMGICDLQESFENVKLLYERAYKAAFYSFILSKD
FT                   IEFWSQISWREKEKLCQSDRIEKLKELILAGKQKDAIRFLESIFDHHFFNKYSADSILA
FT                   LSEKLYTQIVDWFCHHVPKKVLDIHEYQVLVSMFNFTTISDYVNHFKKFVVEATEMVSA
FT                   LKGILNVKDEIDEAIKFINQNYHKDINMAMVANHVSLNYYYFSSIFKEKIGMSFLDYLN
FT                   KVRIEKAKELLVNTDLKVWEIAEKVGYKNPKHFARIFKDITGLTPNEYRDAQKRLQE"
FT   gene            70382..75580
FT                   /locus_tag="Calhy_0060"
FT   CDS_pept        70382..75580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0060"
FT                   /product="Glucan endo-1,3-beta-D-glucosidase"
FT                   /EC_number="3.2.1.39"
FT                   /note="KEGG: csc:Csac_2548 carbohydrate-binding CenC
FT                   domain-containing protein; PFAM: glycoside hydrolase family
FT                   16; S-layer domain protein; Carbohydrate-binding CenC
FT                   domain protein; Carbohydrate binding family 6"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05822"
FT                   /db_xref="GOA:E4Q9F1"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9F1"
FT                   /inference="protein motif:PRIAM:3.2.1.39"
FT                   /protein_id="ADQ05822.1"
FT                   /translation="MRAKKFVANILLFAFLIMSIFPGGIAKASSGQIFKDISTNFAKDD
FT                   ITRFYQLDLINGYPDGTFKPAKNISVAEFCKILNSYMGFVQEAPLDVSLRINPLTWYYR
FT                   ELKKAQAAGYLTLFVKEGKLDPSRFVTRQEVFAAVAAALNLDNQKADILNSFSDAQKIE
FT                   PRYLSGVAALISFGFVKGYPDGTLKPEKGITRAEIVKLLSGIGALIVTKPGEYSLSKNE
FT                   GFIIVNSSDVEIKDVSIKGNIYINQSVKDGSVTLDNVTVDGGKLFVFGGGENSVKLVNT
FT                   KVKEVVVDSKLSKTNIELYKNSQAENIIVLSSAKVTQVSDESSIKFITLKQSGNQPADV
FT                   EIKANCEALYVYSPNSKVNIKNSKVKKLVATDLAQNFALSMVSSKIDSVELNSNGSLNI
FT                   DKESGIEKLVVKALAKDVKISSNGKINEASVYSESVVLNGKTLSKGEKVDISTVESKQP
FT                   SSSTALQSTLLAQSSGSTSSTTGSSSQGSTGGGTNQTGNNNQNQQGGNQTQPTWQLVWE
FT                   DDFNGNSIDTTKWNFTIGAGGYGNNELQYYSSRPENARVENENLIIEARKENFEGSPYT
FT                   SAKLTTQGKFSFTYGKVEVRAKLPEGQGVWPAIWMMPEDMNIYGGWPVCGEIDIMELLG
FT                   HEPNKVYGTIHYGNPHTYHGGNYTLPNGQKFSDDFHIFGLEWEPGKIKWYVDGQLYYET
FT                   SDWFSRSSNEAFDYTYPAPFDREFYLILNVAVGGNWPGYPPQDANYFPQKMVVDWVRVY
FT                   KPAGVTYSDNVAKPQESITYPQDARPPLSDGNLIYNGSFDIDSPDVDGIEGVANTDYWQ
FT                   FLHLPDFGGDGTIENIGGSVKINITKPGSQTYSVQLIQRPICLIKGKTYKLTFRAKSEG
FT                   SRTIEVKFSSGGGDNGSTWIDYAVKTFNLSSDWQDYSYIFTMQSSTYAKARIEFNVGLN
FT                   NLPVYIDDVKLVEYDVNDPSAIKEPLPNGNLIYNGTFDQGDGRFTAWEFVKETAADATY
FT                   TIGSKPEERYFKAVIANGGQNFSDIKLVQSNIKVGAGENLLLAFSAKAFESPRQIKVYI
FT                   SDQNFNPITEVKVVSLSLDWNAYKFNLKSIDNLPSDTRAKLVFEIGSSNSDVAIDNVSL
FT                   KKVLPSSFIVVQAEDFGSLTNATNNGQYVAFSQGGVASFSVNIPKSGEYLVSYKLKAGQ
FT                   GSSLKLIVGSTVYDAEVAPTSGNWAVVSDTVYLDSGENNMQLLADNVDLDYIEFSPNFI
FT                   KNGDFSKDLDSWTYWIGNGGSGAAEVSRGQLKVSITNIGLAFWSIQVIQGPMTLESGKT
FT                   YRISFDAKSTSARDMFIKIDDSTYYGHLEKYVPLTDKMKNYTFDFVMDATRSDIRLVIG
FT                   LGTMSPGGANPQTQAHTVTIDNVAIAEVSENCGYFEREVAEILTGEVPSEPQQFVGDKL
FT                   LPDGSFDTPDTINNWHWWSSAGNNVSMSIENGELKLSISSIGSDPWDPQLYREGISLVN
FT                   GKNYKISFKARATYPRKINVAIGKPLTSDPWFIEYMPKKTIDITSEMAQYEIYFAMNNP
FT                   TDLGAKLAIEIGNVAGYSQVPFDIYFDDIQIEVVDSIPQETAPPVQHTQKVGDQIIPDG
FT                   TFDTGVGEWVYWSGDQWSGVSDMQVTAENGKLKVHLNSVGWQPYSAQVARKNLTLENGL
FT                   TYELKFKMSASQATKIQVNIGKELSTDPWFIAYAPTTVFDIGTQDQEYTLRFKVTQPTD
FT                   VTKVVFEFGPINGQYPPLPLDIYLDDVTLTVVSDQ"
FT   gene            75687..78920
FT                   /locus_tag="Calhy_0061"
FT   CDS_pept        75687..78920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05823"
FT                   /db_xref="GOA:E4Q9F2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9F2"
FT                   /inference="similar to AA sequence:KEGG:Csac_2547"
FT                   /protein_id="ADQ05823.1"
FT                   /translation="MQANPKYYYDEKTNSFCIENYQLSKPFSSFLPGIAGIFGIPLWCF
FT                   YVNRGQCIVSFGTKNKDGSILEFLPADRAYRLASTHGFRTFLKLNKNLFYEPFQTENLL
FT                   NFAKSKMSIFADHLEICEENPNIGIKTEVRYYTLPNKNVAGLVRELKIINVSEKPIDIE
FT                   ALDGLALIVPYGKNDFALKNMSRTSEAWNFVENLDKKAPYFRFHSSAEDTTEVVEIKEG
FT                   NFFVSFDNTHGSFERCDVVIDPEIVFGISSEIVKPYEFIFSDRLGISNQVFANKTCCAF
FT                   AYAKRTLKPHEALKLCSIIGHAKSVDEVNHFVDSIDSAEFFDRAFEENKGVIDAILANN
FT                   TIVTSDKKLDEYAKMCYLDNILRGGVPFTIELDDKKDVIYLFSRKHGDLERDYNFFEIQ
FT                   DTYYSQGNGNFRDINQNRRNDIFFNPDVFDFNVWYFMSLIQLDSYNPLVVKGIKYRLNS
FT                   LDPLDKYVKSGKEELKKFFKKDFLPYELIKFLEKQNIEINISKEDFVNCCLVNSEKVIE
FT                   ADPGEGYWIDHFTYNFDLIENFESIYPDKMRQLLLQRKYYYYDNEHYVKPRRERIKIID
FT                   GQIKQHGAYALDKEKQELINSRADKKRYVRTYSGLGDIYTGNLIEKLLVILLNRMATLD
FT                   PFGVGVEMEASKPGWNDALNGLPGIFGSSVCETSELLRLVRMLKKYFEVYLEDVKEIEV
FT                   FEELYSFFVKLKKLLSQMQDREDTLFYWDESNNIKEEYREKTRFGVSGNMACISREEML
FT                   EFLELCNEKLSKAKEKAFDAEKGLFYTYFINQPVEYEYDAQKQEIKIKKFSQKKVAFFL
FT                   ESQVRAMKVIDDKELKRKIYQSVRESSLFDRKLKMYKTNESLANETNQLGRIKAFTPGW
FT                   LENESIFMHMEYKYLLELLKGGLYTEFFEDFKMVLPPYMDPAVYGRSIFENSSFIASSS
FT                   NPDKSVHGTGFVARLSGTTTEFLNMELIMLFGEKTFEYKNGELIFKLSPKLPGWMFTEE
FT                   EREVEIVVNGNKQTIVIGKNQLAAVLFGRTLVVYHNPQKTNTYAQDAKVLKYILHFDDK
FT                   VVEIEGEKVPEPYSYEVRKGMCKKIEVLL"
FT   gene            79003..80772
FT                   /locus_tag="Calhy_0062"
FT   CDS_pept        79003..80772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0062"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: csc:Csac_2546 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region;
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05824"
FT                   /db_xref="GOA:E4Q9F3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9F3"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ05824.1"
FT                   /translation="MIKKLLEKWNDIKLKNKLLIAFVILMLLPMSLIFLLSYTSLKNST
FT                   LEKFTLYNQVLFENATEEVQNFLDELNSIKYDFIMDDNLISDIGKTFARYTNHQDSFLY
FT                   TNILTKMSQFISTKEIIQSVQIINKSKEVYFFSKLQGDVPYESDKQIKEGFFNEIVKQE
FT                   GKYVNSGYDKSRDVYVVGCELFSRDKIQPVAEMIVSFSLDFLKDVIEKYHLTEGGFYVA
FT                   DRSSNKVIFKTTDKFESIIEKLILKDETKLVPKTIFFEETIPDLNWKIIYIVSESSLLN
FT                   NFSYTKRLLILSFSFLAIFAILFLIFISENITAPITRLIYQMRNLEQSKLKNNIKIARK
FT                   DEIGDLLNSFYQMLKRIDELVIRVYEEEIARKNAEINLLYMQLNPHFLYNTLDTINALA
FT                   ELGRCKDVSVVAVSLAKFLRSNMAINNSTISLADEIKQIDHYLTIMKIRFSGKLSYRIV
FT                   YSQEEVLKAEVPRHLLLPLVENSVVHGFKNKNGDAKILIRAKKIENRLKLEVVDNGCGI
FT                   ELAKIEKIKNASNDGIGIPNIIKRLKLLYKEDFDFEIKSKVGVWTKIIIQLPWDKVVKK
FT                   EEKENVHSFDSGR"
FT   gene            80744..81487
FT                   /locus_tag="Calhy_0063"
FT   CDS_pept        80744..81487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0063"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: csc:Csac_2545 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05825"
FT                   /db_xref="GOA:E4Q9F4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9F4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ05825.1"
FT                   /translation="MCTLLIVEDEEILLERLVKTIDWESIGINKVIGIARSEEALNVLI
FT                   TENVDIILTDIRMPIMDGLDLAEFVHSRLKHPLSGYKEFEYAHRAIKLGVVDYILKPFT
FT                   KEEVLETVKKAVEKVAAEQSRQQRLDSCENKNIIDMVFDFIFANCSKQISLNDVAEYVH
FT                   LHPVYLSRLLKNKTGKTFKEILTEVRLKKAEKLLKTSSLKHYEIAEAVGFSDAQYFSQV
FT                   FKKVYGMTPIEWKKQVLENKARLKI"
FT   gene            81579..82883
FT                   /locus_tag="Calhy_0064"
FT   CDS_pept        81579..82883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0064"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2544 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05826"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9F5"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ05826.1"
FT                   /translation="MKKWLKVVALAILVVFSISVVLVGQMGEKKVQGATNELTFWSWVS
FT                   DSDTIKQVYEQAIKEFNSTNKYGVKIKAVYTPGEQYKTKLQTAMAANNPPDILNMWAAG
FT                   KMKPYVDAKRLFPISDIMNKDPQWKNRYVNGVFDLTTFGGKIYGIPQIRVATVIYYNKQ
FT                   IFAKYKLTPPKTWSELVNVIKVLTKNNVIPFALDARDPWILAMYAEYIANRIDPDAYRK
FT                   VQKDPNAWTDKAFIETGKKIQELVKLGAFPKGATSLDYVAARNLFDQGKAAMYVMGIWD
FT                   VGYLSTQSPVKKYVGAFKWPAIEGGKGNINNFLAGIEQVIAVSSNCKNKQAAAAWLKLL
FT                   SEQRYAKDLLAEKAGYFPTVKVNPDPKKVTGLYLEVLNLLKDQNTKDSFTYYDVMFGPI
FT                   IGDGFNNTIQSIYLGKDPVEAFKKLAEIAKKEMKK"
FT   sig_peptide     81579..81653
FT                   /locus_tag="Calhy_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.445 at
FT                   residue 25"
FT   gene            82983..83861
FT                   /locus_tag="Calhy_0065"
FT   CDS_pept        82983..83861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0065"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2543
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05827"
FT                   /db_xref="GOA:E4Q9F6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9F6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05827.1"
FT                   /translation="MERAFGNKLAIAIFIAPALILFTLVIPLPILHSFYMSLFKWDMLS
FT                   TMTYVGFENYKELFSDGIFLSSIWHTIEITVLSLIFQVTLGLFLALCIVNIIKGRKYFQ
FT                   NAFFIPNILSSAVIGILWFFVYNYDFGLINSILKSIGLDSLQQEWLSQKYVILALSITT
FT                   CWQWVGYHMILYIAAISGISQDIIEAAIVDGAQGLKMVTKIIIPQIRPVLRVSIVLIIT
FT                   GSLKYFDMAWIMTEGGPDFASETIATYIYRTAFNKLQYGLGSAASTFLFVVSILVTVLI
FT                   NRFAAKREEVY"
FT   gene            83883..84731
FT                   /locus_tag="Calhy_0066"
FT   CDS_pept        83883..84731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0066"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2542
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05828"
FT                   /db_xref="GOA:E4Q9F7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9F7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05828.1"
FT                   /translation="MFAKYIKLSPVAKAIIFAFLTFYSILTLFPLIWLVYNSVKTNNDF
FT                   LANPFGLPQLSKLQLKNYYDAWVTMGIQRFTINSLIISSVSVIFSLIISSMAAYAIERM
FT                   IWRSSQKVLNYFLAGIMVPIQIILIPLFINFKKLNLLDSRIGLLIPTVAFALPTSIFIL
FT                   TGFYKTIPHELEEAALIDGCSVYKIFYKIILPLTMPAFVTIAVFNFLGAWNDLLIPLVL
FT                   IQTPELMTLPVGLLNFRGMYGAELTKMFAAVVISAIPSIIIYFVLQDKLLKGMIAGAVK
FT                   G"
FT   gene            84944..86365
FT                   /locus_tag="Calhy_0067"
FT   CDS_pept        84944..86365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0067"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: dth:DICTH_1903 putative sugar uptake ABC transporter
FT                   sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05829"
FT                   /db_xref="GOA:E4Q9F8"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9F8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ05829.1"
FT                   /translation="MNRLFYLRNWRIVGIVTALIFLAGIVLGIALISSKPAKAVASQTV
FT                   SIRVGIWPLDNDEAGKKAWQKYEQNFKKKYPNIKLIPDPYSYSPETFLPKAESGDLPNI
FT                   FYTWFTEPRKIIPAGYAADITTYAKKYGYDKAINPDVLKLLTYNGKIYGIPRDGYALGL
FT                   YLNMNLFKKAGLVDKNGLPKYPKTWDELRKTAQIIKQKTGKAGFFMPSKDNVGGWHFTA
FT                   IAWSFGAEFEKKVGNKWVQGLDSPGAVAALQFIKDLKWKYNVLLPNTLLSWGDWIKYYG
FT                   TDQVGMVLAAPDVINLPVQDYKMSKDAIAIVPIPKGPKGQYTLMGGTAIMFSSNSTPAQ
FT                   IDACFKLLEVIGMSPKVNKETLNAIEISLKEKAAQGLPVGPRALPVWINKERVQAEDAI
FT                   YKKYTNVNMALFKPYYDEAFKHLKPEEPYYTQDLYRILDGCIQQVLTNKNADPKKILQA
FT                   AGREFQTKFLDKVKE"
FT   sig_peptide     84944..85063
FT                   /locus_tag="Calhy_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.648) with cleavage site probability 0.592 at
FT                   residue 40"
FT   gene            86486..87385
FT                   /locus_tag="Calhy_0068"
FT   CDS_pept        86486..87385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0068"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dtu:Dtur_0174
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05830"
FT                   /db_xref="GOA:E4Q9F9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9F9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05830.1"
FT                   /translation="MNKKMSGKLSNRLSENISGWLILAPSIILFTFYIWEPMIYSLVLS
FT                   VHETKGFRMERFVGLQNYIDVLKDNVFHQALINTFFYVIWSLIIGFLVPIVVALIINEM
FT                   VHLNSFFRFSIYFPNMVPGVAALVLWGFLFDPSEGGLLNAIRIKLGLQPSDWLQNPKLT
FT                   IPLLIFIMTWKAAGSTALIYIARLQGINQELYEAACIDGAGIFRRIVHITLPELYSTAR
FT                   MLLIMQIIFVFQVLYEPLVLTGGGPNNASLSLMLLSYNYAFVDFVAGKSATVSVLVTLI
FT                   LMCLTFIYMKATKENNNV"
FT   gene            87411..88289
FT                   /locus_tag="Calhy_0069"
FT   CDS_pept        87411..88289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0069"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dth:DICTH_1901 integral
FT                   membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05831"
FT                   /db_xref="GOA:E4Q9G0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9G0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05831.1"
FT                   /translation="MSRLDSKTSGIINFLDLRKPSVKALYYILLFISCCIAFVCLAPPL
FT                   WVFLSSLKNIKEFAQVPPTIIPHTFEPQKIITTWKTLNFTKYYINSFILVAGSVVCAIV
FT                   FNGLAGYVISIIKPRGYRFVFNLILWSLMIPATINLVPIFKNIVALKLNNSYIPLWLSY
FT                   GANAFYVLLFKNFFDEIPREIIEAAKIDGCPNLRLFYKIVMPLSVPIIMVVTIFSINAS
FT                   WSDFLLPYIVLKNRESYTVMIKIYEMSFGNTWMSADMKMLAVLYAILPPVVLVIFFQKY
FT                   LTQGVVIGGLK"
FT   gene            88346..90643
FT                   /locus_tag="Calhy_0070"
FT   CDS_pept        88346..90643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0070"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: cpy:Cphy_3314 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05832"
FT                   /db_xref="GOA:E4Q9G1"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9G1"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADQ05832.1"
FT                   /translation="MINKKGSRYVKVDPWCIIEENFDKSNMRVLESLFTVSNGYIGTRG
FT                   YFDEFYTGDTHIGTYVAGVFEEIYEKPSYKGVPNRTQFVVNNANWLYTRIIADGEELDL
FT                   NHSNFSEYKRVLDLKKGILTREFIWHTEKGSSFKLKFERFISMTKSNVCCQKIEITSLN
FT                   KSGKVKIISGVDFSHKHRIYDTNYWEGLFKSNENDYISIGCKTIKTNKISIANFKIEAN
FT                   KACEQGIVEGEKIIAKEMVFDIEENETIEIEKVVVINSFDRLNENLQSKNGKLCQSVFG
FT                   QYSYSKLKQEHERFWERMWEEVDIEIGQDSENQQGIRFCIFQMLQAYSGMQQVVAGIGA
FT                   KGLSGEVYNGNSFWDSEVYCLPFYLFTNIDAAKKLLEFRYYTLPQAQQRAKELDLKGAF
FT                   YPIATIDGTESCTLWQHANLQLQVSTAVAYGLYHYYIVTKDEKFLFEKGTEILIEVCRM
FT                   LESRCQLGQKDGKYGFFGVMGPDEFHMMVNNDFYTNYMAKKSLEFTIEVLKLLKAKDEK
FT                   LYNEITRKTKLERNEVERWADIAKNMKIIQDPQSKVFEQHEGYFNLPHIELSTIPEDQI
FT                   PIYKNWAYDRIFRYDMIKQPAVLLCMLLYSCDFSFEEKKANYDYYDLRCIHESSLSPSI
FT                   HSILACELGYYDKAYEYFRYATRLDLDNYNRNTEEGLHITSLAAAWLNIVYGFGGMRSD
FT                   TAPIKLAPIIPDNWSYYSFRIKYNGAVLKIVVDPQYVTIKKLKGADVELMVYDKTYTIT
FT                   EDEIKIPLQKRR"
FT   gene            90646..92931
FT                   /locus_tag="Calhy_0071"
FT   CDS_pept        90646..92931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0071"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: cpy:Cphy_1874 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05833"
FT                   /db_xref="GOA:E4Q9G2"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9G2"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADQ05833.1"
FT                   /translation="MILSWRISKEGFNPSSIELDGSRFLIANGYMGYRGTLEEFGKNEL
FT                   VACTVAGVYDRYDDKWRELVNVPNGLFVKVYYNNTLLSPMTFQDCAHTYGLDLKDAYYF
FT                   RNTKFFVDKEKWIRIKTKRFASSTDYHLLCLEYSITANFDCEIGIETGIDCDIWEINGP
FT                   HFKEMSFQNLDGIYVTHLITNEGKNLVVAETADHLDNFINEEYLRLYVRKSKVKLASDK
FT                   EFKFYKYMCVTHSLEFEKPFDEAIKRINEAKNLGFDYFFEKHRERWQERWSICDISIDG
FT                   DEKAALSLRFSMYHLLSIAPYHSEKLSIPARGLSGQMYKGAIFWDTEIFMLPFFSYTLP
FT                   DVARNLVMYRVHTLDGARRKAKEYGFEGAFYAWESQETGDDACSLFNVTDVITQRSIRT
FT                   YFRDKQIHISGDVVYGFFTYYNATGDFSIFLEGAAEAVFECAKFYYSYAYYKPLKDRFE
FT                   ILDVTGPDEYHERVNNNAYTNRIAKFTFEKAIWLYDILKEKYPNILQEIDSKTCISQYI
FT                   EKIKEAEQKMFLQKPNEEGIIEQFDGYFKLEDIEVEKLKDKMLHPYEYLGGGNGLATQT
FT                   QVIKQADVVVLLNLFESEYEKEILKANWEYYNRRTEHGSTLSYSMYGLLAAKLGKLKDA
FT                   YEYFLKTALIDLEGNYKQYVGNLYIGGTHPAANGGAWMAAVFGFGGIRVEGTKVEIDPH
FT                   LPAHWKSLRFNLIIHGNLFEFEISNSKILIKSTRLKDSKNRSYRIVANKSEFIHEIGQL
FT                   LEINLKGE"
FT   gene            92936..93604
FT                   /locus_tag="Calhy_0072"
FT   CDS_pept        92936..93604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0072"
FT                   /product="beta-phosphoglucomutase"
FT                   /note="KEGG: cpi:Cpin_5088 beta-phosphoglucomutase;
FT                   TIGRFAM: beta-phosphoglucomutase; beta-phosphoglucomutase
FT                   family hydrolase; HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05834"
FT                   /db_xref="GOA:E4Q9G3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9G3"
FT                   /inference="protein motif:TFAM:TIGR01990"
FT                   /protein_id="ADQ05834.1"
FT                   /translation="MVPIKVLLKRIEGAIFDLDGVIVDTAKYHYSAWKKLANMLGFEFT
FT                   EKDNEKLKGVSRKESLEILLKIGGKENEFSEAQKEELMDIKNSWYLEYINKLTEDEILP
FT                   GAKELILTLKEQGIKTGLATASKNAMLILERLNIKDLFDAIVDGTQISRAKPDPEIFLK
FT                   CAQKLKIDPQKCVVFEDAAAGIKAAKLAGMFAVGVGSCDMLGEADIVICSLDQLIKELK
FT                   "
FT   gene            93656..95650
FT                   /locus_tag="Calhy_0073"
FT   CDS_pept        93656..95650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0073"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: cth:Cthe_1307
FT                   cellulosome anchoring protein, cohesin region"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05835"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9G4"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ05835.1"
FT                   /translation="MIKKLCSLILIMVFLFSSFPVAFADIRVETPYMEYQGDTLKFYST
FT                   VESDIYGELSIGDEVLVSVYAIKEDGNSILLGQGKIVILDVYQDQTDGKVYYNGSNYNL
FT                   IETSIPVSSALLTNSSKIKFYTATLNKITNTSNSSYSIFALPPIILPNPASVDKTALGN
FT                   ADLELSMYLPTSVQISKIVKAATQTELKKDIDYVVSNNKLYFKNTYVKNLSLGQNEFEI
FT                   YDNFGNITILKINVTESAHVPSNQQGSTPSQSSGSAATNAGSNQQGSFQQQPAEDRSKL
FT                   ESPIQLSVDENLNTANATVDKDTISKLLLSQKVEETKKLVLDVKAQENISTYNMNLPKD
FT                   TLQVLSDKVESLKITTPVCSLELNKTLLQDIKDKEVSVKVSNKTENIAESVKQILGQKP
FT                   IVSVQITAGDAKLESLGKSAVKLEIPYKPSAIEKENTHKLVGVRIDGDNIVTLKQSFYS
FT                   AQDGHFVIFTDHLSDFSLLYRDVSFDDAFYSYAKKQIEFLATRDVIKGVGKNKFMPKNN
FT                   ITRADFVTLIVRAFGLEARVDSNFDDVLPSDYYYQTVGIAKKLGIVNGVGNNKFEPKKN
FT                   ITREDVMCILARTLKVLGLLITNVEPEKVLGKFNDAEQISSYAKDAIAQLVNAQIVSGY
FT                   NNMLSPKRNLTREESAVLLYNIYQNILLR"
FT   sig_peptide     93656..93730
FT                   /locus_tag="Calhy_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.942 at
FT                   residue 25"
FT   gene            95683..99768
FT                   /locus_tag="Calhy_0074"
FT   CDS_pept        95683..99768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0074"
FT                   /product="Carbohydrate binding family 6"
FT                   /note="PFAM: Carbohydrate binding family 6; KEGG:
FT                   pjd:Pjdr2_4054 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05836"
FT                   /db_xref="GOA:E4Q9G5"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR033801"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="InterPro:IPR041342"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9G5"
FT                   /inference="protein motif:PFAM:PF03422"
FT                   /protein_id="ADQ05836.1"
FT                   /translation="MKRRLVSIITILIQLLSLIAYVPAVHAQGLPDLIVTDITWQPANP
FT                   QAGDKVLFSVTIKNVGDAPTPSGVVHGVGFHIDNDYTRFWWTDNFTGPLQPGEEKTLTV
FT                   TGGMGGPDRNLPTWDAIGGRHTVWAFVDDYDPNPGDDITGRIKESNEDNNVFGKEILVT
FT                   ASSSGPRIVRIKSAWTGQYVYQAGDKLEYSYDIPAEDARSQWIIEEFEGSIRIKNRATY
FT                   NYIHIENYDSKKYVECGNIDDSWYSARWVLEEAGGSYRIKSAYKNTQYLNIEGNPGHVV
FT                   LSEVYPEWDSAKWILEDVDITQDYTAPLPDLVIEDVYWEPANPQEGDDVLFKVKVKNIG
FT                   EGAVQQGEQIAAGFNVDGKAPWFWTDLYTGGLAVGQSIVLPVIGGTEGKYWKAKSGIHT
FT                   LYCNVDDYDPDPNDDKVGRVKESNDNNNSFHKRLPYIPKAQPKEEPLPLICGAVYVGGK
FT                   LNVAKDVYHNDTRAENKVKQIREKFNNLKNNNNVDASLFDELAKYKIEKVVVGTPNPAN
FT                   TKPSKFAMYWDENYLYAVVRVYDAAKRKDAPDPGQIWNNDSVEIYLDMDRNKEDSYTSD
FT                   DFQYFFGWNYEQPMEFKHNAIQNVRFTQHDFDDGYGMLIEIPWTTLGVSAQKNMVFGFD
FT                   IAIDDNYANQTRGCQYIWNSKDDQAWQYPNRFGDCQLVLGLGTPKQLPPQQKQQAQKPE
FT                   APPYQVPAGIGASVPWIELEAESASTNGDIIGPSYEVNDEANEASNRRFVRLDQVGEYV
FT                   EFTVPSEVNSIVVRYSIPDSDDGKGIDATLSLFVNGQFRQKLNLTSRYSWVYGAYPWSN
FT                   DPSFGAPRYYFDEVRALIGQVNPGDKIRLQVDSGDDSPYYDIDLIDIENVPPPLTKPDN
FT                   FLDIRDFGAIPNDGKDDTKAIYDAIFAAKQQGKGVWIPEGVFEKLEGPVVDNVYSGFSG
FT                   TGYVKGFDVIGATEKLLITGIPSDGNNTMEIRYSNATNTNQTLSFIVNGKRYEVSLPPT
FT                   GSWDSWQTATIDVALNTERNLLQIIHQYEDTGNIYLDYVKVNTTLFEAEDGWLTCPIYV
FT                   DNVTIRGAGMWYSTISGPYSQFVLMGNNCKFYDFAIFGETNSRIDELDDNAFSGWGGTG
FT                   SVLENIWVEHKKCGFWVGNSKYGRTDGLVIRNCRFRNLMADGVNLCDGTINSIIENCHA
FT                   RNTGDDAFAIWSATYNQNVWACENNIIRNNTVQQPWLAQGIAVYGGSNNIVENNLIIDV
FT                   PTSAGILISTTFPCIPFSGITEIRRNSIIRAGEPSGKLGAIRIMSDQQDISGIAIKDLD
FT                   LYDCTDVGIRFMGTKQANGIVFENVRINYTGSYGIYASGETKGTVIFKNVTIDNTALEK
FT                   VMIETPNMNVQKLEGNNW"
FT   gene            99899..100906
FT                   /locus_tag="Calhy_0075"
FT   CDS_pept        99899..100906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpe:CPE0369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05837"
FT                   /db_xref="GOA:E4Q9G6"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9G6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ05837.1"
FT                   /translation="MYKSIKYRITLVTSIIFIGFILLVAMASNFIFKDFLMDYYYQLLQ
FT                   KNDQSIINNYKIYVTLIEESAKQIGTNSKVFDLLKNNNTEGNITEILDGIKLSNTRILA
FT                   VILYDTNGRYYTSSYVVDYPTLSELLKDKRIKEFVANDKKQSLWLIRNRGLAPYYNNTY
FT                   YKSAYGVVSFISKIYDENKRLCGYLVIDIDPKYFYQRHFGVSDHADISVYLYDKDIGLL
FT                   PRQDEQTQTLLKLSSVIKNRKIDTNTLKKENSLIRIDDNTLLDIVRIFESGYIVILYDI
FT                   SEFGRDILTYTILIVIVSSLLIGMSFLSSTILTQTIYKPLINLVDKIRKYNYSS"
FT   sig_peptide     99899..99982
FT                   /locus_tag="Calhy_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.956 at
FT                   residue 28"
FT   gene            complement(100909..102642)
FT                   /locus_tag="Calhy_0076"
FT   CDS_pept        complement(100909..102642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0076"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: csc:Csac_2533 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: histidine kinase
FT                   internal region; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05838"
FT                   /db_xref="GOA:E4Q9G7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9G7"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ05838.1"
FT                   /translation="MKINFLRIFKLKSRITFFLVLGIVIFTFIIISFSRMFSEFIIQKY
FT                   YYKHLKDIHSDIQEGIYLLLTNINLTSVRLLQNQDIYDLLSNTNLSYNEKEKKLTTYLN
FT                   TLGINDYIGDIVIVTKKGEVFNFNTKVNPSLFITKELLSHIEDRRNLFVWGPVVKDNGN
FT                   NYIVLGKRYYNFYTGQYLGYLLMLIDENSIAKICNKSKSSDIVSTLVIDQQNKIISHPE
FT                   SKYVGSIIFENWLSDAKKEFSYSLRTINEGQFLVAISRPSENLERLNCRWFIVSLLPLS
FT                   NLKEQLTKINVVIIWLVLITLILCVIIAIKAASSLTNPIRFLLNRINSIGQTKNVKPYI
FT                   YKNLHDEIWELELAFEEMTKRISNLVETINHDMEKQRELELTALQSQINPHFLYNTLDA
FT                   IAWIAKIKKQPEIENIVMALAKFYRISLHRGEKYIRLSDEIELVKNFVAIEKIRFPNKF
FT                   DIEFEIAPETMDMKILKFTVQPLVENSIKHGILPKKEKGLIVVKSMLVNEDLHIEVSDN
FT                   GVGFDPSELDNLSKNSRGGYGLKNVDERLKIEYGKEYGLFISSEKNKGTTILIKIKAKS
FT                   E"
FT   gene            complement(102632..103912)
FT                   /locus_tag="Calhy_0077"
FT   CDS_pept        complement(102632..103912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0077"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: tex:Teth514_0399 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05839"
FT                   /db_xref="GOA:E4Q9G8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9G8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ05839.1"
FT                   /translation="MMIVDDEYYVKEGLKQTIDWAKYQIEIVGEADNGEDALNLAKTLN
FT                   PDIIITDIRMPILDGVEFMKKLRENEINSHLIVISAYDDFEYARAAIKYGATNYILKPI
FT                   DNNELIETIQKVIKKIESERNFIDSYNSFKNNISALKVNLLREIVYGKISDSRLIKETL
FT                   SYFKIDSNNIMVITIRITNYEKSALTANEHLRMLKEYINSQILKNVFARISNGGICLEK
FT                   DEDEFVIIIGLDGDTDTLYEQLKNEFCYLMKKINRKFQNDNFTVAVGISDVHLWDNISK
FT                   AYREATFASNYSPLPELNIIGCARDKDLIGIRKEVKDALKMIVENYNRDITIDEVANKL
FT                   HISTSHLMHLFKDELGKTFYDCLVEYRISKAKELLLSTNLKVYEVAEKVGYQDAKYFSQ
FT                   LFKKYTGYTPKEFVDYHTFAGELKDEN"
FT   gene            104106..105386
FT                   /locus_tag="Calhy_0078"
FT   CDS_pept        104106..105386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0078"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: gym:GYMC10_2443 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05840"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9G9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ05840.1"
FT                   /translation="MKNFKKILALVVVIVFMVSLIGMLDSTGVDAKTAEKVKIRAVTYF
FT                   TGADPWTNTWKEVIKDFMKKNPNVEIIDEATPTTNDAIRTKIKTDFASGNEPDVTFFFV
FT                   GADAEPLLKSGKVFIWDNELKKDTKWSSNIYKSALAFTTYNGPIKEYKGKVYAIPTIGF
FT                   YEGLYVNVDLFKKYNLPLPTDWNKFIKAVNTFKSKGIIPIAGSILESYYLIETFILSAG
FT                   GPQGRNTPFHPSWEKGLNIIKDLYKMGAFPKDALTLQDSQAQALFADKKAAMMINGSWC
FT                   VGGLKDKVNTKIMPVPVVPGGKAHPTDIIGGFGSGWYVSKDLNAKKNGWPVKFVKYITS
FT                   PEVEAKFIAVGGVPAIKCKVPNVTPVAQSGYDMMAKANSVSMPIDAQILPEAFTKIRTD
FT                   LAYVVTGKKTAKQLLAEAKKIQDRVKK"
FT   sig_peptide     104106..104201
FT                   /locus_tag="Calhy_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.503 at
FT                   residue 32"
FT   gene            105491..106363
FT                   /locus_tag="Calhy_0079"
FT   CDS_pept        105491..106363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0079"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gym:GYMC10_2444
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05841"
FT                   /db_xref="GOA:E4Q9W6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9W6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05841.1"
FT                   /translation="MQILKNKKYAILLLFPALILVGVFIYYPLFATFYYSFFDWRDFSN
FT                   YKTFVGLDNYRQMIEDYAVRKALVNTLIMMVCVIVFQVGIALVLALIVDSIKAGYKFFR
FT                   TVFFFPVVISGTAIGLMFYLAYGYDYGLLNAIATAFGGQKRVWVTENSALTMVLIPVIW
FT                   QYVGFYFVIFLAALSKVPQDIYESALIDGITGIKKAVYITIPLIWDVIAVCISLAIVGT
FT                   FKVFDIVYVITGGGPMDASQVLGTYLYKVAFTGQNQGYASAIGVLIIVLGVILSAISNK
FT                   LTERETITY"
FT   gene            106384..107229
FT                   /locus_tag="Calhy_0080"
FT   CDS_pept        106384..107229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0080"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gym:GYMC10_2445
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05842"
FT                   /db_xref="GOA:E4Q9W7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9W7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05842.1"
FT                   /translation="MSGMTKKFSFADVIKYLILVLWACTTILPLLWVLNNSFKESNEIL
FT                   LNPMKLPSKLSFFNYSQLISYGNMNIFRGFLNSLIISGSVVLLVLLFGGFAAYVIARFD
FT                   FKLTGIVKIFFTGAMLVPAFSIVIPSLVILRKLGLNGSYLALILPQTAGLLPFATLTLA
FT                   GFMKTLPVELEEAAIIDGAGVLRIFFRIIVPLSIPGLVTAAIFVFLWSYNDLFMSLIFI
FT                   PIREKQPICVLLSLVSSIYGTNYGAMMAALIITVLPVIILYVFLQEYVIKGMTAGAIKG
FT                   "
FT   gene            107294..108331
FT                   /locus_tag="Calhy_0081"
FT   CDS_pept        107294..108331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0081"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="KEGG: dtu:Dtur_1620 glutamine--fructose-6-phosphate
FT                   transaminase (isomerizing); PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05843"
FT                   /db_xref="GOA:E4Q9W8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9W8"
FT                   /inference="protein motif:PRIAM:2.6.1.16"
FT                   /protein_id="ADQ05843.1"
FT                   /translation="MHKMLKEIYEQPSVMKRCFESNVEIIRLIARNVKDRNINNIIFVA
FT                   RGSSDNAATFGKYIIEILSGIPAGLAAPSVASLYKKNLQLEKTCVIGVSQPGQSEDICS
FT                   FLDMAKANGAMTIAITNNPSSKLSLIAEYKLNMNVGIEEAVAATKSFTAEIVLLELFAA
FT                   FLAEDDKLVFDLSNIENIFEEVLGKEEIIRENIERFRYMNECFILGRGVSFPVALEFAL
FT                   KIQETSYVRAKGFSTSDFRHGPLAMIDKNIPVFIIAPVDETIEDNIEIAERLTKEGIDI
FT                   ITFSDSDKLNKKACKYVEIKKDLNKFIKPLFVIPLIQLFSYYLCVLKGNNPDKPRHLSK
FT                   VTITK"
FT   gene            108419..109207
FT                   /locus_tag="Calhy_0082"
FT   CDS_pept        108419..109207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0082"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: cpy:Cphy_3861 two component AraC family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain; response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05844"
FT                   /db_xref="GOA:E4Q9W9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9W9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ05844.1"
FT                   /translation="MKKVVIVDDEEIIREGLKTFVNWKKLNYEVVALAENGTEGLYIVE
FT                   KYKPDIIITDIRMFGLNGLEMIKEIKKKNKKSKIIIITAYRNIEYAQEAIKLGVFRLLF
FT                   KPAKTDEIEKAVQEAIEEMEYERITDDKEALRQCVLQVIKRQKNEGEEKPLSFMASKIL
FT                   SYLLENYYKEISLQELAEEFYISHWHLSKLIKKELGLNYTDLINIIRIEQAKRLLAIPR
FT                   YRVNEVGSMVGYNDNTYFCRVFKKLTGMSPQEYRNKYFVN"
FT   gene            complement(109243..111018)
FT                   /locus_tag="Calhy_0083"
FT   CDS_pept        complement(109243..111018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0083"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: cce:Ccel_2114 putative sensor with HAMP
FT                   domain; PFAM: histidine kinase internal region; histidine
FT                   kinase HAMP region domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: histidine kinase HAMP region
FT                   domain protein; ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05845"
FT                   /db_xref="GOA:E4Q9X0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9X0"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ05845.1"
FT                   /translation="MKYIKSLFRLTSIKFKLLLALVVITCIPTLILGYIGYLKYTEILK
FT                   DKFLKSQEVNIIQISSIIEYYTQNIYNFTQEVLYDNSIYNFYKALIDRNDDSELFDYIF
FT                   KKDFEGYLNSLLLSRNDINLIAFNFSVNNSLYYVSRENEKLESLDVCTIYQKAKITAGK
FT                   PIIYVKPINKFYSDVYIGRIVYDRNTLDEIGLLIIKMNLNKMYDSITTLKIKNYDAIAF
FT                   AYRDKLIYVNFSNSTNLTGLEDLIVKQHKFELSSKFKNNYYFVKSDVPISGWTCYMFFS
FT                   KKFLLNEINLVSKTLFILFIITVFLSLLLINYIYLDITSPINQLIKYMKKVENGEIQIK
FT                   IESNRKDEFGYLISSFNRMTEKINHLINQVYKARLIAKDAQIKALQAQINPHFLFNTLD
FT                   VINWKAKFLGAEEISEMITALATLLEYSINREDSTLVSLQRELEYIDSYIFLVCKRNNH
FT                   LRNLNFIKDIKGNDLLNYKIPFMTLQPIIENCIKHAFDSSIKDPTILIEIQEYNNNLII
FT                   KVKDNGKGIEPEKLAHINNKLNKIPDFSEKDSCGIGLLNVHRRLRLLFGNQYRLLLNST
FT                   VGSGTEIILTIPASK"
FT   gene            complement(111150..112565)
FT                   /locus_tag="Calhy_0084"
FT   CDS_pept        complement(111150..112565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0084"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; KEGG: vex:VEA_002577
FT                   GlcNAc phosphomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05846"
FT                   /db_xref="GOA:E4Q9X1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9X1"
FT                   /inference="protein motif:PFAM:PF02878"
FT                   /protein_id="ADQ05846.1"
FT                   /translation="MIKFGTGGWRAIIGDDFTKENIQKVAQAVSIYMKEKGIDSDGIVL
FT                   GYDRRFLSDKAARWFSEVLSANGIKIFFINKVAPTPLVMFTVKKLNTKFGATVTASHNP
FT                   ADYNGIKLFIEEGRDAPLEVTSEIEAIANSLPSDSIKRLKFEKAIDNGFIEIIDPFDDY
FT                   IDAILSMVDIEAIKKRKLRILLDPMYGVSRTSLQTILITARCDVDTIHERHDTLFGGRL
FT                   PSPTTSTLYRLKHLVVEKGYDLGIGTDGDADRVGIVDEKGNFIHPNDILVLLYYYFLKY
FT                   KGWKGPAVRNLATTHLLDRIASSFGEKCYEVPVGFKYISAKMEETGAIIGGESSGGLTI
FT                   KGHIKGKDGIFAATLLVELICKTGRKLSEILEEIQRIYGVLYMEENDFSLEPEEKEKIW
FT                   EILFDKKHLPDFPFEISNVSYIDGVKVYFKNGGWVLARFSGTEPLLRIYSEMDDKEQAQ
FT                   EVCRIFAEFLNLR"
FT   gene            complement(112605..115004)
FT                   /locus_tag="Calhy_0085"
FT   CDS_pept        complement(112605..115004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0085"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: glycosyltransferase 36; putative carbohydrate
FT                   binding; glycosyltransferase 36 associated;
FT                   alpha-L-rhamnosidase; KEGG: cpy:Cphy_3854
FT                   glycosyltransferase 36"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05847"
FT                   /db_xref="GOA:E4Q9X2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037828"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9X2"
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /protein_id="ADQ05847.1"
FT                   /translation="MRYGYFDNQNREYVIERPDIPVSWTNYLGVKDMCTVISHNAGGYS
FT                   FYKTPQYHRITRFRQNGVPLDRPGHYVYLRDDETGDYWSISWQPVGKSLSIAKYVCRHG
FT                   LSYSKFICDYNNIHAEQWLFIPLDDAVEIWDVRVKNTGISRRKLSIFTYAEFSYHHIEI
FT                   DNQNLQMSLYASGSSYKDGIIEYDFFYIPDMYHFFASNFEPDSFDCVRDIFIGNYRTET
FT                   NPIAVEKGMCSNSEDLTGNHCASLHKRFILEPGEEKRFIFMLGVGDRNKGREIKEKYSK
FT                   FENVDNSFYELKKYWDDKLSVFQCTTPHEGLNTMINIWNLYQAETCVVWSRFASFIEVG
FT                   GRTGLGYRDTAQDAMSIPHTNPQKCKQRIIELLKAQTSEGYGLHLFEPEWFEEDDTPKP
FT                   KFKSPTIVPKPKKDSIIHGIEDACSDDALWLIPTISEYIKETGEIEFLDMIIPFADKGQ
FT                   ASVYEHMKRIIDFTAKHVGPHGIAKGLRADWNDCLNLGDGESAMVSMLHYWALQSFIEI
FT                   ARYLGKREDVEKYSALAENIKKVCNDVLWDGRWYLRGITANGLKIGSNECEEGKIYLES
FT                   NAWAVVSGVADYERGISAMDAVYEYLFSKYGLHLLHPPYSKPNDEIGFVTRVYKGIKEN
FT                   GAIFSHANTWAWVAECKLGRGSRAMELYNALLPYNQNDIIEIRESEPYSYCQFVYGKYH
FT                   KSFGKARHPWLTGTAGWAYHAVTHWILGIRPTFDGLVIDPCIPSNWDKFEVIRKFRGAT
FT                   YKITVHNPNRVEKGVKNITLNGKDLEKNFVSVQPKGSINEVIVVMG"
FT   gene            115255..116223
FT                   /locus_tag="Calhy_0086"
FT   CDS_pept        115255..116223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0086"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   csc:Csac_2540 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05848"
FT                   /db_xref="GOA:E4Q9X3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9X3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADQ05848.1"
FT                   /translation="MEFRTLKESELEKWFYHCASVFGENRNLDFWLDYFKRHYFNDPFR
FT                   DINSIFVAADGSSIASTVRLFYRKIYFHGKEITVGGIGEVSTKPQYRGMGLASKLLRMA
FT                   IDTMREKKLSISILFASLHNFYGKLGYKVLTREFCLLDRNIFRKYYESKVAQAREVKEI
FT                   KLSDNDIEIMDEIYKVYSANFNGPVVRNREYWLNWVKFEPKTSLGYFIDGRLAAYLFYR
FT                   KNGKEVIILEYGCFDSSNKEIPLIEFIKFIINNENAEAIKYPKAIGLELTGCTEFKDNS
FT                   LMLNLITPFKLEGLLVDSTERLISILTREPDKFLFWGTDNF"
FT   gene            116264..117907
FT                   /locus_tag="Calhy_0087"
FT   CDS_pept        116264..117907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0087"
FT                   /product="Glycoside hydrolase, family 20, catalytic core"
FT                   /note="PFAM: Glycoside hydrolase, family 20, catalytic
FT                   core; KEGG: csc:Csac_2539 glycoside hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05849"
FT                   /db_xref="GOA:E4Q9X4"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9X4"
FT                   /inference="protein motif:PFAM:PF00728"
FT                   /protein_id="ADQ05849.1"
FT                   /translation="MFKIVPKPKKLDFTGKWFDFDGFENFPDFISREFSIPKGSWKIEI
FT                   VERPGTGISIEDKKVKVWGNVNVAYATLVQLLIQRKDALPQVTVEEEFRFSFRGFHLDI
FT                   ARGGVPSFSTFKNILRWLFLLKYNYFAIYFEDLFLWEKHPKIGAGRGRLTKEELKEIIE
FT                   YGKNLGIEVFPSLELTGHMENILSIPEYSKYSEWYLPREGCLDLSNEEAKKFAYELLEE
FT                   VLEFFPSKYVHIGGDETWALGRGKSLEKNWIFEGPKLYEEHHKNMIDIVEKYGKIPIMW
FT                   GDMLTGMFLKPNEKQVWGKLLQSDIWQRVILANWDYAAMPKEHFINRIESFGDKYQSNQ
FT                   IVCPGFSNWDRFYPDFEVAIENIKNFIDAAKTKGFQGFLVTAWGDDGEECLFSFLYPLL
FT                   IATIELAEGDGKWEESFIILSGESEKLLDVRKVFGTSKIANNIKGLLYGNKEVVQMGTS
FT                   EEQGLKRYFEEALQKVIGVNLPEDLAFIRQAIRVAIKRLENTVTAADLIELGSYYCRLW
FT                   RKERKKEGLDRIVERFWAAAGKVSLELEES"
FT   gene            117933..119078
FT                   /locus_tag="Calhy_0088"
FT   CDS_pept        117933..119078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0088"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /note="KEGG: ate:Athe_0096 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05850"
FT                   /db_xref="GOA:E4Q9X5"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9X5"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ADQ05850.1"
FT                   /translation="MRKKFLVKKIFNGHSFIEDNVLVVEDGIILGTQEGIDTGKDEIID
FT                   RRDFILSPGFVDKHTHGIGGVDFFDTTENDLKTIQNYYFKHGVTTIVPTIVSAPFENIF
FT                   KLTKAIKEAKKDPNFKLNIPGIFLEGPFINPAKKGAHDERFLQRPTAEKLEELSSNCEE
FT                   KIIDIALAPELLENPNEFISKAAERGINISLGHTESSFEQAAQAHMLGAKSIVHLFNAM
FT                   PQLHHRQNSITTYALLSSIKVELICDFIHLSPEIIKLTYKLKGPESIIIISDSISATDL
FT                   SDGEYSLGALDVKVENGICKLADGTIAGSTLTIDKAVKNLIKIGIRLEDALQAATYNPS
FT                   RLLSLECGRVKEGFRADFVLMDEDLNIKEVYIGGELVYKAQ"
FT   gene            complement(119084..120673)
FT                   /locus_tag="Calhy_0089"
FT   CDS_pept        complement(119084..120673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0089"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: csc:Csac_2518 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05851"
FT                   /db_xref="GOA:E4Q9X6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9X6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ05851.1"
FT                   /translation="MTKLLIADDEPEVIEGISTLVDWENNGIKIVGCATNGEEALEKIR
FT                   MLCPDIVLIDIKMPKLDGLQVIENAKKEGYIFESIILSGYDDFYFAQKALELRSLNYLL
FT                   KPCRPKEVLDAVLKAKNVLEKEREKEALINRFIEYYNETLPILKERILNEVIFGIRSKE
FT                   EIEKLFERYNIKLSSGKYCVVLAKFDIENASDTYPSSPVKQEAYTLACVNLIQEELEDF
FT                   RAEVFRGRNEIVILINSDFEFDREMMDDILTKVKKIVDEKLGLKLYFGVSRWIDKIEKI
FT                   NSSYEQALNALELKFFADDIDILYYDDICLNKNTLLYPIDEEKAIINSLLLCQKDTIKD
FT                   KVENFINSLYAINTFNKWFIKSAVLALLGSIIKVCHEKCIDLNDVVNSKVFENILKTEK
FT                   KELLKASLLSFLNAVVDRIEQSENKNLIVKAAINFIEKNYNKNITLESVAKEVYVTPAY
FT                   LSILFKRELKINFIDYLHKIRIQKAQELLKNQNLKTYQVANMVGFSDEKYFSQVFKKYT
FT                   GLTPTQYRESLL"
FT   gene            complement(120711..122501)
FT                   /locus_tag="Calhy_0090"
FT   CDS_pept        complement(120711..122501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0090"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: csc:Csac_2517 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: histidine kinase
FT                   internal region; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05852"
FT                   /db_xref="GOA:E4Q9X7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9X7"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ05852.1"
FT                   /translation="MLLKLKNYFLRLSIKYKILILFYSIIVVTSLVLALFSYTISTNQL
FT                   KEEVGNLLLRDTKRIAASIDFLQRDVNELSSFLFLDQRVQNFISPRPDFTKYSLEPLAS
FT                   LLASKDYISFIMLYSFQGDKYYFSNDNSTGVADFYELKSTDFFKQIIKNKGAPIWLSLN
FT                   SLPFTLIAKNNYPKIAMARLLLDFNTYEPAGVLIICINIPTIEKIYMEDLKEKEACFFI
FT                   ADSNNRIISLESTTPQFTATFAQKLLNENILSRENEIITANSSKLLITSSYIPTSNWRL
FT                   VSIVSLENAINAIRNSFVLLYIRVLILCLIFAFIISMYFSSMLTAPLQKLVSSMKKVRQ
FT                   GNFREQVNIDPHASDEIAILVCEYNNMVEKINQLINKVLKLEIHKKEAELKALEAQINP
FT                   HFLYNTLDTIFWKAEKSHDSEISEMIYSLSRLFRLTLNRGSEFIQVKGEKELIEHYLFL
FT                   QSKRYKNKLQYSIEIDPEILDHYIPKLILQPFVENAIVHGMENSTTPTFIQITGEKEGE
FT                   NLCFTIKDNGIGMSKMQLDRIKDLLESGKEATFGYAIKNVNERLKLYYETHFKLNIQSQ
FT                   PGQGTEVKLILPIDYISVES"
FT   gene            122825..124147
FT                   /locus_tag="Calhy_0091"
FT   CDS_pept        122825..124147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0091"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2516 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05853"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9X8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ05853.1"
FT                   /translation="MSKKALKVVVSVMLIAALIVSVFGLVQGNLTASASTQKTVKIKFL
FT                   SNLPDRTSNQGKLEQMLIDSYMKANPNVKIEVEALQDEPYKQKFKVYVATNQMPDIFMV
FT                   WGQPSFFLPVMKAGYAAEIKLDQIKGYGFKTSSLKDFMYNGKLYGLPRNTDFMVLYYNK
FT                   GLFNKYKVKVPTTFNELLNAAKVFRKNGIAPIAINGKDKWILAILYQELVVKESGDQKL
FT                   IYDAISKKSVSKNQILLKAAKDLVNLVNVGGFQDAFVAADYGAANNLFAQEKAAMYYMG
FT                   SWEVGMAANPNFSESFKKNVDATYFPIISGGKGKKTDILAWHGGGYAVSASSKVKNEAM
FT                   KLLLYMMHPTRWAKIGWQQGLVVPGQNWEKFMTGKETVLQKKLTQIFSSATSVSGTVWQ
FT                   DAFTPNFKTEAETLCQMLVAKAITPEKFLAKIEELAKLEVK"
FT   sig_peptide     122825..122929
FT                   /locus_tag="Calhy_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.478 at
FT                   residue 35"
FT   gene            124229..125116
FT                   /locus_tag="Calhy_0092"
FT   CDS_pept        124229..125116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0092"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2515
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05854"
FT                   /db_xref="GOA:E4Q9X9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9X9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05854.1"
FT                   /translation="MHKVLSDKRTILLLVLPGLLIYTFAILFPIILSVYLGMTDWSGIG
FT                   RPNFIGLENFKKIIFTDTTFWKSLRNAILLALAYVFVQHPIALAFAIFIDKVGGRAEKV
FT                   FRTIFFIPCVIPVVVTSRMWVSLYDPQYGLINKILDFLHLGFLKQQWLGDTKTALISVI
FT                   IICMWQGFGWALLIYYAGLKGIPEELYEAARIDGATGVKLYTKITVPLLQPVIKVNFTI
FT                   AIIYALKQMETVYLTTNGGPGDASQFLANYLYIRAFNSYQYGYANAISVLFVIACLAVN
FT                   VLFQKIFKSENYEF"
FT   gene            125138..125980
FT                   /locus_tag="Calhy_0093"
FT   CDS_pept        125138..125980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0093"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2514
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05855"
FT                   /db_xref="GOA:E4Q9Y0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Y0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05855.1"
FT                   /translation="MARESSFNKKSRAVLLVVLGLFSIGQLFPLVWLIDFSLCKSGDVY
FT                   GANILKIPNPPQFINYYLAWRDGKIPQYFINSVIVNVTSVLLVVLFSLMMGYAFVRMEW
FT                   KWSNKVLTYVLLGLMIPIHATLLPNFVIFRQLKMLDSYFALIIPYVAFSLPQAVFLMTG
FT                   FIGSIPRALEESAIIDGCGIFRILFQIILPLSKPAIVTVTVTTFLNTWNEFIMAATYLT
FT                   SDKFRTLPFSVYNFAGQYASNYAVQFAVMTIVALPSLIVYIALNEQVTKGVTLGAVKG"
FT   gene            126132..127472
FT                   /locus_tag="Calhy_0094"
FT   CDS_pept        126132..127472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0094"
FT                   /product="Glucosylceramidase"
FT                   /EC_number="3.2.1.45"
FT                   /note="KEGG: ate:Athe_0097 glucosylceramidase; PFAM:
FT                   glycoside hydrolase family 30"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05856"
FT                   /db_xref="GOA:E4Q9Y1"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Y1"
FT                   /inference="protein motif:PRIAM:3.2.1.45"
FT                   /protein_id="ADQ05856.1"
FT                   /translation="MFKKIACYITAQDQGNPLRQVDNTKECDKIEKESVITIEPSSTFQ
FT                   EVIGFGGALTEAAAVNILSLLPHQQEEILRRYFDPKEGLGYKLCRIHMNSCDFCVDSYS
FT                   CDDVEGDSELKYFNIERDKKMVIPLLKRIKEYCPDLKILVSPWSPPAWMKTNGDMCHGG
FT                   KLKDEYKKTWARFFCKFIKAYKEEGIDIWAVTVQNEPMATQVWESCIYTAEEERDFVKD
FT                   YLGPTLEEEGLSHIKILIWDHNKDIIYDRVKTILSDKEAAKYVWGVAFHWYGGDHFDQL
FT                   KKIKEEFPDVNLVFTEGCQEGGVKLGSWELGERYAHEIIGDFNSYTIGFMDWNIVLDTM
FT                   GGPNHVGNFCDAPIIVDKDQKKIYYQNAYYYIGHFSKFIRPGAKVVKSSCSDARLEVLA
FT                   AKDQDDTLAVVVFNKNPEEIEFSMVIGEKIFCGKSPARSILTIVLEK"
FT   gene            complement(127509..129878)
FT                   /locus_tag="Calhy_0095"
FT   CDS_pept        complement(127509..129878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0095"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: ate:Athe_2329 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05857"
FT                   /db_xref="GOA:E4Q9Y2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Y2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADQ05857.1"
FT                   /translation="MLKFLKNRDFLVKLLLSYFLVFVIPFVAGLYAYYNGYSISLNNLK
FT                   SYSKTIMTNLPSKINDVALRPLELIEESINASPFYLTLISNHNLLASKNEIILDIRNFT
FT                   QQLMLYYTSPFILEIGIYIPFENIIITPNFFESSKLYYDYIVRPIDTDYLDWLNLLNKS
FT                   YNRYFMPMSFLIRGQPRSTILFLHSLPYWTFQDKKATLFILLDEEKLNDFIKSNVIYEN
FT                   SNIYVLNSDNTTLTQYVPDKNIDSLLKDTIKNSFTENSLTEMKTKKDKIILYYKSDMYQ
FT                   WKYIIAISSQSFFKPINNMKIYLLLYFIFSLILGLPTIVLLSLKSYRPVDEIKNILVSK
FT                   FKKQKFSYPYSEGIENIEDKSEMIKLKELASLLVAEEEFLRKQINEFLPTLQNWFLEHL
FT                   LVGNIPSAISEKEVFEKYQIKFDSDLFMVILVEIYDCQNFELQKDITDYSFVRFIIFNI
FT                   LNEVLTSQNNKVYNVILGEKKLGIILNIVDHNDTVDSIVGRLEYGKNFIQSNFAILLTI
FT                   GVSTIKKGISAINTCFEEAEKALSLKFISGNVKIYKFSDALSQLKDETLSFITPEMENR
FT                   ILECILNGNKASLEEIFKNIHSKIFVSDNIPIIQAKLLCVNLYILYENACRLINYKSSS
FT                   ELFKIIENEIITKTNTLTLDDLFFKIQDNFIRLAEFVKNNQLSFRFTLVEKVKTYIDEM
FT                   YSDPNLSLSLIAEKFNITPQYLSSLFKEKTGQNLSDYITHLRIEKAKLLLTQTNYSVNE
FT                   IALKVGYIYPNSFINVFKKKVGLSPTKYRTLYSSQN"
FT   gene            130134..131714
FT                   /locus_tag="Calhy_0096"
FT   CDS_pept        130134..131714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0096"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2032 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05858"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Y3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ05858.1"
FT                   /translation="MFARRMSKLIIWMVVIAFLSSMFIFYNVASAQTSKPVLTIFTWMD
FT                   PKAAPVLKNYREMAVYQTIMKKFKVDLQFIHPAMGSENEQFNIMIASRQLPDIIDWHWF
FT                   AYPGGPQKAIMDNVIIKLNPYMQYAPNLKKYFDTHPDVKKMATTDDGTIYMFPFIREDK
FT                   INCTFYGPIIRKDWLDKLKLSVPQTIDEWYQMLVTFKKNAEKLNNKMPVYPFSADYWSA
FT                   NPRGVFDYCSFLVGAWGIKTDFYVDKNRVKFGPLQPEFKQFMAVLQKWWKEGLLDPDLL
FT                   TMNRQAIQAKIMNDQIGAFLGLLGGSMGKFLQAKKGTDFDLVGAPYPTLKKGQVAALGQ
FT                   RDFPVNGDGMAITPKCKNIQLAIKILDWGYSKEGYLAYNFGVEGRSYVMKNGQPVYTES
FT                   ILNHPKLSAMEAIAQFGRVSWSGPFVQSKYYVNQMVAMLPQQKDALKEWTKPDNSKLLP
FT                   PITFTPDEAAKISNIMNTVNTYYNEMFVKLMTGKSNDMNGFVNTLKRMRIDEALKIYQT
FT                   AYERFMKKK"
FT   sig_peptide     130134..130229
FT                   /locus_tag="Calhy_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.894 at
FT                   residue 32"
FT   gene            131863..132810
FT                   /locus_tag="Calhy_0097"
FT   CDS_pept        131863..132810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0097"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2331
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05859"
FT                   /db_xref="GOA:E4Q9Y4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Y4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05859.1"
FT                   /translation="MARQTNSKKQGQSELLRDLKRNKNLYLMLLPIVAYYFIFHYIPMY
FT                   GVQIAFKDFTPAKGILGSPWVGLEKFREFFVYDSYYVWRIIRNTILLNVYDIIFGFPAP
FT                   IIFALLLNEVKNSLYKRTLQTISYMPHFISTVVIVGIILDFFSRDGLINQILKSLGILS
FT                   EPISFMTEPGWFRPIYVGSGIWQQLGWNSIIYLAAISNIDPQLYEAALIDGAGRFKQAI
FT                   YVTLPGILPTIVILFILRMGSIMNVGFEKVYLMYNPLTYETADVISTYVYRKGLLEMDY
FT                   SYGAAVGLFNSLINFMFVVMANQLSKKFTETSLW"
FT   gene            132825..133712
FT                   /locus_tag="Calhy_0098"
FT   CDS_pept        132825..133712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0098"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2332
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05860"
FT                   /db_xref="GOA:E4Q9Y5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Y5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05860.1"
FT                   /translation="MVKMKKGVGEIIFDIFNYIFLGLLCFTFLYPMLYVLFASFSNPIK
FT                   LMAYRGPLLRPLDFSVEAYKLLLSYPMIWIGYRNTIIYVVFGTAINILLTTMGGYVLSR
FT                   RNLKLKNPIMFFIAFTMYFSGGMIPTYLLVQSLGMIDTIWAMIIPGAISTTNLIIMRTG
FT                   FHSVPDSLEESARIDGAGDWTILFRIMIPLAMPMIAVMILFYAVGHWNAFFNAIIYLRS
FT                   RDLYPLQLVLREILIMNSTENMTTGISDASDRFAITELIKYAAIIVATVPILCIYPFLQ
FT                   KYFVKGVMIGAIKE"
FT   gene            133765..135549
FT                   /locus_tag="Calhy_0099"
FT   CDS_pept        133765..135549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0099"
FT                   /product="Beta-glucuronidase"
FT                   /EC_number="3.2.1.31"
FT                   /note="KEGG: dtu:Dtur_1539 beta-D-glucuronidase; PFAM:
FT                   glycoside hydrolase family 2 TIM barrel; glycoside
FT                   hydrolase family 2 sugar binding; glycoside hydrolase
FT                   family 2 immunoglobulin domain protein beta-sandwich"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05861"
FT                   /db_xref="GOA:E4Q9Y6"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Y6"
FT                   /inference="protein motif:PRIAM:3.2.1.31"
FT                   /protein_id="ADQ05861.1"
FT                   /translation="MLYPRETRTREVKDLNGIWKFKLDKENKGYEEKWYLQPLKDTIPM
FT                   PVPASYNDITQDPEIRDHIGDVWYETSFWVPSGWTDKRIVLRVGSAAHRAKVFVNGKEM
FT                   VEHKGGFLPFEVEITDAVSFDAENRLTILVNNVLDWTCLPPGFIRYYDDSFHPHGYKTQ
FT                   EYLFDFLNYSGIHRPVVLYATPKTYISDITVIPDIQGQNGIVEYKVEIEGVNCQKAVPK
FT                   ITIIDRENKVVVEGSGTSGILEIKNAQFWEPSNPYLYTFRVETLVDGKVEDVYELPIGI
FT                   RTVKVEGNRLLLNGKPIYLKGFGKHEDADIRGKGYDSVIAVKDFNLLKWIGANSFRTSH
FT                   YPYADEIMNLADELGILVIDEAPAVGMNFFNKNEKVFCNERVNEDTLNHHIQVIRELIK
FT                   RDKNHPCVIMWSVANEAATYEDEAYEYFKKVIDEVKKLDKTRPVTIVESSFPDETKVGT
FT                   LVDVICVNRYYSWYTDCGKLELIEYQLEKELLRWYELFKKPVIVSEYGADTIAGFHSDP
FT                   PVMFSEEYQCRMLEEFHKVFDKLDFVIGEHVWNFADFATKQAVHRVMGNRKGVFTRQRQ
FT                   PKAAAFLLKRRWANLKRK"
FT   gene            135589..135729
FT                   /pseudo
FT                   /locus_tag="Calhy_0100"
FT   gene            complement(135761..136504)
FT                   /locus_tag="Calhy_0101"
FT   CDS_pept        complement(135761..136504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0101"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   ate:Athe_0100 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05862"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Y7"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADQ05862.1"
FT                   /translation="MCRAKIYIGTSGFSYSHWKGIFYPENLPSAKRFEFYTTYFQTTEI
FT                   NSSFYRLPQEKIILNWYSSSPDSFVFSLKAPRTITHIKRFCEVEEEWNKFKNRIKLLKG
FT                   KLGPILLQLPPSFKAEDENLRRILKFLDGKENFKFAIEFRHKSWCSEGIYDILKNKNIA
FT                   WVIADSSRYPKAKIITANFTYIRLHGPKEMFASCYSDDDLKNLANDIKEYSKACEEIYV
FT                   YFNNDFNGYAVKNAKTLMDIVNNLL"
FT   gene            complement(136545..137633)
FT                   /locus_tag="Calhy_0102"
FT   CDS_pept        complement(136545..137633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0102"
FT                   /product="monosaccharide-transporting ATPase"
FT                   /note="KEGG: ate:Athe_0101 monosaccharide-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05863"
FT                   /db_xref="GOA:E4Q9Y8"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Y8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0101"
FT                   /protein_id="ADQ05863.1"
FT                   /translation="MNHIYRSKKVVKKSRMKKVFFIFTLILFATAVTIFIVYWPNISKN
FT                   EQQVLKPSKVRIGFAMGTLKEERWFKDRDILIAKAHERGYEVEWVNANENDVEQINQVK
FT                   YLLSKNINILIIVPNNYEKCSSAINLAKKRGIKVISYDRLVKNSDIDVYVSFNNYKVGE
FT                   LMAKWLLKTVPRGNYVFLLGDPGDYNVQMIKEGYHKVLDSFIQKKQINNILEKYCYNWR
FT                   KEYAYNYVNNLLEEGKRIDAVLASNDSLAEGAIMALSEKRLAGSVPVTGQDADISACQR
FT                   IVKGTQLMTVYKPIDKLVDLTLDIVDKLIKNKPLKPTSMLNNGYKNVPTFFIDPIGVDK
FT                   SNINDTVIKDNFHTWDEVYITK"
FT   sig_peptide     complement(137538..137633)
FT                   /locus_tag="Calhy_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.742) with cleavage site probability 0.624 at
FT                   residue 32"
FT   gene            complement(137655..139214)
FT                   /locus_tag="Calhy_0103"
FT   CDS_pept        complement(137655..139214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0103"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: ate:Athe_0102 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05864"
FT                   /db_xref="GOA:E4Q9Y9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Y9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ05864.1"
FT                   /translation="MTYKILIADDEKIVVDSIKFILENNLKEDIEISTFTSGREALENL
FT                   LFYSYHIAFIDIKMPDLDGLELIEEFRKMRNSDFPLFIIVSAYDKFEFAKKAIKEKAFA
FT                   YILKPYSIEDIISTVQSAIAHVNSILAKTKENIEKNAQLIVMRNLLENSFIPTLIFKNA
FT                   FDIVDVNQYEKIFGINLKSGFLMVLAPKDKSDFVSSFKELDNIRKDIRISFEHKALISI
FT                   GMGEYLICFFPASSQKEAEVLKEKVQEILKQKPYWNDIKIGFSDFYYLDEGYENAFWEA
FT                   YYSTLDLDSPEENEENEHLLLLTENLEAKLIHSINNPTQIPMIENYINQLCRLYIELFG
FT                   ENNLKYKVIKLIIMLLLEIGVANSDESIDVEKLIAQILNASSEQIVEIFKKAVLTLFSK
FT                   AKIKHEQIINNDSINKAIEFINQNYNQEITLSQISAAFNFNPYYFSKLFKKYTGVSFKT
FT                   YLTKLRIQKACQLLKNSSKSIKEISFAVGFSDPNYFIKAFKKFIGVTPSAYRNLPSEAN
FT                   PI"
FT   gene            complement(139211..140698)
FT                   /locus_tag="Calhy_0104"
FT   CDS_pept        complement(139211..140698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0104"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: ate:Athe_0103 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region;
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: histidine kinase HAMP
FT                   region domain protein; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05865"
FT                   /db_xref="GOA:E4Q9Z0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Z0"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ05865.1"
FT                   /translation="MKFFSVQSKLLAFFFIIILSLLAIDILIQYNNSYIVSLVNETFET
FT                   INTINVTKQDISSLNSNLQRYLISGDSDSMLSVYGSLNSIDEKLTVLESKILTKEEYLY
FT                   YTNLITIFEYLSKLTERLVIYKKGNLPLSKTYSEYIDFSKFLNLYLEKFSEQKIKFTME
FT                   IHHKAQRQLNSIRRINTLVILIWTLFASVLSIVFSNTFTTPIINLSKVANKIAHGNLEA
FT                   QLPQYSANDEVAVLYQSFSNMISNIKDMVKKLEEKADLERMYAQQKIEAIKYKQALQEA
FT                   ELKNLQAQINPHFLFNTLNTILQIAMFENAKQTYAILLRTSNYLRYVVHNINRVVKLEE
FT                   EIENVNNYMFIYRMRFGDRIKLEIEVESETKLLLMPCMILQPLVENAIIHGFKERENGI
FT                   IKILAKKVENQAIIEVSDNGTGIEKEVLEDLKNFSFEDNKTTGIGLSNIAKRLSYFYNI
FT                   ENPLYIKSNAEGGTTVTIKVPFITDISKLPKQEVNSI"
FT   gene            complement(140711..141685)
FT                   /locus_tag="Calhy_0105"
FT   CDS_pept        complement(140711..141685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05866"
FT                   /db_xref="GOA:E4Q9Z1"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Z1"
FT                   /inference="similar to AA sequence:KEGG:Athe_0104"
FT                   /protein_id="ADQ05866.1"
FT                   /translation="MKKRLQNLSFRIMVFFSVIIFIAIALYDIYNIRFINTSDKKANFK
FT                   NSVRIMMILPQNQTYWDWFLDQYKDISEKQGIITDIVFYNTSSEAYKLLKLATVTKPDA
FT                   IVMCNIYNSKDIAQVLSTIKSSNVFIVSLFNDMLFRYEDVFVGIDYYYKGKIAGKIIYK
FT                   VFNEKKNIPSSLKIAIVNPFYTTIGGALEVKGLTDFLKSKGIKEIGIKNFNFEYPAFPS
FT                   EEVARQLILEDKQKFNVIYIGSETDTLTIAQNIITFNKLDQFVVIGAGTNQKLQKYVKE
FT                   KIINGIINDNGELIAQKLCEAILSWKKFGHASSYISTNFKVIE"
FT   gene            141900..142955
FT                   /locus_tag="Calhy_0106"
FT   CDS_pept        141900..142955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0106"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="KEGG: ate:Athe_0105 D-xylose ABC transporter,
FT                   periplasmic substrate-binding protein; TIGRFAM: D-xylose
FT                   ABC transporter, periplasmic substrate-binding protein;
FT                   PFAM: periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05867"
FT                   /db_xref="GOA:E4Q9Z2"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Z2"
FT                   /inference="protein motif:TFAM:TIGR02634"
FT                   /protein_id="ADQ05867.1"
FT                   /translation="MKKSLLRIVAIFVAIAFVVGIGFAVVPKYANAKSSKKQIKIGLSL
FT                   ATLQEERWHKDRDEFVKAATKLGAKVLVQAANMDDVKQKEQCENLISQGVDVLVIVPNN
FT                   AEVFTSIIEEAHKAKIPVISYDRLIKNANVDLYISFDNVKVGELQGKYLTSKVPKGNYF
FT                   VFRGAPTDNNATLFYQGAMKYIQPLVKSGKVKVLFDQPVKDWKPEEALRLCENALTAAK
FT                   NNVQGILAPNDGTAGGIIQALKAQGLAGKVVVTGQDADLAAVKRIVEGTQTMTVFKDVR
FT                   LLAKKAAEVAVELAKGKKVSQLKDVNGKVYNGKLNVPSILLTPVAVDKSNIDKVLIQSG
FT                   WFTKEQVYGKK"
FT   sig_peptide     141900..141974
FT                   /locus_tag="Calhy_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.591 at
FT                   residue 25"
FT   gene            143058..144575
FT                   /locus_tag="Calhy_0107"
FT   CDS_pept        143058..144575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0107"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0106 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05868"
FT                   /db_xref="GOA:E4Q9Z3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Z3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ05868.1"
FT                   /translation="MSEYILEMVHITKEFPGVRALDDVTFRVKKGEIHALVGENGAGKS
FT                   TLMKILSGVYPYGTYSGDIFIEGKKQHFRNIKDSEHAGVAIIYQELTLVKGMTVGENIF
FT                   LGREPVVNGIINWNKVYADSKKLFEKLNIEIDVYEKVENLGIGQQQMVEIAKAISKDSK
FT                   ILILDEPTAALTESETRQLFRILKDLKNHGVTCIYISHRLEEIFEIADTVTVLRDGKTI
FT                   STDPISQLTEDEIIKRMVGRELTQRYPKVPHKAKRTIMEVRNFSVYDKDNPEKKIIDNV
FT                   SFEIKEGEVLGISGLMGAGRTELFMSIFGAYPGRKEGEIWLEGKKISINSPREAIEHGI
FT                   CYLSEDRKRYGLVLMMDIKDNILLPNYQKFANGGIINIPKSLSTALDYVGKLRIKIASP
FT                   FQQVMNLSGGNQQKVIIAKWLLANPKILILDEPTRGIDVGAKYEIYNLMNQFVDQGVGI
FT                   VMISSELPEILGMSDRILVMQKGKIAGELMAEEATQEKIMTLATGGR"
FT   gene            144579..145700
FT                   /locus_tag="Calhy_0108"
FT   CDS_pept        144579..145700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0108"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ate:Athe_0107 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05869"
FT                   /db_xref="GOA:E4Q9Z4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Z4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADQ05869.1"
FT                   /translation="MNLKKNLRTYTLIIAILLIWTIFTILTDGNFLTPRNLSMLARQMA
FT                   ITALVAIGMVFVIVAGHIDLSVGSVVGFTGAIAGVLQVWNGWSTPATVIAVLIVGIIIG
FT                   IWQGYWVAYRGVPAFIVTLAGMLVFRGGVLLASKGITISPFKDSFRFIGQGYLNKALSI
FT                   AFGAVLIVGYLLLTISQRNRRKKYNLEVLPMGLEIAKAAVVIALIVAFTGVMISYEGIS
FT                   IPVLILVVFTILLTFVSQNTTFGKYVYAIGGNKEAASLSGINIKNVTMKIFILMGFLSA
FT                   LAGIVLTSRLDAATSGAGTNMELDAIAAAILGGTSTLGGEGTVPGAIIGALIMASIDNG
FT                   MSLLNLEYSYQLIVKGLVLVFAVWLDIMSRKKA"
FT   gene            145862..147985
FT                   /locus_tag="Calhy_0109"
FT   CDS_pept        145862..147985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0109"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: csc:Csac_2452 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05870"
FT                   /db_xref="GOA:E4Q9Z5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Z5"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADQ05870.1"
FT                   /translation="MKSWERLRANSLNKIFKKGSLAQKLSVFVLVLLLIPITIIDIFSV
FT                   SKAVNSVISESKKSYLIATNSTAQYFQILFETAKNAAIQIMSNDSIQSFCTGESQNLKD
FT                   ENEKAKIAQDAKNIIANLVVTSEMFSGAYILTNRQTSLMFPPLVLDYFDFQKIENSKWY
FT                   KTITDSAGYVLIDSHRENFDEVAENNNSQIPAYACSIGFQFRDLKTNQIKGVMLLDIKE
FT                   EWLREKLQSTELSKQGVTTIGILAGGKIVLPLDWENKMNQKLKPNERFVQKVLSQVEAG
FT                   KKEGAFETVYQQKPYLITFSKTQYFDWTVVGMIPVSAIVKSARSMESVIILLTVVFTLI
FT                   AIVFGIIFALKIVKDIEKITDVMAIAEKGDLTNTINIRRSDEIGSLSRSFNNMTKNIKK
FT                   LIEKGVNLTQQVTSSMASLTTIASETSAASNEIARAIQEIAEGAGNQAKEATNVSEIVS
FT                   QFGQKIESIVYSIEQINKLSKDVFELSEDGSDAVKSLDKATVDTVNITDSMIRTINQLT
FT                   DYSKSIGKIISLLGSISEQTKLLALNASIEAAKAGEAGRGFAVVASEIRKLADMSKEST
FT                   REVDEIIKKIINQTKEAQEIADKVELVINNQNTAVETVTGAFGKIKSAIEELFEKVESI
FT                   NKLILSIDKEKTSIIESIENISAISQETAASTQEVSASTEEQLAAIEELKAMIERLNIL
FT                   AQDLYQAMQVFKV"
FT   gene            complement(148057..149100)
FT                   /locus_tag="Calhy_0110"
FT   CDS_pept        complement(148057..149100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0110"
FT                   /product="monosaccharide-transporting ATPase"
FT                   /note="KEGG: ate:Athe_0101 monosaccharide-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05871"
FT                   /db_xref="GOA:E4Q9Z6"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Z6"
FT                   /inference="similar to AA sequence:KEGG:Athe_0101"
FT                   /protein_id="ADQ05871.1"
FT                   /translation="MKKILNFKVIIIGLAITLTFIIIFLFAYIHFLKKNNINRPLKIGF
FT                   AMSTLKEERWFFDRKYLIDAAKEKGFEVEWTNANENDMTQYQQVKYLISKGINLLIIVP
FT                   SSYDSAKNAIELANQKNIPVICYDRIALDANIDAYLGFNNQKIGEIMAKYLLQQSPSGN
FT                   YVFILGNPKDYNAYQIKEGYRKILSPYINSGKINILLEDYCYKWKKEYAYEYVAKLLQA
FT                   GKRIDAILAQNDSLAEGAISALAEKKLAGKIPVVGQDAELSACKRIVNGYQLMTVYKPI
FT                   KKLSDLTIEIAEKIIKKDKLPYTKNFVNNGYKMVPAYLVEPVAVTKNNINLIIKDNYHS
FT                   YEEIFGK"
FT   gene            complement(149117..150652)
FT                   /locus_tag="Calhy_0111"
FT   CDS_pept        complement(149117..150652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0111"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: ate:Athe_0102 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05872"
FT                   /db_xref="GOA:E4Q9Z7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Z7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ05872.1"
FT                   /translation="MKKILICDDESIVIESISHILKKNFSEQMTIDEAYDGEEALQKLM
FT                   FENYHVVFIDIQMPDMSGIEVMEEIRKVKKDPFPLFIIISAHDKFEYARKSVELGAFSY
FT                   ILKPYLVSDIVNITKKAFEEIDNILSKQKEELERKRKIKAMQSLIENGFLFFILNNKLF
FT                   SDFNLRQLEQFLEIQNLQYGIVAILKVEQENSLNNIDILSELKTEIKSAFSNKCIVSFL
FT                   SPSSLLCIFSAESETYKEVLKDKLKKIIKSKTDTEIQIGLSNLCNLYDDFEEAFYESYS
FT                   NIISEDNEETTDLYVELEIMEKRLLNSLLKTTNIIQKQQQISELIKKYTLAYGINQARY
FT                   KIILFVIQLLIEINIKENAKVIYAMEKFLKDIISIDNEMEIIQKSFEIIQIIISEAAIQ
FT                   KKTYSSSNIVSQALEYIKNNFKRNISLEEMSQVLNISPYYFSKIFKKSVGINFKEYLIK
FT                   LKIEHAQKLLTETNMPIKEIAYEIGFDDPNYFIKAFKKYTGLTPASVRNNRNK"
FT   gene            complement(150678..152135)
FT                   /locus_tag="Calhy_0112"
FT   CDS_pept        complement(150678..152135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0112"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: ate:Athe_0103 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region;
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: histidine kinase HAMP
FT                   region domain protein; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05873"
FT                   /db_xref="GOA:E4Q9Z8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Z8"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ05873.1"
FT                   /translation="MKMILSFKTYKAKLIFFILTFILTTIAINLLIQLNVNFLHNYFDK
FT                   TYHNIESINTITNNFGTISRSIQSYVISGDSDSILNVYDSLNSISYELNQLTCQSEDEI
FT                   VYKRSITNIYKTINDNIDMVILYKKQGKDYTKKLSDTIESLDYANYFLQKFTQSKINHS
FT                   VEYYNSLKSSIRKITNTNYVVIALWFILSIIVSLLFTKELTDPISKLAKYSNKVAKGEL
FT                   NFSIPKVDSTDELGILNNSFSDMLENIKDMLKKLEDKAELEKELAKKEIEMVKYQQALQ
FT                   EAELKSLQAQINPHFLFNTLNTLAQMAMLENADKTYDMLIKTSNYLRYCVQNINKLVTL
FT                   SEEVENVKNYIFIHNIRFRNKINLEIDIEKEIEDAKIPSMILQPIVENSIVHGFAKKRE
FT                   GTIKIVAKKYYTSYVKIQIIDNGSGIEPEVLSELAKKSYVSKTSTGIGIENITKRLEFF
FT                   FGIKEPIFIESKKGIGTTVTITIPYIN"
FT   gene            complement(152144..153109)
FT                   /locus_tag="Calhy_0113"
FT   CDS_pept        complement(152144..153109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05874"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9Z9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ05874.1"
FT                   /translation="MSSTKNFILKYLIITVSLLLLLILVWLSASDFLVIRKMGNLNNFS
FT                   QNNYINCAVILPKNEMYWKEFLGEFEQFAQAQKVLSETIFYESEQEEVFGLKLALFSKF
FT                   DFVILCDLFHSSEIKSLIDQLKLQKIKVISILNSNLKDFFDTTLGFDYFQKGRLVASNI
FT                   EIVAKQKNLDRLKIAVITNTINKSLSGNSEVEGIKSYLKEKGIEFSVDLFSIEYGNAES
FT                   EKLLNNIIAAQQYNCYYTTEELETFAFIDSFVKSPKDSNFIFIGAGDDSRLLRYRDEGL
FT                   IDRLVMPNYDELAIRSILIMKDFEKLASKGQFIPISIIVK"
FT   sig_peptide     complement(153020..153109)
FT                   /locus_tag="Calhy_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.727) with cleavage site probability 0.482 at
FT                   residue 30"
FT   gene            153342..154412
FT                   /locus_tag="Calhy_0114"
FT   CDS_pept        153342..154412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0114"
FT                   /product="D-galactose ABC transporter substrate binding
FT                   protein precursor"
FT                   /note="KEGG: bbe:BBR47_06800 D-galactose ABC transporter
FT                   substrate binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05875"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA00"
FT                   /inference="similar to AA sequence:KEGG:BBR47_06800"
FT                   /protein_id="ADQ05875.1"
FT                   /translation="MFNKKKFWVVLVSMVLIISLVLVGCGKKSTNDSSNGTSEENKPYI
FT                   GVAIYKFDDTFMTGVRNAIAKEGEGKAKLDFVDCQNSQSTQNDKIDLFITKKVDALAIN
FT                   PVDRTAAGVLIDKAKQANIPVVFFNREPLPEDMKKWDKVYYVGAKAEQSGTLQGEIMAE
FT                   YWKSHPEADKNHNGIMEYVMITGEPGHQDAILRTEYSIKAVEAAGIKTKALAQDTAMWD
FT                   RVKGQEKMQAFLASFGDRIEAVFCNNDDMALGAIEALKAAGYFKNGKYIPVVGVDATTP
FT                   GLQALEEGTLLGTVLNDAKAQGKATFNLAYVLAKGEKPTKENVGFDITDGKYIWVPYQK
FT                   VTKDNLEEMKKYVNEQ"
FT   sig_peptide     153342..153416
FT                   /locus_tag="Calhy_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.692 at
FT                   residue 25"
FT   gene            154487..156049
FT                   /locus_tag="Calhy_0115"
FT   CDS_pept        154487..156049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0115"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbe:BBR47_06810 galactoside ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05876"
FT                   /db_xref="GOA:E4QA01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015862"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA01"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ05876.1"
FT                   /translation="MIFHSWKIDSRGAIAMAKTEYILEMNGITKEFPGVKALDNVTVKI
FT                   KRGTVHALLGENGAGKSTLMKCLFGIYKLDSGEIILDGQHVHINNPIDAIKLGISMIHQ
FT                   ELQPVNQRNVMENIWLGRFPRVSVGPFKFVNHKKMYEDTKALLQKLEIDVDPKAIVGHL
FT                   SVSKVQLIEIAKAVSYNSKVIVMDEPTSSLTENEVEHLFRIIRDLKSKGVSIIYISHKL
FT                   EEIFEIADEVTIMRDGKVVGSWSISELTPDMMIANMVGRQMSDRFPQKTNKPSEVILKV
FT                   ENLTSVDPKSFKNVSFELRKGEILGIGGLVGAQRTELIEAIFGLRSIKEGKIFIKGKEV
FT                   IIKNPQDAIRNKIALLTEDRKLTGIIPELNILENTTLASLRKYLNGFGLLNDKKRLLDT
FT                   QNFIDILRIKTPSYKAQIKNLSGGNQQKVLIARWLLTEPEILLLDEPTRGIDVGAKFEI
FT                   YNLINQLATEGKSIIMISSEMPELLGMSDRILVMCEGRVSGILERNEATEEEIMKLATR
FT                   FSA"
FT   gene            156079..157092
FT                   /locus_tag="Calhy_0116"
FT   CDS_pept        156079..157092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0116"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bbe:BBR47_06820 galactoside ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05877"
FT                   /db_xref="GOA:E4QA02"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR030158"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA02"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADQ05877.1"
FT                   /translation="MTSAKRIKQIVSQNAIYFILLALIIVIAFISPDFLSWRCFRDILL
FT                   QSSTRAIIALGMSLVLITGGVDLSAGRAVGLAAVVSASMLQTADYARRFFPELPQLPLI
FT                   VPILIAMAITLLFGIVNGVAISRLNLPPFIATLGSMVIIYGANSLYFNLPPNNSQPIGG
FT                   LRSDFTNLGTGYIGISGEYSIPYILIIALIVALVVWVLLNKTALGKSIYAVGGNVNAAR
FT                   VSGINVSKVLIFVYAFAGLLYGLAGVLEAARTGGATNNYGNMYELDAIAACVVGGVSTT
FT                   GGIGTVPGVLAGVLIFGVINYGLTFIGVDPYWQLIIKGLIIGVAVALDIRKYLAKR"
FT   gene            complement(157201..158406)
FT                   /locus_tag="Calhy_0117"
FT   CDS_pept        complement(157201..158406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0117"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ate:Athe_0112
FT                   ABC-type Na+ efflux pump permease component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05878"
FT                   /db_xref="GOA:E4QA03"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA03"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADQ05878.1"
FT                   /translation="MNVNLKHVWIVLKKELKDAFRDRKSLFVGIIMPMLFIPVIFIIAS
FT                   VAAKSAYEVKPEKTPICVVGKEYSKTVVNMIEKSEFQIVASSDPKKELLDGKIKAILII
FT                   PKDFEKLILQEKQTSIQILTNDADMKSSNVGSMLSEMINNFSREVVKQRLVQKNLDPSI
FT                   IEPIVIKKENVAPPKKQSATFLAFLIPMFLTLWAALGGMNAAIDITAGEKERGTLEPLL
FT                   TTAATRTSLVTGKYLAVSVMALLAGLSSLIGIVVSFAALPSVLGENFKNSPFAGYSVSP
FT                   VTVLIMLLVVVLTAIIFAAIEVAIAAYARSFKEGQTYLSPVSIIVVIPPYLTMYKMPNE
FT                   LTDTYFVLPLVNAISILKELIYDIVNLQHLGLFVISSLVYIVISIKFAARMFENEKVLF
FT                   RN"
FT   gene            complement(158403..159128)
FT                   /locus_tag="Calhy_0118"
FT   CDS_pept        complement(158403..159128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0118"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0113 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05879"
FT                   /db_xref="GOA:E4QA04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA04"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ05879.1"
FT                   /translation="MVELIELTKDFGKVLAVDRLSFRIEKGEIFGILGENGAGKTTTLR
FT                   MLATMLKPTSGTAIISGLDITKEPEKVRRKIGILFGSESGLYARLTARENIEYFGLLHD
FT                   MKKDEIKKRIDELSESFGMQDYIDRPAGTFSKGMKQKVCFLRSIIHNPEVMLFDEPTNS
FT                   LDVSSAKEVHDFIRLCKQEGRTIIFSSHSMSEVEKLCDRVAIIHKGKLVALGTIDEIKQ
FT                   RFSGHSFEDVFLRLVGEER"
FT   gene            complement(159176..159874)
FT                   /locus_tag="Calhy_0119"
FT   CDS_pept        complement(159176..159874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05880"
FT                   /db_xref="GOA:E4QA05"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ05880.1"
FT                   /translation="MKEYFVHIKGIKGKIVAWIFFVLVFTAFYTFLYQQIKLASLGYAF
FT                   SLVTTIVSLNKLIFYYSDEGSAIANRASANSYFPFLVLLPTKKSSIVIWDFLHGAAVII
FT                   MYIAGFNIVFEILKWLFGISQQYNIYPLFISPLATTLFLFSFYCLMMAVISLIHNRTFT
FT                   LILATITNVLLFIPFYVPLFLTAEDKKVASFLTNLYNDSMISIPFLFISILMFLISLLV
FT                   NLKVIYRREF"
FT   gene            complement(159898..160563)
FT                   /locus_tag="Calhy_0120"
FT   CDS_pept        complement(159898..160563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05881"
FT                   /db_xref="GOA:E4QA06"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA06"
FT                   /inference="similar to AA sequence:KEGG:Athe_0116"
FT                   /protein_id="ADQ05881.1"
FT                   /translation="MKYWKLYKRYVTLTLLYFLVYMLVLCVSEVVFNSPINIESFMSRL
FT                   FSMAFTGIYLTFAMTNFPYNKINFSSEIDLMMLLPLKRVNIVLSRLIRDILIFLLFQIF
FT                   LILITLLIIKKLDIIILYYLFLEINMLISYQPVFTWSSNQKHISNTARISAVAFYLAVP
FT                   FIADLPLMLLFSLSSKSIWYLPINMPNTLVLSLALFYTLLLAGVSIFISYKLIFNKEL"
FT   gene            complement(160541..161416)
FT                   /locus_tag="Calhy_0121"
FT   CDS_pept        complement(160541..161416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0121"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: csc:Csac_2498 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05882"
FT                   /db_xref="GOA:E4QA07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA07"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ05882.1"
FT                   /translation="MIALYVKNLTKTYKNFKLEVQELVLESGYIMALLGRNGAGKTTLI
FT                   KCILDLVKKESGEVLIFEKPFNCDEVQIKQRLGVVLENPIVPGYLKPKEVKEIMKAFYK
FT                   TWDDKLYKKLCDLFEIDQNKKIFQLSKGTVMKLSIALALAIRPDLLILDEPTSGLDPVA
FT                   RNQFVEILQEFVQSEEKAVFYSTHIVSDIENVADFVTIIDGGKIVFSSSRESIQDDYCI
FT                   VKGAANEYDKIPKSAVLSLKKSSLSFEALCRKKDVKLFQDEFVVEKPSIEKFYVMLVRR
FT                   DEEDEVLEVV"
FT   gene            complement(161419..161802)
FT                   /locus_tag="Calhy_0122"
FT   CDS_pept        complement(161419..161802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0122"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: ate:Athe_0118 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05883"
FT                   /db_xref="GOA:E4QA08"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA08"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADQ05883.1"
FT                   /translation="MLKLVISQTSNKPIYEQIKDQIKKQIIEGSLKAGDSLPSIRVLAK
FT                   ELNVSVITTKRAYEELEKEGFIVTVPARGTFVAEIDREKISNIGTKEIEEDLRKVIKKA
FT                   KLLGFDLDKLIEMIERLYKGDET"
FT   gene            162029..162544
FT                   /locus_tag="Calhy_0123"
FT   CDS_pept        162029..162544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0123"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   ate:Athe_2395 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05884"
FT                   /db_xref="GOA:E4QA09"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA09"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADQ05884.1"
FT                   /translation="MIIQKTVFDDKKIQKNLLKIDKEKGDKLMYIYNVMKTLIEYASRS
FT                   NDIPVAAAVVKNGKIISIKRNDSKKAIYHAEILAIIDATSKLSTKDLRSCEMFVTKEPC
FT                   PMCMSAIVLSKVKRLYFGARDFKMGAAESCFNLSQNPFLNHKVEVIGGICEDECRLLLK
FT                   RFFEEKRR"
FT   gene            162707..163159
FT                   /locus_tag="Calhy_0124"
FT   CDS_pept        162707..163159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0124"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: ate:Athe_2394 putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05885"
FT                   /db_xref="GOA:E4QA10"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA10"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADQ05885.1"
FT                   /translation="MENKFLQLVFTSNLQLVKVAEKEILSFLTRETNISADELLEFKLI
FT                   VNELLINAVVHGNKEDSSKSVKVKVGIVDRKLSYIVVEDEGEGFDIDRVFREYTPYDEK
FT                   DEIEDLYEFGRGLMIVASLCEKVKQNQKGNKIVAVRRLKKEEDCYV"
FT   gene            163347..164552
FT                   /locus_tag="Calhy_0125"
FT   CDS_pept        163347..164552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0125"
FT                   /product="Pectinesterase"
FT                   /note="PFAM: Pectinesterase; KEGG: trq:TRQ2_0501
FT                   pectinesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05886"
FT                   /db_xref="GOA:E4QA11"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR033131"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA11"
FT                   /inference="protein motif:PFAM:PF01095"
FT                   /protein_id="ADQ05886.1"
FT                   /translation="MFSLKSYLPDATLSKYVKVSVKADENIFVKMSLNKELLIERFLRE
FT                   DEILDAVVKLNEGKNHLQIEGENLEGNKYVLNKSIRYLEKPFAIVDQNYAGCDKDVAGG
FT                   IVFCKSLKSLTEILKKENSSYKAVFIRNGIYREKVNIDSSRVMLIGEDRNKTIVTYSLA
FT                   AGLPAENGGILSTSNTATFTISGEDFVVENITFENGFDRNVPIEHRQAVAVKALADRLM
FT                   FFNCAFKSTQDTLYADFGRQYYYRCYIEGDVDFIFGAATAVFEECVICSLDREDRKIKG
FT                   YVTAASTKPDSQYGFLFIRCKLISNIREKECVYLGRPWHPSSDPNRWANVVFRECYLDE
FT                   HIHTDGWCEMHGFCPENERFFEYKNFGPGSGKQNPKRPQLDEMEAEMYTREKVLGEWKV
FT                   EI"
FT   gene            164736..165497
FT                   /locus_tag="Calhy_0126"
FT   CDS_pept        164736..165497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0126"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: ate:Athe_2392 transcriptional regulator, DeoR
FT                   family; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05887"
FT                   /db_xref="GOA:E4QA12"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA12"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADQ05887.1"
FT                   /translation="MLSATRRQKIKEILMEKKSVTVTELCNIFNVSDETIRRDLKKLEQ
FT                   EGIIEKNYGGAILKEGVSIVPPISQRSKEFIQEKERIALEAINRIKEGMVVILDTGTTT
FT                   QQIARKLKSFQHITVITNGINIVNELITNNSINLFLVGGKVKNSNFSTVGPEAQKAFLQ
FT                   FSADIAFIGTSGISLEKGLTTSDVFEAEVKRAMIDSSKEVIVVADSSKFKKNAMVSFAT
FT                   LSKVSEIITAGEISSELVENFRQKGVKITVV"
FT   gene            165552..167045
FT                   /locus_tag="Calhy_0127"
FT   CDS_pept        165552..167045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0127"
FT                   /product="Carbohydrate kinase, FGGY-like protein"
FT                   /note="PFAM: Carbohydrate kinase, FGGY-like; KEGG:
FT                   ate:Athe_2391 carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05888"
FT                   /db_xref="GOA:E4QA13"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA13"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ADQ05888.1"
FT                   /translation="MEKILTIDIGTTACKVIVFDLQGNILAKANREYPTYTPQIEWAEQ
FT                   DPLDWWNEVVEGIKEVAQAAGADGIVAIGLSSQRETVVPIDKEGNVLSRAISWMDRRSR
FT                   LEAEEISHQFGKDTIHKITGLIPDSTFTATKLLWLKKHQPEILQKAYIFLQPKEFIGYM
FT                   LTGEAATDHSLASRTMMFDVNKRQWWEDIFEFVGVKTSQFPRLCYADEVIGYLKEDVAK
FT                   ILGLKSGIPVVSGGGDRPLEALGAGIVGSRVMESTGTATNVSMSSNKVPESLDPRVVCS
FT                   CHVIRDHYLIEQGINTSGTILRWIRDNFYRGEKEKGENVYELIDSEAESSSPGANGVVL
FT                   LPFFMGSRATRWNPDAKGVLFGLTLTHSRADIARAVLEGISYEIRACIEILESMGLKAE
FT                   SIVSMGGGAKSRVWSKIKADILGKNVVVEKVQEAASKGAMLLASYAIGARESLIEEKRE
FT                   VLFEYQPDSKNHEIYNRVYEIYNQLYNSVSPLYPKLSQY"
FT   gene            167065..167901
FT                   /locus_tag="Calhy_0128"
FT   CDS_pept        167065..167901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0128"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.40"
FT                   /note="TIGRFAM: ketose-bisphosphate aldolase; KEGG:
FT                   ate:Athe_2390 ketose-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05889"
FT                   /db_xref="GOA:E4QA14"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA14"
FT                   /inference="protein motif:TFAM:TIGR00167"
FT                   /protein_id="ADQ05889.1"
FT                   /translation="MLVNLNEVLSYTKVKKFGVGMFNGLSADFYEGLIDAAEQLRCPII
FT                   IGVADRFVDRLDFEMIAEVMIFLAKRASVPVCVHLDHAKSLKNIMRAIKAGFTSVMFDG
FT                   SSLPFEENIKRTKEIVEIAHSVGVSVEGELGVVGRGDFDFKNPEFYTKPDEAEEFAQKT
FT                   QVDALAVSIGTVHGVYKGEPKLDFERLSEIRKRVDCYLVLHGGSGLSDEDFKKCIEYGI
FT                   NKVNIFTDLTLAINAQLPEFIKQTEDLTPAIFEKIREIVKQEAIKKLKIFGSYNII"
FT   gene            167928..168839
FT                   /locus_tag="Calhy_0129"
FT   CDS_pept        167928..168839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0129"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ate:Athe_2389 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05890"
FT                   /db_xref="GOA:E4QA15"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA15"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADQ05890.1"
FT                   /translation="MNEPIKKYFKIGTIHFMSFPEVIGGEGPIEETLKIILEDDYFDAV
FT                   EITWVKDPEVRKRVAKMLKDAHIAVAYGAQPTLLRTGQNPNDLDPEKRKQVINFLKERI
FT                   DEAIELGAQGLGFLSRQYDEAKKEEAFEALVDTTLQLCDYAKSKGNFMIELEVFDFDID
FT                   KKSLIGPAELAAKFAERIKKEYDNFGLIVDLSHLPLTRETAEQALLPVKDYLTHVHIGN
FT                   AVVKDPSHPAYGDKHPMFGIEGGENDVEEVIEFLRVLKEIGFMDPVKRPILSFEVTPMA
FT                   GQDPKIVLASSKRVLNEAWARL"
FT   gene            168899..169870
FT                   /locus_tag="Calhy_0130"
FT   CDS_pept        168899..169870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0130"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: ate:Athe_2388 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05891"
FT                   /db_xref="GOA:E4QA16"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA16"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADQ05891.1"
FT                   /translation="MKILVTRRIMEPAIELLKKYGEVEVNPHDRPMTREELLKAIADKD
FT                   AVLTQLVDKVDSEFFDHAPNVKIVANYAVGYDNIDIEEATRRGVYVTNTPDVLTNATAE
FT                   LAWALLFAAARRIVEADKFMRGGHYKGWGPMLFLGKGVTGKTLGVIGAGRIGQAFARMS
FT                   KGFNMKILYYDFERKENFEKELGAQYVTLDELLKEADFISIHVPLTPQTRHLIGEREFS
FT                   LMKPSAILINTARGPIVDEKALVKALKEKKIYAAGLDVYEREPEFEPELAELDNVVMLP
FT                   HIGSATEESRLDMAMLAANNIVDFIEGRVPRTLVNKEVLNKK"
FT   gene            170037..170810
FT                   /locus_tag="Calhy_0131"
FT   CDS_pept        170037..170810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0131"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: ate:Athe_2387 transcriptional regulator, IclR
FT                   family; PFAM: Transcriptional regulator IclR ; regulatory
FT                   protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05892"
FT                   /db_xref="GOA:E4QA17"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA17"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ADQ05892.1"
FT                   /translation="MAQNSVQSIERAFEIIEALAVEPRGLTVSELSEKLSLHKTTVHRI
FT                   LQTLLQRGYVQKDRHTLRYKLGVKFVEISSMYLNNIELKTEAHPYLRELVKMFNVTVHL
FT                   AILDEFDVVYIDKVEQVNSIRLYSSIGKRVPAYCTALGKVLLSKYQDHEIKKILKSIEL
FT                   KPYTQNTITDPEILLNEIILARQRGWAVDNQELQPSIRCIAAPVYDYRNEIIAAISISA
FT                   PVNILPPEMDEENAKKVVDTAMAISSRLGYVKDRF"
FT   gene            170852..171499
FT                   /locus_tag="Calhy_0132"
FT   CDS_pept        170852..171499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0132"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: ate:Athe_2386
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05893"
FT                   /db_xref="GOA:E4QA18"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA18"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADQ05893.1"
FT                   /translation="MEKEQVLERIHENGLVVVVRAESKEKALKITEACIRGGASAIEIT
FT                   FTVPGADEIIRHLTKTYSEDKIIIGAGTVLDSETARIAILAGAKFVVSPYLNPEMVKLC
FT                   NRYRIASMPGAMTIKEVVEALECGADVIKIFPGELFGPKIIKAYKGPIPQARLMPTGGV
FT                   DLDNVDEWIKAGAFAVGVGGNITKYANDEDFSKVEEVCRQFVEKIKIAKGKV"
FT   gene            171505..172533
FT                   /locus_tag="Calhy_0133"
FT   CDS_pept        171505..172533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0133"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: csc:Csac_2720
FT                   ribokinase-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05894"
FT                   /db_xref="GOA:E4QA19"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA19"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADQ05894.1"
FT                   /translation="MFEVTSFGEIMLRLSPPGYQRIVQATSFDINFGGAEANVVVALSN
FT                   IGVKTSYVTLLPQNPLGDATINFLRRYGVDTSYIKRKGRRLGIYFLEKGVGQRASSVVY
FT                   DRADSAINEIQPGDIDWEDILRKTRIFFSTGITAALSQNVLNELKMAFKTAKNAGAKVA
FT                   FDINYRSKLWSYDRANEVISELMPYVDILITNEEHVRRVLKIDMEDKYSEGIDLTPDGQ
FT                   KVLFERLQTKYQNLERIVLAARRSLSASKNIFFAYTSDENGNIVFSKKREIEVIDRVGA
FT                   GDAFTAGALYSILRGLESTQMLEVATYMCALKHTVEGDSLIVTEDEIKQALLQDSSGMM
FT                   KR"
FT   gene            172556..173386
FT                   /locus_tag="Calhy_0134"
FT   CDS_pept        172556..173386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0134"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="KEGG: csc:Csac_2719 5-keto-4-deoxyuronate isomerase;
FT                   PFAM: KduI/IolB isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05895"
FT                   /db_xref="GOA:E4QA20"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA20"
FT                   /inference="protein motif:PRIAM:5.3.1.17"
FT                   /protein_id="ADQ05895.1"
FT                   /translation="MEVRFAMHPSQFKTLTTEQIRKEFLIETLFEYGKINMVYTHVDRV
FT                   IVGGAVPTVEALVLEDGKEIGAQYFLERREIGIINIGSKGYVVADGQKFELDKKDGLYV
FT                   GMSTKKLEFGSDDPSNPAKFYFVSTPAHKQYPTEKIDIKQTEATHLGSLSESNERTIYK
FT                   YIHPDGVKSCQLVMGMTILEPNNVWNTMPCHLHDRRMEVYFYFDMPEDAFVLHLMGEPQ
FT                   ETRHIIVRNEQAVISPSWSIHSGVGTKNYTFIWAMAGENQSYSDVNPVPMKDLK"
FT   gene            173413..174174
FT                   /locus_tag="Calhy_0135"
FT   CDS_pept        173413..174174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0135"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="KEGG: csc:Csac_0357 2-deoxy-D-gluconate
FT                   3-dehydrogenase; TIGRFAM: 2-deoxy-D-gluconate
FT                   3-dehydrogenase; PFAM: short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05896"
FT                   /db_xref="GOA:E4QA21"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA21"
FT                   /inference="protein motif:TFAM:TIGR01832"
FT                   /protein_id="ADQ05896.1"
FT                   /translation="MILDKFKLDGKVAIVTGASKGLGQGMAIALAEAGADIVGVASGPC
FT                   TETKQKIEALGRRFLEIQADLRTIEPINSIIEKTVQEFGKLDILVNNAGIIRRCDAIDF
FT                   TEKDWDDVLNLNLKTVFFFCQAAARQFIKQGTGGKIINIASMLSFQGGIRVPSYTASKS
FT                   GVAGITKALANEWAKYNINVNAIAPGYMATDNTKPLREDPVRSAEILSRIPAGRWGTPE
FT                   DLQGAVVFLASSASDYVNGCILNVDGGWLAR"
FT   gene            174392..175516
FT                   /locus_tag="Calhy_0136"
FT   CDS_pept        174392..175516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0136"
FT                   /product="glycosyl hydrolase family 88"
FT                   /note="PFAM: glycosyl hydrolase family 88; KEGG:
FT                   csc:Csac_0360 glycosy hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05897"
FT                   /db_xref="GOA:E4QA22"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA22"
FT                   /inference="protein motif:PFAM:PF07470"
FT                   /protein_id="ADQ05897.1"
FT                   /translation="MKRLKELAKKNYSVKMADSVIAKFPELTDKWQYDYGVVFKGMEYI
FT                   YENTSDEKYFEYIKKNIDSFVDENGNIKKYSKDEYNIDHINNGKAILFLYRKTGEEKYK
FT                   KAAQLLRDQLKTHPRTVEGGFWHKKIYPHQMWLDGIYMGSPFYAEYATLIGKDEAEEIF
FT                   DDVAKQVILCAKHTKDPVTGLHFHGWDESRQQKWANKITGCSPNFWGRALGWFAMAIVD
FT                   VLDFLPQDHQSRETILAIFRQLIDAVLKYQDPETGVWYQVVNFIGRNGNYPEASASCMF
FT                   AYALAKGIEKGYLDSSYIKALERAYEGIIYRFVEEDENGLLNLNGVCMVAGLGGNPYRD
FT                   GSYEYYISEPIKTNDLKGVGAFLKASAWIERLFK"
FT   gene            175543..176886
FT                   /locus_tag="Calhy_0137"
FT   CDS_pept        175543..176886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0137"
FT                   /product="glycoside hydrolase family 28"
FT                   /note="PFAM: glycoside hydrolase family 28; KEGG:
FT                   ate:Athe_2380 galacturan 1,4-alpha-galacturonidase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05898"
FT                   /db_xref="GOA:E4QA23"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA23"
FT                   /inference="protein motif:PFAM:PF00295"
FT                   /protein_id="ADQ05898.1"
FT                   /translation="MFVNVREFGAKGNGIDKDTEAFKKAIEECEKQGGGTIFVPAGIYH
FT                   IGAIHLKSNMTLYIESGAVLKFSQDEEDYPLVYTRWEGEEMQVYSPLIYAENAENVAVV
FT                   GFGTIDGQGEKWWRLHRNKELKYPRPRSICFYRCNNVTIEGIKIVNSPSWTVNPIECQN
FT                   VTVHNVKIQNPYDSPNTDGINPESCKGVRISNCYIDVGDDCVTLKSGTEDCKQKIPCEN
FT                   ITITNCIMAHGHGGVVIGSEMSGGVRNVVISNCIFEGTDRGIRIKTRRGRGGVVEDIRV
FT                   SNIVMKNVMCPFAFYMYYHCGKGGKEKRVWDKSPYPVDESTPIVRRIYISDVVVREARA
FT                   AAGFLYGLTEMPIEDVVFSNVTVEMAQNPEPELPAMMSYLDPMAKRGFVINTVKNIRFM
FT                   NVSVMNQEGAAFELNNCENVEFYRCRAKDTADYSKILSLNNTMNLIAE"
FT   gene            177088..178707
FT                   /locus_tag="Calhy_0138"
FT   CDS_pept        177088..178707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0138"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2378 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05899"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA24"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ05899.1"
FT                   /translation="MICSRTFIRSKEFFKVVVLLVCIVFIISSIGMLSPQSKALATTKK
FT                   VTLTYFVPMSNEASLFYKSFAEIPCYQLMEKATGVKFVFKHPPLAASAAQDQFNLMIAS
FT                   RQLTDIIEWGWDGYPGGPEKAIIDKVIVPLNDYIPKYAPNLKRLLDKNPQIKRMVSSIS
FT                   GKIYGFPALKETPIDAYYGPQVRRDWLEKLKIAPPETVDEWYKMLKAFKTRDPNGNGKA
FT                   DERPFSMLRGAANPRAVFDYCSFLVGAWGIKTDFFQVNGRVKYGAIEPQFKEFMNTLAK
FT                   WWKDGLIDPDILTMNQQTIQANVLSDKIGAYLGIISGHMGAFLAAKKGTDFDLIGVKYP
FT                   VLKKGEIARIGQNEYPFTGRAAAITTSCKNIEAACRALDWAYSKDGYMAFNFGVKGKSY
FT                   MIKNGRPIYTDEILYNPQGLGPKQALAKYALIYGPFVQSREYTLQINLQLPQQKEASKN
FT                   WGMVKNDIALGPVSLFFTPEETKEIANIMNTINTYYDEMFLKMMTGKYNNYDAFVKTLK
FT                   KMKIEEAIKIYQNAYNRYMQRK"
FT   gene            complement(179313..180743)
FT                   /locus_tag="Calhy_0139"
FT   CDS_pept        complement(179313..180743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05900"
FT                   /db_xref="GOA:E4Q7K4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q7K4"
FT                   /inference="similar to AA sequence:KEGG:Csac_0656"
FT                   /protein_id="ADQ05900.1"
FT                   /translation="MFNTKPKQLSFIDLFSHLKASALYKPESLLGLFNKFIDLSHYIPS
FT                   SFYNAYYKYFGKHRYFSLESMLCCFLVQKLLKLNTLTQLRAVLLNSFELRSFCNLHGNV
FT                   PSISTLSRFRKIFASEIHKLFQNISIHAHNISIQQCPQDSSILIFDTTGIVPKVRENNP
FT                   KFIHLLLKNTSKANPELPSEKVYSLVYSSLPKTANANSNIRLMFVNGHFCWALKFAVIT
FT                   NALGIPLALVPLFNYDSPSSDPQEAKAISDSKGLIPSLETLFSYIPKNFSTFIADSALD
FT                   SHNIYSTLKNTFNFSKIVIPLNTRASKNTTPTSDPNIVISEDGIPICKKFNKPFKPEGK
FT                   CQGKNRSLRLKWTCPMSQYKDGKRICSCPQPCTTSKSGRMFYTYPDNFRSFPGINRNSQ
FT                   EFFDLYKKRVAVEQTIYHLKSYMGSDTISTYDHISIFSDFLLSAITFSLLFILAHNIKL
FT                   YCSKLTIKKLNKLKKLIA"
FT   gene            180916..182232
FT                   /locus_tag="Calhy_0140"
FT   CDS_pept        180916..182232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0140"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2376 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05901"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA26"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ05901.1"
FT                   /translation="MIKSKRLIALLVLVVFTMSLFFAFSIKGSEKAKAASKKVTLRFMW
FT                   WGGEARHKATLAAIQAYMKKYPNVRINAEYGGIEGYMQKLITQLVGRTAPDIIQIDVTW
FT                   IGELSAQGDFFADLKTFKEVNLKPFEEKFLKDWCYSNGKLIGLPTGVNASAIHYNKDFF
FT                   KKFGIPENKTWTWEDILTIAEKVHKKDKNYYLLNFDATVCYYLLKTYVLQKKGGKWIND
FT                   DYTMGFDRKTLIEAFTYIDKLFKVGAIQPFSESAPFQGKPEQNPKWLKGELGMLWNWTS
FT                   TFAANKANIPSLSMTMIPIMKNAKSTAVTVRPSQLLAVNKLSKNPKEAAKFINWFLNDK
FT                   QAALILKDVRGVPASSTAREALEKEKALDPVITQITSEALKRAAPPENALSQNQELEKI
FT                   ATDVIQQLAYKQLTPTQAADKLMALYKQKLAEIKRLQSR"
FT   sig_peptide     180916..181002
FT                   /locus_tag="Calhy_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.660 at
FT                   residue 29"
FT   gene            182358..183254
FT                   /locus_tag="Calhy_0141"
FT   CDS_pept        182358..183254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0141"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2375
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05902"
FT                   /db_xref="GOA:E4QA27"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA27"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05902.1"
FT                   /translation="MTARLRRKDLVGLLYVLPWLVGFLVFKLYPFIMSFVYSFCDYSML
FT                   KPPKFVGLYNFIYMLTKDELFPKALVNTLKYVIITVPLKISFALFVAIILNMKLKGINL
FT                   FRTVYYLPSIFGGSVAISILWRFLFMKEGIVNKFLGLFGIEGINWLGDPRIAMFSVSLL
FT                   AVWQFGSSMVLFLARLKEIPSELYEAALVDGASRLKMFTKITLPMISPIMFFNLVMQTI
FT                   NAFQEFTGPYIITGGGPVNSTYLLSMLIYDNAFKYFRMGYAAALSWVQFVIILIFTAFI
FT                   FRSSTYWTYYEYDEGRF"
FT   gene            183260..184117
FT                   /locus_tag="Calhy_0142"
FT   CDS_pept        183260..184117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0142"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2374
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05903"
FT                   /db_xref="GOA:E4QA28"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA28"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05903.1"
FT                   /translation="MYSQSKKAKNTISLFITYAFLILFGLFMIYPLLWVVSAAFKSNDE
FT                   IFKSLSLIPQKIVTDSFIKGWQGTGQYTFGRFFANNFILVVPVVFFTIISSTLVAYGFA
FT                   RFNFPLKRLFFVILISTLMLPDSVNLIPRYILFNAFGWVDSYKPFIIPSMFASTPFFVF
FT                   MMIQFMRGLPREIEEAAIIDGCNSFQILLRVTGPLCKTAMISMGIFQFIWTWNDFLGPL
FT                   IYINSVEKYTIALGLRMCVDSAAAIAWNQIMAMTVIAMLPCIIIFFAAQKYFVEGIATS
FT                   GIKG"
FT   gene            184206..184964
FT                   /locus_tag="Calhy_0143"
FT   CDS_pept        184206..184964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0143"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: ate:Athe_2373 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05904"
FT                   /db_xref="GOA:E4QA29"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA29"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ05904.1"
FT                   /translation="MSYKMIIVEDESEIREGLFTCFPWDKLDFEIVGLFENGKQALDYI
FT                   LQNKVDVVFCDVKMPVMSGIDLARVLFLNNIPVKIVFISGYQDFEFAQKAMKYGVRYYI
FT                   TKPATYDEVIEIFGLIKKELDLQSKNPQTHSEEVKKQDLISIDNPENVIETVKEYIKRN
FT                   YKEATLEDAAKLVYMNPYYLSRLFKCKTGKNFSDYLIEVRMRKALQLMKIPMYKLHEIG
FT                   EMVGYKNPKNFTRAFKKYFGKSPSEFVQER"
FT   gene            184971..186725
FT                   /locus_tag="Calhy_0144"
FT   CDS_pept        184971..186725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0144"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; KEGG: ate:Athe_2372 histidine
FT                   kinase internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05905"
FT                   /db_xref="GOA:E4QA30"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA30"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ05905.1"
FT                   /translation="MIRKNGVYKSKIFKKNFVQIVIVPIVIIAILGLFSCIIIEQYVKN
FT                   EINKNLETVLIQSKNNVELMLGEIDYLYMVFGINKDVTLQIKRILNSLYFSLEDIWQLN
FT                   MFKNVLNSISYTKPFIHSIYVYFENPEGNFIVTPDGITNFQYFYDKRWFDQYKKCKELM
FT                   WVERRKIQPYNFTEESIDVLTIYKKIKSAYSDVDEGVIVLNLYYDQVKKSLSLQSSIPE
FT                   HAMYILDQNGNVLVSNESESSNVSSLVLLKKGTDNYLTKRLESKKYNLTFVSVVSKDYL
FT                   YSIPIRLFKVTLELLLIFIVIAFAASYYIAKINYRNIKKIIDTINSATEGKPPKETKIT
FT                   SNDEYGYIMYNVIKNFIEKHYLVARLQALELLALQAQINPHFLFNTLEHIYLKTLALTG
FT                   TPNEITRMIENLSAILKYSLSNPKSTIFLRDEIKATKAYIELVKARYKEKFDVFWDYSE
FT                   DVLDVKVMKLLFQPLIENSIYHGIKPCEKRCGIKIRIKKLKNDFEHIAIWVVDNGIGMS
FT                   KEKLEEVQGRLSQDFDFSEHIGLLNTNERLKLIYGNNFKLKVWSKLGLGTVVKIILPID
FT                   FEYRKENG"
FT   gene            186726..187604
FT                   /locus_tag="Calhy_0145"
FT   CDS_pept        186726..187604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0145"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   ate:Athe_2371 glycoside hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05906"
FT                   /db_xref="GOA:E4QA31"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA31"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ADQ05906.1"
FT                   /translation="MLKRQDIYIRDPFIMPVKEKRVYYMFGTTDKNCWGDEKATGFDYY
FT                   VTSDLENFKGPYPAFRPPQNFWADRNFWAPEVHFYNGKYYMFATFCSPEGKRGTAILVS
FT                   DTVEGPYVEHSIGPVTPKDWMCLDGTLYIDEDSNPWLVFCREWVEVYDGQILAARLSDD
FT                   LRRIIDEPILLFTASSAPWTASIRVKDGRECFVTDGPFLFRTPNGALLMLWSSFDRERR
FT                   YCVGVAKSLSGNIIGPWQHKPEPIFSDDGGHGMLFRTFEGDLMLSIHTPNSRGNERPLF
FT                   IRLNEDDWENL"
FT   gene            complement(187658..191864)
FT                   /pseudo
FT                   /locus_tag="Calhy_0146"
FT   gene            190424..191371
FT                   /locus_tag="Calhy_0147"
FT   CDS_pept        190424..191371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0147"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   csc:Csac_2323 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05907"
FT                   /db_xref="GOA:E4QA32"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA32"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADQ05907.1"
FT                   /translation="MSNFIKTQKQKFLKILMTIEKVIKALGLKIKSSRRGRPKKFKLSH
FT                   IIACFVYKVKNKINSFRELEYKINENEEFKKAIGIEKSPDHSYFSKWAKVIEEGYIEGI
FT                   ARILVREIVPQTKVCAIDSTPLRSSRGDKEAEVGVCVSLGFYNGYKLHVLATVEDEVIP
FT                   IVWWLTRANIHDSKVVELLYEAKIFGPEVILADAGYNCAKWFEVADRLEIKFVAAVNKR
FT                   NSKDFSNVKNILRVKNMEFLRSEEGQRLYKQRTKIERLFGKLKGEYNLEQIRLRGFRTY
FT                   KRHVDWIMITYLIEVYIQKIENCKFSFKYTWNNL"
FT   gene            complement(192045..193490)
FT                   /locus_tag="Calhy_0148"
FT   CDS_pept        complement(192045..193490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05908"
FT                   /db_xref="GOA:E4QA33"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA33"
FT                   /inference="similar to AA sequence:KEGG:Csac_0363"
FT                   /protein_id="ADQ05908.1"
FT                   /translation="MRKKKNRLFTIVSVLLVLVLIIGAYFYVSYVNKKKQEAEEKKSSS
FT                   ASVTVTNFDRNKITKIDIKHDDIHLVLEKVKDKWIVNGINNPLYFDQDKIDDIAFSCAQ
FT                   MTAEKIADNNPKDLKKYGLDNPKSIVEATFSDGKKVTFYLGSETPITSTYYLMKKGDPK
FT                   VYVVWTNHAENFTIKPQKLLSVKIPEIDTQNITYVKLVRKGQPTIEIKKVDEKNKEDNE
FT                   WKYYVRLWNLVQPYSQPVGVASDKFSEFIENVPNFSPEDIVGEDVYNPKYGLQSPRIEL
FT                   IVKDNKNTLHLFVGNNADDSTVYCRMADSKVVFTMSTYKTDFMNTIKPFDLIEKFAYIV
FT                   NIDYVDKIEIFTKEKKHTLILDKKLIKKATSEEESDEYKYNFQADGRKIDEDTFKKFYQ
FT                   EIIGLLIDGENDKKPTGTPEVTMKFYLVNRKVDVMEYIPYNDDFYMVVRNGKSDFVIAK
FT                   EQVQKMLKDLEDLVAGKYKPPEN"
FT   gene            complement(193487..194944)
FT                   /locus_tag="Calhy_0149"
FT   CDS_pept        complement(193487..194944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0149"
FT                   /product="ABC-type uncharacterized transport system"
FT                   /note="PFAM: ABC-type uncharacterised transport system;
FT                   KEGG: csc:Csac_0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05909"
FT                   /db_xref="GOA:E4QA34"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA34"
FT                   /inference="protein motif:PFAM:PF09822"
FT                   /protein_id="ADQ05909.1"
FT                   /translation="MVKLDLKSIKSSFKTRKFKYGGYATMLTASVIAILIVLNLLVGQI
FT                   PAKLDLTHNRLYSLSKPTVDLLKNLKKDVTIYALFPTGNENPVISEFIQKYAEKSSHVK
FT                   IKYIDPYKNPGFVKKYDTSGSGIDEGSLIVESGSKFRVINRYDMVDYSYDEQTGESNVT
FT                   GLTIEQKLTPAILYVTSDKSPVLYELKGHGEDTLVGLGVSSEIEAANFEIKDLNLLTEK
FT                   SVPQDVSAVVVISPKTDISDIELKKLKDYINSGGRVLFLMDLLKDELKNFNSLFESLGV
FT                   RLEHGVVMEGDNNYNAGNPVWILPKLESHDIVNPIDLNNMYMLLPSAQPIVETKFKKRT
FT                   ITIEKLLTTTSNSWLRKDLNSTSLSKEKGDESGPFTLAVAITDKADALNTKLRPRDAKV
FT                   VIVGNATFLNAQFSKSVPGNLNFVINSLNWLQDKKDNLQIQPKDLTTFRLNLSTTQAMV
FT                   WAAITVVGIPVVILILGLTIWLRRRHL"
FT   gene            complement(194959..195822)
FT                   /locus_tag="Calhy_0150"
FT   CDS_pept        complement(194959..195822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05910"
FT                   /db_xref="GOA:E4QA35"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA35"
FT                   /inference="similar to AA sequence:KEGG:Csac_0365"
FT                   /protein_id="ADQ05910.1"
FT                   /translation="MSAVLKKELKIYFSTPTGYIFMGFFLLISGFFFAVSNLFPASPNY
FT                   TSVLGNITFIFLVVVPVLTMRLLSEEARTKTDQLLLTSPLKLTEIVLGKYLAAVTVFVI
FT                   TIAVTILYPIILSFYGDIPVAETLGAYIGFFLLGCSFISIGLFISSLTDNQFIAAVVTF
FT                   SALLLTWVIDWLESALPTDRVAGFVFVLILVGLVCAWIYLTIRNIIISVSAAIIGAGSF
FT                   VAVYILKPEFYDNAIVRFFKWFSLLSRYQKFTNGLLDLSSIVYYLSFIFVFIFLTIRVL
FT                   EKRRWS"
FT   gene            complement(195819..196772)
FT                   /locus_tag="Calhy_0151"
FT   CDS_pept        complement(195819..196772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0151"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: csc:Csac_0366 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05911"
FT                   /db_xref="GOA:E4QA36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA36"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ05911.1"
FT                   /translation="MIKVEHLTKKYGQHYAIHDISFEVQKGEIVGFLGPNGAGKSTTMN
FT                   IITGYLSPTEGTAYVDGFDILEEPEEVKKRIGYLPENPPLYMDMTVQEYLDFVSDIKKV
FT                   DKKEKKRSMDKIMETVGIAHVRNRLIKNLSKGYKQRVGLAQALIGNPPVLILDEPTIGL
FT                   DPKQIIEIRSVIKSLRSEHTIILSSHILPEVSAVCERVLIINKGKIVASDTPENLSKRL
FT                   THGSKLQLRVLGQRQKVYGILEKVPGVKYIEFIGPKEPNTVEIIVEAENDIDIRADIFY
FT                   ALSEAKLPILMMRAVDLTLEEIFLQLTTEEKEAEAV"
FT   gene            complement(196956..197477)
FT                   /locus_tag="Calhy_0152"
FT   CDS_pept        complement(196956..197477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05912"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA37"
FT                   /inference="similar to AA sequence:KEGG:Athe_2365"
FT                   /protein_id="ADQ05912.1"
FT                   /translation="MSDREILELILEKVTVLDQKVDRLEKRLESLEKRVESLEKRVESL
FT                   EKRVESLERRVESLERRVESLEKRMDALEARVERLELQVAENTQILKALEHLAQVNKAE
FT                   HDNFTHQLARIEGLLSSEISKNKEEHQLLFVKTEENSEKITRLEKDMVVIESVCGKNMQ
FT                   DIAFLKGLKN"
FT   gene            complement(197548..198555)
FT                   /locus_tag="Calhy_0153"
FT   CDS_pept        complement(197548..198555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0153"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: ate:Athe_2364 sodium/calcium exchanger membrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05913"
FT                   /db_xref="GOA:E4QA38"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA38"
FT                   /inference="protein motif:PFAM:PF01699"
FT                   /protein_id="ADQ05913.1"
FT                   /translation="MVAGYVLKLIISLFVILLGCTFFTNAVEWFGKKLNLADGAVGSIL
FT                   AAVGTALPETIIPIIAILFSKGESSHQVGIGAIAGAPFMLGTLAFFITGLAVIVYTLLK
FT                   KRTLKMNVDLSVFERDLTYFMIVYGIAVATTFIHNHKVIRTIIAFILFVAYLIYVKKTL
FT                   ADESENEETQELEELYFTRFLKLPNNLLWISVQLILSLAIIIFGAHLFVEYVQKVATLI
FT                   GISTLVLSIIITPIATELPEKLNSVIWIGKKKDTLAIGNITGAMVFQSSVPVVFGIIFT
FT                   PWNLKGITMVSAILAFSSAVLNLLWVKIRKNVNPFALLFGGVLYLIFIAYVFWI"
FT   gene            complement(198665..201322)
FT                   /locus_tag="Calhy_0154"
FT   CDS_pept        complement(198665..201322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0154"
FT                   /product="calcium-translocating P-type ATPase, PMCA-type"
FT                   /note="KEGG: ate:Athe_2363 calcium-translocating P-type
FT                   ATPase, PMCA-type; TIGRFAM: calcium-translocating P-type
FT                   ATPase, PMCA-type; ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05914"
FT                   /db_xref="GOA:E4QA39"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005782"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA39"
FT                   /inference="protein motif:TFAM:TIGR01517"
FT                   /protein_id="ADQ05914.1"
FT                   /translation="MNQNFSDFHSKTIKTILENLKTSLNGLSYQEAEERLKVYGKNVIE
FT                   EGKKKSIFALFLEQFKNVMVLVLFAAAIISILLGEAADAAIILAVLVINAVFGVAQELK
FT                   AEKAIDALKKLNMPYAKVYRDGHLMQIKTDEIVVGDIIEIEAGDIVPADLRLIESFNLK
FT                   IDESALTGESVPVEKDANDVLDQSTPLAERTNMAFMGTIVTYGRAKGVVVSTGMKTEIG
FT                   KIANFVNLQSAIDTKTPLHEKLEEIGKYLTVGILAIAFIVFVTGLLYRRDVFEMFLTAV
FT                   SLAVAAIPEGLPAVVTIVLAIGVQRMAKRNAIIRRLSSIETLGRVEVICSDKTGTLTQN
FT                   KMNVVKVYCNDNLSENLEHEDNATKTLLRIMALCNDVKLDLVDKQPQFIGDPTEIALVK
FT                   FAYEKGLNKNAIEKVFKRVYEIPFDSVRKMMTTVHQVKNDEKLLVFSKGAVDVIINKCK
FT                   FIMVNDEILPLDENTHQKILQANKEMSSNALRVLAFAYKEIDKNELEDKNAIEDTLIFI
FT                   GLVGMIDPPRKEAYGAVEVCYQAGITPVMITGDHKDTALAIAKELKIIDTSKDELSQVL
FT                   TGTEIEKLDDQQLKERVKEVRVYARVSPEHKLRIVSSWKSHGKIVAMTGDGVNDAPALK
FT                   AADIGIGMGITGTDVTKNVSDVILADDNFATIVAAVEEGRKIYDNIRKTIQFLLSSNIG
FT                   EVVTLFFATLLNWVVLYPIHILWVNLVTDTFPALALGMEKAESDVMKRKPKKTSENIFA
FT                   GGLGFSILYQGLLKGLITLLVFFIGNKLYGHKTAITMTFMTLSLIQLTHAYNVRSNINS
FT                   LFKMGVFSNKYLNLAFIASFLLQVVVLLVPPLRELFRLSYLNFSQWAMVIVASLSIIPI
FT                   VEVVKYFTRHFHKE"
FT   gene            complement(201650..201973)
FT                   /locus_tag="Calhy_0155"
FT   CDS_pept        complement(201650..201973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0155"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   csc:Csac_0542 cupin 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05915"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E4QA40"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADQ05915.1"
FT                   /translation="MPKRNIREEPVMFGDPGFSSWGIAYYKKGQKNIVEKHAHDCDEYY
FT                   FVLEGKLKVISEDKEYILEKGDMLWTRMGDFHEIVEVLEDTTMFWLEGPLMGKKRKGHQ
FT                   YEL"
FT   gene            202322..203416
FT                   /locus_tag="Calhy_0156"
FT   CDS_pept        202322..203416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0156"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   ate:Athe_2361 glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05916"
FT                   /db_xref="GOA:E4QAJ1"
FT                   /db_xref="InterPro:IPR012375"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAJ1"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADQ05916.1"
FT                   /translation="MLREGQVRIPSGCAISGFINKKGVRISGTDIINSIAIMKERGNGL
FT                   GGGFAAYGIYPDRKDWYAFHLFFDDIKAKEDTEHFLNQNFEILESEVIPTRKVSSIQNS
FT                   PIVWRYFVKPLEKRLRDTEKTEEDFVVDSVMFINSKIDGAYVFSSGKNMGAFKGVGYPE
FT                   DIGEFFRIDEYKAYIWTAHSRFPTNTPGWWGGAHPFTLLDWSIVHNGEISSYGTNYRYL
FT                   EMFGYKCTLRTDTEVMAYLFDLLLRRHKLSVEIAAKALAAPFWSVIDRQDEKEREKLRA
FT                   IRAVYASCLVNGPFSIILGFSNGILALNDRIKLRPLVAAQKGDFVYVASEEAAIREICK
FT                   DPEKVWMPKGGEPVYVTLDEGVIV"
FT   gene            203413..204921
FT                   /locus_tag="Calhy_0157"
FT   CDS_pept        203413..204921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0157"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /EC_number="1.4.1.13"
FT                   /note="KEGG: ate:Athe_2360 glutamate synthase (NADPH);
FT                   PFAM: ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05917"
FT                   /db_xref="GOA:E4QAJ2"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAJ2"
FT                   /inference="protein motif:PRIAM:1.4.1.13"
FT                   /protein_id="ADQ05917.1"
FT                   /translation="MISLYENEFEVVRDETKCIRCKVCVRQCANEVHEYDEEEDRVVAD
FT                   SSKCVACHRCVVMCPTKALTIKKTENAFKENANWTPAYINEIYKQAETGGILLTGMGND
FT                   KPIPIYWDRLLINASQVTNPSIDPLREPMELKTFIGRKPDKLEFDENGNLKTKLPPQLE
FT                   LEVPIMFSAMSFGSISLNACESLAAAAVEVGTYWNTGEGGLHQKLYKYKERAIVQCASG
FT                   RFGVDVDYLNAGAAIEIKIGQGAKPGIGGHLPGEKVGEEVSRTRMIPIGSDAISPAPHH
FT                   DIYSIEDLRQLIFALKEATNYTKPVGVKIAAVHNVAAIASGIARAGADFITIDGVRGGT
FT                   GAAPLRIRDNVGIPIELALAAVDSRLREEGIRNQVSIIVAGSIRNSADVVKAIALGADA
FT                   VYIGTAALISLGCHVCQKCHTGKCNWGIATQDPVLVKRLNPEIGARRAANLLKAWSHEI
FT                   KEMLGLMGINALESLRGNRLMLRAVGLTEKEMEILGVKHAGEGV"
FT   gene            204925..205392
FT                   /locus_tag="Calhy_0158"
FT   CDS_pept        204925..205392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0158"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: ate:Athe_2359 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05918"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAJ3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2359"
FT                   /protein_id="ADQ05918.1"
FT                   /translation="MARKIFPKEDVCVGCHLCEVYCVYAHSKYKKPNAKAHELVKLYIK
FT                   HKDSKPTPRILVEEKSGTWTTFALQCRHCDDAPCTKACITGAMKRLEDGRIVCDEEKCV
FT                   GCWSCIMACPHGAVRRGENKKAASKCDLCLELGEPACVKNCPNEALEIKEV"
FT   gene            205414..206682
FT                   /locus_tag="Calhy_0159"
FT   CDS_pept        205414..206682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0159"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ate:Athe_2358 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05919"
FT                   /db_xref="GOA:E4QAJ4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAJ4"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADQ05919.1"
FT                   /translation="MKYVIIGNSVAACGCIEAIRKVDTQNPIVVISDEKYRVYSRPLIS
FT                   YYLGGKVDESKMYIRDEDYYEKNKVETKLGKKAVAVDFKNKEVILDDGEKVKYDKLLIA
FT                   TGGKPFIPPTKGSEAKNVFTFIKFDDVKAIDEAIKNGAKKAVVIGAGLSGLKAAEALIK
FT                   RNLDVTVVELANRILGSILDLEASRIVQDELEKHGIVFKLETSVDEIIGDGKVERVKLK
FT                   NGEVLDADIVVFAIGVVPNIDFLKGTDLKINRGIVVDNRMQTNIEDVFAAGDCAEGYDF
FT                   VFEQQRVIPIWPNAYNQGETAGYNMAGAQKTFDRGFPMNSIGFFDVHMITAGIVVPNSD
FT                   DIEVLAKHDKEKNTYRKIYLKNGRVVGFMFINSIDRAGMITNMIKEGFNVESIKHRLLD
FT                   EDFGYLDLPKEIRQEKILGGAKA"
FT   gene            206684..207436
FT                   /locus_tag="Calhy_0160"
FT   CDS_pept        206684..207436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0160"
FT                   /product="glutamate synthase alpha subunit domain protein"
FT                   /note="PFAM: glutamate synthase alpha subunit domain
FT                   protein; KEGG: ate:Athe_2357 glutamate synthase alpha
FT                   subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05920"
FT                   /db_xref="GOA:E4QAJ5"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR035710"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAJ5"
FT                   /inference="protein motif:PFAM:PF01493"
FT                   /protein_id="ADQ05920.1"
FT                   /translation="MNLHKLTIDAKGIHYKELNEMIENALNEGYKEIDLINVNGQRYIG
FT                   DGLTFPDRKLNIYGTPGNDMAAFMNGLTIEVFANGQDGIGNTMNAGKIIVHGSAGDIIG
FT                   YGMRGGEIFIKGDVGYRVGIHMKEYQDKIPVLVVGGKAGDFLGEYMAGGRIIVLGLTLK
FT                   DGEPITGLYCGTGMHGGVMYLRGQLQPYQLGKEVKVVDMEEEDYKFIDKYVTEFVKLFG
FT                   YSKEYIMSKPFYKLIPYNKRPYGKLYAY"
FT   gene            207531..208022
FT                   /locus_tag="Calhy_0161"
FT   CDS_pept        207531..208022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0161"
FT                   /product="metal-dependent phosphohydrolase HD sub domain
FT                   protein"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: ate:Athe_2356 metal-dependent
FT                   phosphohydrolase HD sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05921"
FT                   /db_xref="GOA:E4QAJ6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAJ6"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADQ05921.1"
FT                   /translation="MDSIDLIALEMIKYFKNDVRRINHALKVFSFARLIGKAEGLDGKK
FT                   QYILEAAALLHDIGIKVCEQKYNQAAGHLQEIEGPEVAKEILLPMNIEKDILERILFLI
FT                   GNHHSYSKIDDIDFQILVEADFLVNIYEDSMKLETIKSIKHKYFKTKMGLFMLEKMFEV
FT                   "
FT   gene            208119..209684
FT                   /locus_tag="Calhy_0162"
FT   CDS_pept        208119..209684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0162"
FT                   /product="L-lactate permease-like protein"
FT                   /note="KEGG: ate:Athe_2355 L-lactate permease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05922"
FT                   /db_xref="GOA:E4QAJ7"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAJ7"
FT                   /inference="similar to AA sequence:KEGG:Athe_2355"
FT                   /protein_id="ADQ05922.1"
FT                   /translation="MDLFLSVLPILLVLFLLIFAKKTADIAGLVGWVVTALIAIVYFKT
FT                   SFDVVLKSSIMGFLAALPVSLVVVTSILQLNVMESAGAMKRIIVFVKGLSKDDKVFQTL
FT                   ILNVGFGTFLAATGAVPVTVLPPILIGLGYSTFAAIALSAVGFDALCTYALLGTPLVVF
FT                   SQIANVDLITAARYFLPFVGVVSFTISLAMLFIIGNSKFVKRGFVPAIIVGLTSYAAAE
FT                   LAILVKAPVITGIFAGILIMLVMMVILKLLGKRVYDSSHFTEEDRKVEKTMGIIKATSP
FT                   WILLVVFILITNLITPIREFLYDKLSMPVEVMKGPKIKPIFTRVIWQSYTWILISTVIS
FT                   IFIFKMDGKQLKSVWEKTKSRIPKPFWSSTVFFLMAYVMMYSGYQKTSNGYELLQKAHN
FT                   IVYVLAEYSAKGFKNAYAFIAPYLGILGGFITGTETSTVAMFAKYTIETSNLLGLSPLL
FT                   MVAAVAFGGGLASGISPSKLQNAAAAIDAIGQESKVLKTTLVISLVMAFITGIISFVLR
FT                   NFTV"
FT   gene            209849..212187
FT                   /pseudo
FT                   /locus_tag="Calhy_0163"
FT   gene            complement(212247..212774)
FT                   /locus_tag="Calhy_0164"
FT   CDS_pept        complement(212247..212774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0164"
FT                   /product="D-lyxose ketol-isomerase"
FT                   /EC_number="5.3.1.15"
FT                   /note="KEGG: dtu:Dtur_0707 YdaE"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05923"
FT                   /db_xref="GOA:E4QAJ8"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAJ8"
FT                   /inference="protein motif:PRIAM:5.3.1.15"
FT                   /protein_id="ADQ05923.1"
FT                   /translation="MKKSEYKKWQRKTCEYFEKAHIVLTEKEKENIEVADFGLGKIEKV
FT                   GLQLVVYVNTERVCAKELVLFPFQTCPEHKHIEKEETFRCRFGKVYLYVEGEPTANRKC
FT                   KPPEGDEKYYTVFHEIELNPGDQYTIMPNTLHWFQAGEEGAVVSEFSTKSTDETDIFSD
FT                   PRIKRIPVIEDD"
FT   gene            complement(212856..214472)
FT                   /locus_tag="Calhy_0165"
FT   CDS_pept        complement(212856..214472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0165"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2032 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05924"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAJ9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ05924.1"
FT                   /translation="MTSVKSKKFKVVLSFTLLIVFFIFITLPVSAVSPSFAASSKSSKP
FT                   VITWWTALDAKVAVSYNNLAQVACYQYLMKKFNVKIEFIHPPSGSETEQFNLMLASKKL
FT                   PDIIETDWLSYPGGPLKAIADGVIIKLNNYLQKYAPNLKKYLDTHPDIKRDVITDDGTI
FT                   YCFPFIREGNLTRVGDGPYIRKDWLDKLKLPVPETVNEWTNMLRKFRDNAKILNGRKAP
FT                   IYPFSIAFRFGSTLRTSWRGSFLAGAWGITLDFYVENGKVKYGPLTSQYKEFIKVLQTW
FT                   WKENLIDPDILNMNTQAIQAKILNDQIGAYLGRVSGDTGRFLQAKKGTEFDITVAPWPV
FT                   LKKGQKPEIGHKHFAYPGYGSAAITTQCKNIPLAMKILDWGYSKEGYMVYNFGIKGKSY
FT                   VIKNGKPMYTDEILNNPKLSILEALSKYARAGWVGPFPQSEDYVVQILPFPQQREALKI
FT                   LSQPSNSKILPPVTLTVEESKKVANILNAINTYYDEMFVRMITGKFTNIDSFQKTLKRM
FT                   GIDEVLKVYQDAYNRYIKRKI"
FT   sig_peptide     complement(214359..214472)
FT                   /locus_tag="Calhy_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.570 at
FT                   residue 38"
FT   gene            214645..216075
FT                   /locus_tag="Calhy_0166"
FT   CDS_pept        214645..216075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05925"
FT                   /db_xref="GOA:E4Q7K4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q7K4"
FT                   /inference="similar to AA sequence:KEGG:Csac_0656"
FT                   /protein_id="ADQ05925.1"
FT                   /translation="MFNTKPKQLSFIDLFSHLKASALYKPESLLGLFNKFIDLSHYIPS
FT                   SFYNAYYKYFGKHRYFSLESMLCCFLVQKLLKLNTLTQLRAVLLNSFELRSFCNLHGNV
FT                   PSISTLSRFRKIFASEIHKLFQNISIHAHNISIQQCPQDSSILIFDTTGIVPKVRENNP
FT                   KFIHLLLKNTSKANPELPSEKVYSLVYSSLPKTANANSNIRLMFVNGHFCWALKFAVIT
FT                   NALGIPLALVPLFNYDSPSSDPQEAKAISDSKGLIPSLETLFSYIPKNFSTFIADSALD
FT                   SHNIYSTLKNTFNFSKIVIPLNTRASKNTTPTSDPNIVISEDGIPICKKFNKPFKPEGK
FT                   CQGKNRSLRLKWTCPMSQYKDGKRICSCPQPCTTSKSGRMFYTYPDNFRSFPGINRNSQ
FT                   EFFDLYKKRVAVEQTIYHLKSYMGSDTISTYDHISIFSDFLLSAITFSLLFILAHNIKL
FT                   YCSKLTIKKLNKLKKLIA"
FT   gene            216581..217504
FT                   /locus_tag="Calhy_0167"
FT   CDS_pept        216581..217504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0167"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2331
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05926"
FT                   /db_xref="GOA:E4QAK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAK1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05926.1"
FT                   /translation="MNKWQELRKDLIRNRNLYLMLLPIVAYYFIFHYIPIYGLQIAFKD
FT                   FNPAKGIWGSQWVGLEKFKEFFVYDSFYVWRIIRNTILINVYDIIFGFPAPIIFALLLN
FT                   EVKNSMYKRTLQTISYMPHFISTVVLVGIILDFFSRDGLINQILKSLGLLSEPISFMTE
FT                   PGWFRPIYVGSGIWQQLGWNSIIYLAAISNIDPQLYEAAKIDGAGRFRQALYVTLPGIM
FT                   PTIIIMFILRVGSIMNVGFEKVFLMYNPLTYETADVISTYVYRKGLLEMDYSYGAAVGL
FT                   FNSLINFALVVLTNQLSKRFTETSLW"
FT   gene            217522..218406
FT                   /locus_tag="Calhy_0168"
FT   CDS_pept        217522..218406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0168"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2332
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05927"
FT                   /db_xref="GOA:E4QAK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAK2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05927.1"
FT                   /translation="MKIRKSAGEIIFDSFNYIFLGLLCFTMLYPILYVIFASFSNPIKL
FT                   MAYRGPLLRPLDFSVEAYKLLLSYPMIWIGYRNTIIYVVLGTAINILLTTMGGYVLSRK
FT                   NLKLKNPIMFFIAFTMYFSGGMIPTYLLVQSLGMIDTIWAMIIPGAISTTNLIIMRTGF
FT                   HAVPDSLEESARIDGAGDWTILFRIMIPLAMPMIAVMILFYAVGHWNAFFNAIIYLRSR
FT                   ELYPLQLVLREILIMSSTENMTTGISDASDRFAVTELIKYAAIVVSTVPILCIYPFLQK
FT                   YFVKGVMIGAIKE"
FT   gene            218541..219941
FT                   /locus_tag="Calhy_0169"
FT   CDS_pept        218541..219941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0169"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   dth:DICTH_1638 alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05928"
FT                   /db_xref="GOA:E4QAK3"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAK3"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ADQ05928.1"
FT                   /translation="MKISIVGAGSVRYSLQLIGDIAKIPELSGVNVTLMDINNQRLDAI
FT                   YILAKKYIEELGANISIEKTLSLEEAVKGADFIINTALPYPPEHEDGFEKYEIITQVAE
FT                   KYGYYRGIDSQEFNMVSTYSYMICSYFDLKLALQISELMEKYSPNAWLLQTANPIFEIT
FT                   QYLTRYTNTKIIGFCHGYGGIYEVFETLGMDKNEVDWQVSGVNHGIWLNRFKYKGEDGY
FT                   KLLDKWIEEGLPNWESKNPWDLQLSPAAIDMYKFYGMLPIGDTVRNGSWKYHYNLETKK
FT                   KWHGKFGGIDNEVERPKFHRQLRASKQRLIELAKKVEADSNCSLTVELPELFTTDRMSG
FT                   EQQILFINALINDKRTRLVLNIPNRGVISGIPDDVVVEVTCQVDAQGIHPEKVEPDLTD
FT                   RIKKFYLVPRIMRMEMALEAFRTRDIKVLEEFLIRDPRTRSYEQVKNVLRELLELPFNR
FT                   EIKEYFGV"
FT   gene            220221..222536
FT                   /locus_tag="Calhy_0170"
FT   CDS_pept        220221..222536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0170"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: ate:Athe_2354 glycoside hydrolase family 3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05929"
FT                   /db_xref="GOA:E4QAK4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAK4"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ADQ05929.1"
FT                   /translation="MSIEKKVNELLKQMTVEEKVYQLTSVLVKDILENNQFSEEKAKKV
FT                   IPHGIGQITRVAGASNFTPQQALEAANQIQKFLIENTRLKIPAIIHEESCSGFMASKAT
FT                   VFPQSIGVACTFDNELVKEMAKVIRLQMKAVGAHQALAPLIDVARDARWGRVEETFGED
FT                   PYLVANMAVSYVEGIQGKNFEEKIIATGKHFVGYAMSEGGMNWAPVHIPERELREVYLY
FT                   PFEVAVKVAGLKSIMPAYHEIDGIPCHANRKLLTEIARDEWGFDGIFVSDYSGVKNILD
FT                   YHKSVKTYEEAAYISLWAGLDIELPRIECFTEKFIEALKEGKFDMAVVDAAVKRVLEMK
FT                   FRLGLFDNPFVKTENIIELFDNKEQRSLARKVAQESMVLLKNDGILPLKEKDLKKVAVI
FT                   GPNANSVRNLLGDYSYPAHISTTEMFFMKEEVDLGDEDAFVKKVVNIKSVYEVIKERIG
FT                   KHTEVVYAKGCDVNSQDKSSFEEAKKAAQGADVVIVVVGDKAGLKLDCTSGESRDRASL
FT                   KLPGVQEELIEEISKVNQNIVVILVNGRPVALENFWQKSKAILEAWFPGEEGAEAIADV
FT                   IFGKYNPGGKLAISFPRDVGQVPVYYGHKPSGGKSCWHGDYVEMSSKPFLPFGYGLSYT
FT                   TFEYKNLTIEKEKITMDESIKISVEIENTGNYEGDEVVQLYTRKEEFLVTRPVKELKAY
FT                   KRVHLKPGEKKKVVFEIFPDQFAYYDYDMNRVISPGTVEVMVGASSEDIKFTGTFEIVG
FT                   EKKDAKEIKNYLSRAWCE"
FT   gene            complement(222604..224607)
FT                   /locus_tag="Calhy_0171"
FT   CDS_pept        complement(222604..224607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05930"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAK5"
FT                   /inference="similar to AA sequence:KEGG:Athe_2353"
FT                   /protein_id="ADQ05930.1"
FT                   /translation="MQEKLIILQQETFKDFPIGNFPFDPNHSAIGEYHCYIPEGYRGRW
FT                   YDPVVYHGWNGSGPTWIVTEEDGKKFMEQTRVLAALKNLWPMLVTGDEFWQDYMVEAQV
FT                   RMLSTLPSAHAGIMFRYVHARSFYALLLHDKKLKLIKKDQENLEVLAWCNFNYDCDTFY
FT                   NLKVECCGSKLIGYVDNKKMVEAIDSSYTRGKIGITATMPAQFTDVRVLMNHQAYKNYL
FT                   MAKNNWVQVEKNLQCEYPQPVLWKIIDFKNFGAGRQIRFGNLPENNQKFMVIAQHQKRV
FT                   HRDAYANISCLTAIDLDGRILWQIGEASSQKDHAYLTADLPFQVCDVDLDGVDEVIVAR
FT                   NFKIMILDGLTGKIKKQIPAPFSDETDKLYSVPFGQYAFDRVNIDSIRIANLTGKSKPT
FT                   DIIVKDRYSRLWAYDNNLELLWKFNGKNTGHFMFTKDIDNDGKEEVVVGYHLLDHDGKL
FT                   IWTLPIESDHTDEIIIGPIDPERNEDIIAMACGDEGLVLSDLKGNIIKRHLIGHAQRIS
FT                   VGNYRPDLKGYEICVTTYWGYQGIIYIFDCKGNLLHQFESPVPGNIITPVNWTGDGKDL
FT                   ILLSGHVQHGGMIDGFGRRVVTFPDDGHPILCADSIDLTGDGRDEILLWDEKKMYIYTQ
FT                   QDNGIKSDVLVPNKYSTINGSNYRGEYSFYNT"
FT   gene            complement(224692..225765)
FT                   /locus_tag="Calhy_0172"
FT   CDS_pept        complement(224692..225765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0172"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: gyc:GYMC61_1695 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05931"
FT                   /db_xref="GOA:E4QAK6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAK6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADQ05931.1"
FT                   /translation="MKRHLEIIKFVFIYLFLICLVSAFLVITYFITKAIYTKLSWQPQE
FT                   LVAQIINSILGIILSGITIRLVSSFLFKGRREHPLWKEVINAINKISKGDFNVNLEKLN
FT                   KQNHPFIELIDGINNMAANLKAMEEMRQEFISNISHEIGSPLTSIRGFASALKNENLSF
FT                   EQRKHYLDIIENECIRLSKLSENLLRLTMLDSEQYPLHLTTYRLDKQIQLTILEFEPQW
FT                   SEKELDITLSLDEIIITADQDLLKQVWQNLIDNAIKFTLKGGAIKIQLYKKETYAIVTI
FT                   SDTGIGISEQDLPRIFERFFKADKSRNRAVSGSGLGLSIVKKIVELHNGKIFVNSQLGK
FT                   GTEFIIQLPLNVKKHRK"
FT   gene            complement(225762..226436)
FT                   /locus_tag="Calhy_0173"
FT   CDS_pept        complement(225762..226436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0173"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: gyc:GYMC61_1696 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05932"
FT                   /db_xref="GOA:E4QAK7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAK7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ05932.1"
FT                   /translation="MPRILIVDDDPHIRELVAHFLTLEGFDIYEAANGKDALNILDTVK
FT                   VDLVILDIMMPEIDGWQLCHNIRKYYGDIPILMLTVKGETNDKVKGFEVGADDYLVKPF
FT                   DPIELVARVKALLRRYQISTSQTIKIGELFLNKKTYECRVGEEEILLPPKEFELLFKLA
FT                   SYPGKTFTRDQLIEEIWGYDYEGDERTVDVHIKRLREKFSKYCIFVIRTIRGLGYRLEV
FT                   IK"
FT   gene            complement(226586..227389)
FT                   /locus_tag="Calhy_0174"
FT   CDS_pept        complement(226586..227389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0174"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: gka:GK0909 ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05933"
FT                   /db_xref="GOA:E4QAK8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAK8"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADQ05933.1"
FT                   /translation="MDNFAVNYQLRRQPGFIQAIQNSLILAFRSLLKVWHTPEQLTDVT
FT                   LQPVFFILMFAYIFGGAIAGNVHKYLPTIVPAILVQTLFSASIISGTQLREDMDTGVFD
FT                   RFKSLPIAQIAPLAGPLLADILRYVVAMLSTFITGYIIGYRPAGGVGHLIIAALFVIGF
FT                   SWSISWVFAFVGVVARTASSVQAISMLVMFPLMFLSNAFVPVETMPHAVQWFAKNNPIS
FT                   HIITAVRELTNVGKIGSDFVISLIGMIIIVGIFAPLTVRIYSRRT"
FT   gene            complement(227434..228390)
FT                   /locus_tag="Calhy_0175"
FT   CDS_pept        complement(227434..228390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0175"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; KEGG:
FT                   gka:GK0910 ABC transporter ATP-binding protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05934"
FT                   /db_xref="GOA:E4QAK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAK9"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /protein_id="ADQ05934.1"
FT                   /translation="MTKARSISTEFAIETYNLIKKFGENRAVDGVNLKVRSGSIYCVLG
FT                   PNGAGKTTTIKMLATILRPDGGWARIFGFDVVKDAYIVRQLISVTGQYASLDESLSGLE
FT                   NLILIGQLLGLNRKEARRRANELLEEFELIEAAKLPLKKLSGGMKRRVDIAASLIVQKP
FT                   LIFLDEPTTGLDPRTRNQMWNTIRRLVKTGSTVLLTTQYLQEAEELADQIAVINHGKVV
FT                   AEGTVEELKKSIGNSTLQLKVKNPTDLETARKIVESLLKTRSNVSLETGSITAPMTDTE
FT                   LIADLVIALRESKIHIAELNVQQPTLDEVFLAIIGQN"
FT   gene            228544..228909
FT                   /locus_tag="Calhy_0176"
FT   CDS_pept        228544..228909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0176"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: ate:Athe_2352 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05935"
FT                   /db_xref="GOA:E4QAL0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAL0"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADQ05935.1"
FT                   /translation="MIEFDPNVPIYLQVIEYLKKEIVSGKIKPGEKLPSVREMSRMFNI
FT                   NPNTAQRVFQELEREGLTKTERGIGNFVTTDSKLIQELKEKMAEKIVENFIVTMKEIGY
FT                   DEDKILGLISKKLNGKG"
FT   gene            228910..231451
FT                   /pseudo
FT                   /locus_tag="Calhy_0177"
FT   gene            complement(229367..230797)
FT                   /locus_tag="Calhy_0178"
FT   CDS_pept        complement(229367..230797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05936"
FT                   /db_xref="GOA:E4Q7K4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q7K4"
FT                   /inference="similar to AA sequence:KEGG:Csac_0656"
FT                   /protein_id="ADQ05936.1"
FT                   /translation="MFNTKPKQLSFIDLFSHLKASALYKPESLLGLFNKFIDLSHYIPS
FT                   SFYNAYYKYFGKHRYFSLESMLCCFLVQKLLKLNTLTQLRAVLLNSFELRSFCNLHGNV
FT                   PSISTLSRFRKIFASEIHKLFQNISIHAHNISIQQCPQDSSILIFDTTGIVPKVRENNP
FT                   KFIHLLLKNTSKANPELPSEKVYSLVYSSLPKTANANSNIRLMFVNGHFCWALKFAVIT
FT                   NALGIPLALVPLFNYDSPSSDPQEAKAISDSKGLIPSLETLFSYIPKNFSTFIADSALD
FT                   SHNIYSTLKNTFNFSKIVIPLNTRASKNTTPTSDPNIVISEDGIPICKKFNKPFKPEGK
FT                   CQGKNRSLRLKWTCPMSQYKDGKRICSCPQPCTTSKSGRMFYTYPDNFRSFPGINRNSQ
FT                   EFFDLYKKRVAVEQTIYHLKSYMGSDTISTYDHISIFSDFLLSAITFSLLFILAHNIKL
FT                   YCSKLTIKKLNKLKKLIA"
FT   gene            231448..232146
FT                   /locus_tag="Calhy_0179"
FT   CDS_pept        231448..232146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05937"
FT                   /db_xref="GOA:E4QAL2"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAL2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2350"
FT                   /protein_id="ADQ05937.1"
FT                   /translation="MMAKYLKYQYRSGLLFYIFFVLGITFAMVWSFNSKSVKIEPDRTL
FT                   KIVIIWLWWFLSLMGVLVYHFVRWSGIFKSPERFLLLSSPKFKPFHFLFGGIAHAVLDV
FT                   LIFSVWFNLVGAIMITPKKYILDFHKIVRILGLNDVFIISVLFFTTIYFWYLTTVIYWN
FT                   TIKSSSKWGWCLIFAFVVLGYIQIKISEFIGKINLSFPAFILAVILFNFAIYSILIFFN
FT                   LKALKKGLDT"
FT   gene            232302..233006
FT                   /locus_tag="Calhy_0180"
FT   CDS_pept        232302..233006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0180"
FT                   /product="TraX family protein"
FT                   /note="KEGG: ate:Athe_2346 TraX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05938"
FT                   /db_xref="GOA:E4QAL3"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAL3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2346"
FT                   /protein_id="ADQ05938.1"
FT                   /translation="MDKFVLKLKSIPYFSILSKDLTKSKSNLLKLIACITMFIDHTGYL
FT                   FFPQKPILRIIGRIAFPIFAYQVAVGFWHTSDHKKYLKRLLIFAIISQYPFYLMTGDGE
FT                   LNVIATFFFAALCLYFFKSSWYVLVIVPLAISYFVSMDYGIYGVLAVLIFYFLYEKPIL
FT                   QLVGFSVLTVIASYLLGWQLQVYSILSVILILFIRMFPVDFEFRLNKYFFYWFYPVHML
FT                   FLVFIGKLLGYL"
FT   gene            233116..233550
FT                   /locus_tag="Calhy_0181"
FT   CDS_pept        233116..233550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0181"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: ate:Athe_2345 DNA polymerase beta domain protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05939"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAL4"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADQ05939.1"
FT                   /translation="MPEINIQEIKKVVVEILKKEISPWLIIIFGSLAKGNFRQDSDIDI
FT                   AFFSDREVSNIERFRISQELADKLNRDVDLVDLKSASTVLKAQIVGTGEVIYCEDEKRK
FT                   NLFFMRTLKEYALLNEERDIVLKSFFGMSIYSEGEKNYDR"
FT   gene            233540..233959
FT                   /locus_tag="Calhy_0182"
FT   CDS_pept        233540..233959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0182"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   ate:Athe_2344 protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05940"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAL5"
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /protein_id="ADQ05940.1"
FT                   /translation="MIDDIIANKIQIIERCLRRINEEYENNPKNLLNYTKQDSIVLNLQ
FT                   RAIEAAIDIAIHLCAVFKFGIPQSCREVFDLLEKNKVVSEELAKKLKAMVGFRNIAVHD
FT                   YQAINLEILKNIIEKNLSDFLEFKSSILNFLQKRS"
FT   gene            233971..234957
FT                   /locus_tag="Calhy_0183"
FT   CDS_pept        233971..234957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0183"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: ate:Athe_2343 TIM-barrel protein, nifR3
FT                   family; TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05941"
FT                   /db_xref="GOA:E4QAL6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAL6"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADQ05941.1"
FT                   /translation="MLDIKGKIFLAPMAGFTDKVFRRLCSRFGADVTVTEMVSSKALVL
FT                   GSAKTKELISFSEEEKIRSVQIFGSDAKIMAESVKILQDEFEYDFIDINMGCPVPKVVK
FT                   SGEGSALMKNPSLAAKIVEEVAKVSRKPVSVKIRKGFDDENINAPEFAYILQESGASFV
FT                   TVHGRTRAQLYSGKADWEIIRKVKEKVKIPVIANGDIVDFESAKRAYEVTRADSIMIGR
FT                   AALGNPWVFLQIKEGFEKGYVETKVLPHMKIRVAIEFFTQLCSEKGEKMAVLEARKHLS
FT                   FFVKGIENAAKIRDKINRINNATELLEFLEELAASLEKKESFVDNIL"
FT   gene            234999..238031
FT                   /locus_tag="Calhy_0184"
FT   CDS_pept        234999..238031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0184"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: ate:Athe_2342
FT                   S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05942"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAL7"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ05942.1"
FT                   /translation="MIKNKMKIITLYRLISWVVLILFFLMLIPANIQAAQEYVGSSSYS
FT                   KMAKNTQIVNLPHNALARDSFLFLSALGFFNTVARQKINPSDTLSKEEALSVILNSVGK
FT                   QQDAFVRAEKLELKRPSGQKLVKPYNYLYLGYIQLAYDMKILSKKEYQDAISQVQPSEK
FT                   EHEKMTQQLIKKNDDTIAKAVYEGRPYSYDDLIFVRSAPATRQEVCLWVVKAFKVPLTY
FT                   ENLAKTYPDYDRIDSKFLSSINTLLKNGALVGRSDGYLHPDDYITYEELAFILGSLKPN
FT                   ILSANGLKEVKLEVKDIQKFNTDKMVLDCEDDNGNDVNITVNPGKQDFGVIADGNFLSS
FT                   SYLQKGDYVAFYVNSKNEVVLASILQRPGQENIKGVISKIDAKKRTFSLKLADGKVYNL
FT                   SLHPKVTIYDANSGKSLNFSELNVGNLVQVKVQKDRADAITLLSLDSPEIERVQGIISR
FT                   ITKDRIVLSQNGQLTEYLLSPDTVYIDKGDFSRVLIKNDFYEGMKVLAGTACGYVQYLS
FT                   TTYDEKSEDIVSGILHEVDSNLGYLEIYNQEGAKKSYRFSKKLGLKVKKDGQNASLDSL
FT                   LPGDVVFLYFSGDFVRTVTASSNLQQKVAKIENVVRSLASGLPQKIIVNIDGRIYGPYE
FT                   INDNVDIVKNGIPAALKDIMPGQYVKLTGSFFGSSAYIRRIEISGNEYVKNIYIAKGTV
FT                   NGNVLYLSDIQILRNNAFEPLYTWLSFQIPSDLKFILDGRPQASLSKLQNLPVVVVTKE
FT                   RFSQEVLDTVVAISRGSFTKIQGEVSMVSSNSVVISGNRYSIGNKTYTVANGLLTPASF
FT                   KVGDEIIGVASQDTIVVAKYQEGMSKPVFVRGQVLDVSELEYITVKDYVYLDGQRGWQY
FT                   VPSKLTLLYDTQTVLCDVYGLGSPKEILNLKNKSVYIIHNGKYANVIIDASFGGYIVTG
FT                   VVGKDMKILNAQYNDMMTQTWNRIDKSFTLDTTQAVLIDAGGNLTAQMPQFGDRVLLLV
FT                   PQSSFDISKSVLTPSIVLVNY"
FT   gene            238067..239521
FT                   /locus_tag="Calhy_0185"
FT   CDS_pept        238067..239521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0185"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: ate:Athe_2341
FT                   S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05943"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAL8"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ05943.1"
FT                   /translation="MNKRYPIAVIMFLCVLFIFGWQVAFGEEGYLGYEGGISAYKDPDP
FT                   KKTKIEYYEYTFITGKPILLSGTIDAKIKRAANNETLSYNYDLKDSTGKISVKRTVSLK
FT                   GTLTKLQNGSITKEYTISTYKETLTVDSTTYNLQNYSFSKSTAVDTNPAVSFFQGQWTL
FT                   EKTYDKGLKITIEGKNYGYDGYWGSGEFQNIKQTVETPSWFATINYNIATVQKTILEFQ
FT                   QNNLPSSIPGTYVLKSKVEGNFTAMYDLPTFTKTGEVLTIRQKGKVTKSIAKSPIVRMA
FT                   IAPTLPKVKGYEYEDAVNTCFAFGGFDSATDFNPTEYITRAQFAKLLMDTLNIYSNYYN
FT                   PRTVQKKSIYKDVPLNHKYYGYIYAVTKAGLMRGKSAEYFKPEDYITRAEAAVVISKVL
FT                   GFDKKVTQPITQTDYLDDDSIPVWAKDAVKVLKDEKIMVGTEDNNFLPQQRLTKGTAAN
FT                   LVYNLINFLRDTLARRYLDMSLFSSD"
FT   sig_peptide     238067..238147
FT                   /locus_tag="Calhy_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.814) with cleavage site probability 0.811 at
FT                   residue 27"
FT   gene            239596..241014
FT                   /locus_tag="Calhy_0186"
FT   CDS_pept        239596..241014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0186"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="SMART: peptidase S41; PDZ/DHR/GLGF domain protein;
FT                   TIGRFAM: carboxyl-terminal protease; KEGG: ate:Athe_2340
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; Peptidoglycan-binding domain 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05944"
FT                   /db_xref="GOA:E4QAL9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAL9"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADQ05944.1"
FT                   /translation="MRINKKLLIKIVAVVVALSIFVAVPVYSQFFIISTDFPTDKQMDY
FT                   IKKVLQVAKVYHIGKYSYDELIDMMFTGLFKSLDKYSEYMKPQQAQDFTQSVNGEFSGI
FT                   GIQIEKQEDYIVVVGVFDGTPAKEAGLKVGDKIIAADGKSLVGKTTDDAVKLIRGQEGT
FT                   TVVIDILRDGKTYRFSIVRRKIKIPVVEYKVLDNNIGYIKLTQFTQGCSNDVKKALDEF
FT                   DKKGIKNIIFDIRNNPGGLLDEVVKICEYFVPEGPIVTIEYNTFKDEYKSKNKNPKYKL
FT                   AVLTNESSASASEIFAQAIKDRKVGVVIGTKTYGKGTVQTLVSLPETDTKKGYVAKVTV
FT                   AKYKSPSGYYVEGKGVVPDIEVQDDSLSQFGPDKILSLSATKKFKKGDMDLEVLAAQQR
FT                   LFYLGYLSNWTAKMDDSTVAAVKKFQKDTKLYPSGVLDITTQKKLNEKFSEFVKSKYVD
FT                   KQLQRAIQYFKTGK"
FT   sig_peptide     239596..239682
FT                   /locus_tag="Calhy_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.881 at
FT                   residue 29"
FT   gene            241182..242201
FT                   /locus_tag="Calhy_0187"
FT   CDS_pept        241182..242201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0187"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: ate:Athe_2339 cell shape determining protein,
FT                   MreB/Mrl family; TIGRFAM: cell shape determining protein,
FT                   MreB/Mrl family; PFAM: cell shape determining protein
FT                   MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05945"
FT                   /db_xref="GOA:E4QAM0"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAM0"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADQ05945.1"
FT                   /translation="MAFGTDIGIDLGTATVLVYVKGKGIVLREPSVVAIEQTRKQILAV
FT                   GEEARRMIGRTPGNIVAVRPLRDGVISDYEVTEAMLKYFLGKVLGKRVFFKPRVVVCVP
FT                   SGVTEVEKRAVLDATYEAGAKQTFLIEEPIAAAIGAGLDISKPVGCMVIDIGGGTTDIA
FT                   VISLGGAVVSESIKVAGDKFDEAIIRYIRKKHSVAIGERTAEELKINIGCAYKKPKLES
FT                   MDVRGRSLLTGLPKTITVTSDEMLLALEEPVSAIIEAVHRVLENTPPELAADITSTGIV
FT                   MTGGGSLLWGLDKLISEKTGIPTRIADDPVSCVALGTGKALESLDVLEASLIKDPRVR"
FT   gene            242219..242986
FT                   /locus_tag="Calhy_0188"
FT   CDS_pept        242219..242986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0188"
FT                   /product="fagellar hook-basal body protein"
FT                   /note="KEGG: ate:Athe_2338 flagellar basal body rod
FT                   protein; TIGRFAM: fagellar hook-basal body protein; PFAM:
FT                   flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05946"
FT                   /db_xref="GOA:E4QAM1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAM1"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADQ05946.1"
FT                   /translation="MIRGIYTSASGMILNQKLMDITANNVGNVSTTGFKRDVAQVESFR
FT                   NMLAYRIYDKPSSPDNAIGYMSLGSDVSRIVSDFSQGLYIKTDEPLNLAIRGNGFFAVE
FT                   MPNNQGAQQILYTRNGAFTLNSRGELVTLDGFYVLGQNGRIVLQNGGQVRIDEQGNVYQ
FT                   DGRFVDRLRVVDFQDKQLLRKVGNNLFEADALSQSIPFSGKIIQGYLEGSNVNSVQEMV
FT                   NMINVLRAYEANQKAFVIQDETLQKAVNEIARK"
FT   gene            243042..243845
FT                   /locus_tag="Calhy_0189"
FT   CDS_pept        243042..243845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0189"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="KEGG: ate:Athe_2337 flagellar basal-body rod protein
FT                   FlgG; TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   fagellar hook-basal body protein; PFAM: protein of unknown
FT                   function DUF1078 domain protein; flagellar basal body rod
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05947"
FT                   /db_xref="GOA:E4QAM2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAM2"
FT                   /inference="protein motif:TFAM:TIGR02488"
FT                   /protein_id="ADQ05947.1"
FT                   /translation="MMRALYSAALGMKAQQTNVDIISNNLANVNTTAFKKDKAEFKDLL
FT                   YETLSRADVVAGDGKPVSLQIGHGVTISAITKSFAEGNLERTENPLDLAIQGEGFFVVS
FT                   TPNGPRYTRDGSFKVSNVEGQIKLVTSDGYPVLAEGDTEIVLPETAISSITIDETGRIT
FT                   YKDQDGQIQDSGFKIKIVRFINPQGLLAEGKNLYNVSATSGDPVSEEEMEGQKSRILQG
FT                   FLEMSNVQVVDEMVKLIIAQRAYEINSKAIQTADDMLSMANNLKR"
FT   gene            243870..244220
FT                   /locus_tag="Calhy_0190"
FT   CDS_pept        243870..244220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0190"
FT                   /product="Flagellar protein FlgJ-like protein"
FT                   /note="PFAM: Flagellar protein FlgJ-like; KEGG:
FT                   ate:Athe_2336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05948"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAM3"
FT                   /inference="protein motif:PFAM:PF10135"
FT                   /protein_id="ADQ05948.1"
FT                   /translation="MSDVSSIKIQAHYQQGISNSIIDKLEKAYSEKDKQKLKEACEEFE
FT                   AIMLSTIFKQMKKSIPKGGLFKESIADDIFNDMFVDEVSKSASKQGGIGLSKLLYDSMI
FT                   KRIENAYKFKEE"
FT   gene            244419..245234
FT                   /locus_tag="Calhy_0191"
FT   CDS_pept        244419..245234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0191"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: csc:Csac_0598 xylose isomerase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05949"
FT                   /db_xref="GOA:E4QAM4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAM4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADQ05949.1"
FT                   /translation="MYKFIFSAFGDEIASSLDEQIEVLKKHGIEYLEFRSANGKNIADY
FT                   TENEAKEVLKKLKDSGIKVSAIGSPIGKVDVNCDFEKYLELFKHILQLAHILETKYIRI
FT                   FSFYVPEGEEEKYTDVVIERLSKFTEIAKRENLVLLHENEKEIYGSNAERCFKILSTIN
FT                   SPNLRATFDPANFVQCKVEVYPHAFELLKDYIEYVHIKDAKFSDGSVTVAGEGDGRVKD
FT                   VIKALKRRAFCGFLSIEPHLNNNLPGGGPENFARAYRAIKKIIDEEGEI"
FT   gene            245236..246336
FT                   /locus_tag="Calhy_0192"
FT   CDS_pept        245236..246336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0192"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: csc:Csac_0599 oxidoreductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05950"
FT                   /db_xref="GOA:E4QAM5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAM5"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADQ05950.1"
FT                   /translation="MSKLKFGIVGCGVISKTHATAISALSSDAELVAVCDTIEERARKI
FT                   ADEFGAKKIYTDYEKMLQDTDIDVITICTPSGMHADMAVLAADAKKHVIVEKPMDITLS
FT                   KADKIIEAQNRNNVVISIISQHRYSDCMQLLKRLMNEGKFGRIVLAASYTKWYRSQEYY
FT                   DSGSWRGTWSLDGGGALMNQSIHYIDMLQWIVGKVSEVFAYCTTRAHERIEVEDGAVAV
FT                   VKFENGAIGQILGTTSAYPGFETRLEIFGEKGSAIAINTQLESLFFKDGSEKEYLESYK
FT                   KEDGGPVGASSAAIKEGGHVRQYRDVINAIKTGTKPLIPAEEGRHPVEIILAIYLSSLT
FT                   GKPVKLPLESDEEVLKEIEKIKGKGF"
FT   gene            complement(246427..247194)
FT                   /locus_tag="Calhy_0193"
FT   CDS_pept        complement(246427..247194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0193"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ate:Athe_2333 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05951"
FT                   /db_xref="GOA:E4QAM6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAM6"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADQ05951.1"
FT                   /translation="MKKDKIAAQLYTLREFLKTEEDIFYSLKKVSEIGFKAVQISGIGK
FT                   IEPKRLKEICDEFDLKVCATHIPFERLKTELDNVVQEHKILDCSHIAIPSAPSEYKSEE
FT                   GALMFALACNEIGKKLKEEGITLSYHNHSFEFKKYGGKTWLEILIENSSPEYLMIEIDT
FT                   YWVQFAGANPEKWIRSLEGRIPLVHLKDMGMIEDFKQGMFEVGFGNLDWDGIIASCNEA
FT                   GVEWYIIEQDMCQRSPFESLKMSFDFLTKNYLD"
FT   gene            complement(247251..248135)
FT                   /locus_tag="Calhy_0194"
FT   CDS_pept        complement(247251..248135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0194"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2332
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05952"
FT                   /db_xref="GOA:E4QAM7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAM7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05952.1"
FT                   /translation="MKIRKSPGEIIFDTFNYVFLGLLCFTMLYPMLYVIFASFSNPIKL
FT                   MAYRGPLWRPLEFSTEAYKLLLSYPMIWIGYKNTLIYVVVGTAINILLTTMGGYVLSRK
FT                   NLKLKNPVMFFIAFTMYFSGGMIPTYLLVQSLGMIDTIWAMIIPGAISTTNLIIMRTGF
FT                   HAVPDSLEESARIDGAGDWTILFRIMIPLAMPMIAVMILFYAVGHWNAFFSAIIYLRSR
FT                   ELYPLQLVLREILIMSSTENMTTGISDASDRFAVTELIKYAAIVVSTVPILCIYPFLQK
FT                   YFVKGVMIGAIKE"
FT   gene            complement(248160..249113)
FT                   /locus_tag="Calhy_0195"
FT   CDS_pept        complement(248160..249113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0195"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2331
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05953"
FT                   /db_xref="GOA:E4QAM8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAM8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ05953.1"
FT                   /translation="MEKAATKHFQPSRWQELKKDLIRNKSLYIMLIPVVAYYFIFHYIP
FT                   MYGLQIAFKDFTPAKGIWGSPWVGLEKFKEFFVYDSFYVWRIIRNTILINVYDLIFGFP
FT                   APILFALLLNEIKNSIYKRTLQTVSYMPHFISTVVIVGMIMDFFSRDGLINQILKSLGI
FT                   LSEPISFMTEPGWFRPLYVGSGIWQNLGWGSIVYLAAISNIDPQLYEAALIDGAGRFRQ
FT                   ALYVTIPGILPTIVIMFLLRVGHMMNVGFEKVFLMYNPLTYETADVISTYVYRKGLLEM
FT                   DYSYGAAVGLFNSVINFLLVIFSNKIAKKLTETSLW"
FT   gene            complement(249281..250882)
FT                   /locus_tag="Calhy_0196"
FT   CDS_pept        complement(249281..250882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0196"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2330 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05954"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAM9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ05954.1"
FT                   /translation="MDWFKSSKKVLSLIVVIAFTLSLVIPAFVSSSSTAYAKSTPTLTY
FT                   FVRLDPKVATSYNSYSSIAAYQLLQKKLGVKIVFKHPPVGGETDQFNLMVASRQLTDII
FT                   EWNWIDNYPGGPVKAMLDKVIIRLNDYIPKYAPNLNKFLQQHPDIKKLIVTDDGDIYGF
FT                   PALRGNNPKIACVYYGPQIRNDWLKKLGLKEPETVDDWYKVLKAFVTKDPNGNGKKDER
FT                   GFSILRNASNPRYAFDYSSFLVGAWGIKTDFFQVNGKVKYGPLEPQYKQFIATLQKWWK
FT                   DGLIDPDILTMNQKVIRANVQNDVIGAWIGLLSGDMGFFLNLKKDIIATKFPVLKKGEY
FT                   PLLGQAEFLFSRTSAAITTACKNVPLAMKVLDWGYSKEGYEAFNYGVLGKSYVKKDGKV
FT                   YYTDEILKNPQGLSAAEALAKYARASISGPFAQADEYYYQIQMMYPQQKDAVVNKWSQV
FT                   KNDRILPPLSFTDDESKRLANIMNTVNTYYDEMFLRLMTGKATNVDAFVKTLKQMKIDE
FT                   AIKIYQQAYDRWKKRK"
FT   sig_peptide     complement(250769..250882)
FT                   /locus_tag="Calhy_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.973 at
FT                   residue 38"
FT   gene            251190..253511
FT                   /locus_tag="Calhy_0197"
FT   CDS_pept        251190..253511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0197"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: ate:Athe_2329 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05955"
FT                   /db_xref="GOA:E4QAN0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAN0"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADQ05955.1"
FT                   /translation="MFKKILWRFVFSYLVIFIIPLFIGIGAYFSVKEIMMSSLYRYNKT
FT                   TLTQLEDKVENEVVKSVESLADWINLNPYYFIFLPEAKEALDSSDRLLNIRNLCREIYS
FT                   QTYKNSYILDAFIYIPSENLIIGPSYTTTPYNYYTYINRPLDMSYEKWLKFLNGEYKMQ
FT                   YIPSFEIKADYKKLSTIMFANTLSRWIIDGKNANVFVIIDQSKIVNLMKEIISYPKGIM
FT                   WILDRNNNQVLKVSAEKQNISLPKINFSIYNDFSIREFKLDGQKWIVYYTISPLYGWKY
FT                   ISMVPVDSFFEEIRKIRNLSLLLLGLMSVISSILIFFFSVQNYRPLSEIKSLLQSNNEN
FT                   KDLKSTKSEFDVIRDLVVHTLSKEEEMKRQITRFTPIIKNNLLYQLLVGGILPESIGDL
FT                   ELKTLSMEKQSGKFVVCLVEIDDCSGFIKGESDSEYALVTLVVTNVLDELLDTNNFKHW
FT                   NVLFSRTKLSVIVEIKDSFEQSLPKLSSLFENMIEFLEKNFTIFVSVGISGEVLGIVNL
FT                   KFAYEQAEKVLSLKFVKPNMKIFKFSELSQDITSEKEFLPKDIENRIINSVKEGKVEGI
FT                   YEVFEDIRCHITAANSPHMAKMILIYLYGLYYQLLNSIPNTVGDDQKPEPEKVMRLIID
FT                   EKNPKKVLQALQEDYRILAESVIVNKQKMGNDLISNILEYIHQQYSSSEISLSTIADKF
FT                   NITPQYLSAIFKEKTGQNISDYIQNLRMNRAKELLLTTDYSVSQIAKMIGYTEVSGFTK
FT                   AFKKFEGVSPNKFRELNKPQ"
FT   gene            complement(253591..255876)
FT                   /locus_tag="Calhy_0198"
FT   CDS_pept        complement(253591..255876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0198"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; Transketolase
FT                   central region; KEGG: ate:Athe_2328 transketolase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05956"
FT                   /db_xref="GOA:E4QAN1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAN1"
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /protein_id="ADQ05956.1"
FT                   /translation="MEKEFQFWEKIKDITYQYLDFTLNYRQSGHPGGSHSKAHMLISLL
FT                   FGKKMIYDIRKPEYRFNDRLILSAGHTIPIIYSLFAVIGDAFDEMYRQTKDVKYLIAED
FT                   KLVRYYDLLTFRHNKGLPGHAESSGKTLLLKFNTGPSAHGLPASVGQALALKKAGLQNV
FT                   KVFLIEGEGALTAGATHESQNGAWAYGLGNLFWLLDWNDFGIDDRPFSSVVYGTPDEWF
FT                   SAHGWKVCGTMNGHSWNDVYSTIKKAVEEANENTPNLMWFKTKKGYEYGVYDNKSHGVP
FT                   HKKNSEIFWETRKPFMEKYGVEFVGFGKPAPSNPDEERKQWEENLKIINRVLTSDEELV
FT                   KYITDTLVEIAEALPKDAPSTFVLNQNPYKDPAIYDYKNYPDWLFAKPGENVPNRAALA
FT                   KWGMYINGVVGRKYGRPLIIATSADLTESTNLHGFGLGKDDFAGFGVYDREKNRNGAIL
FT                   PSAITEFLNAGVCAGLATVNLSENPYEDFNGFWAITSTYGSFMYLKYGAIRLFSQMAQD
FT                   SPVKFGKVIWVAGHSGPETAEDSRTHFGIFEPGVLQLLPKGKIINLYPWEHNEVPVLLA
FT                   AALATDINNIALHLTRPPIEIPDRSALGIPSHFEAAKGAYIINDFDPNRRKDGTIIVRG
FT                   TSTTYNLIKLLPQLRKDFNLKIIAAPSFELFMMQEDEYRNKVLPLEDWMDSMVITNESK
FT                   KLMHDWIFSKVSEEYSLSSDWDNQWRTGGTVDEILKEAHLDCDSIYSGIERFVKDREKR
FT                   IAKLKSIL"
FT   gene            256216..257166
FT                   /locus_tag="Calhy_0199"
FT   CDS_pept        256216..257166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0199"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: csc:Csac_0601
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05957"
FT                   /db_xref="GOA:E4QAN2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAN2"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ADQ05957.1"
FT                   /translation="MLHTFINAIQGVLVILFVLMLGYFLAKYRWFDSKVSDLFAKVVVN
FT                   VSLPLYMIANLTSTFTKSELEHSAQGLLIPFLSILLSYSVAVMLARITNVKAHRRGLFA
FT                   AIFSLSNSIFVGLPMSLALFGDVATPYTLLYYMANTTIWWTLGVYGIIRDNKTENQKVL
FT                   SIDTLKRIFNPPLIGFLIGVGLVLLQIKLPKFIFDSFKMVGGLTTPLSIFCVGITMYEM
FT                   GFKNFRLDKDSILVFAGRFLVTPFITWLLSHFIPVPKLMRDVFIIMSAMPVMVNSAIIS
FT                   RVYNGDYEFATAMITYSTVFSVVIMPFLMVLIKII"
FT   gene            complement(257159..258388)
FT                   /locus_tag="Calhy_0200"
FT   CDS_pept        complement(257159..258388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0200"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ate:Athe_2326 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05958"
FT                   /db_xref="GOA:E4QAN3"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAN3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADQ05958.1"
FT                   /translation="MQLAISGPFRALRHKNYRYYWFGQAISVIGSWMQNMAMQWLALEL
FT                   TNSALLLSIVTASEQVPVMILSLFAGAILDRKQKKRVILITQSLLLFFAFVLFLITYTD
FT                   VVQYWHLVVLALMRGVVTTFDNPARQSYMIILVGKEDLPNAVGLNSMIFNLARIIGPAV
FT                   ASLVISTVGIEMCFLANAISFVPVIIGVFLIDAKEPQKEENGKSVFAEVIEGLKYVYKT
FT                   KVLLRAISLVLIMGTFILNFNVLIPVYAKLALGRNETGFGLLMSSMGIGSLIGAFLTAT
FT                   RRKEKINLNLLFKFILSVSLVYILLGINKSYKVACVLFVLVGLLAISFNTSANALLQLS
FT                   SSDEFRARVLSIYFLCNAGTTPIGNLFTGTISQKISPWAGFYISGLVTIVLTTMVLITT
FT                   FKRRSLEKTK"
FT   gene            258721..259743
FT                   /locus_tag="Calhy_0201"
FT   CDS_pept        258721..259743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0201"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ate:Athe_2325 lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05959"
FT                   /db_xref="GOA:E4QAN4"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037459"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAN4"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADQ05959.1"
FT                   /translation="MILKFNFEPIVKNDFINVSGSTLYSKDKGYGFETFKFRVDVPNGN
FT                   YDVKLVLKNFKKDIASATVMVFPRRLMIKDAQIKKGNVYEEEFTVNVKNEKIIFEIETD
FT                   GAEVCSIEVKEAQNPIVIYLAGDSTVCDQENLPYAGWGQALGCFFKKGVSVSNHAYSGR
FT                   SSKSFIEEGRLTKILENIKEGDYLFIQFGHNDQKDDKRYTEANTTYKIMLKVYIDEARK
FT                   RGAVPVLITPVARRHFDENGKIVGSGLHFDYPKAMRELAEEENVFLIDLLQMSSQLFEK
FT                   LGVEESKKLFVHAKPGEYPQFPEGVEDNTHFNMYGAYEIAKLVVEGIRKVNLKLKEYLR
FT                   "
FT   gene            259883..261232
FT                   /locus_tag="Calhy_0202"
FT   CDS_pept        259883..261232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0202"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: ate:Athe_2324 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05960"
FT                   /db_xref="GOA:E4QAN5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAN5"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADQ05960.1"
FT                   /translation="MGKLFGTDGVRGVANKELTCELAFDLGRAGAYVLTETKQKPKILI
FT                   GKDTRISCDMLEAALCAGLTSVGADVYLAGVITTPAIAHLVKSHGFDAGIMISASHNPY
FT                   EFNGIKFFNSQGFKLSDQIEEKIEDIILNRKWNEVPHAQFDAIGRVNRVDLKKNYQEYL
FT                   KSTLNGASFKGLKIVIDCANGAAYKIAPEVFEELGAEVVVINNQPDGTNINKECGSTHL
FT                   KMLQQEVVKNKADFGIAYDGDADRTLFVDEEGSIVDGDKIMLLLAQNLKQQGKLQRNTL
FT                   VVTVMSNMGLFVAAKELGINLEVTKVGDRYVLEKMLEGGYSIGGEQSGHIILLDFATTG
FT                   DGILTSLQLTKLIKESGKKLSDLAKIMKVYPQVLVNAKVENGKKDLYSKDPVILEAIKK
FT                   VEEKLNGKGRVLIRPSGTEPLIRVMIEGEDYEEIKKDAHELASLIESRLS"
FT   gene            261544..263379
FT                   /locus_tag="Calhy_0203"
FT   CDS_pept        261544..263379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0203"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: csc:Csac_0606
FT                   glucosamine--fructose-6-phosphate aminotransferase;
FT                   TIGRFAM: glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: glutamine amidotransferase class-II;
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05961"
FT                   /db_xref="GOA:E4QAN6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAN6"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADQ05961.1"
FT                   /translation="MCGIVGYVGTKNCVPILLSGLKRLEYRGYDSAGVAVIDIDKSKID
FT                   IVKTKGRLTVLEEKLNQNPIEGFVGIGHTRWATHGEPSDENSHPHVSQSGKIAIVHNGI
FT                   IENYLKLKEFLIKKGYTFASDTDTEVVAHLIEYYYDGDILDAFIKTLEKIQGSYALGVL
FT                   CLDRPDMILAARKDSPLIVGLGQGENFIASDIPAILEYTRDTYILEENEIAIVTKDKVE
FT                   IVNTEKEPVKKEVFHVTWDVSSAEKGGYEHFMIKEIMEQPKAIRDTLTGRLPDSGFEVN
FT                   LDGIKITKEDLQKLNKIFIVACGTAYHAGLVGKHVIEKLTRIPVEVDIASEFRYRDPIV
FT                   DENTLTIVISQSGETIDTLVAMREAKARGSRTLGIVNVVGSSIAREVDDCLYTWAGPEI
FT                   AVASTKAYTTQLICLYLIALDFATKLGTISYEEFANIRDEIKRLPEKVEYVLTHRENIQ
FT                   KYASEHFNAKDIFYLGRGLDFAVAMEGSLKLKEISYIHSEAYAAGELKHGTIALIEDGT
FT                   FVIALATQEKLFEKMVSNIKEVKSRGAVVLSVAQEGNTEIENVSDHVLYIPRTLDILAP
FT                   VLTVVPLQLFAYYTAVQRGCDVDKPRNLAKSVTVE"
FT   gene            263475..265046
FT                   /locus_tag="Calhy_0204"
FT   CDS_pept        263475..265046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0204"
FT                   /product="Cl-channel voltage-gated family protein"
FT                   /note="PFAM: Cl- channel voltage-gated family protein;
FT                   TrkA-C domain protein; KEGG: cbe:Cbei_2937 chloride
FT                   channel, core"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05962"
FT                   /db_xref="GOA:E4QAN7"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAN7"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /protein_id="ADQ05962.1"
FT                   /translation="MSNNDAKSILHNYWSLSHFKIIVESTVIGFVTGILIVLFRLAIEK
FT                   VLQFSLCLYSFLHIHPWLIPIWSIFLILFGLIIGFMVQKEPMIAGSGIPQVKGILIRRL
FT                   EMSWWKVIIGKFFGAVVGILGGLSLGREGPSVQIGAAVGQGFGKLMKRSKLDERLFITC
FT                   GASAGLAAAFNAPFAGLMFALEEIHKNFSPLIMVYALVASIVADFVSANFFGLRPVFRF
FT                   KDLISLPLDKYFVLIILGIITGIFGVLFNKVLLATQKAYQKLIFIPANLRPIIAFLIAG
FT                   LVGYSLPDVLGGGHGLISKVVTRNYSIRMLIILLIVKFLFTMISYGSSTPGGIFLPLLS
FT                   IGALTGAIYGKSLTILSIIDKQYITNLIIFAMAGYFSAIVKAPVTGIILIVEMTGSFSH
FT                   LLSVSIVCLVSYIVSDILNSKPIYEQLLERILSKSVGVYKKQHDSKIVLESFVSVGSQI
FT                   ENKKIKDIKWPENTLVVAVRRGGREIIPRGNTEIWAGDCLVLLVNENKVAEVKKWLENM
FT                   IEGCKM"
FT   gene            complement(265120..265449)
FT                   /locus_tag="Calhy_0205"
FT   CDS_pept        complement(265120..265449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0205"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   csc:Csac_0607 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05963"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAN8"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADQ05963.1"
FT                   /translation="MKNSNDNMPVCPVEITLALIGSKWKILILRELLHGTKRFNQLLKS
FT                   INGISQKVLTQQLRSMEKDGLVIRKVYPEVPPRVEYTLTELGLSLKPILDAMYEWGERY
FT                   KKIKG"
FT   gene            265581..266135
FT                   /locus_tag="Calhy_0206"
FT   CDS_pept        265581..266135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0206"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   csc:Csac_0608 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05964"
FT                   /db_xref="GOA:E4QAN9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAN9"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADQ05964.1"
FT                   /translation="MKVIGVIGSPRKGGNTEILVEKILSGAKEAGAEVEIFKLNELNIH
FT                   PCQGCNFCQEHGMCRQQDDMQKIYDAMYSSDALVVGSPIYMSYVTAQTKIFLDRLYALL
FT                   KIGEGPRIPAGKRCVLVYTQGGGTDGQKVMEELSMFFKDALGMDIKAIIGANNLNPIGA
FT                   VNERKDVLERAFEVGKEIVKG"
FT   gene            266436..266879
FT                   /locus_tag="Calhy_0207"
FT   CDS_pept        266436..266879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05965"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAP0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2320"
FT                   /protein_id="ADQ05965.1"
FT                   /translation="MLHKLNKIVYVENYESDYVYAHPSLIDDLDEILSESGKETDFGKQ
FT                   FRKKIIFLENLKKNCIQQKSFERLSKHGYLYSLRVMGVHNIRILFAFFALQGKEIVILL
FT                   NAFPEKSKSTKNNPKSYSYAIEKAEERIEELKSVYEDLQLITS"
FT   gene            266972..267346
FT                   /locus_tag="Calhy_0208"
FT   CDS_pept        266972..267346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0208"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: ate:Athe_2319 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05966"
FT                   /db_xref="GOA:E4QAP1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAP1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADQ05966.1"
FT                   /translation="MLDNKRLISAYKIVEKYTNEEDKKYFELDDILVDIAVKIIQYRIK
FT                   NNLSQKELAQKLGISQAMVSKLESGDYNPTVKMLYEIAKKLGFELEIEFREKTECEENW
FT                   LESSEELLDEVINNEVGEAA"
FT   gene            267343..267783
FT                   /locus_tag="Calhy_0209"
FT   CDS_pept        267343..267783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05967"
FT                   /db_xref="GOA:E4QAP2"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAP2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2318"
FT                   /protein_id="ADQ05967.1"
FT                   /translation="MIEIGNLKADFQLVSTRVVKFELETKKEESDEIEVELKCDYDIEE
FT                   IEENNEIYIGTVQFKAAFEGKKKNKKLFKIHIVYEGCFAGKKEKLGLEDFKNMLELNGI
FT                   ITLTHLTRSYIMSCTALAGFNPPLRLPLINVHKLREMKHKTM"
FT   gene            complement(267776..268009)
FT                   /locus_tag="Calhy_0210"
FT   CDS_pept        complement(267776..268009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05968"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAP3"
FT                   /inference="similar to AA sequence:KEGG:Csac_0616"
FT                   /protein_id="ADQ05968.1"
FT                   /translation="MRKIFVEVYAHFSKEGEITPISFVWLDGKTYEIDKIIEKRNAASL
FT                   KAGGQGIRYKILVRSKMLYLFYDENRWFVEFT"
FT   gene            complement(268054..269289)
FT                   /locus_tag="Calhy_0211"
FT   CDS_pept        complement(268054..269289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0211"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: csc:Csac_0617 DNA-directed DNA polymerase;
FT                   PFAM: UMUC domain protein DNA-repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05969"
FT                   /db_xref="GOA:E4QAP4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAP4"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADQ05969.1"
FT                   /translation="MGRVILHCDLNNFYASVECLYHPELRNKPVAVCGESELRHGIVLA
FT                   KNQIAKSYGIQTGEVIWQALKKCPNLVILKPNFPLYIRFSELVQQIYSEYTDLIEPFGI
FT                   DECWLDVTQSTGILGSGRKIAYEIKERIKRELGLTVSIGVSFNKVFAKLGSDYKKPDAV
FT                   TVITKENFKQIVWPLPAKDLLYVGSATEKKLSSRAIYTIGDIAKSSPEYLKRILGKWGE
FT                   VLWIFANGFDTTPVTPPLFEDNIKGIGNSITLPRDLTSYEDAEYVIRMLSESVAQRLRQ
FT                   QYLKCFTIQVWIRDSFLFSITRQEKLQTPTFLAREIAQKAFEIFKKNWSFKNSIRSLGV
FT                   RALDLVCANSFYQLEFDSLKKFKLEQLEKTIDRIRKRFGHTSVLPAVLLTKPDLPCEIA
FT                   LHNKIHPVAFFK"
FT   gene            269496..269819
FT                   /locus_tag="Calhy_0212"
FT   CDS_pept        269496..269819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0212"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvi:Dvir_GJ23366 GJ23366 gene product from
FT                   transcript GJ23366-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05970"
FT                   /db_xref="GOA:E4QAP5"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAP5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ05970.1"
FT                   /translation="MKKKVWLFFLIILLSVTVVVVFGIKLFREYHSTPEKAIKFYVLVR
FT                   NGPWAASKVTIIKGNSCNQTYDYRQYIVEGYRDRKTGMEIMFFYLSKDENGLWEVTSVG
FT                   TGP"
FT   sig_peptide     269496..269567
FT                   /locus_tag="Calhy_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.460 at
FT                   residue 24"
FT   gene            270027..270689
FT                   /locus_tag="Calhy_0213"
FT   CDS_pept        270027..270689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05971"
FT                   /db_xref="GOA:E4QAP6"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAP6"
FT                   /inference="similar to AA sequence:KEGG:Csac_0527"
FT                   /protein_id="ADQ05971.1"
FT                   /translation="MEYLKPSNLLNLVISPTKVFRKIKEKPDFLILIFLIPLIAALAIL
FT                   FMPKIPEEVLLEHVKKTVEDPKLQETTLKSLKVTMSPVFLAGTTFVKDIISFFITAFIL
FT                   LIIIRLAGGEIDYKKALAIVAVANLVMIPYYIFYVIYARAINLNMLDIQMDFKYFIRTY
FT                   LHVFSIWRYVLIGVGVFAVCELNKAKSAIITAVYTIITLIMPIVSMFTQNFMKFGGR"
FT   gene            270709..272355
FT                   /locus_tag="Calhy_0214"
FT   CDS_pept        270709..272355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0214"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: ate:Athe_2611 efflux transporter, RND family,
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05972"
FT                   /db_xref="GOA:E4QAP7"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAP7"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADQ05972.1"
FT                   /translation="MQDAAKGLKNWQKAVIIVLLISVGFILTFVLTMPSGSKKNISSKP
FT                   KTAKVQKISLKQTLLVSGTVQSSSTRNVISKANGTLEKVFVKNGQYVKKGDLIAKIDDS
FT                   QAAYKIESLKRQLLDLELQRESFQRQLQNFTLKSPQDGFVQNLAVEEGLLVSQGMQIMT
FT                   IVDDSKMKLSTQLPAWCYGKVKQGQKAEVVVSDLMDKVDGVVESIGSRMYKNQDGVMVF
FT                   DAKVVVSNKNGSLAEGMRASVSFLLSSGEKVTSLSEGILEVFSKKSIVSPVSGRIEKVF
FT                   VENGQKVKTGDLLLRFWSDDIEVQIKQLDLKIEDIKSQIEAAEDDLKNYKILSPIDGKI
FT                   ADLNLQDGDVVTAGQIICSVYDPKHLMISAQVEEIDILKIKPGQKVNIKLDAVGSTKDK
FT                   PIEGYVTEISEKAQVDTSSISKFVVKIEFENNNSIKIGMHAEAEIILKSKEAALVVPVE
FT                   AVHKEDGKYYVYVYTQQKAKTSKKNKEQKTSQKIDEYGLDSSYYKDAEKRQVKLRMTTD
FT                   KYVEILEGLREGEEVVLPKFDSEKQGRSLFY"
FT   gene            272375..273562
FT                   /locus_tag="Calhy_0215"
FT   CDS_pept        272375..273562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0215"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   csc:Csac_0529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05973"
FT                   /db_xref="GOA:E4QAP8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAP8"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADQ05973.1"
FT                   /translation="MEKFLLSCKMAIQSIFLNRLRSFLTLLGVVIGVGAVVAAVGLAEG
FT                   TTAGITKEIEKLGTNLVYVFINPASKSEDVSVDEFLEFARKNNDVILGVSPFVQYPAEA
FT                   LFRGKKEECQVIGATAEYMMIENLALSKGRFISPVDSDFRQKVAVVGSRVQKKLFDNQN
FT                   PVGSEINVNGQVFKVVGVLKEKQGGRDNTVDDSVIVPLFALNSMSTGEHALVKNFLVRT
FT                   VSADKNSEVKKRIKEYVSKIVKKEDRYSVYDMSELMSTLNQITYLLMIILGGIATISLV
FT                   VGGIGIMNIMLVSVTERTREIGIRKAIGAKRSDIRVQFLIESMVITGVGGIIGILLGFF
FT                   VIAVGISKIPGVEPVYSLKWAFVAFGISVLTGVIFGMLPAEKAARLNPIEALRYE"
FT   sig_peptide     272375..272491
FT                   /locus_tag="Calhy_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.704 at
FT                   residue 39"
FT   gene            273583..274272
FT                   /locus_tag="Calhy_0216"
FT   CDS_pept        273583..274272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05974"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAP9"
FT                   /inference="similar to AA sequence:KEGG:Csac_0639"
FT                   /protein_id="ADQ05974.1"
FT                   /translation="MKRSKILIGICSLAVLIGIVAAGWSLASKKELPKDVAAVVNGHKI
FT                   YKKDLDMAYGLEELRYENAKASFEELKNKYGDDVAKKLEGSLRKKTKQEILDEMIERLV
FT                   LYDEAKKEGCEVSVDEAKAYYNKTQKALQDIISGKIATDEANNTKKAAELVNSFLRKHG
FT                   ISEDEYKKGLIREYQKMLSIQKYLQKKEKQYKDKNPDVTLKEVEDYLARLKVNLKKKAE
FT                   IIVNKNI"
FT   sig_peptide     273583..273651
FT                   /locus_tag="Calhy_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.771 at
FT                   residue 23"
FT   gene            complement(274353..275603)
FT                   /locus_tag="Calhy_0217"
FT   CDS_pept        complement(274353..275603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0217"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: ate:Athe_2609 SufBD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05975"
FT                   /db_xref="GOA:E4QAQ0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAQ0"
FT                   /inference="protein motif:PFAM:PF01458"
FT                   /protein_id="ADQ05975.1"
FT                   /translation="MSSRHYIDEKILELAKSALNKKAAYGQDIDLSQFEEAEEKDQISE
FT                   LSKLPEEIQKTILNAGIEVSEESRSGSFLQLDHSVVYRRLQQRYQGQLEILDINEALEK
FT                   YPEVREKYFWKAVKPDRDKYTAFSATHPAHGYFIRVFKGQKVEKPIQACLLLQENARIQ
FT                   NVHNIVILEEGAEVQIINGCATAPKVKEGLHIGISEFYLEKGSRLTFTMVHNWAEDFYV
FT                   RPRGVTVVEDDAVFVSNYVLLKPVKSIQSFPIAVLKGKNSVASFNSLLYGLKDSEIDMG
FT                   SHIILEGENSSGQAISRAIVKDSAKIYSRGILEARQNRSKAHLDCRGILLSSNGMMYAV
FT                   PELLSDGAPQSHLSHEAAIGPIAEEEVEYLMSRGLSKDEAISLITQGFMDVKILGLPKQ
FT                   LENYIQELILQTQEENM"
FT   gene            complement(275582..276322)
FT                   /locus_tag="Calhy_0218"
FT   CDS_pept        complement(275582..276322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0218"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2608 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05976"
FT                   /db_xref="GOA:E4QAQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAQ1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ05976.1"
FT                   /translation="MLEIIDLHVEVGSKEILKGVSLTIPDGETHILFGPNGSGKTTLMM
FT                   SIMGLPKYKITSGKIIFNGIDITYMPTHERAKLGIGMMFQKPPAIRGVELQKLSEIIKS
FT                   IRQTDADIQEYAKILNLEEHLSREVNYGFSGGEIKRSELLQLLCQKPSLVLLDEPESGV
FT                   DLDNITLLGNVIKKLLKGEKIKKRHTSGLIVTHTGYILEYVNADKGHILMDGKLVCSGS
FT                   AEDLFEEIRQNGFGRCENCLQDTI"
FT   gene            276494..276820
FT                   /locus_tag="Calhy_0219"
FT   CDS_pept        276494..276820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0219"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   ate:Athe_2607 protein of unknown function DUF970"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05977"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAQ2"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ADQ05977.1"
FT                   /translation="MKLVLAIVSEVDRNKLNLALIENGVPATIIYSTGGFLNRGTVTFM
FT                   IGAEDDRLDEVIELIKKNVSERKEVSKSTLPPALQSLFFVSKQKIEQGGAVIFVLDIEN
FT                   FLKV"
FT   gene            276822..277751
FT                   /locus_tag="Calhy_0220"
FT   CDS_pept        276822..277751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0220"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ate:Athe_2606 thioredoxin-disulfide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05978"
FT                   /db_xref="GOA:E4QAQ3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAQ3"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADQ05978.1"
FT                   /translation="MIVLKYTLYGYNNIGVKLRMIYDCAVIGAGPAGLSAAINLAQTNR
FT                   SVVVFATKEEDSSIYRAPEVNNYLGFHGVTGKELLQAFYDHAKKMGIEVVHKKVINFYK
FT                   SGDIFTINANNEFFEAYSVILAIGTPKKTLLENEGEFVGRGISYCAVCDGMLYKGRTIA
FT                   VIGEAIDAEEEAEYLSELAKKLYYIPLYKKNEFHFKDNVEVILSRPKSVYGEDFVNALE
FT                   LEDRTLNVDGIFIIRKTMPADQLIYGLEFTEDGHIKVDSKMQTSIEGLFAAGDVVGRPY
FT                   QVAKAVGEGQIAGLSASTYVKMVKEKQK"
FT   gene            complement(277810..278160)
FT                   /locus_tag="Calhy_0221"
FT   CDS_pept        complement(277810..278160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05979"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAQ4"
FT                   /inference="similar to AA sequence:KEGG:Csac_0534"
FT                   /protein_id="ADQ05979.1"
FT                   /translation="MMYRIFCESYYNYIKNFENKGAKDEYRYKIAKVFELIVDPQKFYK
FT                   EKSKNSETYQNLCDLLCYMKENIHRYPKFKAFLWTLESRQIEPDYCGKTPQNILEDQAK
FT                   IANMFLNLMYWE"
FT   gene            complement(278150..278659)
FT                   /locus_tag="Calhy_0222"
FT   CDS_pept        complement(278150..278659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05980"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAQ5"
FT                   /inference="similar to AA sequence:KEGG:Athe_2604"
FT                   /protein_id="ADQ05980.1"
FT                   /translation="MHEREALFNLLKDAEKIAKVLQIRPFSLYLLGGSACILGEYLDRA
FT                   TRDFDILDLNYPSQIGKVLRFLGDFDLLEYESTPIAPSFKKRAIKLEGFEYIRVYVLSK
FT                   EDIVVSKIIRLDEKDIEDIDKLMPSCNKELINKIIEEILNRKDFFETKKKRFLEKLEIF
FT                   RVKYDV"
FT   gene            complement(278769..278987)
FT                   /locus_tag="Calhy_0223"
FT   CDS_pept        complement(278769..278987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0223"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="KEGG: ate:Athe_2603 regulatory protein, FmdB family;
FT                   TIGRFAM: regulatory protein, FmdB family; PFAM: Putative
FT                   regulatory protein FmdB"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05981"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAQ6"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ADQ05981.1"
FT                   /translation="MPFYDLRCKDCGEEFNVRASIKERENKEIECPSCHSRELEAVFKS
FT                   VNIISSSKSSDSGYSCTSGCCGGSCGF"
FT   gene            279238..279957
FT                   /locus_tag="Calhy_0224"
FT   CDS_pept        279238..279957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0224"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; KEGG: ate:Athe_2602 iron
FT                   permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05982"
FT                   /db_xref="GOA:E4QAQ7"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAQ7"
FT                   /inference="protein motif:PFAM:PF03239"
FT                   /protein_id="ADQ05982.1"
FT                   /translation="MVQGFVIAFREVFEIILVVAVMIGVIQKLNQKDLLKSLNIGLVLG
FT                   IVLSALLSIIVFAFYESLEESFEGVEIALKALLVILITWFLALAIKYQKRDLKQQTYEK
FT                   VINFQKYSYGIFLLSLVNVLREGTELVIFSLASFSKDKSLTLFYGIGLGIFAAVLLGYF
FT                   VFKLSNRINIRLFFIATTLILVIVSSEVLKDLVEEILKEGLKTQNEVIPTVLSVGYILI
FT                   FLVLMIQSNIISRQKTE"
FT   gene            280047..281522
FT                   /locus_tag="Calhy_0225"
FT   CDS_pept        280047..281522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0225"
FT                   /product="stage IV sporulation protein A"
FT                   /note="KEGG: ate:Athe_2601 stage IV sporulation protein A;
FT                   TIGRFAM: stage IV sporulation protein A; PFAM: Sporulation
FT                   stage IV protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05983"
FT                   /db_xref="GOA:E4QAQ8"
FT                   /db_xref="InterPro:IPR014201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAQ8"
FT                   /inference="protein motif:TFAM:TIGR02836"
FT                   /protein_id="ADQ05983.1"
FT                   /translation="MDADIYREIAKRTNGDIYIGVVGPVRTGKSTFIKRFMDLFVIPNI
FT                   EDEYKKERTKDELPQSAQGKTIMTTEPKFVPNEAVEVLLSSGARLKVRLVDCVGYLVEG
FT                   AMGHLEENHPRMVTTPWFEKPIPFEEAAEIGTKKVIQDHSTIGIVITTDGTITEIPREN
FT                   YIKAEERVIEELKLLNKPFVIVLNTAKPYSPDTQELKKELEEKYKMPVLIVNCLQMQIE
FT                   DVKRILETVLFEFPIVEVKINLPRWFDELEDESWLKKEIYEKIKEYAEKLDKIRDITDQ
FT                   LEVLKQHPQIDRCEVVGINLGDGKSELSIYFKEGLLFKIIEESTGFEIKGEHHLVRLLC
FT                   ELSQIKKEYDKLKDALNSAKEKGYGIVAPALDELKLETPEIVKKGNSFGVRLKASAPSL
FT                   HIIRVEVETEVSPIVGTEKQSEELVNFLMKEFEDDPKKIWESNIFGKSLHELVKEGLQN
FT                   KLHRVPEDSQEKLRETLQRIINEGSGGLICIIL"
FT   gene            complement(281564..284197)
FT                   /locus_tag="Calhy_0226"
FT   CDS_pept        complement(281564..284197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05984"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAQ9"
FT                   /inference="similar to AA sequence:KEGG:Athe_2600"
FT                   /protein_id="ADQ05984.1"
FT                   /translation="MKKFLSFISFATILSFILSAFAKPYTEILRFKTTQQIAPRTYYEK
FT                   YELLTDEGFVDINCIKLDLIDSGFDFDVLRAGVANTGDFVYNMVYNQIDKNPVAAINAN
FT                   FFYTNTKTNYNKIWPIGISVSGGKILSSPNNKQNTFPAFVYTNSNEILFDYINGLSYKL
FT                   VNVDSGYEFKIAHINKFTGDLTYPILFTGDYVQKTIGDKYKGIVELIIKDGIIKDIREE
FT                   TPAVVLDKDEYLLAATGNYAKNLKTNFKVGDKVEIKIDLSVPLEKIKAAASGNTFLLKD
FT                   GKILTFTHEIAGRHPRSAIGIDKIGRYLYLVAVDGRNGKSIGLSQGELANFLQSIGVWT
FT                   AINLDGGYSTQLIAKDNDGNLKAFYNTGETRKVFDSIAAFYKYRDDKISTFYIDCPDKV
FT                   FAGEEYPIKVFAKDRFYNTITYDAVYLKVYQDAYEIDIKDGIFTPYKDGVVTISCVYED
FT                   VYQKAFAQKKISVYKPEILTTSKKQLKLMPGESLALRFYIKDKVGHFKEIDPRKVQAEE
FT                   NPAFEFKDGIFIAKSNFRGFVTFTYKDLKCSIPVGIGETLQLLRSFDYLALSWPKGVSM
FT                   FLSSKNKTQGKYSNKIYFSVSSTKGKSFKLDFKTPVDLTNISKISFDICANNVKVYLGF
FT                   KMLSGTQKEVEITQLKSDNFKSYSLNVESYKTLDYILLIPQKTQGYIWIDNLTGDVVNL
FT                   PPVENINQYVAKFDEKLAKTSVIFLTKGFESLPSEIKKKVESNLGSYLKCYSLEKDNPP
FT                   YEKNEKFNIVFLRTKSGSILDFSYYQWMRIKNLSAEKKPLIVVLDIPFESLRQDEKDVL
FT                   IRLLKSRKAPSMIICTTSDYTRVERYDTLYIGYASSNNLLAKSSAKSINLACDVEKGYI
FT                   YLARGH"
FT   sig_peptide     complement(284129..284197)
FT                   /locus_tag="Calhy_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            complement(284243..284950)
FT                   /locus_tag="Calhy_0227"
FT   CDS_pept        complement(284243..284950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0227"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: csc:Csac_0539
FT                   PP-loop domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05985"
FT                   /db_xref="GOA:E4QAR0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:E4QAR0"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ADQ05985.1"
FT                   /translation="MQHIFSKVRKAVEDFEMIEEGDKIAVGVSAGKDSLTMLYTLSFMR
FT                   RFYPKKFDVVAITIDMGFEGMDFLPIKEFCDKIDVEFHLVPSQIKQIVFDIRKEENPCS
FT                   LCANLRRGILNSTAKSLGCNKVALGHHLDDVVETFFLSLFFEGRIYCFSPKTYLDRTQI
FT                   TTIRPMIYLKEHDLRSAAKRLELPVITNPCPANGKTNRQRMKEFVKSLKQFHPATKDLV
FT                   FNAIKRNIWGLKD"
FT   gene            285101..285177
FT                   /locus_tag="Calhy_R0003"
FT                   /note="tRNA-Pro1"
FT   tRNA            285101..285177
FT                   /locus_tag="Calhy_R0003"
FT                   /product="tRNA-Pro"
FT   gene            285277..285361
FT                   /locus_tag="Calhy_R0004"
FT                   /note="tRNA-Tyr1"
FT   tRNA            285277..285361
FT                   /locus_tag="Calhy_R0004"
FT                   /product="tRNA-Tyr"
FT   gene            285379..285454
FT                   /locus_tag="Calhy_R0005"
FT                   /note="tRNA-Thr1"
FT   tRNA            285379..285454
FT                   /locus_tag="Calhy_R0005"
FT                   /product="tRNA-Thr"
FT   gene            285483..285558
FT                   /locus_tag="Calhy_R0006"
FT                   /note="tRNA-Lys2"
FT   tRNA            285483..285558
FT                   /locus_tag="Calhy_R0006"
FT                   /product="tRNA-Lys"
FT   gene            285568..285644
FT                   /locus_tag="Calhy_R0007"
FT                   /note="tRNA-Arg1"
FT   tRNA            285568..285644
FT                   /locus_tag="Calhy_R0007"
FT                   /product="tRNA-Arg"
FT   gene            complement(285859..286440)
FT                   /locus_tag="Calhy_0228"
FT   CDS_pept        complement(285859..286440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0228"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ate:Athe_1028 protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05986"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB08"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADQ05986.1"
FT                   /translation="MEAKVPKIYTYADYLQLPQDAKVELIDGVIYNMSPAPSRIHQEII
FT                   FELILVIGNYIKQNNKPCKIYTAPFDVVFVEEGQDESKATNVVQPDISIICDKKKLTDR
FT                   GCIGAPEMIIEVVSQNNPAHDYIRKLNLYTQFGVKEYWIVNPDEQNIFVYVYRPETGYS
FT                   YPKVYTFNDKVKVSLFEDLIIDFAQIKEML"
FT   gene            286595..287212
FT                   /pseudo
FT                   /locus_tag="Calhy_0229"
FT   gene            complement(287282..288433)
FT                   /locus_tag="Calhy_0230"
FT   CDS_pept        complement(287282..288433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0230"
FT                   /product="peptidase U34, dipeptidase"
FT                   /note="KEGG: tsi:TSIB_0536 peptidase U34, dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05987"
FT                   /db_xref="GOA:E4QB09"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB09"
FT                   /inference="similar to AA sequence:KEGG:TSIB_0536"
FT                   /protein_id="ADQ05987.1"
FT                   /translation="MCDTIVALKNSTLNNCVLFGKNSDREKNEPHIVIRVPRKEHKKGE
FT                   KVKCTYIEVEQAEVTYDCFLFKPSWIWGAEMGVNEFGVVIGNEAVFTNQRQGPPALLGM
FT                   DILRLALERSKTAKEAVDNIIYFIERYGQGGKCGYTKNLKYHNSFLIADFENAWVLETA
FT                   GVYWALQKVKDVRSISNALSIRNDYDMKSKMIKREIIDFKKEFENPLITKFACGNFRQQ
FT                   LTQKMLEEKKGKLTIEDFKSILRYHYNLNSKNFLYGSMKNICMHSKSIISSETTGSFIV
FT                   ELIDRKINIFATGSSLPCLSIYKPLWFVENRDIFFTEEKTDLAIGYWKAQRKIIENVEK
FT                   GKVDRDTYLKNRDEREKELFKLARNVKNDLEKENIIKMAWQFE"
FT   gene            288602..290032
FT                   /locus_tag="Calhy_0231"
FT   CDS_pept        288602..290032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05988"
FT                   /db_xref="GOA:E4QB10"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB10"
FT                   /inference="similar to AA sequence:KEGG:Csac_0656"
FT                   /protein_id="ADQ05988.1"
FT                   /translation="MFNTKPKQLSFIDLFSHLKASALYKPESLLGLFNKFIDLSHYIPS
FT                   SFYNAYYKYFGKHRYFSLESMLCCFLVQKLLKLNTLTQLRAVLLNSFELRSFCNLHGNV
FT                   PSISTLSRFRKIFASEIHKLFQNISIHAHNISIQQCPQDSSILIFDTTGIVPKVRENNP
FT                   KFIHLLLKNTSKANPELPSEKVYSLVYSSLPKTANANSNIRLMFVNGHFCWALKFAVIT
FT                   NAIGIPLALVPLFNYDSPSSDPQEAKAISDSKGLIPSLETLFSYIPKNFSTFIADSALD
FT                   SHNIYSTLKNTFNFSKIVIPLNTRASKNTTPTLDPNIVISEDGIPICKKFNKPFKPEGK
FT                   CQGKNRSLRLKWTCPMSQYKDGKRICSCPQPCTTSKSGRMFYTYPDNFRSFPGINRNSQ
FT                   EFFDLYKKRVAVEQTIYHLKSYMGSDTISTYDHISIFSDFLLSAITFSLLFILAHNIKL
FT                   YCSKLTIKKLNKLKKLIA"
FT   gene            290429..290530
FT                   /locus_tag="Calhy_0232"
FT   CDS_pept        290429..290530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05989"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ05989.1"
FT                   /translation="MDKFELNVAKLVDKKIQKNCKRKTRKIKTLKLK"
FT   gene            complement(290570..290893)
FT                   /locus_tag="Calhy_0233"
FT   CDS_pept        complement(290570..290893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_4138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05990"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB12"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ05990.1"
FT                   /translation="MKKKKKILLAAILILLVVIFSVAIVITSKEFHKTPEGAIRFYIVL
FT                   HKGPWALSNVKIIRGKYIDKFYGQQYVVEGFTDRVTGMELRFFYLKKDESGLWKITSVG
FT                   TGP"
FT   sig_peptide     complement(290822..290893)
FT                   /locus_tag="Calhy_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.590 at
FT                   residue 24"
FT   gene            complement(290933..291943)
FT                   /locus_tag="Calhy_0234"
FT   CDS_pept        complement(290933..291943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0234"
FT                   /product="DNA repair photolyase-like protein"
FT                   /note="KEGG: csc:Csac_0382 DNA repair photolyase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05991"
FT                   /db_xref="GOA:E4QB13"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB13"
FT                   /inference="similar to AA sequence:KEGG:Csac_0382"
FT                   /protein_id="ADQ05991.1"
FT                   /translation="MTSSEKSFLAKNFSHVYVEKAVLSHPVTIKILENLRRSQIVKIDN
FT                   YKEVFCRARQNYSLQEKSKKLILAKKWGEFLYPGPSICHNFGYSNFFYTSNILNCICSC
FT                   EYCFLKGMYSSANIVAFVNIEDYFKEIDAVLKNKPLYLSVSYETDLLALEKIVPFSSAW
FT                   IEYAASKQNLTIEIRTKSTNFQALENLKPQDNVILAWTLSPQEIIEKFEHGTPSLSSRL
FT                   SAIKKATENGWKVRLCFDPILYIEDWKSIYEKFLRQVFGELNPDKIVDISVGVFRIPKD
FT                   YLKRMKKVFANEITSFPYEESQNIYTYPKELKEEMINTILLILGNFAPSSKIFVI"
FT   gene            complement(291912..292751)
FT                   /locus_tag="Calhy_0235"
FT   CDS_pept        complement(291912..292751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0235"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   csc:Csac_0383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05992"
FT                   /db_xref="GOA:E4QB14"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB14"
FT                   /inference="protein motif:PFAM:PF01048"
FT                   /protein_id="ADQ05992.1"
FT                   /translation="MIYIVTAFHAEAKALIEHFGLKKLYEPSKFQIFSGNDILLIESKE
FT                   GIVKSSIATTFALTKFGAGSKDIALNIGICGAVENAFSKGDVILCNKIINHHSKKAFYP
FT                   DILIQHSMKEASLESFMHPVKKDSLPLEIEGDTVDMEGAGFFEAASIFLPLHNVHCIKI
FT                   VYDFLDFEKINLAEIENLIKQSIPHIESLINSLLKLNFEFCNNTPEIDNIPLLVNKLKN
FT                   SLHLTTYMTNELESLLKDYIIRHKKLPDFIFEFFEVQINSKKEGKNYFDKLRKILLS"
FT   gene            293128..294441
FT                   /locus_tag="Calhy_0236"
FT   CDS_pept        293128..294441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0236"
FT                   /product="transglutaminase domain protein"
FT                   /note="KEGG: csc:Csac_0385 transglutaminase
FT                   domain-containing protein; PFAM: transglutaminase domain
FT                   protein; SMART: transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05993"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB15"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADQ05993.1"
FT                   /translation="MDFLVCKIPEEIEREEKLGNFCLALRLIDRWLADERITEVQRKRL
FT                   MYEKNRINRILESYPFYEETALKKAMELIDSFSREEFYHLLSEGYLDYIVIEGKRRFEE
FT                   RFVHNIAFALPSYRERLKKDPVAQKARELLDKRLEELTQGDPPKRYRVRAKMTVAIKDD
FT                   ADHFRVWLPFPKEELQVCDVKLVSTSQKDYFLADNKVSQRTIYFEGKEKEYFVEFEYTI
FT                   NEWINKVDPEKVEENDLDEFLGEQPPHVVFTPYLKLLTNQVVAGENNPYLKAKRIFDWI
FT                   TNHVKYSYVRPYATYENISQYVAENLKGDCGFQALLFITMCRIAGIPARWQSGWYINPL
FT                   MASPHDWALFYVKPYGWLPADLSFGGARRENEKLRSFYFGNLDGFRMVANSDFMKDFEP
FT                   KPNFLRFDPTDNQLGEAESLSGKVKIESKIEVISFEEI"
FT   gene            294465..294802
FT                   /pseudo
FT                   /locus_tag="Calhy_0237"
FT   gene            294893..295306
FT                   /locus_tag="Calhy_0238"
FT   CDS_pept        294893..295306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0238"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="KEGG: csc:Csac_0399 BadM/Rrf2 family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05994"
FT                   /db_xref="GOA:E4QB16"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB16"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADQ05994.1"
FT                   /translation="MRLTQASDYALRIVLHLSKKKGMVVEADTISEEEKIPKRFLLKIC
FT                   RDLIKAGIIESARGKNGGYILAKNPEDITMKDVILAVEGTLALNRCQIDPSACSKRATG
FT                   YCAVHKAFSSVMKTVAKEFEKYNFAELAKMDGN"
FT   gene            295405..297288
FT                   /locus_tag="Calhy_0239"
FT   CDS_pept        295405..297288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0239"
FT                   /product="carbon-monoxide dehydrogenase, catalytic subunit"
FT                   /EC_number="1.2.99.2"
FT                   /note="TIGRFAM: carbon-monoxide dehydrogenase, catalytic
FT                   subunit; KEGG: csc:Csac_0400 carbon-monoxide dehydrogenase,
FT                   catalytic subunit; PFAM: Prismane"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05995"
FT                   /db_xref="GOA:E4QB17"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010047"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB17"
FT                   /inference="protein motif:TFAM:TIGR01702"
FT                   /protein_id="ADQ05995.1"
FT                   /translation="MEICTFCETADKRLGEFIKSKEDLETSFNRKPRQSVKCGFGLQGI
FT                   CCRLCANGPCRITPTQKRGVCGADADTIVARNFLRAVAAGAGCYLHVVENVAHNLKKMA
FT                   ENQIDVPFKGQKTLHALADKLGIHGQDDREIALQLAEKVLSDLYKPRWDEMELVKYMAP
FT                   AMRYKKWSELGILPGGAKSEVFDAVVKTSTNLSSDPVDMLMHVLRLGIATGLYGLALTN
FT                   KLNDIIMGEPVLRSAPVGFRVIDPDYINIMPTGHQQSLFWALLKRLNDEDVKKMAQDAG
FT                   AKGFRIIGCTCVGQDFQLRGEHAKDVYAGHVGNNFTSEAVLATGAIDLVVSEFNCTIPG
FT                   LETVAERYMVRQICIDDVAKKANADLVQYSPEEAMEIADRILKEAVDSYKFRRGRVNID
FT                   IPYDHGYESALTGVSEGSLKEFLGGSYKPLIDLIASGRIKGIAAIVGCSNLTSIGHDIF
FT                   TVELTKELIKRDILVLSAGCTSGGLENCGLMSKGAEELAGDKLKEVCRELNIPPVLNFG
FT                   PCLAIGRLEIVAAELAEILNVDIPQLPLVLSAPQWLEEQALADGAFGLALGLPLHLSIP
FT                   PFITGSKLVTEILTEKLPDITGGRLIINNDVKSSADELESIILQRRKDMGI"
FT   gene            297308..297748
FT                   /locus_tag="Calhy_0240"
FT   CDS_pept        297308..297748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0240"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /note="KEGG: csc:Csac_0401 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05996"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB18"
FT                   /inference="similar to AA sequence:KEGG:Csac_0401"
FT                   /protein_id="ADQ05996.1"
FT                   /translation="MKRIYIEPTACTGCMNCILACIAHHKGVQSVLEIDFSDNDLEFAN
FT                   NVVLNTEGKIVPIFCRHCDQPECVTACMSGALTKDETTGYVICNQSWCAGCFMCVMSCP
FT                   YGMIKPNKSGDVAIKCDMCLDREIPACVQSCPVQAISLIDVD"
FT   gene            297766..299049
FT                   /locus_tag="Calhy_0241"
FT   CDS_pept        297766..299049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0241"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: csc:Csac_0402 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05997"
FT                   /db_xref="GOA:E4QB19"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB19"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADQ05997.1"
FT                   /translation="MKYLIIGASAAGLSCARTLRRLDSNGEIVVISKDDMVYSRCMLHY
FT                   FISDDRPLDKMRFVEEDFFDKNKVKWIRNTAVIEIRPFNKSVVTSDGAEHTYDKLLIAT
FT                   GATPVIPPIEGLAEGIEKRKDIFTLRDIGDAIKIKEAAKTSRQAVVIGGGLIGLDVAVS
FT                   LNKQGVKVTVIEMKDHILPQQLDKTAAQRYERIFKDNGIDIITGQAVSNVIYGLSGKVK
FT                   GVTLSDGSFVFADMIVVAVGVKPSFPRIDKCDLEIENGIIVDQYQRTSIQDIYAAGDAC
FT                   QSYELLTQRHILTPIWPSAVKQGQTAAYNMAGIGKPLIDNFGFKNSMKFFGLSTISYGY
FT                   VEPPDNSYNVAICSGPNYYYKVVYKENVLYGAIIQGDISGAGVVGKLIQNKCNLSNKLV
FT                   RNDWNNVFRLTYGDFFKQNQDGTFEFAC"
FT   gene            299208..300471
FT                   /pseudo
FT                   /locus_tag="Calhy_0242"
FT   gene            complement(300529..301356)
FT                   /locus_tag="Calhy_0243"
FT   CDS_pept        complement(300529..301356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0243"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: csc:Csac_0406 helix-turn-helix
FT                   domain-containing protein; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; SMART: Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05998"
FT                   /db_xref="GOA:E4QB20"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB20"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADQ05998.1"
FT                   /translation="MVSDLTPTSVLEAEHVRILYYDFDDYTRASYSSKNYLRFCSILQG
FT                   DKYVEINESEKFKYDSNSFVILPPYSKVKLEIKEKTKALVIEIDSYLINHVLSKLKMEF
FT                   EPYELGNVNNVLFVGKYSPDLTETYKKIVDTFLSRKVNREFLLDLYTQEFVYDIFKYRG
FT                   AEKIITDKNSEIYHILDYINTNYLRKLKISDIAKEFNMREYEFTKYFKKFTGKSPKEYI
FT                   KDLKLNKAKELLKFENVTNVCYDIGYENISHFIKEFKNKFGVTPNLYKKTLNS"
FT   gene            301468..302619
FT                   /locus_tag="Calhy_0244"
FT   CDS_pept        301468..302619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0244"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   csc:Csac_0407 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ05999"
FT                   /db_xref="GOA:E4QB21"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB21"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADQ05999.1"
FT                   /translation="MKTYRFYMPPISLMGRGCLKDVGEEIKALGYKKALIVTDKALVKI
FT                   GLVKKVTDILDDANISYVIFDETKPNPTVKNVEDGLKILKDNNCDFLISIGGGSPHDCA
FT                   KGIGLVATNGGSIKDYEGVNKSQKPILPLVAINTTAGTGSEVTRFAIITDEDRHVKMAI
FT                   VDWHVTPLIAVNDPELMIEMPKSLTAATGMDALTHAIEAYLSTDATPVTDASALMAIEL
FT                   IFKYLKKAVENGNDIEAREKMAYAEYLAGVAFNNAGLGYVHAMAHQLGGFYDLPHGVCN
FT                   AVLLPHVLSYNLKVVPHRFIDIAKAMGIDVQGVSAEKAGEMVIESIRALSKEIGIPAGL
FT                   KELGVKDEDIRILAENALKDACGLTNPKQATVEEIMEIYKSAF"
FT   gene            complement(302707..304251)
FT                   /locus_tag="Calhy_0245"
FT   CDS_pept        complement(302707..304251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0245"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: csc:Csac_0408 alpha amylase, catalytic region;
FT                   PFAM: alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06000"
FT                   /db_xref="GOA:E4QB22"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB22"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADQ06000.1"
FT                   /translation="MKRILRYILIFAIVFAVGLSSFLAGLSNSQSPVQTKKDGLIFYEV
FT                   FVRSFYDSNGDGIGDINGLAEKLPYIKSLGVNAIWLMPIFESPSYHGYDVTDYYKVNPD
FT                   YGTNEDFVNFIKKAHKMGIKVIIDMMINHTSSKHPWFIEASSNKNSKYRNYYIWATPNT
FT                   NFDEPSDLGTKQWYKKGDSYYNAIFWSEMPDLNFDNKAVREEMKKIAKFWLEKGVDGFR
FT                   LDAAKHIYPLSREKDTLAWWEEYAKFCRSIKKDVYLVAEVWDSPQRIAQYAKIFDSCFN
FT                   FTIAQNIIEGVTYENTQTLQNNLSSIYNLYKNVNPQFVDAPFLTNHDMNRAYTEIGSNS
FT                   KMKLAAALLLTLPGNPFIYYGEEIGMKGQKPDEYIREPFKWYETWKKGQTNWEMSLYNS
FT                   GPDVASVEKQEKDKNSLLNFYRDMIGFRKKNLPLLKGDFQLIKTSADTLSFARVYNNQK
FT                   MVLIFNFTGKELSKTITLPSNIKLAGKIVKGSGKILSLKNGKLSFSIKSYSFIILN"
FT   sig_peptide     complement(304162..304251)
FT                   /locus_tag="Calhy_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.904 at
FT                   residue 30"
FT   gene            complement(304371..304592)
FT                   /locus_tag="Calhy_0246"
FT   CDS_pept        complement(304371..304592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06001"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB23"
FT                   /inference="similar to AA sequence:KEGG:Csac_0409"
FT                   /protein_id="ADQ06001.1"
FT                   /translation="MKEALLILLAMSGCLLAHIFMHKAMMGRGCHGHDHHHSNETQKAS
FT                   DFKDHQFHQHHHSEELVALDKPKSEENK"
FT   sig_peptide     complement(304539..304592)
FT                   /locus_tag="Calhy_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.954 at
FT                   residue 18"
FT   gene            complement(304616..306871)
FT                   /locus_tag="Calhy_0247"
FT   CDS_pept        complement(304616..306871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0247"
FT                   /product="spermine synthase"
FT                   /note="KEGG: csc:Csac_0410 spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06002"
FT                   /db_xref="GOA:E4QB24"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB24"
FT                   /inference="similar to AA sequence:KEGG:Csac_0410"
FT                   /protein_id="ADQ06002.1"
FT                   /translation="MILVSISLVSISLFIYQVILNRIYSALFWYHYTFLITSFAIFGLG
FT                   IGGIIAYNQRQKSEDLKTNSLVKALFLLSISYIFSLGIIYVLPFQNNVLIYLILATLPF
FT                   IIGGYFFSTVFEQFGKISNKLYFADLIGSGFGSIIVLLSLNNLGVYRTVILICIISVIA
FT                   WLILSAQFKKKMLLSIGVLAVFLLGLFIPNKYVYSIEQNFIGFITNKTKTLGSIAKSNQ
FT                   KAKIVYTKWNAFSRTDVIKVEGDNDEMIVTIDGTANAPMYRFDGKKSSLNKYKDDIEYL
FT                   PFSFGNNHKTLIIGPGGGRDILYALAGNGKQITGVEINTSSIDAVRHFKEFNGDIYNRP
FT                   EVKIYGEDGRNFVRKSKEKYDVIFLALVMTNASQNIGYALSENYLFTVEALEDYMNHLT
FT                   DNGKLAFLAHDEEDMSKLIATILRQLNKKGIAIKDTPKYMAIFAKEVQLMDGNEHIHYP
FT                   LIIVKNKPFSQLESKKLKETADRGKIIPLYIPYVNDKGPLYHIKQGHLTLVQFENGFSF
FT                   SATPATDDKPYFYDFSKGVSPVLVFIFFFILLGSMILFTPIISQEKAFKPSLYFSSLGI
FT                   GYMLIEIPLIQKFILYLGHPVLAFNYVLAGLLIGSGIGAYFSNAKVFNNLSNRIYLPAL
FT                   LVMVINIGLIFSLNSIFKVTSDFSLVSKILIAAILVMIQGFFMGMPFPRGIKILSENKK
FT                   KSKTIPVMWGLNGVMSVIGSVLSIMLSMEFGFTIAMLAGALLYGLISLQNRNLVTAK"
FT   gene            complement(306908..307639)
FT                   /locus_tag="Calhy_0248"
FT   CDS_pept        complement(306908..307639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0248"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: csc:Csac_0411 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06003"
FT                   /db_xref="GOA:E4QB25"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB25"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ADQ06003.1"
FT                   /translation="MVYLLPFAAGLTSFFSPCIIPMISVYFSLITGVSIRDLKDIELHK
FT                   KMRKFILINTFIFVSAFTLVFTIAGALGGSIGRWLSGYTTIMNKIGGAITIIMGLNLIG
FT                   LLNLNFSFLNKYSADNIKTPSRYFTTFLIGLFFAIVCSHCIGPILYSMLIYTTTTKSAS
FT                   VGMTIMFLFSLGLAIPYLLVGYYLPHAINAIKRAKKFQNAICAVAGATLIFLGIVMFLN
FT                   KLQDLTAIFSRLLPYKLPFGM"
FT   gene            complement(307653..308189)
FT                   /locus_tag="Calhy_0249"
FT   CDS_pept        complement(307653..308189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06004"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB26"
FT                   /inference="similar to AA sequence:KEGG:Csac_0412"
FT                   /protein_id="ADQ06004.1"
FT                   /translation="MTKKTKRIIVIAVLFAFVVSSLYAQVIISQQKKQSNTQTKTTYRQ
FT                   DSKQSTSSKNNSPDPLIINSEGFITIGVRYLNPIKDDKDNLVFEVFLDNHQIDLSTLNF
FT                   NGKVLFSTSEGIKVNNAKWWIEGSGHHVMAFIKIPKKINGKNLITPKTKYIQLELQNIG
FT                   GVKLRIYRWDKKFLN"
FT   sig_peptide     complement(308115..308189)
FT                   /locus_tag="Calhy_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 25"
FT   gene            308512..309135
FT                   /locus_tag="Calhy_0250"
FT   CDS_pept        308512..309135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0250"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: csc:Csac_0414
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06005"
FT                   /db_xref="GOA:E4QB27"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB27"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADQ06005.1"
FT                   /translation="MKNKTEIIRRRYDRAAKYYDAVESMMEKKWFSQWRKLLFSFVKGP
FT                   KVLEVGVGTGKNMPYYSQDWEIVAIDFSPKMLEKAKERAVKLNLQVDLKLMDVQNLEFA
FT                   DNSFDTVVTACVFCSVPDPILGLKEIRRVLKDDGLLVMLEHVRSKKEPIGKIMDILNPL
FT                   VVGIYGANINRNTVENVKKAGFEIVEEKNLLSDIVKLIIAKPRL"
FT   gene            complement(309190..310386)
FT                   /locus_tag="Calhy_0251"
FT   CDS_pept        complement(309190..310386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0251"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="manually curated; TIGRFAM: transposase, IS605 OrfB
FT                   family; KEGG: tte:TTE0715 transposase; PFAM: transposase
FT                   IS605 OrfB; putative transposase IS891/IS1136/IS1341
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06006"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB28"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADQ06006.1"
FT                   /translation="MKIIVKRTEQIQINKNHELWSYCDKVCFAAKNLYNFANYTVRQEF
FT                   IHNGRWIRYRELDKMLKEHETYKSLPAQTSQQVLRLLDRNWKSFFKAIEEWSKDKSKFL
FT                   GRPKLPKYKKKDGRSIAIFTNQQCRIKNGYLTFPKTELKLKTRITDKLKEVRIIPKGSI
FT                   YVVEIVYEKEIGKIQRPPKKIAGIDLGLNNFVTLVNNIGIKPIVINGKVIKSINQYYNK
FT                   KRAQLMSYVGNRGSSRRIEKLTLKRNNKLLDYMHKASRFIVKWCKQYNIDTLVVGYNPN
FT                   WKQEIELGKVNNQNFASIPFYQFVNMLKYKCEEEGINIIITEESYTSGCSFLDGEEINE
FT                   INYNPRRRIKRGLFRSNKGILINADVNSAYNIIRKVFPEAFAKGIEGVGLHPVRLNIA"
FT   gene            complement(310334..310978)
FT                   /locus_tag="Calhy_0252"
FT   CDS_pept        complement(310334..310978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0252"
FT                   /product="Resolvase domain protein"
FT                   /note="KEGG: csc:Csac_2584 resolvase domain-containing
FT                   protein; manually curated; PFAM: Resolvase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06007"
FT                   /db_xref="GOA:E4QB29"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB29"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ADQ06007.1"
FT                   /translation="MKAKEVLELLKISRPTLTKYVKEGRIRVTVMPNGFYDYNEEDVYK
FT                   IFMKGVERKTYIYARVSTPKQKRDLENQIELLKQFCFSNGYKIHGVFSDIASGISFEKR
FT                   NEFFKMLDDILAGKVERVVIAYKDRLSRVGFELFKRLFRKFNTEIVVVSEVGSEKLDSQ
FT                   EIIEEIISLLHCYSMKFYSKRKIQKIRKLLESEVFEDNSQEDRANTDKQEP"
FT   gene            311255..312007
FT                   /locus_tag="Calhy_0253"
FT   CDS_pept        311255..312007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_2613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06008"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB30"
FT                   /inference="similar to AA sequence:KEGG:CHY_2613"
FT                   /protein_id="ADQ06008.1"
FT                   /translation="MPNYSVFTNKPEELKVQMFGSDLSTPIAVNNDGKIFIKSVEDTVN
FT                   ITGTITATDLDIRNLINTQDSVQIYGTDGTTNKPILTDTDGKIVISSTGVLSVQATDLD
FT                   IRNLNNTQDNILIYGLSDSGNTAISTTATGDININHNGRKFFELSLLNVTTGDDYQYTD
FT                   FIDVSNYSTYSFYVKNTGTTNAADIVLQISPTTNAGDTIDLLLLASLPAGDKDVLVPNK
FT                   FLRYIRLGYKSTVSLLPTTLDIYFQAHV"
FT   gene            312133..312984
FT                   /locus_tag="Calhy_0254"
FT   CDS_pept        312133..312984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_4715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06009"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06009.1"
FT                   /translation="MPEIILRAKLALSVTNYENQNNQVDKRIIFIGRDGKHNFRSLMFF
FT                   DTSCIPESCTITKAELVLFKIKDFYSTQDKIIKIHALLDYFSFKTTYNNIPAYESFFIE
FT                   APIDNSKITAEVNVKDIVVRWVDGSLKNKGIILFLNEDKKSLMAFTSFRFPIRYLRPLL
FT                   RVEYAMPQIPDIIVSNQTVQIKEQEAILIGTTQVISNSYDTSYILDGTVVAKNEGTNPT
FT                   QLTLECSNDNLNWIDDVSVILEAGQIKIMVPKYYSKFIRFKANAIGNINIKIRYVYKEF
FT                   MH"
FT   gene            313099..313431
FT                   /pseudo
FT                   /locus_tag="Calhy_0255"
FT   gene            complement(313503..314048)
FT                   /locus_tag="Calhy_0256"
FT   CDS_pept        complement(313503..314048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06010"
FT                   /db_xref="InterPro:IPR024485"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB32"
FT                   /inference="similar to AA sequence:KEGG:Csac_0417"
FT                   /protein_id="ADQ06010.1"
FT                   /translation="MKILKSILGIGLVLALVLTFTFVFAKGLQPGSAQKTKSAAAGWQQ
FT                   NTGYGYGFMPHTNMQELVAKALGLSVDELVQKIQNGQTINDILKEKKLTVDEFKKKLYD
FT                   LRAAEIDKLLKDGKITKDQAEFLKKHFQANIQYCIDNILDWSNNGFGGMMGFGHGGGMM
FT                   GFGHGNMMGAGFSGMMGY"
FT   sig_peptide     complement(313971..314048)
FT                   /locus_tag="Calhy_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            314224..314889
FT                   /locus_tag="Calhy_0257"
FT   CDS_pept        314224..314889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0257"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: csc:Csac_0418 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06011"
FT                   /db_xref="GOA:E4QB33"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB33"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ06011.1"
FT                   /translation="MANILVVEDQQDLNQIITRFLKNEGFNVINSYTAKDALEKLNDTD
FT                   LVILDIMLPDMEGYEVLKEASKKGIPTIILTSKSEEFDKLKGFELGAEDYITKPFSMLE
FT                   LIARVKVVLRRNRNFEESIKLLGGKVEIFPQRFKVIVDGEDVNLTHKEFELLLFLAKNK
FT                   DLVKSRDEILEKVWGFDFIGETRTVDVHIKQLREKLKDYKFLIKTVWGVGYKLSEEKE"
FT   gene            314911..316164
FT                   /locus_tag="Calhy_0258"
FT   CDS_pept        314911..316164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0258"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: csc:Csac_0419 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: histidine kinase A
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06012"
FT                   /db_xref="GOA:E4QB34"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB34"
FT                   /inference="protein motif:PFAM:PF00512"
FT                   /protein_id="ADQ06012.1"
FT                   /translation="MKLFTKIALNFIGIIVFLVLSIYISNMLYLKYFLEDMIIDDLKKL
FT                   SQDALENKLEGDLSAMKILILQGNTIVLEEGGLDLPYHMIMPVFNSTGVYEFSHPHLKV
FT                   EYIAYVLKRGDFTSIAITTKPYYGYALNIISKNLIKISIIFILIGLLVSLLISRHISKR
FT                   IIKISIATQKIAKGEDFELKDSSTDEVGDLARSINSLKNSLRLLERVRREFVANFVHDL
FT                   KTPIAVIKGYCESTKYLDIDDKEKIKQNMDGIEKQCDYMQNLISNMVELSKISAGIIEK
FT                   KIEEVDVNLIIKEACEQLKKLAELEDVEIIIKSLNSPKIKTDLNSFRRIINNLLQNAIE
FT                   NTKDKKVYIEAEREYVDIYNKTDLKEEELIFLFERYKSSKKGFGLGLSIVKELCKILDI
FT                   KLETFIVGGYIHFKIWLK"
FT   gene            316311..317417
FT                   /locus_tag="Calhy_0259"
FT   CDS_pept        316311..317417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0259"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   ate:Athe_2585 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06013"
FT                   /db_xref="GOA:E4QB35"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB35"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADQ06013.1"
FT                   /translation="MNKIKVAVLGCGNIAPVYLKNLKRFGIFDVVACADVDAEKAKSIA
FT                   SEFSVPQAVEPDKVYDLDVDIIVNLTPPQHHYEINKRVLESGKHLYSEKPLCSTLKEAK
FT                   EILELAEKKNLKVGCAPDTFLGANIQTAKKLIEDGWIGRPFAANCFILYGGPEKWHPNP
FT                   HFIFKKYLGPLFDVGPYCLTALVFLLGSVKKVSGMGMITYKERLITSEPHRGEKIEVEM
FT                   PTYVTANLLFDTGVIGSVTVSYDVPATNLRGIEIYGTEGTLIVPDPNFFDLGSVYLKRH
FT                   EDKEFTKMPTINLFNYDNLRGLGILDMALSIKLSTPLRASGRLSYHVLEILWAIYTSIQ
FT                   EGRFVDVESTAPQTSLLDMELLREVLCL"
FT   gene            317569..318138
FT                   /locus_tag="Calhy_0260"
FT   CDS_pept        317569..318138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0260"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ate:Athe_2584 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06014"
FT                   /db_xref="GOA:E4QB36"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB36"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADQ06014.1"
FT                   /translation="MNIFWLVAIVSAILYQLLFGNVEKITEILFSAPQKAADIFLTILL
FT                   SIMLWSGFLRVVQDSNLVDIFKKLLKPIFGALFETKNERALNFMLLNVVANMLGLGNAA
FT                   TPAGILAMQELSKEAKNSTASDDMILFVLINTCSIQLIPTTVILLRTKFSSSAPAAITF
FT                   PTLFVSMASLFVGIILCKVLSKVWKQ"
FT   gene            318135..318653
FT                   /locus_tag="Calhy_0261"
FT   CDS_pept        318135..318653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0261"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ate:Athe_2583 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06015"
FT                   /db_xref="GOA:E4QB37"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB37"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADQ06015.1"
FT                   /translation="MKNISGYLIVSFLLVIILFAAAKKIDVFKSFVEGVKDGLRISIKI
FT                   FPNVFALIVAVELFTKTGVLDILQKFLSPVLSFFGIYKEALGLIIIKPFSGSSSFAVLR
FT                   DIFEKYGVDSDIGIYSSIICASTETLFYVITTYLAATNVKKTRYLIPVAIAVDFLVLII
FT                   AAMIVRMSI"
FT   sig_peptide     318135..318203
FT                   /locus_tag="Calhy_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.721 at
FT                   residue 23"
FT   gene            complement(318710..319351)
FT                   /locus_tag="Calhy_0262"
FT   CDS_pept        complement(318710..319351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0262"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   KEGG: ate:Athe_2582 methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06016"
FT                   /db_xref="GOA:E4QB38"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB38"
FT                   /inference="protein motif:PFAM:PF02310"
FT                   /protein_id="ADQ06016.1"
FT                   /translation="MEILNEISQLIQKGNAKLAPEKVKEALSSGISAETILNDALIQAM
FT                   SVVGEKFKNNEIYVPEVLIAARAMKAALEVLKPILTETGVKPIGKVVIGTVKGDLHDIG
FT                   KNLVAMMMTGAGLEVIDLGVDVAPEKFCEAVKTHNPQVVAMSALLTTTMPNMKTTIEKL
FT                   QEQGLRDKVKVIVGGAPVTESFAKSIGADGYAPDAASAAELAKKFVQGVA"
FT   gene            complement(319371..322361)
FT                   /locus_tag="Calhy_0263"
FT   CDS_pept        complement(319371..322361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06017"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR033400"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB39"
FT                   /inference="similar to AA sequence:KEGG:Athe_2581"
FT                   /protein_id="ADQ06017.1"
FT                   /translation="MLDLEKLKNPDNFYRCAPFWSWNDNLKEEELLRQITEMHQKGYGG
FT                   FFMHSRVGLVTEYLSEEWLNLIKKCIEHAKKLNMLAWLYDEDKWPSGFAGGAVAFKNPS
FT                   YRHKFLVLLKEDHVEQDDEVLSSFVHGGVKYIVAKRTMKLGDKWFNGSCYVDLLSKEVT
FT                   QEFINLTHERYKSYCQEYFGDAMPGIFTDEPTYLRVHYKDIPTLPWTEKLPERFLQKKG
FT                   YDIKEHFEELFFNVGNYHKVRFDFFDIALEMFIENFTIPYAKWCEENGIMMTGHYMAED
FT                   TMRGQIEWIGAAMPHYEYMQLPGVDKLARHLEQVVTMKQVSSVAEQLDKKGVLCETFGT
FT                   TGQHVSFLHRKWISDWQAVLGVTYINPHLSLYSMRGERKRDYPPNLFYQQPWWEDEKFF
FT                   ADYLARISYIAGLGKRDVDVLVLHPISSAWAEYSKFDDSVDKLDILLDKTVKDLIANKI
FT                   DFHFGDEIILSKYAQVENGKIKVGSYSYKVVVLPPLTNLRKTTLKLLEDFVNTGGKVVA
FT                   LKDFLFSRFELCMIDGRKCEIPLKEKFISAADLNELVNILKEEVSNYIEVIDKKTGQNA
FT                   KKIILQSRKLNDGNRIIFLANTDLQREAEITIKIPTDNNVFAADLVDFGVFKIPTIRRE
FT                   KGCAVIDATMYPASSLCLLVSDKELSQNTKNLISGVVFDNSFEYKTGSCEFDIALKNYN
FT                   TLILDRIKYEVDGKVIFEDCYVSQVWHKHFYNLPEGTPFKATYYFEVEKVPSKLFVAIE
FT                   CAENLDRILVNGQPVKFERKTESFSPDQNFLDVNISKIDITSFVKEGKNEIVLSGRKSN
FT                   NITAPGCHERVKDPKNHRPTEVEAIYLVGSFSLICVDETKFILTEPKKPCHFDITKDGY
FT                   PFYVGSMSLKSSFEITKESSKRVYIKLNNVNASIAKVFVNGKKACTLFSQPFLADITEH
FT                   VNEGKNELEIVLTNTLFNLIEANHKADVFEELYRRPQSFIDFENFTSRYMLLPFGLGSY
FT                   SILTSDV"
FT   gene            complement(322391..323032)
FT                   /locus_tag="Calhy_0264"
FT   CDS_pept        complement(322391..323032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0264"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: csc:Csac_0425 class II aldolase/adducin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06018"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB40"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADQ06018.1"
FT                   /translation="MQDIRSIKSQICRIGRIMYERGYISGPDGNISVRVDQDKIITTPS
FT                   GVSKGFLNEDMLVLIDMEGKILEKSNYKPSSEIKMHLKVYQEREDIGACVHAHSPYATT
FT                   FAVLRKPLDKPILAESVFIFGGYIPVAPFATPSTVEVPQSIAPYVKDYDAVLLSNHGVL
FT                   TYDKDLEMAFYKLEIVEFWAKILFLSSQIGTPQVLSPEEIQKVLDLRKGK"
FT   gene            323271..325001
FT                   /locus_tag="Calhy_0265"
FT   CDS_pept        323271..325001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0265"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: csc:Csac_0426 alpha amylase, catalytic region;
FT                   PFAM: alpha amylase catalytic region; glycoside hydrolase
FT                   family 13 domain protein Ig domain protein region domain
FT                   protein; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06019"
FT                   /db_xref="GOA:E4QB41"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB41"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADQ06019.1"
FT                   /translation="MQVIHNQVHDIFALSRNKFYVRLWVQKGLVRSVTLIFSDRYDLDV
FT                   QKVKMDFYMNVGSFEVYTAHVQNKTPRFAYKFLIELLDGSFKIFNQFGLAEQEENLYFD
FT                   AFQFPYANEADIFEKPSFAEGLVVYEIFPDRFKRGKKEVHSKKLFDWDYCSWDVPGSEV
FT                   FLGGDFAGIKEKIEYFKALGINAIYLTPIFKSLSSHRYNVDDYFDVDPLLGTKEEFKEL
FT                   VDSLHENGIRIILDMVFNHTGVGFFAFQDVIKNGENSKYYSWYNIKSLPVDIQKGNYET
FT                   FAINVKSMPRINTSNKEVQDFFLEVLKYWLLEFDVDGFRFDVANELDKNFIRRIRRELK
FT                   AIKKDILLIGEVMHRSENFLMGDMFDGVMNYFSWEVFARYLMGKYNAEDASRILADYRL
FT                   KFNPVLFSCQLNLIGSHDTERVLTRLGNKKLAMLAAVYNLTYQGIPMIYYGDEIGMEGG
FT                   HDPDCRRGMIWEEEKHDREIFNLYRRLIDLKKTSSALNSDNVREFSIDDVLCFERKSES
FT                   EVVYILFNPRKSLQKVRLWSEFIVDREIEFFSTQQKIKNHSCYIEVELSPESCEIVIVK
FT                   "
FT   gene            325109..326017
FT                   /locus_tag="Calhy_0266"
FT   CDS_pept        325109..326017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0266"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2578
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06020"
FT                   /db_xref="GOA:E4QB42"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB42"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ06020.1"
FT                   /translation="MKKREPIGYVYLAPALISMAVLSFFPIAMTVYYAFTNFNLNHMED
FT                   YKFVGFKNFVDIITGPFKEVFAPTFAWTFTFALVTVLINFAVGLLLAVLLNNKFMKETN
FT                   IYRSILIIPWAIPGTIASLAWQGLLNEEYGAINMLLKTFHLDPIPWMTDPFWAKISIFI
FT                   VNLWLSYPFMMNASLGALQSIPPELYEVAEIDGAGWFTKLFKITIPMIVPTALPILISS
FT                   FAYAFNNFNVVYLVTGGGPARLDTQFAGHTDLLVSTTYKLTMQFYRYDLASAMSIIIFF
FT                   IVGTISLINMKLTRAFEGGER"
FT   gene            326017..326886
FT                   /locus_tag="Calhy_0267"
FT   CDS_pept        326017..326886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0267"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_0428
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06021"
FT                   /db_xref="GOA:E4QB43"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB43"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ06021.1"
FT                   /translation="MVGREYMTKQDAIALWISRVIIWIAIILSLLPTWFIIVASLSKGG
FT                   AFFQSSFFPKEITFENYIELFRKKSSPSQTLPDFVMWVKNSLIVCFGVAFLQIFMTAPA
FT                   AYAFSRINFVGRKNGLKTLLILQMFPTFMAMPAIYGLLAKFNLLDNLFALILVLAGGSA
FT                   FNIWLLKGNMDQIPYEIDEAAIIDGAGHFLIFRKIILPLTAPMLAVMFIWSFNGVFNEF
FT                   LLSSLVLQSPENATVPIGLRNFINNQFSANWPMFSAASILASLPIVIIYMALQKQIQSG
FT                   LAAGAVKG"
FT   gene            326940..328562
FT                   /locus_tag="Calhy_0268"
FT   CDS_pept        326940..328562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0268"
FT                   /product="alpha-glucan phosphorylase"
FT                   /note="KEGG: csc:Csac_0429 alpha-glucan phosphorylase;
FT                   TIGRFAM: alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06022"
FT                   /db_xref="GOA:E4QB44"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB44"
FT                   /inference="protein motif:TFAM:TIGR02094"
FT                   /protein_id="ADQ06022.1"
FT                   /translation="MKKLPTVAYFSMEFGLDSNFKIYAGGLGILAGDYLKAAKDLGYPV
FT                   VGVGILWKQGYNKQIVTEEYGVIDAFPIYRYNFLKDTGVKVKVRIRNRDVYCKVWKVDN
FT                   FENADLYLLDTDLPENADRWITGQLYGWFGEERVAQEMVLGIGGVRALKELGIKVDVYH
FT                   FNEGHAVFAGLELVRYYMEEEGLSFEQALSKAREKIVFTTHTPVEAGNETHPLRLLMYM
FT                   GANLNLTEEQLVYIGGAPFNMTVAALRLARISNAVSDLHRITANAMWAQVDRRSRIIGI
FT                   TNGVHVGTWADRRILESRHDPEKLWQTHTQIKRELLDFVEKRTGIKLREDVLTIGFARR
FT                   AAPYKRSDLIFRDKEAADKMFKNDLQIIFAGKSHPLDDTGKEIVNNIIAMSKKYPGKVV
FT                   FLEDYDMEIGKMLTRGCDIWLNNPRRPLEACGTSGMKAAMNGVLNVSTLDGWWPEACQH
FT                   GINGWQIGDGFESKDEKEQDSHDLKSLVNVMQNEVIPTYYKNRDRWVKMMQNSIESTLE
FT                   KFSAERMVKEYYEKMYIQKSHED"
FT   gene            328569..329591
FT                   /locus_tag="Calhy_0269"
FT   CDS_pept        328569..329591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0269"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: csc:Csac_0430 alanine racemase; PFAM:
FT                   regulatory protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06023"
FT                   /db_xref="GOA:E4QB45"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB45"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADQ06023.1"
FT                   /translation="MATIKEIAKEANVSPSTVSRVLAGSSKISPETTKRVLEAIKKLGY
FT                   VPNANAKGLVVKKSFTVGVFVPREPENAFLNSFFDQVITSICAVVNNFEYDILLALSNP
FT                   EKERELLKRLVESKKVDGFVLLSSREKDPAIEYLKSIDFKFVVIGRPNGFENSVNWVDN
FT                   DNVKAGFDATEYLIRLGHKKIAFMGGPGDLVVTSDRFSGYKKALEKYGIQLRSSYIKFA
FT                   NYYKKSYRENAYEILNQDDRPTAIVCMDDLIAIEVFKVAESLNLKVGKDLSVIAFNNSN
FT                   VSEICQPPLTTVDINILHLGRLAAEVLMMDLSESTKTYRRIIVPHQIVERDSCGKAQML
FT                   "
FT   gene            329731..330936
FT                   /locus_tag="Calhy_0270"
FT   CDS_pept        329731..330936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0270"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2574 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06024"
FT                   /db_xref="GOA:E4QB46"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB46"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ06024.1"
FT                   /translation="MKNLKRILTVALIIAFAVVALIPLSGVFATSKKQLVVWSHLTQDE
FT                   VKALQPIADKWGKANGYTVKVITDQGSFQSFQTAAMSGKGPDIMFGIPHDNLGAFWKAK
FT                   LLEAVPANLIDKKNFVSTALDACSFEGKLYALPIAMETYALFYNTSKVKEVPKTMSQLI
FT                   TLAKKYGFMYDVNNFYFSFAFIAQNGGYVFKNKGGSLDPNDIGLATNGAIKGLSLIRDF
FT                   VLTYKFMPKDIKGDIAKGNFQNQKIAFYISGPWDVQDFIKAKVPFAVAPLPKTDDGKPT
FT                   PSFVGVQAAFVSAKSKNKDAAFKLMKYLVENSALTLFKVGHRIPVLNKVLASSEVKSDK
FT                   IMSAFAEQAKVGIPMPNIPEMSAVWTPAGNALSLITTGKATPKQAADAMVKQIKQGIAQ
FT                   MQ"
FT   sig_peptide     329731..329820
FT                   /locus_tag="Calhy_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.877 at
FT                   residue 30"
FT   gene            331154..332215
FT                   /pseudo
FT                   /locus_tag="Calhy_0271"
FT   gene            332193..333311
FT                   /locus_tag="Calhy_0272"
FT   CDS_pept        332193..333311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06025"
FT                   /db_xref="GOA:E4QB47"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB47"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06025.1"
FT                   /translation="MERIIKNKFLSGKLTNRERFRRVMHYQNVDRIPNFEFGYWNETLP
FT                   TWHSQGLPPEIDNEEKAYKFFGIDSYKYVPIKNGLLPQFEQKVLEETQEYMIIIDSEGI
FT                   KCQIFKNRASTIPHYLEYPIKNKDDWERFKERLNPDDPARYPENWDEIVLELQKRDYPI
FT                   CIHCGSLLGKLRDWMGFENIALAFYDMPDLVDEMIEYMTDFSIKLMEKALKDVEVDFAL
FT                   GWEDIAFNNGPIISPQMFKEFLMPRYKRIADFLHKHGVDIIGTDCDGNIMPIVELWLET
FT                   GFNLMFPVEVHAGTDPVVLKKLYGDSIRLMGGVDKTKLQGSKEDILKELKRLEKVVEQG
FT                   GFIPHIDHRCLPDVPYENYLYYLENKKAMLGY"
FT   gene            333352..335745
FT                   /locus_tag="Calhy_0273"
FT   CDS_pept        333352..335745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0273"
FT                   /product="glycoside hydrolase family 35"
FT                   /note="PFAM: glycoside hydrolase family 35; KEGG:
FT                   scb:SCAB_20461 putative glycosyl hydrolase (family 35)"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06026"
FT                   /db_xref="GOA:E4QB48"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB48"
FT                   /inference="protein motif:PFAM:PF01301"
FT                   /protein_id="ADQ06026.1"
FT                   /translation="MIMHIVVNVDMTCPQKKISLLSFGGKNSSIEILVTNKYLLKNKIP
FT                   WLPTMGEFHFSRYPEDLWEKEILKIKFGGIQIIATYLFWIYHEEIEGEFEWSGNKNVRK
FT                   FVELCKKHDMFVFLRVGPWAHGECRNGGFPDWLLQKGCNLRTDDPMYLEYVERWYREIA
FT                   KQVDGLYFDQDGPIIGIQLENELYNNKEHIVTLKKIANKVGLRAPIYTVTGWGPKGGAE
FT                   FPEGEVVPVFGGYPEAPWEQHTKELPPNPNFFFTRLRNDAGIGNDLIPSSNDALSDDQE
FT                   VYNYPFWTCELGGGIQKTYHRRPYINPDDVGAIALVKLGSGCTLLGYYMYHGGRHAIGK
FT                   LSTLQESKDTGYPNDYPVISYDFQAPLGEFGEVRRHYHILRNLHMFVEDFGDILAPMEI
FT                   YLPELVPANRFDTTTPRVAVRSNGKSGFVFFNNYQRNPKLSDIEKLQVKIQLPEKALTV
FT                   PFQPFTLERDAYFFLPFNFDVGSFKIVYATAQPLCKLYNEKDEELIYVFKKCKGLEVEY
FT                   VFEGDITENIVSHKEFSEVCNIEGSSYTRISNVQLGVEKSILLKHKESDKNVKIITLDQ
FT                   MHAEKTWKLKINNRERILICPTHNIFVEDDTVHVFGENPEGYFYLYPAYEDDKIEFDEN
FT                   LRAEMVAENLYRISFWFEEITTDVKWYEEEFVKNEFDRFLYADVNGKGNIKQFKLRYKI
FT                   WGNKEDLDDLLLEVEYVGDVIQAFVDNKLVNDDFYDGFNRFHLSLKELNFPEEIIIKMS
FT                   AISKFHDIYLQKVPDYKDNDRVAVIKSAKLIPVYKREIKFIKRR"
FT   gene            335751..336686
FT                   /locus_tag="Calhy_0274"
FT   CDS_pept        335751..336686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06027"
FT                   /db_xref="GOA:E4QB49"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB49"
FT                   /inference="similar to AA sequence:KEGG:Csac_0437"
FT                   /protein_id="ADQ06027.1"
FT                   /translation="MPRPPAPLFRDPIYDGAADPTIIYNHLEKSWWILYTNRRANQKLP
FT                   GKAFMHGTDIGIAESKDGGRTWFYRGTIELQYGRGRNTFWAPEVIFYEGEYHMYVSFVP
FT                   GVPQDWNAERYILYYKSKNLWDWEFVCKLELSSNKVIDACVFQMPDGTFRMWYKDEADH
FT                   SYIYAAESNNLKDWKILGPALTDRPQEGPNVFWWKSKYWMITDPWCGLGVYSSEDATAW
FT                   HRHENILDRPGKREDDGQIGHHADVLVIDDETAYIFYFTHPEGMEGTEEFWKDSKYWRT
FT                   SLQVAKLEYVDGKVVCDRDKEFDFYLPDLF"
FT   gene            336975..338506
FT                   /locus_tag="Calhy_R0008"
FT   rRNA            336975..338506
FT                   /locus_tag="Calhy_R0008"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            338652..341602
FT                   /locus_tag="Calhy_R0009"
FT   rRNA            338652..341602
FT                   /locus_tag="Calhy_R0009"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            341661..341777
FT                   /locus_tag="Calhy_R0010"
FT   rRNA            341661..341777
FT                   /locus_tag="Calhy_R0010"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 69.77"
FT   gene            complement(341853..342800)
FT                   /locus_tag="Calhy_0275"
FT   CDS_pept        complement(341853..342800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0275"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; KEGG: ate:Athe_2560 ATPase associated
FT                   with various cellular activities AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06028"
FT                   /db_xref="GOA:E4QB50"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB50"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADQ06028.1"
FT                   /translation="MEIASVAKKIIQNISKVIVGKDVQIELVITSLFAGGHVLLEDVPG
FT                   TGKTMLSKALAKSIDCSFKRIQFTPDLLPSDLTGIYYFNMKMQEFEFRPGPIFTNILLA
FT                   DEINRATPRTQSSLLECMEERQVTIDGITHKLEDPFFVIATQNPIEIQGTYPLPEAQLD
FT                   RFLIKLSLGYTNKEETIQMLTRFREKNPLDSIEPVVAKDEVIKIQEKIKEVYVNEDILS
FT                   YIYEICQSTREHEMVQLPASNRSFIALMRASQSLAAVRGYDFVLPDFVKYLAPFVLSHR
FT                   ILLKNQYIIKNAKSSDVINEILEKVPVPSENFAF"
FT   gene            343070..343525
FT                   /locus_tag="Calhy_0276"
FT   CDS_pept        343070..343525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06029"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB51"
FT                   /inference="similar to AA sequence:KEGG:Athe_2559"
FT                   /protein_id="ADQ06029.1"
FT                   /translation="MANERLGTDVIVQIGIIVKDIEKTAKDFAEFFGVDMPQIIVTEEY
FT                   DKSHTQYKGKPTNARAKLAFFRNFKNVEIELIEPDENPSTWREFLETHGEGIHHIGVFV
FT                   KNMDEKIENLKKEGIEVVQKGDYTGGRYAYMDSTDKLKFILELLENF"
FT   gene            343556..344200
FT                   /locus_tag="Calhy_0277"
FT   CDS_pept        343556..344200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06030"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB52"
FT                   /inference="similar to AA sequence:KEGG:Csac_0293"
FT                   /protein_id="ADQ06030.1"
FT                   /translation="MKRILALVGDFYHSHDNLLKALKQATNAALDNCEIIDASIENFEE
FT                   FLSQNPDAIVISAENRVNPQDEIVKCWMTEQVEKRIKEYVESGGRLFVWHSGLASYPEE
FT                   GEFCKLVKGYFKFHPDKHKLVRYHSLHEATLDGKKFDFEIMDEHYFVFCDKDNTNIYLY
FT                   SESEDGSSIAGWWHNFGKGKVVALTPAHREDGLLDNNFQELLKAVLTILFK"
FT   gene            344370..345542
FT                   /locus_tag="Calhy_0278"
FT   CDS_pept        344370..345542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0278"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase; KEGG:
FT                   csc:Csac_0294 N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06031"
FT                   /db_xref="GOA:E4QB53"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR028584"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB53"
FT                   /inference="protein motif:PFAM:PF07221"
FT                   /protein_id="ADQ06031.1"
FT                   /translation="MDITRFKEDLKAHLEEKIIPFWQGLKDNEFGGYYGYMDFNLNVNR
FT                   EAQKGCILNSRILWFFSACYNVLKNEKCKELAFHAFEFLKNKFWDKEYEGLFWNVSHKG
FT                   VPVDVTKHVYVQAFGIYGLSEYHEASGDKEALHLAKRLFEILETKCKRENGYTEQFERN
FT                   WQEKENRFLSENGVIASKTMNTHLHVLESYTNLYRVLRTEDVYEVLEWIVRLFVDKIYK
FT                   KGTGHFKVFCDDNWNELIRMVSYGHDIEASWLLDEAAKYLKDEKLKKQVEKLSLEVAEV
FT                   SLQEAFDGQSLINEKVEDRVDRSKIWWVEAETVVGFFNAYQKTKEEKYLDAAIKTWEFI
FT                   KEYLVDKRKNSEWLWKVDENLEALDMPIVEQWKCPYHNGRMCLEIIKRVD"
FT   gene            345646..346653
FT                   /locus_tag="Calhy_0279"
FT   CDS_pept        345646..346653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0279"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ate:Athe_2556 transcriptional regulator, LacI
FT                   family; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06032"
FT                   /db_xref="GOA:E4QB54"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB54"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADQ06032.1"
FT                   /translation="MGKRVTMKDIAEKLGVSKVTVSKALKDSPDISSSLKEKIIKTAQE
FT                   MGYIYNAKGRMLRENLTYSIGVISSEKYYGKDDYFYIDLYKHLSNSLEKLGFTTTFNII
FT                   SQSDENELSVPNALLEQKVDGVVILGQMSLDYIQKILSYNYPTVFLDFYCDKFNVDCVI
FT                   TDNFYATYEITNMLIEQGHTKIGFVGNIYATSSIQDRFLGFYKALLENKIDLNKDWIIK
FT                   DRDDNNNFIDIVLPKNLPTAFVCNCDKTAYLTIEKLKSSGYKVPDDVSVVGFDDSLHAV
FT                   LSQPKITTVRVNLEEMGRRTAKMMVEKIKQGEKHYGKMLIKGRIIIRESVKALK"
FT   gene            346725..347711
FT                   /locus_tag="Calhy_0280"
FT   CDS_pept        346725..347711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0280"
FT                   /product="glycosidase related protein"
FT                   /note="PFAM: glycosidase related protein; KEGG:
FT                   ate:Athe_2555 glycosidase PH1107-related"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06033"
FT                   /db_xref="GOA:E4QB55"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB55"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ADQ06033.1"
FT                   /translation="MDVKIIGQSLPNMPWEERPKDCKDIVWRSKHNPIIKRNQAKDANS
FT                   IFNSAVVPFKDGFAGVFRVDDRARRMNIRRGFSKDGYNWEIDDEPIDFIQQTRDPLVSE
FT                   YKYDPRVTFIEDRYYITWCNGYHGPTIGVGYTFDFEKFYQIENAFLPYNRNGVLFPRKI
FT                   NGKYAMLSRPSDTGHTAFGDIFYSESPDMIHWGCHRHVMSAGYTPWQSLKIGAGPTPIE
FT                   TSEGWLLIYHGVLLSCNGYVYSFGAALLDLEKPWIVKARSKSYLLSPQEYYECVGDVPN
FT                   VAFPCATLCDASTGRLAIYYGGADTVVNLAFAYVQDIIDLLKRESQE"
FT   gene            347962..349608
FT                   /locus_tag="Calhy_0281"
FT   CDS_pept        347962..349608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0281"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2554 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06034"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB56"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ06034.1"
FT                   /translation="MFKRRVALLVAIAFLMTIIVPGFFSAPTKAVAASKNPIVFKIYWG
FT                   DSNAEPVDVWKTPIGKKVEQITSVRLQFEFIVGSDEETKAGIMLASGDLPDLINAHNVV
FT                   NKFIEAGALVPLDNYIAKYGKNIKKWYDAKALKKLKYPKDGHIYYLTPFREESDPLYSF
FT                   AGFWLPIYVLKEIKWPVVRDIDTYFKIVKDAVKKHPTYNGKPTIGFTALTDSWRIYVLM
FT                   QQPLRLEGYPNDGGWLIDEKTGVVKDSYTMPYAKTYYKILNQMWNEGLLDKEMFSQNYD
FT                   QYLAKISSGRVVGFYDERWQIQSAIDSLEKQGLYDRIPIAMPVLKKGVKRDRYNVVTMG
FT                   TGAGISITKKCKDPVAAFKFLDRMAGEDILKLINWGIQGQDYYVKNGKMYKNAKQIQNY
FT                   MSPDYRKKQGIGGNIWFAFPRPPFDWTYSDKSGKISWDYSDQALEQRYKPYEKEVLKAY
FT                   KIKSFKDLFSPTWNSPYGYGWDIKLPDDLQAIQNQADDLQRRYITKAIMAKPGEYDKIW
FT                   NEYLNKMKKIPIKKVIDFRQKEIQRRLKEWN"
FT   sig_peptide     347962..348060
FT                   /locus_tag="Calhy_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.889 at
FT                   residue 33"
FT   gene            349720..350646
FT                   /locus_tag="Calhy_0282"
FT   CDS_pept        349720..350646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0282"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2553
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06035"
FT                   /db_xref="GOA:E4QB57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB57"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ06035.1"
FT                   /translation="MQSSKKGIWATIYNQRQLIVLTFPFLIMVLIFNYFPLWGWLLAFK
FT                   DYKPYLGFQNSEWVGFKNFADLFSDVYFFQALRNTLVISCLKLIFNFLSSITFAILLNE
FT                   IKNMLFKRTVQTISYLPHFVSWVVAANIVYTVLSPDYGIINELLVKFHILKEPINFLGE
FT                   PQYFWFIAPITEVWKEMGWNAIIYLAAMTNIDPQLYEAASIDGAGRLKRIWYITLPGIL
FT                   PTVKILLIMNVGWILNAGFEQMYLLQRPSTLDYSDILETYILRYGIGSGRWSYATAAGI
FT                   FNSVVSLILVTTANRIASKIGEGERVF"
FT   gene            350674..351576
FT                   /locus_tag="Calhy_0283"
FT   CDS_pept        350674..351576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0283"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2552
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06036"
FT                   /db_xref="GOA:E4QB58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB58"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ06036.1"
FT                   /translation="MQTSAKYRTTEDLVIDIVVYTVMIIVMIATLYPFWNILAISLNDA
FT                   LDSIRGGIYLWPRKFTLNNYRVILSNPDIYHATLISVLRAVIGSLTNVLSCLMVAYAIS
FT                   RKDYIFRRFISKVIVFTMYFSGGLIPTYLLMKNLHLVGTFWVYILPGMVSAFNIIVIRS
FT                   YIDGLPQSLIESAKIDGASEYRILFQIIMPLCLPVLATVTLWVAVGQWNAWFDTFLYNS
FT                   GKPELSTLQFELQKILQSVQSASTNPDFSASLTSSGRTVTPTAIRATMTVVATLPILFV
FT                   YPFLQRYFIHGLTIGSIKE"
FT   gene            351637..353427
FT                   /locus_tag="Calhy_0284"
FT   CDS_pept        351637..353427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0284"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: csc:Csac_0300 histidine kinase internal
FT                   region; PFAM: histidine kinase internal region; histidine
FT                   kinase HAMP region domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06037"
FT                   /db_xref="GOA:E4QB59"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB59"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ06037.1"
FT                   /translation="MRKVIKIINDIPLFKKIFSIFFIFVFIPLLILSSQFISQIYFYIN
FT                   DKLRSQLENASNMTISNFKKAIELAINLAYTIYSDPRVIETVNNRYSSVEEFYDAYEKN
FT                   IKPILQNARILYPQISQITIYCDNPTILNADGLAFLTEEYKKFFQKGEKEGKNLYVLSG
FT                   LENEKPYVSIVLNLNFYEQYVPKYQHSTIKKFLRIDLNRVYLNSILSTFKDGHIFIADE
FT                   KDTVYFSDLLYYNQVGRLSDILKEEKNQTIVSEKLLSTELPYFENWRYIVTTNNSGISK
FT                   RLLEHQRNYLAIVVLCFTLAFFALFLIVNSVVNRLSILARHIKKARKQQFESINIEAGK
FT                   DEIGQVIEEFNIMAQKIKELLEKEIKYELRQKELALEKKQAEINALQSQINPHFLFNTL
FT                   ETIRMRSMLKKEFETANTIKLLAKLLKRSIRWENDLITIEEEISSIYDYLEIQKYRFGE
FT                   KLKFEIDVEEDVKSIKIPKMTIQPLVENACVHGIENSKGEGRIVVKVFKECDVIAITIE
FT                   DNGKGLEDNKITELLRSVKGLSSDKASSVGLKNVFRRLELFYDKDFSFDILRGQLGGLK
FT                   VVIKIPNKRDFEDAVQSVDS"
FT   gene            353402..354908
FT                   /pseudo
FT                   /locus_tag="Calhy_0285"
FT   gene            complement(354981..357254)
FT                   /locus_tag="Calhy_0286"
FT   CDS_pept        complement(354981..357254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0286"
FT                   /product="5-methyltetrahydropteroyltriglutamate/homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="TIGRFAM:
FT                   5-methyltetrahydropteroyltriglutamate/homocysteine
FT                   S-methyltransferase; KEGG: ate:Athe_2549
FT                   5-methyltetrahydropteroyltriglutamate/homocysteine
FT                   S-methyltransferase; PFAM: Methionine synthase vitamin-B12
FT                   independent; Cobalamin-independent synthase MetE domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06038"
FT                   /db_xref="GOA:E4QB60"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB60"
FT                   /inference="protein motif:TFAM:TIGR01371"
FT                   /protein_id="ADQ06038.1"
FT                   /translation="MISVVGFPRIGQNRELKKWVESYLDKKLSKEELIQNSKTLKKTHW
FT                   QLQKEYGVDLIPSNDFSFYDTFLDHAMLVGSIPEEYKAFFSDELELYFALAKGYQDQNI
FT                   DLKALPMKKWFFTNYHYLVPEITEKTKFELSSTKPFDEFVEALSIGIKTKPVIMGALTF
FT                   LKLSKKSNVDVYDKSFWEKLLDVYIQILKRFENLGCEFVQIDEPILVTDLSAKDIDLFE
FT                   SFYRSLLLHKGKLKVLLQTYFGDVRDCFEKIISLDFDAIGLDFVDGKFNLELIKKFGFP
FT                   QEKLLVAGVVNGRNVFKNNYKNTLELLNMLSSFVDKKNIVISTSCSLLFVPYSLKFETQ
FT                   LDSNKKKFLAFAEEKLKELSELKLLFSQENFTANSIYLQNAQLFEELNKNKLSDVSTAV
FT                   NNLTEDDFERKPCFEERIKLQKEVLKLPQLPTTTIGSFPQTQDVRSARSKLKKGEITFD
FT                   EYESFIKSKIERVIKLQEEIGLDVLVHGEYERNDMVEFFGENLEGFLITQNGWVQSYGT
FT                   RCVKPPIIFSDIKRKKSLTVEYIKYAQSLTSKPVKGILTGPVTILNWSFVREDIPLKDV
FT                   AFQLALAIKEEVLELEREGVKIIQIDEAALIEKLPLRRCQHSEYLSWAIKAFRLTCSKV
FT                   KPQTQIHTHMCYSNFDELLDEIAKMDVDVITFEAAKSDFTLLDSINKSSLKADVGPGVF
FT                   DVHSPRIVSKEEMKKLILKMIEKVGKDRLWVNPDCGLKTRKEEEVMPTLQNMVLAVWEV
FT                   RNNL"
FT   misc_binding    complement(357513..357737)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 125.43"
FT   gene            358140..359870
FT                   /locus_tag="Calhy_0287"
FT   CDS_pept        358140..359870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0287"
FT                   /product="ATP-dependent OLD family endonuclease"
FT                   /note="KEGG: pmo:Pmob_1497 ATP-dependent OLD family
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06039"
FT                   /db_xref="GOA:E4QB61"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB61"
FT                   /inference="similar to AA sequence:KEGG:Pmob_1497"
FT                   /protein_id="ADQ06039.1"
FT                   /translation="MKIKTVFIHNFRSIKDGKFDLYDYNVLVGSNNSGKSNILTALRIF
FT                   YEDEIKYNDSNDFPKFKTDDNESWIEIEYVLSEEEVKSIKKEYVYDNNILKVRKYLKSE
FT                   DRNKVKANQSNIYAYESGKLSENLFYGARNISQAKLGTVIYIPALATTNETLKTTGPSP
FT                   FRKLLNLIIKELSKKSKSFQRLYEEFEKFNINLKNEETEDGLSLKNIENKINNSLREWN
FT                   VKFNVNIEPIGPDEVIKSLVKTNFIDETLNKEMNVTQYGLGLQRHLIYTLIKIASQIEK
FT                   ETEEESNNKKDFSPDFTLILFEEPELFLHPTQQEILNVGLRNLASEENHQVLITTHSPI
FT                   FVSKNIEEVSSIIKLKREEGVTKIFQITNEKIDELIKNNNELFVILKNKLEDPQTDERI
FT                   KKRIRELIGETEEERRLEEESIRYLSWLDSERCCAFFADLVLICEGATEKVFIDYLIRN
FT                   KVQKLNEKKIYVLDAMGKFNIHRYMNLFKELGIYHSVLMDKDENRNVHEFVNEFIVNNK
FT                   NEYTKKIDFFESNIEDFLNVPRVKQDWKKPINMLWHYFHNKIEEKKLEDLIEKVRQLIE
FT                   "
FT   gene            359991..360233
FT                   /pseudo
FT                   /locus_tag="Calhy_0288"
FT   gene            complement(360242..361476)
FT                   /pseudo
FT                   /locus_tag="Calhy_0289"
FT   gene            complement(361760..364951)
FT                   /locus_tag="Calhy_0290"
FT   CDS_pept        complement(361760..364951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0290"
FT                   /product="helicase domain protein"
FT                   /note="KEGG: pmo:Pmob_1535 helicase domain-containing
FT                   protein; PFAM: helicase domain protein; type III
FT                   restriction protein res subunit; SMART: helicase domain
FT                   protein; DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06040"
FT                   /db_xref="GOA:E4QB62"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB62"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ADQ06040.1"
FT                   /translation="MLTDLTFITNQDGQTLKDRFLTLIKDTQFFDILVGYFYLSGFYLL
FT                   YPSLEKTEKIRILIGIGTEQKAFEFLKNAQQLSLFSHYQTKNAIRDFIKYEMDNSEDSK
FT                   DIEEGIKKFIEWIANGKLQIRAYPSKSLHAKLYIMTFKEGDRDVGRVITGSSNFTYSGL
FT                   VDNLEFNVELKNRADYEYAKAKFEELWNEAVDVSQDFVITLKENTWLNENITPYEIYLK
FT                   TLYEYFKEDLETIDDIYLEDLPENFKQLEYQKQAVLNAKKILEKYGGVFISDVVGLGKT
FT                   YIAALLAKQLDGKTLVIAPPKLIDRKNPGSWKNVFFDFAVPADFESIGKLDDILKSGVE
FT                   KYKNIIIDEAHRFRNENTEGYKKLSEICRGKRVILITATPFNNTPMDILNLIKLFQSPR
FT                   KSNIPGVANLEAFFTKLNNRLKNIDRQENYDEYIKVTRENAKLIREKILKHIMVRRTRS
FT                   EIEKYFADDLKKNKIKFPKVQDPFPLFYQFNEEEDNIFMETIRLITQELKYARYMPLLY
FT                   YKEKISQLEEQSQKNMGGFMKVLLVKRLESSFYAFSKTIDRFIQSYERFIREFEKGNVY
FT                   VSKKYINRIFELLEDGDDILVQTLIEEGKAEKYSSKDFKDNFIKDLKSDLQILKRIKNM
FT                   WSKINRDPKIEKLIDEFMRNEILKNKVIIFTESQETAEYLSENLSRALKENILLFTGKS
FT                   TERDRDAVIENFDDRAKIKKDDYRILITTEVLSEGVNLHRANVVINYDIPWNPTRMIQR
FT                   IGRVNRVDTKFDTIYVFNFFPTKQANDQIKLKELAKAKIEAFLTLLGGDAAILTEGEPV
FT                   DSHELFDKLVSAKIFIQEDEEVESELKYLKIIREIKEKDPQLFEKIKHLPAKARSAKLR
FT                   NQISNQLSSELFSGESFLLTFFRKGKLQKFFLVSEKAQPVEVDFVTAAKVLECSNNEQK
FT                   ETIPLNFYDLLEKNKLAFYEATTEVPIEPQKMSTNQKYILSLLKILLKSPVVSEHQKSY
FT                   LLKLKDKIEEGAIPKKIINHVTNLIKEKLTNKNPLDIVPIFEKEISSRFLEEHFIAQQE
FT                   NYSEKREIILSLYLK"
FT   gene            complement(364987..369446)
FT                   /pseudo
FT                   /locus_tag="Calhy_0291"
FT   gene            complement(366590..367537)
FT                   /locus_tag="Calhy_0292"
FT   CDS_pept        complement(366590..367537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0292"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   csc:Csac_2323 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06041"
FT                   /db_xref="GOA:E4Q9D1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D1"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADQ06041.1"
FT                   /translation="MSNFIKTQKQKFLKILMTIEKVIKALGLKIKSSRRGRPKKFKLSH
FT                   IIACFVYKVKNKINSFRELEYKINEDEEFKKAIGIEKSPDHSYFSKWAKVIEEGYIEGI
FT                   ARILVREIVPQTKVCAIDSTPLRSSRGDKEAEVGVCVSLGFYNGYKLHVLATVEDEVIP
FT                   IVWWLTRANIHDSKVVELLYEAKIFGPEVILADAGYDCAKWFEVADRLEIKFVAAVNKR
FT                   NSKDFSNVKNILRVKNMEFLRSEEGQRLYKQRTKIERLFGKLKGEYNLEQIRLRGFRTY
FT                   KRHVDWIMITYLIEVYIQKIENCKFSFKYTWNNL"
FT   gene            complement(369610..370229)
FT                   /pseudo
FT                   /locus_tag="Calhy_0293"
FT   gene            complement(370392..370652)
FT                   /locus_tag="Calhy_0294"
FT   CDS_pept        complement(370392..370652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0294"
FT                   /product="cytotoxic translational repressor"
FT                   /note="KEGG: ate:Athe_2547 cytotoxic translational
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06042"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB64"
FT                   /inference="similar to AA sequence:KEGG:Athe_2547"
FT                   /protein_id="ADQ06042.1"
FT                   /translation="MKIYYSQLFKEKVNKLPPDVKKILKKKLELLLQNSYHPFLRTKKI
FT                   QGTKDIFETSITMGIRLTWQYKEDGIILGNIGEHDKTLKNP"
FT   gene            complement(370649..370930)
FT                   /locus_tag="Calhy_0295"
FT   CDS_pept        complement(370649..370930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0295"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: csc:Csac_0303 AbrB family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06043"
FT                   /db_xref="GOA:E4QB65"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB65"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADQ06043.1"
FT                   /translation="MVIVEIKKKSQVTIPAQILKKLNLQVGDLLQIEEKDGRIILTPVV
FT                   TVPKEQAWFYSEKWQREEATVEQEIKEGKLMVANSLQELFEDLGLNDE"
FT   gene            371116..371277
FT                   /locus_tag="Calhy_0296"
FT   CDS_pept        371116..371277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06044"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB66"
FT                   /inference="similar to AA sequence:KEGG:Athe_2545"
FT                   /protein_id="ADQ06044.1"
FT                   /translation="MVYDDNNTKRRRFKRSSEAERGIIEKLSELGYGMTEIVRELGRSA
FT                   ISCCCRGE"
FT   gene            371461..372039
FT                   /locus_tag="Calhy_0297"
FT   CDS_pept        371461..372039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0297"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: ate:Athe_2544 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06045"
FT                   /db_xref="GOA:E4QB67"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB67"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADQ06045.1"
FT                   /translation="MNTKSICLVSLFAALTAVGAYIKIPIPYVPFTLQLLFCALAGLLL
FT                   GPKLGALSQVVYVSTGLIGIPIFAEGGGPLYIFKPTFGYLIGFILCAYIAGYISHLKQS
FT                   RSISLNLIGSLSGLFVVYLLGVSYLYVIYNFYLKMPKTISWALYWGFLVCVPGDIFLCI
FT                   VASFVAKRLKPMLERVLLINTRYLQEPQE"
FT   sig_peptide     371461..371520
FT                   /locus_tag="Calhy_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.532 at
FT                   residue 20"
FT   gene            372063..372794
FT                   /locus_tag="Calhy_0298"
FT   CDS_pept        372063..372794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0298"
FT                   /product="dethiobiotin synthase"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: ate:Athe_2543
FT                   dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06046"
FT                   /db_xref="GOA:E4QB68"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB68"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADQ06046.1"
FT                   /translation="MSAVYIIGTDTDVGKTFICAGLCWALKEKGYNVGYFKPVLSGAKR
FT                   RGKMLIPQDTEFVVNFAKIKGDIYRLTPFIFEKPASPHIAAGEENKDIDVDQIKQTFDD
FT                   LSKVYEFIIIEGCGGLAVPLKEQNNQFYMQYQLIKEICNNVILVTTTKLGTINHTLLTV
FT                   EFAKAYGLYLKGIIVNRYKNEPDEDKVINTIAKFTNIPILAKVDFINDFPSDVDENKFK
FT                   NIFKKCFDDRAIMKIMGVFEC"
FT   gene            372788..374137
FT                   /locus_tag="Calhy_0299"
FT   CDS_pept        372788..374137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0299"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="KEGG: ate:Athe_2542
FT                   adenosylmethionine-8-amino-7-oxononanoate aminotransferase;
FT                   TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06047"
FT                   /db_xref="GOA:E4QB69"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB69"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ADQ06047.1"
FT                   /translation="MLNEWQQRDLKYIWHPCSQMKDYEELPPIVIEKGQGVWLYDVEGN
FT                   RYLDAISSWWTNLFGHCNKRLNDALKAQADKLEHVIFANFSHKPAIELSQKLVKITPNG
FT                   LEKVFFSDDGSTSVEVALKMSFQYHQQKGNYTKLKFACFTNSYHGETLGALSVGSIDLY
FT                   SKIYKPIMKESIKIQGPDCFRCKYHKTRYSCNVECFEEVEKILEKHHKEICAVIIEPII
FT                   QCAGGMKIYPPKFLKLLREVCTSYDVHLIADEVAVGFGRTGKMFACEHAGITPDFLCLS
FT                   KGLTAGYMPLAVTLTTQEIFDAFYADYVELKAFLHSHSYTGNPLACAVALESLKIFEEY
FT                   NVLKKINEKATYLEELARETFDNHRFVGEYRQFGFIGAIELVEDKATKKEFDWRKRVGY
FT                   HIYKTALKKGLLIRPLGNVIYFMPPFVIENDEIDFMVRNTLESINQFFGL"
FT   gene            complement(374223..375233)
FT                   /locus_tag="Calhy_0300"
FT   CDS_pept        complement(374223..375233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0300"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; TIGRFAM:
FT                   biotin synthase; KEGG: ate:Athe_2541 biotin synthase; PFAM:
FT                   biotin and thiamin synthesis associated; Radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06048"
FT                   /db_xref="GOA:E4QB70"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB70"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ADQ06048.1"
FT                   /translation="MLNFLQSVQFVKEVEKKIIEYEKDIDFNEAIMLYEIAKHDADLVK
FT                   NLANTIKQHYFENTIELCSIYPAKVGLCSEDCKFCSQSIHHSCSIEIKDLATLDEVTEY
FT                   LENVISFPVKRFSLVTSGEKLNDSEFEKILDIYSYISKNYNILLCASLGFLTQERAKKL
FT                   LKAGVVKYHNNLETSSKYFKNICSTHTQQQKKEALKIAKEAGLQICSGGIISMGEDMIE
FT                   RIKLAFELRELDVDSVPINILNPIKGTPFEDMKIMDQNEIFITLALFRIILPKKTILLA
FT                   GGKENALGDMEIMAYECGINGCMVGNYLTTKGMGIREKIEMLESLDLKFQTNMHK"
FT   gene            complement(375554..375649)
FT                   /locus_tag="Calhy_R0011"
FT                   /note="tRNA-Ser5"
FT   tRNA            complement(375554..375649)
FT                   /locus_tag="Calhy_R0011"
FT                   /product="tRNA-Ser"
FT   gene            complement(375802..376923)
FT                   /locus_tag="Calhy_0301"
FT   CDS_pept        complement(375802..376923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0301"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: ate:Athe_2540
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06049"
FT                   /db_xref="GOA:E4QB71"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB71"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADQ06049.1"
FT                   /translation="MRGHIAKKGKKYYIVVDIGVVDGKRKQKWLGGFETKAEAEEALPR
FT                   ILNIIYQNKNKLLEQKTFGELLDLWLNTVAKNRVSLSTFQSYSSSIALHIKPFLGEYEL
FT                   GKLTPMDLQKYYQHVMTEKGLSSTLALYHHRIIHQALDYAVKMDMLEKNPADYVDPPKK
FT                   RNYQPSIWDEETIKKALEIFKGTNIRIPVLLAIYTGMRIGEIAALKWEDINLEQGYITV
FT                   NKTFMKINGQTYIKEKAENKNSYRIVAISNQVVSELKEWKAKQEKLKEELKELYHDEGF
FT                   VCTFEDGRVQDPKYITKVFQKTIEKHKLPKIRFHDLRHTHASILLKHGVDPKHISDRLG
FT                   HSTITTTLNIYSHVFDEKRKKVAETFEDILKNQ"
FT   gene            complement(376920..377354)
FT                   /locus_tag="Calhy_0302"
FT   CDS_pept        complement(376920..377354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0302"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   ate:Athe_2539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06050"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB72"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADQ06050.1"
FT                   /translation="MNYKQLLKKVISFIEFVDTEYGTRDPEKIAAMENIFRLVWKLPRC
FT                   IQGFSFIHDGDKYIVINEKLSEKGRQFALLHELYHLLNSHTNEYNRLLFMTNAFVKTTK
FT                   TEIEADYFAFICMNYEDFENINPLTIEHEVAIFKRRYLKI"
FT   gene            complement(377362..377799)
FT                   /locus_tag="Calhy_0303"
FT   CDS_pept        complement(377362..377799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0303"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: ate:Athe_2538 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06051"
FT                   /db_xref="GOA:E4QB73"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4QB73"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADQ06051.1"
FT                   /translation="MAKKNKIARTLGLKIKKLREEKGWTINQLALYAGVNPTSIMRAER
FT                   GESELSLGNLLRIAKALKVDLNTLVEESMGQIKLGDEELVPEEKDKTPDIYEIIKKAEN
FT                   LNFKGIPVNEPDVKQAIVEAITFAIRLKAKEKRQENKEIEE"
FT   gene            377997..378191
FT                   /locus_tag="Calhy_0304"
FT   CDS_pept        377997..378191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06052"
FT                   /db_xref="GOA:E4QBF0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBF0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2537"
FT                   /protein_id="ADQ06052.1"
FT                   /translation="MNYEYIREFIAKVPTYKFARLIGVHPSTIFRIKQGKQPSPGVILR
FT                   ILETKPQGFEIERFLGEIK"
FT   gene            378188..378550
FT                   /locus_tag="Calhy_0305"
FT   CDS_pept        378188..378550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06053"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBF1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2536"
FT                   /protein_id="ADQ06053.1"
FT                   /translation="MNVHELIKKMDEIEKSVAEIKNLLYEMTKEESKGFLTVEELRRKY
FT                   RIGKNFLYWLCKSNLVDFRYLNRKYYISEKSFLQYLENLRPGKTTAMPTTSKREEHNTK
FT                   IVQIENKLQKYLESIK"
FT   gene            378572..379096
FT                   /locus_tag="Calhy_0306"
FT   CDS_pept        378572..379096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06054"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBF2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2535"
FT                   /protein_id="ADQ06054.1"
FT                   /translation="MARKLSQEKINEILRLFYEEHKKRVEIHRITGVSRPTINKYIKED
FT                   PRYWEEVAYRLLEANNRRKAQWRSYQQKRRERAKRELWDETYEIMKREHAQAVAELSYH
FT                   RWPSVSTLYEFVRSCYRWVRGKFVRKDCLEDGTLVPTTLPKYIRPVHTLTEGLKKRRNT
FT                   VINTANNVLAY"
FT   gene            379107..379358
FT                   /locus_tag="Calhy_0307"
FT   CDS_pept        379107..379358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06055"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBF3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2534"
FT                   /protein_id="ADQ06055.1"
FT                   /translation="MIQITRHAIKRYKERIMPCSDLEAELNILKAAVHGILLSRRGKYK
FT                   AVQYGPAVLIIYENGGIATVKTIEHVKFSGWWKKEKMW"
FT   gene            379527..379814
FT                   /locus_tag="Calhy_0308"
FT   CDS_pept        379527..379814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06056"
FT                   /db_xref="GOA:E4QBF4"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBF4"
FT                   /inference="similar to AA sequence:KEGG:Athe_2532"
FT                   /protein_id="ADQ06056.1"
FT                   /translation="MNDLNGIVEPVTPEQFSNTLAKLFVTLLQIVQNFIKPIAGLGIMI
FT                   AVLLLLVGYVFHVQIAKKMGASILGGVGFVVIIYLLAPYILGVIYNTFGK"
FT   gene            379833..380177
FT                   /locus_tag="Calhy_0309"
FT   CDS_pept        379833..380177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06057"
FT                   /db_xref="GOA:E4QBF5"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBF5"
FT                   /inference="similar to AA sequence:KEGG:Athe_2531"
FT                   /protein_id="ADQ06057.1"
FT                   /translation="MNKIKKVWASVSTALAFAMLQLTAFATADFSGIVEQKDTKAVVQD
FT                   IVTKVKTPIQIIAVGAAVILFMVRSALLAATQDEHKQAQIKKSFGIMIIGLIGVFFAAS
FT                   IVGFIVNAVK"
FT   sig_peptide     379833..379913
FT                   /locus_tag="Calhy_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.742 at
FT                   residue 27"
FT   gene            380268..380561
FT                   /locus_tag="Calhy_0310"
FT   CDS_pept        380268..380561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06058"
FT                   /db_xref="GOA:E4QBF6"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06058.1"
FT                   /translation="MRTFKIPLDEKIEDKVIGGIMTWKQFLVFVVPALIGFGLFSELRF
FT                   PIWLAAILEIFILVIGSAFAFLKINGDELDVFLKKLYKFYTGKRTILYRSDD"
FT   gene            380563..381348
FT                   /locus_tag="Calhy_0311"
FT   CDS_pept        380563..381348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06059"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBF7"
FT                   /inference="similar to AA sequence:KEGG:Athe_2529"
FT                   /protein_id="ADQ06059.1"
FT                   /translation="MSDLLVILVGGLLILGYKLFEKRIKTKANLISSSSKTQGIQKVDD
FT                   RNHLKRLLEIKNILPDGTVVMDNFRYVRIFGLSSQDFDLMSEAEQEAFELSLMSLMRAL
FT                   DVPVQFFITTQRVETTQQVNEIDGFLTQNTATINESLKKYCEMLKNELLQLQKQKDMYV
FT                   RKSFVSIWVREQNEKVAFEKLNDRTKKIISLFKNAGIKIYQLSMPEVLQLLHDEFNKNK
FT                   IFKVDEAIKNHVLDLYNSGKKGVVVDDSVIEEVYREETA"
FT   gene            381305..383164
FT                   /locus_tag="Calhy_0312"
FT   CDS_pept        381305..383164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0312"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: ate:Athe_2528 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06060"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBF8"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADQ06060.1"
FT                   /translation="MIQLLKKSTEKKQREDKNQQTKSRLDKNALGLLDLVVPDCLHLEK
FT                   DYIYLGSERYARVYVLAVHPYEINLGFFNSFFNLGQIVISIYVEPADTGEVIVDLTKKI
FT                   TKLKSNEIVSMQQGKKPDYRKMTQAEDYEMLRAALQRGIEKVLYVQVFFTIFAESLEKL
FT                   KEKCEEFESRCSAYNIKPRCLSFEQLEGLLTVLPLGNQKYLEHQRTYTTGSAASTVPVG
FT                   NTDVYYEGGVFLGYNLLTGAPVFYNQFAPELTGPHIAIFGTVGSGKSTTMKTMLARAVA
FT                   FGFAACVLDPEGEYEKLINMLGGKYVKVKSGEKIGLNPFELEVEEDEGKKFVDIDSKIS
FT                   EIRFILGIISENFIGKKLDGIQLAIIERAVRKLYADRGIDKSPESLYTNFATDSQGRFY
FT                   IGKVKKKLPILSDLREELLKEQETQQLAKAMEVFTGDGTLALFDCESQIDLQEGDRIIG
FT                   FNLKEFDKDPFLKFFAAVNILNWIWNKFSHAKMRQQKKVVIFDEAWMFTKYESTNDYLE
FT                   SLSRRGRKYRISLMVASQTILEFLNTPAGRTMLNMCATKFLLKQEPDLAQETAEYFKLS
FT                   DAAKNFLMTAEKGQGILVNSKEKVLLQVTPFAFEWDYVTTTNF"
FT   gene            383238..384176
FT                   /locus_tag="Calhy_0313"
FT   CDS_pept        383238..384176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06061"
FT                   /db_xref="GOA:E4QBF9"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBF9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06061.1"
FT                   /translation="MEQFISTIFYWVKKVLYFLFGSEGIKSLIAIFYFFTDRQKYEQII
FT                   NQIPAVALSDDIGTALVLEVILIAIEAAIYIWLVKKIRYAFMWLRRNARRMPVFNLKPG
FT                   VVLCLVPRRKITITSQKDAIRVLKTLKNYNRSLKKFILCHEISMTLLLDENNELLLACI
FT                   DNHGDCWEVNSMAHEVVYSYNTSFNGKCKKVIVAHTHPARVDKNMVYIESTTFPSKNDY
FT                   NSYEFIKRAIHPVKVLDDLVLPALDHERVFSIATNKLLPKKRFRRLPNMYFREVFNTFK
FT                   EDKALHPTMIGIRLLYREKKYTPKKEEVFAR"
FT   gene            384173..386413
FT                   /locus_tag="Calhy_0314"
FT   CDS_pept        384173..386413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06062"
FT                   /db_xref="GOA:E4QBG0"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBG0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2526"
FT                   /protein_id="ADQ06062.1"
FT                   /translation="MTKFKKLKFSVLAVLSGLFLFYPVVSFAGPVDIGKTFITSLSNKI
FT                   VYVGIGFVVIAFMLAFLKLMFTQNEQEHAQTAQWLKYIVIACIILGIFTSIIGVILGFE
FT                   QKFTDAMKVLPSTQQGSQPVNQADTDKTMTWIGLALTWIINYFIQLIEWIGRLAGFKPL
FT                   NQLLFNNTVFSDKEFKFLLTFYSFAAACSIAFVVLMVGKTAIQLTVSGLSVRKRVNLME
FT                   EITTWFQVVLLIAAAPLLFSFMFWFFEKLTNWLYAYVKTETTYFGNVEGITASVAKFFG
FT                   FGLDENKIAQNGFIDTLALDLGTSNPLNTAIVKLIYALLYFKVNLIFLTRRIILGVFFL
FT                   FTPFAAAMWGIKKDANVMNVWFGEIITNASMAFFYAFTLLAVLHLFTAVGLDGWLFGAI
FT                   AMYSVPKIADTLRNLLQNYFERLSGIDEMSLANPFFSGTLAMMKGAQNSFVHAFGSQSK
FT                   ASEWSTSIGSTSGGEINAGGLAGGFSPAGGGSGSGGSGATFAGFTGSRTFEGGPIPMGG
FT                   FSGVPATGGPKIEFASTSGSTTSGSSASPLDSLTGYRNIYTDTDATRKAFLRNLNAMTG
FT                   GSKLYRAGQFLQGVGETLGRDNPTFQAFSYFAGGIMKSAGSINRIGQAIDLTTLERMSH
FT                   MQEYKQHFANLAPVVNKLTAEGKYGVVMDAIRKGDVSILAMNGVTMTDEISNSVLKLSE
FT                   AFKGEREITKKQLGINEVIAAKKLGHGYENFERYFARKHPYKDAAEAFIFKV"
FT   sig_peptide     384173..384259
FT                   /locus_tag="Calhy_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            386545..387093
FT                   /locus_tag="Calhy_0315"
FT   CDS_pept        386545..387093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06063"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBG1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2525"
FT                   /protein_id="ADQ06063.1"
FT                   /translation="MQKTDFNSFEIMVDIGECYSKVAKLPDNIRELCSEPECIEDAKYM
FT                   VVYEDTEEKIYLCQKHFEFIRTNTFCYAIENVLDNPKVQEIPVVFGEDKKVKVSYLGTV
FT                   DIVHETEDYLRSLGLLDSSESLDVEVFLSMLRAHDRIAYANIVNDKIFAYLLDESNDEY
FT                   IITEKEWKEILQRLGEYAL"
FT   gene            387090..387656
FT                   /locus_tag="Calhy_0316"
FT   CDS_pept        387090..387656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06064"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBG2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2524"
FT                   /protein_id="ADQ06064.1"
FT                   /translation="MTDIFDRARVALLYPKNDSKRERIEYEVSDNMRCSVCGEKAYYRL
FT                   SKTPAWFCTRHYNQLLNRSLWDFIDRYLVAMDPLAVLYLEYNDKNINLEVWFTDRLMKD
FT                   IQYYFRDVGFKNLRLDKETFLSVVRSCNGVAYADWIDNKLITFMVPVHDCLITKQEWEE
FT                   IKQRVIKKGFLKKVQINNKSPDYDF"
FT   gene            387879..388832
FT                   /locus_tag="Calhy_0317"
FT   CDS_pept        387879..388832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06065"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBG3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2523"
FT                   /protein_id="ADQ06065.1"
FT                   /translation="MKCAVDVGFGFTKAVNEKGKEVIFPSAVAKTFLTDIGLKPTSEYF
FT                   ITYMNQTYAVGKAATHCMITETSFSDDRFVSEFSKLLVLTALMALDSDREIELGLGLPL
FT                   MLYPKLKEKVRDYFEFAEEIIVDSNNVAHTYHITRCEVFPQGVGALFSIDSNIEKGIYC
FT                   VLDIGFRTTDVIVVEVNENNINPLLELCFTLDKGMSMAIEKLSIILERKYGVSYDTNLL
FT                   LDIHERSQISVRGRKINIEEQKKEVFNTIANDIVQSISRKLQRGFDTFDGVFVAGGGAF
FT                   NIAAVLQKEFENVQVIYNAQFANAKGFLNLLSILDE"
FT   gene            389010..389249
FT                   /locus_tag="Calhy_0318"
FT   CDS_pept        389010..389249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06066"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBG4"
FT                   /inference="similar to AA sequence:KEGG:Athe_2522"
FT                   /protein_id="ADQ06066.1"
FT                   /translation="MKKTLSVKIDEKHPIWQEENKTRVILDALELYYATKAVVSGSIKL
FT                   NTIPVNLPSSSENQKENNLAKNKKVVKSFLNAFS"
FT   gene            389318..389935
FT                   /locus_tag="Calhy_0319"
FT   CDS_pept        389318..389935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06067"
FT                   /db_xref="GOA:E4QBG5"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBG5"
FT                   /inference="similar to AA sequence:KEGG:Athe_2521"
FT                   /protein_id="ADQ06067.1"
FT                   /translation="MSNIPNDFIPLIEHLTKWTKELEFSIYQIRESLFALQYKVKFYAS
FT                   IIEDIHNYKIDTTFLSDITEAKYEDDILTILIYDVPPVYKVATQSDTLKWKEMIYNALS
FT                   KLPEKPYFEKAHIVFEFYVPHSVSIRADTDNRMLKTLINALVIAGIIPDDTMYHMSFSC
FT                   FGYPIDNMYCKTLIKVAHPDNIHKVITAKPDIKITNKIPVKE"
FT   gene            390349..391338
FT                   /locus_tag="Calhy_0320"
FT   CDS_pept        390349..391338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06068"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBG6"
FT                   /inference="similar to AA sequence:KEGG:Athe_2520"
FT                   /protein_id="ADQ06068.1"
FT                   /translation="MVEITERDNKLIEKIIKFKMVPYSVAKEIYQNEWAYYRRVKKLID
FT                   GEILKKVGGRYLTLDKGGIEYVNLEYMIWFEPLSNPTSKEVLYRWENVLRVGNRPYIYP
FT                   HFTTCWDLKSESRKQREQQGKKEISDKNKVLGVAKGYAIFKVSQKASMKVLSEMIDDID
FT                   ELVEHDIHRFVILCEGEKLKDFLQVVTKYSTRLRVQALHTLPLSESGLQIMDVIIGIPE
FT                   WKHRIATAVYSNAFPSRNRLFDFEAGGKLVYIGIDGEMIGKNAVENVLKSSPYRAEILC
FT                   LKGQEWRFEGIQANLRTITLQEFLNIVRYESTPSSQPGSQTRFGEMQV"
FT   gene            391354..393231
FT                   /locus_tag="Calhy_0321"
FT   CDS_pept        391354..393231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0321"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: ate:Athe_2519 TraG
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06069"
FT                   /db_xref="GOA:E4QBG7"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBG7"
FT                   /inference="protein motif:PFAM:PF02534"
FT                   /protein_id="ADQ06069.1"
FT                   /translation="MKKAFGIVAILVIYYLMMAYLIGMFSGAISQDAWEQLMAGKSPKI
FT                   VIQTDPVAALGNVFHSPAVLKVWLGVATVLLVVAGVFIFAYRDELKIHFGKEVPADERG
FT                   TYGTADWMKIKEAKKVFRFGSEQKGILLGKVNGQRVVLPADTKYNKHIAIFGAPGTGKS
FT                   RTFARPNIIQIAKMGQSMIITDPKGELFEDMAVWLEQQGYDVKALNLVNIECSDRWNPL
FT                   DAVADDMDATVFADVVIRNTQAGMRKAGGDPFWDRAELNLLKALVLYIKETRPAQEQNL
FT                   GELYRLLATTNMAGLQSMFMSIPNDRASKMAYNIFAQASEQVRTGVIIGLGTRLQVFQN
FT                   RLVQKMTEVSDIDLEAPKKRKVAYFCIISDTHRAFSFLSSLFFSFLFIKLVNLHDTTTD
FT                   PEIRAREVYFLLDEFPNIGEIPDFQEKIATIRSRRLHCSIIFQSLGQLEKIYPLDWENI
FT                   IGCCDTKYFLGANDLKTAEYVSELLGTKSIHTRSVSRQGGLEGLTEIERITQSVGKRQL
FT                   LTQDEVLRFENEKAIVMVRGHKPLIVEKVDISELKESKQLTIRAIKDYLRPWAAEVTGN
FT                   TTAGQVCDAGAQSQINTDQSQTTFTTPPENSADSSEGNKQQETGEDELL"
FT   gene            393218..393418
FT                   /locus_tag="Calhy_0322"
FT   CDS_pept        393218..393418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0322"
FT                   /product="spore coat protein SP75"
FT                   /note="KEGG: ddi:DDB_0191431 spore coat protein SP75"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06070"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBG8"
FT                   /inference="similar to AA sequence:KEGG:DDB_0191431"
FT                   /protein_id="ADQ06070.1"
FT                   /translation="MNCYNGVQPAQPGNTATLHPAAGTVQTQAIAAQPQTASTTPPVDN
FT                   ADCATGGATTGASAADDEELL"
FT   gene            393473..394264
FT                   /locus_tag="Calhy_0323"
FT   CDS_pept        393473..394264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0323"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ate:Athe_2518 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06071"
FT                   /db_xref="GOA:E4QBG9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBG9"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADQ06071.1"
FT                   /translation="MKIPVLPYKGEVFEEVRYAHFLEKTGYTTTPLPMKILSFGACNYS
FT                   CPYCKRNGYRKEGNYIKDSIWVETGEIAEKVKEHLMHGYVIRLSGGDPCCFGGVAKAIA
FT                   KYVKRKGGMVSIAHNGSDPEFVQQLIDYTDFWAIDLKSIRPDRFRRITGTGNKSNKYLN
FT                   NTLMSISLVSWYDIPVEVRTIIFDDTEESELIEIAKFLKSCANPNLYWTLRLYKGQAVG
FT                   KFKSPELTKVTDMARRIREAYPVLKIGIRKNWNGESGLLTI"
FT   gene            394298..395065
FT                   /locus_tag="Calhy_0324"
FT   CDS_pept        394298..395065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0324"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   ate:Athe_2517 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06072"
FT                   /db_xref="GOA:E4QBH0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBH0"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADQ06072.1"
FT                   /translation="MQSTQIKTDKRIYELQQALKTGRILLGEVITKEQQNGKWYAVVKW
FT                   KGLRLYCNEAELGLQEQVKNKADALLGALIEFVVVAQENGRFYISRVKAMEKRRKIWQE
FT                   KIKEGDIVEGRVTGVTPRNAFIEVLGYEFALPAEEMLWNYTNDLRRHFKIADRVKAKVI
FT                   SKDPPKISVKQAYPNPWDTPPSVQVGQVLVAPVDAIAPFGFLVRLDDGKQCLCPPYSNA
FT                   REIPTIGTRVVVQIQSIDLEKRRIFGTIQRILR"
FT   gene            395082..395234
FT                   /locus_tag="Calhy_0325"
FT   CDS_pept        395082..395234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06073"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBH1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2516"
FT                   /protein_id="ADQ06073.1"
FT                   /translation="MQTKLIPARELLDRYDKRPAWQKKVDDFVTKAQILLIKIKIACKR
FT                   RHRVI"
FT   gene            395357..395677
FT                   /locus_tag="Calhy_0326"
FT   CDS_pept        395357..395677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06074"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBH2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2515"
FT                   /protein_id="ADQ06074.1"
FT                   /translation="MARKILFESIDDYLHLAEKTLKDDRFTNRVLRMLKKLPAGSKGVL
FT                   IKPFPVTIEKFQKPKYRYETWLTGHVQSMITGEILMFLAGTDGTVACKNQKTFLVIHSR
FT                   EN"
FT   gene            395779..396930
FT                   /locus_tag="Calhy_0327"
FT   CDS_pept        395779..396930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06075"
FT                   /db_xref="InterPro:IPR025639"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBH3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2514"
FT                   /protein_id="ADQ06075.1"
FT                   /translation="MSMAVYQLCFAEYTEVLKQEIIQEIEKFQKCLNVTDKESMRKLHK
FT                   LPRCEEIKKHRDFLFSEGQKIINMFFADGWEVEPEKIDPVLIPVENDAQNSIFKTARFT
FT                   WSLPYTEGYGRRLKFLVFDNFNGKLIGILGLQSPVLGLKARNEYLGLSKGPEKLKVLNR
FT                   TMDIYTLGALPPYNFLLGGKLMVLAAVSNEIREVYRKKYEGKTTEIEGNNIDGDLVMLT
FT                   TTSAYGRSSIYNRVKYKDNLICIPVGYTEGQGTLFLTGSLCEKAREYLQSKGVKVKSGY
FT                   GNGPNYKFRLAKALARQLKLEGIEVELVTHGVQREVYVFPLIKNLQEYVKAPDTTEPEY
FT                   FDYPFSDLASYWKERYCLPRSKRDTEWKAWRKEQVWQDIAKSL"
FT   gene            397089..397484
FT                   /locus_tag="Calhy_0328"
FT   CDS_pept        397089..397484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06076"
FT                   /db_xref="GOA:E4QBH4"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBH4"
FT                   /inference="similar to AA sequence:KEGG:Athe_2513"
FT                   /protein_id="ADQ06076.1"
FT                   /translation="MKKRIISILIKVFLGCSILVTMLSQKGAIINIYNRNPKLMILTVI
FT                   IIGIIALIDGIVRVILPVDTSTLFLFYTIEIPPLIFIALSFLYNPELCKLNITLPLVVV
FT                   LSIIFIFTLTLDIVAEKRQQQVKNNIR"
FT   sig_peptide     397089..397172
FT                   /locus_tag="Calhy_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.610 at
FT                   residue 28"
FT   gene            397521..397748
FT                   /locus_tag="Calhy_0329"
FT   CDS_pept        397521..397748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06077"
FT                   /db_xref="GOA:E4QBH5"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBH5"
FT                   /inference="similar to AA sequence:KEGG:Athe_2512"
FT                   /protein_id="ADQ06077.1"
FT                   /translation="MKNVFLVWVVGVLLSIPIFVMLVLLRGIDNNLYYLTVRAFSFFLA
FT                   FIGIVGFVLSMYYFYKFHKSNNDKTQKKIC"
FT   gene            398080..398358
FT                   /locus_tag="Calhy_0330"
FT   CDS_pept        398080..398358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0330"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="KEGG: ate:Athe_2511 histone family protein
FT                   DNA-binding protein; PFAM: histone family protein
FT                   DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06078"
FT                   /db_xref="GOA:E4QBH6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBH6"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ADQ06078.1"
FT                   /translation="MSKEELIKAMSQKSGLTKKDSEKALNALIESIQEALSKGEKIQLV
FT                   GFGSFEVRQRAERKGRNPQTKEEIIIPATKVPVFKAGKMLKRAVIAD"
FT   gene            398507..398875
FT                   /locus_tag="Calhy_0331"
FT   CDS_pept        398507..398875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_1066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06079"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06079.1"
FT                   /translation="MVPSYCRLIVGLPEKIQDDTIIIYHDEKYNEYERVHVFEQYLFPE
FT                   RTRVFVTTLDLNNLTLVQKLRNRVRAYIKNKSQLDIIIVPVTDFSVLYADIVTIAPSVV
FT                   FGERGKRTLNFYFSASLL"
FT   gene            399039..399476
FT                   /locus_tag="Calhy_0332"
FT   CDS_pept        399039..399476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpr:Vpar_0856 ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06080"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06080.1"
FT                   /translation="MARGIGIYDATSWADETDIISIVAETLWDAYFGREKYAYAYYDRS
FT                   DNAIKTESADNIKEAIKQAAKDGNVILFVASKKTAQSAVREDIVNIFVQVHGITALLDK
FT                   RQTEEMYYSCFSIFAECLLKKNKGQLEKDIRRRLGKAIMVK"
FT   gene            complement(399718..400038)
FT                   /locus_tag="Calhy_0333"
FT   CDS_pept        complement(399718..400038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vsa:VSAL_I0118 putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06081"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06081.1"
FT                   /translation="MIKNFDFDEKNFKNNTENIKKYLEKLIELHNKEQEFLVKTSDCYT
FT                   ADKILVVRVVEIHMKKNPIIFCRGRSTHPNSQERPCTLHVTDIKAMTYDETRKKWLLEL
FT                   KN"
FT   gene            400290..400514
FT                   /locus_tag="Calhy_0334"
FT   CDS_pept        400290..400514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06082"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBI0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2504"
FT                   /protein_id="ADQ06082.1"
FT                   /translation="MDELRRRQCLKCDYLNNDIPINKKKPNCKDFLNCEVYNVTIKLKM
FT                   RIQYLRGEIGPMFICTKDGCTVENFEFDI"
FT   gene            400877..401380
FT                   /locus_tag="Calhy_0335"
FT   CDS_pept        400877..401380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00497940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06083"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06083.1"
FT                   /translation="MKDFWDRCVGEMQGLTEIDRAVYSTFTEDIKDDKQFYEQYLKAFS
FT                   MKFDEKECKTFEARLGLLGYSDRIAEMVVEKTLEDDEKLIELLYSRGEIVEAFIKLLVC
FT                   YVVRDVWRKVHDTAFELARKTGGEVLRLFPDRVVYEDEQKAFSDFFMYMRKYGYYLAGG
FT                   GQQQ"
FT   gene            401377..401940
FT                   /locus_tag="Calhy_0336"
FT   CDS_pept        401377..401940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvi:100242575 hypothetical protein
FT                   LOC100242575"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06084"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBI2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06084.1"
FT                   /translation="MKSREVEKMIRKLPDKHMESNIDERFCVGDILSILLHEYSGSSLL
FT                   SALLSLYDCECAFCTPLYTCASETAAVTKGKLGGKDLFRKALLDAKYDGVLQKWYENLR
FT                   GMSVDTFIGCVVLRYLGKLILLHMARELGQNVNVKDETSVQEFTERLRKELFRIEWEEA
FT                   VRRAEFKKWLRAEREVDEPPEDVE"
FT   gene            402476..403009
FT                   /locus_tag="Calhy_0337"
FT   CDS_pept        402476..403009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06085"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBI3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2500"
FT                   /protein_id="ADQ06085.1"
FT                   /translation="MDVNTLYKMYCRKGRAKLDDGKKIYRAVSPVAPYYRKTTFIVFSN
FT                   GHVKELEDYAYTYAKRLMDLGLSVPRVDYDDIVTVIALLPDETIKNIIAIVQKYEQKRW
FT                   LDEDEDYYLDKAPTYVITPIDSIERIIKTEKKKLNKHFFDEFKEKLQGTRLALPAPARR
FT                   ANIFRRLLLRLARV"
FT   gene            403019..403282
FT                   /locus_tag="Calhy_0338"
FT   CDS_pept        403019..403282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06086"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBI4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06086.1"
FT                   /translation="MEVGKIKFAEGEREKCTGVIHTSSRRTEEDSRRIEWIRRHWRIPE
FT                   NWNVEPVELVERCSYVPGSYIGYRIVNEQGQTVYYGVLRPVR"
FT   gene            403336..403512
FT                   /locus_tag="Calhy_0339"
FT   CDS_pept        403336..403512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06087"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBI5"
FT                   /inference="similar to AA sequence:KEGG:Athe_2496"
FT                   /protein_id="ADQ06087.1"
FT                   /translation="MYETIVVGYTSDGYYGPIQAGTYDDLETAIRFPELKEHVDVIAVY
FT                   VYDCQGKLVYPRK"
FT   gene            403567..404046
FT                   /locus_tag="Calhy_0340"
FT   CDS_pept        403567..404046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pyo:PY01173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06088"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBI6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06088.1"
FT                   /translation="MNTLIHKRPVTKEEISEEIRKFIDYFEKEELPVIAIYEAEDLIYD
FT                   LAYWAQPVQDNWPLGGTIWTYDFERQQKTYLVHQNSKIEEVDGFEFFELQIWKVFEKYP
FT                   QKLLTTKYIIVAEMHENVASICYTENTTAVQNKVLGIIREKQEIKQKIQKLLAGL"
FT   gene            404373..404873
FT                   /locus_tag="Calhy_0341"
FT   CDS_pept        404373..404873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tal:Thal_1536 glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06089"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06089.1"
FT                   /translation="MVGVIRSLHNTVCPVPFVQTLLKTAQGFYVFLEVCQKSLQGGINM
FT                   RVLISVEKLAEKIRPFLPEGIDVDITIRTDENTWEDYAAFTFVADPRDEKVLANFIKTT
FT                   LSGLDENDAMLLNTYFWDKTKKQTHELSIPKLSPLICKAFGRNKLSDCLPFYEDKLLLV
FT                   FDE"
FT   gene            404939..405115
FT                   /locus_tag="Calhy_0342"
FT   CDS_pept        404939..405115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0342"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_1168 UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06090"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06090.1"
FT                   /translation="MNCWACNKREFTVSFESGVRIFCSNCGEELTKDEIEDFLDDVRER
FT                   LYYKKVSETEDEE"
FT   gene            405190..405624
FT                   /locus_tag="Calhy_0343"
FT   CDS_pept        405190..405624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmu:246738 DnaJ (Hsp40) homolog, subfamily C,
FT                   member 28"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06091"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06091.1"
FT                   /translation="MSDMLEKEVKDMKEVKDAFLATLEELFNPKYPVQKLNWGQVWKTI
FT                   NGKLSKGNSYKNGYGKGKPYPEKDIIKLIEARFDGTMLELKGNRVLFSIIRTPDGFVEC
FT                   YKLTQQFERTPNKQAIEAIERALDTDLGSINDMFVEMYAY"
FT   gene            406057..407073
FT                   /locus_tag="Calhy_0344"
FT   CDS_pept        406057..407073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mar:MAE_11230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06092"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBJ0"
FT                   /inference="similar to AA sequence:KEGG:MAE_11230"
FT                   /protein_id="ADQ06092.1"
FT                   /translation="MRFVPVVDKDGNPLMPTKPSRARRWIKSGKATPFWSKGIFCVRLN
FT                   IEPSARYKQPVALGIDPGSKMEGYSVKSKAHTYLNIQAYAVTHVKSAVETRRNMRRARR
FT                   YRKTRRRPVRFNNRKNKDLPPSTKARWQWKLRIVKWLTRIFPITDFVVEDIKAVTKLGQ
FT                   KRWNESFSPLETGKNWFYAELSRLGKVHIKEGRETKQLRESYGLKKTSKKLEETFESHC
FT                   VDAWCLANWCTGGHVQPDNTELLVIIPLRFHRRQLHMLQFDKGGIRRRYGGTRSLGFKR
FT                   GSYVKHPKYGLCYVGGHMNGKLSLHDINTGKRFTQQANPDDCKFICFASWRYKYKEL"
FT   gene            407429..407692
FT                   /locus_tag="Calhy_0345"
FT   CDS_pept        407429..407692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dtu:Dtur_1308 MutS2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06093"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06093.1"
FT                   /translation="MSITQKEIEVFLEKYKEYLLSQVEEIKNILQTLPADAVERAFSYK
FT                   DTAEIAEKLKYYHSMYQIGPHALEEVFGKNKINFSKRGVTVV"
FT   gene            complement(408045..408806)
FT                   /locus_tag="Calhy_0346"
FT   CDS_pept        complement(408045..408806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0346"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ate:Athe_2493 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06094"
FT                   /db_xref="GOA:E4QBJ2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBJ2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADQ06094.1"
FT                   /translation="MERVIRKQLLYRTGVEYGDYALNHVLGCAHGCKYPCYAFLMNKRF
FT                   RSINYDDWVKPKPVDNTIELLEKELPKLKGKVGYINMCFATDPFMYNHPEITKLSCNVI
FT                   ALINSFGIPVRTLTKGVYTPDVAKVTNHPENCFGITLVSLSEDFRRKYEPNAAPVNERL
FT                   RSLFAMHKCGFKTWVSIEPYPTPDIIEQDIDEFLESIGFVDRIVFGRWNYGRLNYPEQG
FT                   KFYHEMASKVIEFGKKKGIEIVIKKEVVISG"
FT   gene            complement(408812..408955)
FT                   /locus_tag="Calhy_0347"
FT   CDS_pept        complement(408812..408955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06095"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBJ3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2492"
FT                   /protein_id="ADQ06095.1"
FT                   /translation="MKDFCLPYTAAKERKQEYSKRMMKKKFLEACLLKRRMRRTEKYSS
FT                   WR"
FT   gene            complement(408952..409185)
FT                   /locus_tag="Calhy_0348"
FT   CDS_pept        complement(408952..409185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06096"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBJ4"
FT                   /inference="similar to AA sequence:KEGG:Athe_2491"
FT                   /protein_id="ADQ06096.1"
FT                   /translation="MFIKKLNDDVLRVIGQLYSIVADDYADKAYKEVKGIKILVYKAEG
FT                   DANLVRIDIKKVEGEISGESCQETKQGEVREE"
FT   gene            complement(409163..409453)
FT                   /locus_tag="Calhy_0349"
FT   CDS_pept        complement(409163..409453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06097"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBJ5"
FT                   /inference="similar to AA sequence:KEGG:Athe_2490"
FT                   /protein_id="ADQ06097.1"
FT                   /translation="MSETRFCCHCAGELRKESTTVGLGFYNVPIWIKNVKVDVCSNCKV
FT                   RHFDAALLDLIVKLARELRQTSDELGLKIKNVEIEFEMEKEDNKDVYKKVE"
FT   gene            complement(409476..409838)
FT                   /locus_tag="Calhy_0350"
FT   CDS_pept        complement(409476..409838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bah:BAMEG_2556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06098"
FT                   /db_xref="GOA:E4QBJ6"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06098.1"
FT                   /translation="MSKYLVCSAVMLLGIVICLFCSYYTISFLARVDQMFPDDQEILEL
FT                   TGKIRHRMLSDMILCFIAFIIFAVLILIGIINFIIGIVLLAAFMWGIMNIIDSTIICYK
FT                   VKSKHFKQVHERKNFR"
FT   sig_peptide     complement(409740..409838)
FT                   /locus_tag="Calhy_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.634) with cleavage site probability 0.448 at
FT                   residue 33"
FT   gene            complement(409864..410364)
FT                   /locus_tag="Calhy_0351"
FT   CDS_pept        complement(409864..410364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ame:725793 centromere/kinetochore protein
FT                   zw10"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06099"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06099.1"
FT                   /translation="MIAVKNNLEKILKSISQNPLARVCEHYGVITNGHFAILSEAIPDS
FT                   IRKKLCRPGHHVPAPFIKNIRNNILKARSVSLRRECIVRFDPTSSKDGIVYMTLNESTF
FT                   VAYSQLYYEFILLLGCVLYHDVEKNCGYIVQKSTREITGLLMPVVVPVIIAKVGAKNYC
FT                   ELK"
FT   gene            complement(410361..410666)
FT                   /locus_tag="Calhy_0352"
FT   CDS_pept        complement(410361..410666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06100"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBJ8"
FT                   /inference="similar to AA sequence:KEGG:Athe_2489"
FT                   /protein_id="ADQ06100.1"
FT                   /translation="MPKQIIEELVENLIYDAVVEYREELENNQEWCRAKEEFESLVREI
FT                   KENIDPLTSTVDAGEKMRKLINQLLDRHIYLINLAELNAYRNGFHDGAKLILMFLG"
FT   gene            complement(410666..410920)
FT                   /locus_tag="Calhy_0353"
FT   CDS_pept        complement(410666..410920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06101"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBJ9"
FT                   /inference="similar to AA sequence:KEGG:Athe_2488"
FT                   /protein_id="ADQ06101.1"
FT                   /translation="MPYVYFRVSEQAKWGVDENGNYAPVYSKIKINQSVDTAEKVEALR
FT                   ELLANVMHIKKEYITVIDREEYMQNVDDDEDLGDEECDE"
FT   gene            complement(410920..411333)
FT                   /locus_tag="Calhy_0354"
FT   CDS_pept        complement(410920..411333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06102"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBK0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2487"
FT                   /protein_id="ADQ06102.1"
FT                   /translation="MKICFVIWSVVLMILKLEDVKRCKEMEFDVTTAKETVCHTYDKDI
FT                   IKNLCETAEYLYSRVLETRELKLIRDILCTISVEQRNLKDTLKKEASKLLRKGLKEAAN
FT                   YADTMAFIVDLKLCEIEKLIAKNEEILSKERGE"
FT   gene            complement(411368..412189)
FT                   /locus_tag="Calhy_0355"
FT   CDS_pept        complement(411368..412189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0355"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: ate:Athe_2486 AAA ATPase; PFAM: AAA ATPase
FT                   central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06103"
FT                   /db_xref="GOA:E4QBK1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBK1"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADQ06103.1"
FT                   /translation="MSTRMHHSPLFDLDQAAQREEVCPVCGSKLWTEVEIFGVIRKLPC
FT                   ACECQKQEYEKQQQLQEAREKTLRLERLRSFSLMDKKFESCTFENFKIDSENEQFYRLA
FT                   KNYCEQFEEMKKQNVGLLFYGPPGTGKTFLAFCIANYLIERFYPVIAVSMIGFLAKLKQ
FT                   LYSLSSGEMEIEVLNNFKNADLIVLDDLGAESSTGWAVEKLYMLVDMRYRDEKPLIVTT
FT                   NYGLEELKEKLGIRIFDRLIEMCCPVEIGGTSRRLKSAYQKAQVVNKLLGE"
FT   gene            complement(412131..412826)
FT                   /locus_tag="Calhy_0356"
FT   CDS_pept        complement(412131..412826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06104"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBK2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2485"
FT                   /protein_id="ADQ06104.1"
FT                   /translation="MQCKKCSENFAVKESEQESVSPVDSRSQTTLQNQSPQNDKDINIF
FT                   EDNNNSQDNKLTNVNNQDNLEVLEDNKLTNVNTEVGLKEQGATGKDVNNLLPAVNNRQL
FT                   IADLVRRFEEITGRHDDRFYPLLGQLYNRYGYAEVLWALSRLEWGLKNKKIEKPEGYLI
FT                   NVLKNSNDKKKESEADGKRKKDNRRYGELPPDDPYSIIKPIRLGKQPDPDVDPYASLPV
FT                   IRLGPSSTA"
FT   gene            complement(412924..413259)
FT                   /locus_tag="Calhy_0357"
FT   CDS_pept        complement(412924..413259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0357"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="KEGG: ate:Athe_2485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06105"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBK3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2485"
FT                   /protein_id="ADQ06105.1"
FT                   /translation="MSILKEIEAFEIWLEANSLSPLAQLLWYKLTSIKNHLAETEWFPV
FT                   SNRELMTKTCILSEHTLIEARNELKKAGLIDFVSGKKGQPTLYKLNSVSNLLQENPAEN
FT                   TVQKNTL"
FT   gene            complement(413288..413446)
FT                   /locus_tag="Calhy_0358"
FT   CDS_pept        complement(413288..413446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_2010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06106"
FT                   /db_xref="GOA:E4QBK4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06106.1"
FT                   /translation="MSSKNKRIALTIRLTPEMNEKLTEVTRKMGISKNAYIKMLLINAL
FT                   QIFDKSA"
FT   gene            413640..413825
FT                   /locus_tag="Calhy_0359"
FT   CDS_pept        413640..413825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_1992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06107"
FT                   /db_xref="GOA:E4QBK5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR021831"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBK5"
FT                   /inference="similar to AA sequence:KEGG:Athe_1992"
FT                   /protein_id="ADQ06107.1"
FT                   /translation="MADYKKAYTLRIDETLLDKIRVVAEKNKRSINAQIEYLIQQCVEE
FT                   FEAKHGEIKIDEEKTE"
FT   gene            414018..414377
FT                   /locus_tag="Calhy_0360"
FT   CDS_pept        414018..414377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0360"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: tpd:Teth39_2244 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06108"
FT                   /db_xref="GOA:E4QBK6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBK6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADQ06108.1"
FT                   /translation="MKNRIRELRLERGLSQEELGKVLNVSGRTIGHYENGSREPTPEAL
FT                   NKLADFFGVTIDYLLCRTDVRSTEKQDTKDKLQTPADVNKEPASDDIKELLLLAQNLQE
FT                   EDLKLLKQIAKRLNR"
FT   gene            414617..414868
FT                   /locus_tag="Calhy_0361"
FT   CDS_pept        414617..414868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06109"
FT                   /db_xref="GOA:E4QBK7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBK7"
FT                   /inference="similar to AA sequence:KEGG:Csac_2618"
FT                   /protein_id="ADQ06109.1"
FT                   /translation="MLNKTTTVRVDIETYEGLKKLSQELNRPMQKIIQEALSEYKKKII
FT                   LSKTAEAFAALKENNKLWQEEIEERKLWENTLQDGIEK"
FT   gene            414865..415203
FT                   /locus_tag="Calhy_0362"
FT   CDS_pept        414865..415203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0362"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein; KEGG: csc:Csac_2617
FT                   transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06110"
FT                   /db_xref="GOA:E4QBK8"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBK8"
FT                   /inference="protein motif:PFAM:PF02452"
FT                   /protein_id="ADQ06110.1"
FT                   /translation="MNPQRGEIWLVDLNPTRGHEQSGIRPAVIISVDEFNSCPADLVVV
FT                   VPITSKNKNIPLHVEIQPENSGLAKISFAKPEDIRSISKERLVKKIGKLPEAKMKELEE
FT                   KIKILLGL"
FT   gene            415245..415559
FT                   /locus_tag="Calhy_0363"
FT   CDS_pept        415245..415559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cfa:485154 synaptotagmin-like 2"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06111"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBK9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06111.1"
FT                   /translation="MQRIPGTVTAKGQNKSPNRTQRYFEKTRYIPDSQGAGKTSRIVVA
FT                   KFKNVVYNKISQAKLCSKAVYKNVKIKVGKQKLALVTKQPGLLCFEKKNFCAVFSKSVV
FT                   "
FT   gene            415666..415983
FT                   /locus_tag="Calhy_0364"
FT   CDS_pept        415666..415983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06112"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBL0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2477"
FT                   /protein_id="ADQ06112.1"
FT                   /translation="MLYHPDEITIDGLECYLDWSKHSTKREVERLFTVEDVIATLQLAC
FT                   GLLDFKSGTKCWVRNHTRGKSVLVRVVAGGQWICLEIITLLNKIAKPKKGTEVIDVWEE
FT                   K"
FT   gene            416074..416400
FT                   /locus_tag="Calhy_0365"
FT   CDS_pept        416074..416400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06113"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBL1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2476"
FT                   /protein_id="ADQ06113.1"
FT                   /translation="MNKEPRITFSKDFDPEKYKDIEDMPTQEEIRQFVLECLKECEIAI
FT                   NDHEGFVGDGKTAIVERISEDEYVVTFYFPYDAVNVSEQKKKDPNYKSVREIVMENRRK
FT                   QQQR"
FT   gene            416913..417866
FT                   /locus_tag="Calhy_0366"
FT   CDS_pept        416913..417866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06114"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBL2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2630"
FT                   /protein_id="ADQ06114.1"
FT                   /translation="MRDSLPPQEHDSTFKFLFEHPKDILFLVKDVIGYSWADQIQPDSI
FT                   EIVPNEFVDEQFLQKRADVIAKAKLKDREVYFYILIENQSTVVKDMPERLLKYMILLWA
FT                   KKIREGVKKLPAIIPIVTYNGLEKDWDISQEIISEFDVFKDDIFRYALVNISKLDAKTL
FT                   LQEENDVLSPVVFYLEQVRDDTEKLIERLKEVVPKLQSLSQTNVERFLIWAGNVIRPRF
FT                   PKEEREKYDKLAQELKQGGVSKMGEFVSNVARLLDEAQMRKFNEGIQQGMQKGKLEGRL
FT                   EVARKLIQRGFSDEDIADITELDVERIKELRQELIN"
FT   gene            complement(417948..418271)
FT                   /locus_tag="Calhy_0367"
FT   CDS_pept        complement(417948..418271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06115"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06115.1"
FT                   /translation="MTVQYPKTKDVIVELIENLVYDAIYEHHADLEEDEQWQKLQEEIQ
FT                   QIMKTLKQLIPPQQHSLLDELMDKIFYMNSLAELNAYKFGLFDGAKLLNSLTTGEILQF
FT                   VSS"
FT   gene            complement(418289..419140)
FT                   /locus_tag="Calhy_0368"
FT   CDS_pept        complement(418289..419140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0368"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: amt:Amet_2601 IstB ATP binding
FT                   domain-containing protein; PFAM: IstB domain protein
FT                   ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06116"
FT                   /db_xref="GOA:E4QBL4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBL4"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADQ06116.1"
FT                   /translation="MTNMRNFMNGDDFFRFVRDENKPPVRCEYCGRLLYYVYPVVGGRQ
FT                   SSAGFYETCDCEGVKQREVEEERKYIEELQQKAKLARVEKLLSQSNLGRRFRERTFENF
FT                   RFELNPEAYRVALDYAQNFEVYAHKGQGLIFTGSFGVGKTHLAAAIANYLIIHKSVPVV
FT                   FGSVSFLLGELKRAYELEAISADRIEKQLCTVDLLVIDDLGKEKPTEWLVEKLYFIINN
FT                   RYEDYRPVVITTNLTLDEIEQRLNVAGSLAGSAIVSRLVEMCRIVPMHGQDFRLSLRKN
FT                   AC"
FT   gene            complement(419106..419858)
FT                   /locus_tag="Calhy_0369"
FT   CDS_pept        complement(419106..419858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06117"
FT                   /db_xref="GOA:E4QBL5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06117.1"
FT                   /translation="MKSNRLQTTLRLPKNLDEQLSKISMEMGVSKNSLIVFLLTESLSK
FT                   FSSQKMQVKESEQESVDPVDSCSQTTLQDRQYDIILQPTETHNCLDNIVVKDVVNNVVV
FT                   NNVCSYTTTNREEQTENRKAVIVELTRKYREATGESKEDDYRYIGRLCKEYDAHLIAKA
FT                   IEELEYVLLERKVDNPRGYLRGILKKMCLSDSTTPSSHNTGSHSNRDFAMDTEKCFEKW
FT                   LESKINEWNEDFLRRVKNDKYAQFYEWG"
FT   gene            420001..420192
FT                   /locus_tag="Calhy_0370"
FT   CDS_pept        420001..420192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ckl:CKL_2011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06118"
FT                   /db_xref="GOA:E4QBL6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBL6"
FT                   /inference="similar to AA sequence:KEGG:CKL_2011"
FT                   /protein_id="ADQ06118.1"
FT                   /translation="MPSRKRQFTLRLDEDNFLKIKYIAQQNRRSTANQIEFLIEQYIRE
FT                   WEKTHGEIDVSLVEEDDN"
FT   gene            420457..423192
FT                   /locus_tag="Calhy_0371"
FT   CDS_pept        420457..423192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0371"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: bhy:BHWA1_00405 type
FT                   II restriction-modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06119"
FT                   /db_xref="GOA:E4QBL7"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBL7"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ADQ06119.1"
FT                   /translation="MTKHWKAIILRRFEELDTKNEILTIFDEKDKIIDFSNCIEQHQKQ
FT                   KFEDEAYIRTYLVLKLIKELGYRCEVIELEKKYSIGRPSRKEARLDILVKTKKGHPFML
FT                   LECKTPDSFIKEKDDAIENQLFAIAKQEIKGNIKPKYLVLYTIEIENGEILDRAIVIDF
FT                   EQFPTYEDWKEAGEPSLDEIPADYGIAKKYTYANIEKPDPISGLKPLRKDYTLTDFEKL
FT                   RVDLHNKLWAGGEADYNDIFYHLIKIMLVKIYDELFTPRGEIYSFQIFYKDDKPETPAE
FT                   LAKRLEDKYKIALKDLLNYDEEKIKEIPLIERDKFTYEKLFYAVEKLQEISLTENVHSK
FT                   EEDVLGLFFESILQNEFKQSKGQYFTHKNIVRFLIYALELDKLAIYKLNQTYPHFPYII
FT                   DPAAGSGTFLIEAMKIITKEVLKNKDKLKLTRALEEKIKDLEDPNRKHHWAEDYIYGIE
FT                   PNTRLGLAAKLNMILHGDGNMNIFIEDGLMPFKINGKAFYTRKWKGKDVGLLAESEETN
FT                   IYPKPINGRFDVVMSNPPFSIKIEAMRSYRHIRDTFVFYDKKNSENLFVERWFQLLAPK
FT                   GRLGVVLPESVFDTKENLYIRNFLYKYFKIKAIISLPKEAFEPYTSTKVSLLIAERKTD
FT                   EEVKAWEDKWREYANEYNKLRNSKLIKFFIENDKILDSFRKLLDNHNIEIDYSKVLVHD
FT                   LLDDNLKNEIEAKIPQKNKNKFKDLVEEIESFKNKYKLDELDTEENKEILKRFLKQFYP
FT                   QEQEFKSFKELLEYVYDDVLEIATLDYPQIEGQNDYCNSWWVFGEVSKHFNYPIFYAEV
FT                   ENIGYKRTKRGEQDKDIPVKDENENIIAFKNDLFKVKAEKVKRTYWVNKGSKVVQEEKE
FT                   EIIKTDIIIDTENPETVLDYLRKADIWSENPNFNLRCKKK"
FT   gene            423189..424634
FT                   /locus_tag="Calhy_0372"
FT   CDS_pept        423189..424634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0372"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: bhy:BHWA1_00406 type1 restriction
FT                   modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06120"
FT                   /db_xref="GOA:E4QBL8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBL8"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADQ06120.1"
FT                   /translation="MKIHIKNLSELTNNSYLRADFKFAYYYDTSFVRLKAKWKESFKLR
FT                   QIVSRIRNGKDFSKKVYADYETDTCYIRVNNLKPMGEFTGEDIIFLRDEEIEKFFNLFI
FT                   DEGDFLITRSGTVGIAFKFIRHDLPEYIRDKNFMPAGYIIVIKVHNLFDDEYLKYFLYS
FT                   SISRRYFEALACGKSQQNISQADLGKWLVPLQILKNIPVNEIKEKEQEISKLKTQIKEP
FT                   KIIVSEVFGKYFKLDLKQYSDLEKKHIFEENLFNLSRATQLRSSLKFHHPRSDFVLGKL
FT                   KEFKTVKLKQLLREPVRRGVQPEYKEEGEVMVVKTANLKNSYIDLSEVEYVSSEFFQKN
FT                   KKKAGIKYLDVLIASTGTGSIGKVDIWESDEEALVDGHISILRVDQDKVNPRYLTYYLR
FT                   SLFGYSQIEANFSGMSNQIEIYPNDIEKFDILLPDKTIQEQIVKEIETKLNAQKKIAEQ
FT                   IERLKQEIDNLIEKAILEENKNL"
FT   gene            425159..425329
FT                   /locus_tag="Calhy_0373"
FT   CDS_pept        425159..425329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06121"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBL9"
FT                   /inference="similar to AA sequence:KEGG:Athe_2637"
FT                   /protein_id="ADQ06121.1"
FT                   /translation="MESAVMQEIHRFQEKFYEETKDMTLQEFLEYVHKRAEKVRKELEE
FT                   FKEGNGGEILQ"
FT   gene            425532..425732
FT                   /locus_tag="Calhy_0374"
FT   CDS_pept        425532..425732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0374"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   ate:Athe_2006 protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06122"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBM0"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ADQ06122.1"
FT                   /translation="MLFTVVVSKEDNWYIAKCIENSVASQGKTIEEAIANLKEALELYY
FT                   EGEEIQKPQMPPLITTIEVAV"
FT   gene            425733..425957
FT                   /locus_tag="Calhy_0375"
FT   CDS_pept        425733..425957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0375"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: ate:Athe_2005 YcfA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06123"
FT                   /db_xref="GOA:E4QBM1"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBM1"
FT                   /inference="protein motif:PFAM:PF07927"
FT                   /protein_id="ADQ06123.1"
FT                   /translation="MSPKYPVLKPQEIIRALKKAGFKEVSQRGSHLKLKKENPTRIVII
FT                   PMHEEVARGTLKSILEQAGISLEEFLELL"
FT   gene            426226..426582
FT                   /locus_tag="Calhy_0376"
FT   CDS_pept        426226..426582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0376"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: ate:Athe_2672 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06124"
FT                   /db_xref="GOA:E4QBM2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBM2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADQ06124.1"
FT                   /translation="MKEEVYKKIGEKLRELRKQRGFTQEQVAKYLGITQEQLSYYETGA
FT                   REISVATLQALARLYGCDYNYLLSDDEQLNTQVAINFRADEIADEDLEVIAFANEFVMN
FT                   LDMMYRMCEEIENE"
FT   gene            426575..427342
FT                   /locus_tag="Calhy_0377"
FT   CDS_pept        426575..427342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0377"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   ate:Athe_2671 protein of unknown function DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06125"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBM3"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADQ06125.1"
FT                   /translation="MSNIAELRALETRKELGLAFYEPVDIFKVLHEIEGISVVIMEMSN
FT                   KMSGLFTRKGKANLIVINSRKSLGHQRFTAAHEYYHFKYGKGVVSRICPIRKFADDNPE
FT                   EREANIFALNLLVPADGLKYVLQKKTKGKQIGISDIIFLEQYFGVSHQCMLIRLRELGI
FT                   INEQQKKEFSQNVITKAKEYGYSTQLYKDTSDKEIQVYSEYAELARKLLEAGRISYGKY
FT                   EELLIEGGYAPLLFEPQQDTEGEINEFEDANSF"
FT   gene            427314..427871
FT                   /locus_tag="Calhy_0378"
FT   CDS_pept        427314..427871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06126"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBM4"
FT                   /inference="similar to AA sequence:KEGG:Athe_2670"
FT                   /protein_id="ADQ06126.1"
FT                   /translation="MNLKMPIVFDNDCICSFSWINRLDIVDKLFAGHIIIPDDVLNEIK
FT                   KLLKYKSYQYVFHNIESKIRNQEYRLERIPILTPYEEEFKSLTDEERRKNPIGRGEASA
FT                   IVIAKYLNGTLASNNLKDVLPHIQPDHPPLITTETILYLAYQRKLISFYEGQQILDEMK
FT                   LRKRKLSTYSFFELLDKYKETD"
FT   gene            428002..429852
FT                   /locus_tag="Calhy_0379"
FT   CDS_pept        428002..429852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06127"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBM5"
FT                   /inference="similar to AA sequence:KEGG:Csac_2639"
FT                   /protein_id="ADQ06127.1"
FT                   /translation="MRKLLSFVVILSLLLSFTFPVAQAGTITQKVQAAINKIDYITAGK
FT                   FVTSLLVGAKVKPDKPLDYWGKAVKMGLIPGEVKKDRPITRAQASYIVWKLINAVPELK
FT                   DKNIPVEVRRVPPTEAFMRGICFFGGPLASNYDIFNRQIVGYDLTDFIQGYQLLVMEYK
FT                   YADGRTEYKYVWDRYKGTSLAPGTYKYIDDPFRKILAEFKKKYPDKTVYAPRPYQKGWM
FT                   FTLDPLVEVKKLSYPFILSQKRISSFGLPYTDSRQFSKPEDVVDALIYKDTLIEQLKIP
FT                   LTRFDLAAITYLYHTQGREVFQGGIANYNIKEHPYFNMYLEDYLINYPRKYPTDHTRFA
FT                   YYCKDYSKIPQLYREPMLRLADLGIITPDQSALYIGVYYFNAGKTLTRAEAVQMIARVF
FT                   DKSKRDVLDEVTIKLDNYWVPKAQIGAGYYVYYDSQKLKFKSSENSYTFDTFGHFKITS
FT                   ATATFRVEELKSAFIIKTLVRRVPNEYGNWGLATFVYGGKSTNFNQCTVQPYDDFDDPK
FT                   TDYLWENYKTILVNFVPIAYRDELQKDLKTYSFAKIKSMTTSRTIAKNYGDIYVVYTAG
FT                   NFFGVDTIRYELYTTLPNYIREGKGYYLVLSAKPNTKYVQ"
FT   sig_peptide     428002..428076
FT                   /locus_tag="Calhy_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.958 at
FT                   residue 25"
FT   gene            429868..437040
FT                   /locus_tag="Calhy_0380"
FT   CDS_pept        429868..437040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2638 PKD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06128"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06128.1"
FT                   /translation="MLNNNKSLFKALSFLCILSLVLSFVPPVRIWQTVKADDTKLYNGG
FT                   IDSYNGQGRDYWLQRADKGSGTIKDKIFVPSINKWVYFNCEIYAERGQVVYGEPWDVPA
FT                   NSLASPAGFKADSSGYFLQNKTSGTRGWFRYLGYSQSGAPFSDSNFPPDLKPEVVQPNE
FT                   VVELSSVPASAKDVLGLTGYDPSKVSASDWDTLFKNLFLIKEYDSGTYQTLKQLLVDSG
FT                   KVTTASGLSTYVAYLGTDANHNASARIIWKDSTGRLRYRTYTGIITQGGNPKVTTKGID
FT                   GTIVSGLSFASGSGSSSLNGTVLLYNPQSSAQPSIDIYVNGELNDGLGTFGANPYYDNN
FT                   TLTRNDVLQYQTRITSITINGNPVSSSIINRWTDAIVTGKDTDTVSFRTAVEGRRFDVP
FT                   KDMLKGGDNTVVVTGETQVEFDIGNGRTDKYPRQPSLATLTFTIRVLNPQPPQLQLSVT
FT                   PSQSTVTITNGQYSPSKYVNHQINATVTVPSPPAGYQVTAMEFYIDTNNPPAGNVITKT
FT                   ISNGTGTKYSFDNIKSFQYDASKIPLDSSGKGTGTPAYYGKVRYVLKDPNGNLHESPWS
FT                   NPPAPVQARVSVKENSDTPVLSANSNDVINLDKNGNPTSYTVKISATANVGDTGTKTIQ
FT                   KWVFTAVHNENTSETGTSTVTTTGRNASTTISVPIATNKDRTTETFNVTATLYFTDGAT
FT                   KKTNTVKVEVPVNVQMDINLDFTGPTQIVGNEGDSIKIPLKAVATIPNKNQTIKLWRVW
FT                   IRQDIESLLSPTYQTTSDVASVTATKTYPTSGTLKLTKDMNGQTLTFIARAKAQPVTGD
FT                   ELDSGQKTLTVKLIVNTTDKPVPPVTPPAGDVTCEGLLDPMTVPATLNPFTGEVTPDTT
FT                   TVKTGIRASISDTGGRTVDHWTLYCGIGSPTDVMATYWTRKTSIEIPIGSYDSKQYTVN
FT                   NKDGYVVFAYKAVVYFTDGTYKEGTDEKVFAVSWSYQNHKPTCYVNAPGIVAQGDDIYV
FT                   YVTGTDEDIIYGDYVMTDITSISPSNGIQDYEKNSYNNGSTTIASFWSDTLTTYTIQGF
FT                   ARDKLGAGSFATANITIIPAIPLPKIQTIGDLKVNRKIIFDGSSSYSGSKRATILWNKA
FT                   QWKIEPYSGLTANDIKLITPTTGVQSTSVIAKKEGQVKVTLTITNSYGNTQSTSIIVTI
FT                   KPDEPPVANFTMPTKIIRDPADSSQATIQITSNSYSPDGDTIAKHAWFYAYDSNNDGNF
FT                   DNETWYIRKSDGTWQAVGDWNKVQNFDIETVDTGNDTTITLKTSNVGRYKVALVVREGL
FT                   DLTGISNWVSVYDLQKGNTFDWDEGKCVAEVINIAPFASLNASKVDRKTVNIIILTDKS
FT                   SQSDLNAINSKIGQLKAQLYSYGVDVNVIVSNQRIVSGSTTDFKAMSCPYFFKYKGHLQ
FT                   FLPSLFYVSYPNYYYVATDIDTKGLDNDYSKYNNYSSNFFSYFPNLANYGCIPGKSGLW
FT                   GSHVKDVLSMGIEVHQDAQSVVSIYFSNVTFIGDDNKTWTAQVYLSGYDYSFPHIILSN
FT                   GDGKYYENGFVYYYPLPYNAFINYNGNSFRYNDLKWSNVYFRNYFDKSLLNGKVVDPNL
FT                   YTNLDYTENNYFPTFYRDNNYIYAIGFYVSPMDYYVTYPHGLYPLISLSSIESLSYLCL
FT                   SQITDGDNYVVYLSDTQGNSSTQWGQYFALSSADKNFLKILTDNNFKFIAVSPSSTFDY
FT                   LMPNTPQNVTLRQLANATDGKLYDTAGNAIAQLDQALNDIKAKYTNVQLTPDPVYVLAD
FT                   EEKVIYYPYWEDYENDTIINQRWKYEHDETVFDNNLGKAEFDNTWLSTPIEVFTKPGKY
FT                   MVTFQVQDNPPPGTDDFDNYKLWSKLERQMVLYVHRRPIADFTAVYNKSTGKVTITDNS
FT                   YDPDHQYNRSDKGIIAWKWQYKTTDDTNWTDTTLANLQNMTLQSGKIYLIKLEVQDCDG
FT                   PNGVGVWSKPKIAMIDLSVANNPPVADFTVDSEILKGNQPSNLTDKSYDPDNDPITAWH
FT                   WWIYNSDGSTNKDFGEVTNNNIATVKSYIATMQEDSYRLSLQVKDSNNNYSAVASKWFR
FT                   VYSQSKDTEQDVVNNPPTCSFTMTITDHRTRLRPQTTYSDPDGDPKNAEQWYIKFNGQI
FT                   QYFDKLPDTLESAGYTYDGTYEIGYRVQDNPTSRSTKLKPLWSNWYVQTYYISTPVTIN
FT                   AWVEKFEKRAKNRAEVEILKQHTVKASEIRIGEALIVKAKTIGYVEKIEAWFDRVETTV
FT                   KGQRVTKTITGYWEARDSQGNLTGTMQIVNLHTWLIPQNTNTTYQNNWSSDLDDKKLMV
FT                   RFRIHHYNSWAIEKFPAAAQHNLWDGVYRWSDWTKGNTFDYNEMLRLYGRPSYFLSNNN
FT                   PPDKLWIKVRAYRKNTDGSYKTTDVDLSVLIKGELQYGTEIITP"
FT   gene            437197..438417
FT                   /locus_tag="Calhy_0381"
FT   CDS_pept        437197..438417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06129"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBV5"
FT                   /inference="similar to AA sequence:KEGG:Csac_2637"
FT                   /protein_id="ADQ06129.1"
FT                   /translation="MVAIATGIPEIDNQLAQKIKDSQIVHYREYLLINKFETVIVSPHL
FT                   EGSIPVEDTIFQLRSRNTRIVFILFADIEDRAELIKFLITCGVYDIIAGSATIEEIVNI
FT                   YNNPRTFADITPVYLKVSGAKDIAVTTKQVQQETEQTDYKTASQEVEKIVEKVIEKEKV
FT                   VEKEKVVEVERPVFVQPIPIGVWSLDNPFLSAKFSIELAKGIDAFFTRKRIKSQIALVD
FT                   FEEITPRIPSILKIQPCNVDYIVRMINSGDLTQELLEKHLVKQGNLKIFSGIDDDVFFT
FT                   VNEKHLLTILRLISRTAYTVVNAGYGIWTSGVVTTFAESNKILVLVEATKFSVVKTLKI
FT                   LNKLEHMWGLDKSKIHICLFGEGLTSEIDRGTVVDIAEQNNFKYVHSIPTKMNKALPQL
FT                   IETLIGG"
FT   gene            438424..439560
FT                   /locus_tag="Calhy_0382"
FT   CDS_pept        438424..439560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0382"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   csc:Csac_2636 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06130"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBV6"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADQ06130.1"
FT                   /translation="MIINPMHVNLRIDTEELEEEKITEIIQELIRRRPEVIAANELQLA
FT                   NLGSEIQKIITEKGFKKISVKDVINNMVGYGILQDLLEDPEVTDVFVNGPDYIACKKNG
FT                   IVYRTNKKFKSKKQLREFIKRVVVLNGKWINENEAKVVVSDPRQTLRIVATLEVLTLDT
FT                   PVLRIRKPPTSRTLDELVELKVLTPQQANQLKDFVKTRKTIVIAGAPASGKTALLSALI
FT                   REIPEAEQYKVIQESAEIPRLHDNSWVELIRQTDNPNIKEYSLFELTRLGLLESLDRII
FT                   IGEIKGKEAYEWIMAVYSGMWGSMTTIHSNSAEEAIEKLIILMKMADNDLSENFLRNVI
FT                   IHSVDYILYMERFSLKQIYRVRKEANSCAEEVLDVLQT"
FT   gene            439526..440278
FT                   /locus_tag="Calhy_0383"
FT   CDS_pept        439526..440278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06131"
FT                   /db_xref="GOA:E4QBV7"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBV7"
FT                   /inference="similar to AA sequence:KEGG:Csac_2635"
FT                   /protein_id="ADQ06131.1"
FT                   /translation="MLKKFWMYYKRRDKFLRYTINNFLFFEVYFAVQIAVTIVFFAFGI
FT                   RYSVLQGIGLAVISFVFLSFLYDYLVARAKDKLNQGFISFLSTFAGFYAINKNVMKSLK
FT                   ETCDFIDEPVKGIVLKNLLLYEKGQLAYEELFTRIADEIDIKSYRNFFMLLLTADTTGA
FT                   DITGITRRLIDTEQEKNRAMVQLRSSISYGLIMIFIMSIITLYMFNNALSTQQITEGIT
FT                   PATFVFVMSAVIFALLLGKVMSKWLEGE"
FT   gene            440285..441043
FT                   /locus_tag="Calhy_0384"
FT   CDS_pept        440285..441043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06132"
FT                   /db_xref="GOA:E4QBV8"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06132.1"
FT                   /translation="MIQKYLPLVIQTVVLAVMGVVLYSIITEKKISRLIVASSKTDKFA
FT                   FQNLTIPLTVLFAVGGFLFARLVRAEGLVAQILLATGFGMIGHELPKEIERTRKNKLRS
FT                   SIADIALMCELGLKAGLSLDRIFAVIAETIVEPRYKDAFLQAAATYKTTHNIEDCFTIL
FT                   RSQLDLPELEILKRALLEVEKVGLSGIQSLEVFSQVETMNKIEQIYKKSDKARSYTTYA
FT                   IVAMVFALISIYFFPLFKLATDTLNQILGK"
FT   gene            441040..442437
FT                   /locus_tag="Calhy_0385"
FT   CDS_pept        441040..442437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06133"
FT                   /db_xref="GOA:E4QBV9"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBV9"
FT                   /inference="similar to AA sequence:KEGG:Csac_2633"
FT                   /protein_id="ADQ06133.1"
FT                   /translation="MIKVSSSKRIYQLAIVVFTFLLAYILLMIQTEYHIQNDTFWHLKA
FT                   GEYMIKHKTILTHDVFSWTVKGAHWYSHEWLWEVIVYTVYSKFGFTGLFIFDLLQVFLI
FT                   LLLGVILFSNALSYTVFSAGMLMYTSAGYIVARPHLTGLLLFILMLAVYYNVRNEKARL
FT                   ILVFLVFLLWSNIHSSVVLGTGVVILLTLLKDKLEREKFILPPVVFAGSLINPHFAGIY
FT                   IYFFKTVLAQDMIKYINEWQSPNFHMKAILFFTLAIITVFVFAIKISKDTKGVIWFITG
FT                   LAAFLTGIRNAALFSLFAALSIKDVVLQDKRIEKLLKQFLIFALPVLLLTQVSIALPDE
FT                   KFFKNAIANIMPQKAVDYMIAHGYTDRVFNEYHYGGYLMWRGIKPSIDSRADLYYFANK
FT                   KFWDDFINSTLLLNEKPEDVLFKTKARYVLFPSNSGYIKYLKAKGTGKVLYQDREATLL
FT                   ELKGSLN"
FT   gene            442464..443132
FT                   /locus_tag="Calhy_0386"
FT   CDS_pept        442464..443132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0386"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: csc:Csac_2632
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06134"
FT                   /db_xref="GOA:E4QBW0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBW0"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADQ06134.1"
FT                   /translation="MDSQELVKTNELYNRHWWFLGKYKIVHKLIERYVRTPYVPRVLDI
FT                   GCGPAYFSRFYQYTGIDPNTNIDSHNIIRARIEDVKLTGKYDVILALDVLEHLEDDRII
FT                   LRYLNENLKDNGIAIITAPAHPWLFSEHDRVCGHYRRYTRKQLKELFRDFDCKLYYFNS
FT                   LLFPVELVFRLLTGGKNNLKLLPGWLNALLLFVFSVEYYLLPVLPAGMSLLAIVRRKRR
FT                   "
FT   gene            443138..443326
FT                   /locus_tag="Calhy_0387"
FT   CDS_pept        443138..443326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06135"
FT                   /db_xref="GOA:E4QBW1"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06135.1"
FT                   /translation="MLARITAVLRDRTGVSEMMGSAFLLIFVVLVMATLLKNLGNTIAN
FT                   GYLRLNIKIQQQLNQIP"
FT   gene            443346..444071
FT                   /locus_tag="Calhy_0388"
FT   CDS_pept        443346..444071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0388"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   csc:Csac_2631 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06136"
FT                   /db_xref="GOA:E4QBW2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBW2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADQ06136.1"
FT                   /translation="MKGAIVVPCYNEFFRLHCNFVTWYKLKKQYELIFVDDGSNDGTFR
FT                   VAERLGKCIRLDKNMGKGYAVRVGILEALKTDPDFVGFTDADLSVSPDQWEKLIAKLKD
FT                   FDIVTGSRSMPDSVVNRSPMRKLTGKVFSTIVHEVLQLQVHDTQCGLKFFRPEAAKLLF
FT                   AEPLVANRFAFDIEILLRAKLLELSIAEIGIIWQEQKGSHVKLSSVFEMLKSLIKLASV
FT                   YNGLSPLEYRKIIQARRVM"
FT   gene            444072..444257
FT                   /locus_tag="Calhy_0389"
FT   CDS_pept        444072..444257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06137"
FT                   /db_xref="GOA:E4QBW3"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06137.1"
FT                   /translation="MRKITEVFKDNSGVSEMMGSAFLLIFVVLVMATPLKNLGSTISGG
FT                   YNTLNTKIQQQLNQIP"
FT   gene            444278..444466
FT                   /locus_tag="Calhy_0390"
FT   CDS_pept        444278..444466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06138"
FT                   /db_xref="GOA:E4QBW4"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06138.1"
FT                   /translation="MLRRIAEVFRDTSGVSEMMGSAFLLIFVVLVMATPLKNLGTTISG
FT                   GYNNLNVKIQQQLNQIP"
FT   gene            444533..444964
FT                   /locus_tag="Calhy_0391"
FT   CDS_pept        444533..444964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06139"
FT                   /db_xref="GOA:E4QBW5"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBW5"
FT                   /inference="similar to AA sequence:KEGG:Csac_2630"
FT                   /protein_id="ADQ06139.1"
FT                   /translation="MKFLVLLKDRRGNSSVISFLIVLPLILSLSFNPILMYLDAQKYQR
FT                   LDHIVQKYLTIMESEGGLTTSRYIELVENLTSIGCDMSKTTIDYTPYPVDFGNEVRLGV
FT                   TTQMKLVRISILRAGGANVQIITARAGPYYSVSKKNVGE"
FT   gene            444954..445424
FT                   /locus_tag="Calhy_0392"
FT   CDS_pept        444954..445424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06140"
FT                   /db_xref="GOA:E4QBW6"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBW6"
FT                   /inference="similar to AA sequence:KEGG:Csac_2629"
FT                   /protein_id="ADQ06140.1"
FT                   /translation="MGNKNGDSALILVSVLLFTIIIPISTYAMNSTILLTQYDKIKQAI
FT                   KVSAMGALYNVSQDTILYDTGKQTVADAFTTLFKKNLQIDDSGYSKILTTTQPITIQEL
FT                   VVYDAGDVPATCPQGTVISFPAIHVVVSTQFKDCFGKPRDVLIHSDIDIFER"
FT   sig_peptide     444954..445040
FT                   /locus_tag="Calhy_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.822) with cleavage site probability 0.640 at
FT                   residue 29"
FT   gene            445433..445873
FT                   /locus_tag="Calhy_0393"
FT   CDS_pept        445433..445873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0393"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   csc:Csac_2628 peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06141"
FT                   /db_xref="GOA:E4QBW7"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBW7"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ADQ06141.1"
FT                   /translation="MQSLLALLGATVLAAIASYYDIKTRQIPDWIWALAAVLAVAIWQK
FT                   NILKNGNLMIAILIFICLFLLAYYRLLGGGDLKLISALALLVGGSITTAIAAGTLLQLG
FT                   FAYWRMLKTGENMWGQRLPLMPFVFFGLVAVVIINLFTKISL"
FT   sig_peptide     445433..445486
FT                   /locus_tag="Calhy_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.569 at
FT                   residue 18"
FT   gene            445890..446102
FT                   /locus_tag="Calhy_0394"
FT   CDS_pept        445890..446102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phe:Phep_3090 siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06142"
FT                   /db_xref="GOA:E4QBW8"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06142.1"
FT                   /translation="MRTVLFNLSLILAGFGLGIYTCAAMLFNSLSPFDVMKKEGHPKLG
FT                   CVKSLFWLAVVLVAALVVLLSVVKK"
FT   sig_peptide     445890..445961
FT                   /locus_tag="Calhy_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.428 at
FT                   residue 24"
FT   gene            446159..446365
FT                   /locus_tag="Calhy_0395"
FT   CDS_pept        446159..446365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cnb:CNBE2800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06143"
FT                   /db_xref="GOA:E4QBW9"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06143.1"
FT                   /translation="MNKVKRIFKKVVKILRDRNGANEIIGSALLMVYTVLAVIPSIMGC
FT                   ARTIDTAIQSLDNQLTKFLTEGF"
FT   gene            446393..447019
FT                   /locus_tag="Calhy_0396"
FT   CDS_pept        446393..447019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0396"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: SAF domain protein; KEGG: csc:Csac_2625 SAF
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06144"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBX0"
FT                   /inference="protein motif:PFAM:PF08666"
FT                   /protein_id="ADQ06144.1"
FT                   /translation="MKLKKIGLFFIFLILAAGLAFAEYYLLTNTANKPQYQLIIVAKQD
FT                   IPAGAQITLDKLSVARVDVRTPVHAATTRKQILGRYALYDIKAGEPIIPEHLTDLSIDT
FT                   LANGMKLTAVRIDPVPYDFINIGDEIELGCVIQDKTLSWRVRVIQVYDANFRDIRSVKE
FT                   QLQQTNAQQAPALMIGYLAVAGDDATIKTLKSAEKQGTLFVIKEK"
FT   sig_peptide     446393..446461
FT                   /locus_tag="Calhy_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            447036..447503
FT                   /locus_tag="Calhy_0397"
FT   CDS_pept        447036..447503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0397"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: csc:Csac_1433 single-strand binding protein;
FT                   TIGRFAM: single-strand binding protein; PFAM: single-strand
FT                   binding protein/Primosomal replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06145"
FT                   /db_xref="GOA:E4QBX1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBX1"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADQ06145.1"
FT                   /translation="MNKCLFFGRLTRDPEVFNTQNGNKLVRITVAMDRTVKGEKKAEFI
FT                   PCIAFGKNAELIEQHYTKGREILVEARAENARGKTKDGVEYPTFRFVIERFYFAGSKKE
FT                   QQKEQTATTSETEPEFSEDELEKELEEFFEEDETFEPPEKGIITSEEDIPF"
FT   gene            447568..448092
FT                   /locus_tag="Calhy_0398"
FT   CDS_pept        447568..448092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0398"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   ate:Athe_2447 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06146"
FT                   /db_xref="GOA:E4QBX2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBX2"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADQ06146.1"
FT                   /translation="MQRALNLLLQNMSEKNATLLTHSLNVAKLCTIIARNLGMDEEYYY
FT                   TAGLLHDAGKLLVPNALLDKSISIGNEEQEILKNHSKWGAELLKLLGLNEFSVIALLHH
FT                   QDTSDLPLPVQIVAVADKFEAMTSLWRQYKKPVTAKEAIDELWNMRIFHPTVIEALAIA
FT                   QAEFLTEKKTC"
FT   gene            448240..448614
FT                   /locus_tag="Calhy_0399"
FT   CDS_pept        448240..448614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0399"
FT                   /product="endodeoxyribonuclease RusA"
FT                   /note="PFAM: endodeoxyribonuclease RusA; KEGG:
FT                   ate:Athe_2445 endodeoxyribonuclease RusA"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06147"
FT                   /db_xref="GOA:E4QBX3"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBX3"
FT                   /inference="protein motif:PFAM:PF05866"
FT                   /protein_id="ADQ06147.1"
FT                   /translation="MGSYKIEIAARPVPKARPRLGSNGKMYTPRETREFEELIGWTTRS
FT                   VVRKPIEKPVKVNIDVYSKTRADIDNIAKAILDGLNGVAFLDDRQVVDLRIRKLPPVDC
FT                   EKIVISIKETRSVQKCKNSG"
FT   gene            448596..448967
FT                   /locus_tag="Calhy_0400"
FT   CDS_pept        448596..448967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06148"
FT                   /db_xref="InterPro:IPR025518"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBX4"
FT                   /inference="similar to AA sequence:KEGG:Athe_2444"
FT                   /protein_id="ADQ06148.1"
FT                   /translation="MQKLRLKVYICSPYKNNPEENRRKALQYCRKAFEEGYLPIAPHAY
FT                   FPQFLDETTEREQGLEMALQLLLECQELWVFGPEITEGMRREIEYAKKFGIPIKCFYFK
FT                   KVDQVKEILKGSGTDEQKH"
FT   gene            448951..449241
FT                   /locus_tag="Calhy_0401"
FT   CDS_pept        448951..449241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06149"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06149.1"
FT                   /translation="MSRNTNICSDISGIAEQIRRDLKIGQKVKTNRVPWTSGQGKSDYE
FT                   HRTRAGKVIAKYPYFFVVQFPQYRECFKYTDVASDIIQLCDETEENQDVFS"
FT   gene            449269..451476
FT                   /locus_tag="Calhy_0402"
FT   CDS_pept        449269..451476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0402"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; Lytic transglycosylase
FT                   catalytic; KEGG: ate:Athe_2441 peptidase M23"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06150"
FT                   /db_xref="GOA:E4QBX6"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBX6"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADQ06150.1"
FT                   /translation="MYGFDRQKTKQVAKAYVKHKAKAALIAFLKSPPGLITIGVLLIIL
FT                   LIIGSLQAFIEAGEISNRLDDEHNQKLQKEVVDIAREKSGSLLDYYGTDEDLALNAAWI
FT                   LSYYKYLQFMNKADITEAKDFDEVAKEMAKQGIKSAVNQILPQWYIYNKLKGELTNVAE
FT                   RMKPRFLYIKTERRTVTTKLLHYSMPRTYSYTVSKEVYNPETGKYETQTENKNKTVTVK
FT                   WTEKVEITETQPIWLIVAADTIKQRYTFSYDINEYKRTYQNSVPQKTQKTKSQDLKLDF
FT                   DPKKFIENKDCLHASNSGINSKFELKTNFDSAEKEQKPSTSSKTVETSPQTEEPAFSPE
FT                   NGASNVSHTDGEKKVEKEEILQVVETVPELSNQNAIGKEYERLEEMILEDNPKEDIALA
FT                   RSMIVNSALSFMSGTKDMSWVFSQINDYMNVGGYVSSSYIPAQFLLMFQEAEKLFGIPY
FT                   WFLGAIAYRESSFNPQARTPNSDGVAVGLMQVQQKYWNSRVETFKNAFPDVTITGDINN
FT                   PRDQVLIGSWTIYNCIKEMVGDPSSIDWQGDGWKEQVIPALAGYWMGIGGAKKWDAPNN
FT                   YAKTRSEYAPQLIAQAQLYKSVGEMLANPEIAKPVAGDMNITSPFGMRYHPIYKTWKMH
FT                   TGIDIATTYGQPVFAVKDSVVKFAGWMSGYGKVIILQSGEYEFYYAHLADIDVQVGQMV
FT                   TKGQQIGGADSTGNSTGNHLHFEVRINGTPVDPLTVLGNLQ"
FT   gene            451588..451803
FT                   /locus_tag="Calhy_0403"
FT   CDS_pept        451588..451803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0403"
FT                   /product="transcriptional repressor, LexA family"
FT                   /note="PFAM: LexA DNA-binding domain protein; KEGG:
FT                   ate:Athe_2440 transcriptional repressor, LexA family"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06151"
FT                   /db_xref="GOA:E4QBX7"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBX7"
FT                   /inference="protein motif:PFAM:PF01726"
FT                   /protein_id="ADQ06151.1"
FT                   /translation="MQGLTERQQQILYAITSYINEKGYPPTVRELADMVGIKSSSTLHG
FT                   HLKRLEKKGYITKEKGKPRTIVPTAV"
FT   gene            451836..452030
FT                   /locus_tag="Calhy_0404"
FT   CDS_pept        451836..452030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hap:HAPS_1644 exodeoxyribonuclease V, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06152"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06152.1"
FT                   /translation="MRHQAAVPVPAFSMDLEEDKGLVLLRLILFYLYRTHIPIVFFEER
FT                   NKIFATKESFRCKSYTKMI"
FT   gene            452134..453810
FT                   /locus_tag="Calhy_0405"
FT   CDS_pept        452134..453810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mdo:100016673 similar to GTPase, IMAP family
FT                   member 4"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06153"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06153.1"
FT                   /translation="MEKKLDLYPYVAAAISINPKAWHIIDNKILKHLDKLYEYGIKSDY
FT                   WNKPPIVSLPADSVIYARELLCAFEYIKNNNEDNLKNDEILDDIFEMLRDIFKKAFPEV
FT                   YQRVVSATNISIDRVLRSLVLAQKERKDYAWEELIWYEKNMFLTVFCAKLFGKEIIIDD
FT                   GYKFFSEYLRTRLEFDDKNECVSNLDMLGHFKKMDIATFEEYKKEGRRLQKTIETNNPY
FT                   FFRMYFIRDEFNAETQQAKNVPPIDSYLQKLNAVPAQDIINAVYPKLNSVLAYMFDIFD
FT                   VDVPELQYANLDHKDIEHIYSFAYMCQPLFNNMSEKEKLSKLQDIIVISVYLWPLLKDY
FT                   VKLKQQYATLHSEYVTKFVIQKKEQEDIESLQEEIKKLKLLEARYNGLKKQYSNYDVIK
FT                   NQLEFYKSNYEKLLTENEQLKKENSQLVQELEKYKADIEELAKLRSIVFEEEIETPQPA
FT                   VNDYSVLKDKKIAIIGGHKGQFDELKNYVQELLHIEVGRLNYDENILATVDVVVFISKI
FT                   LNHTGYYKAINAVKKLKLKYVITSYINTEKILKLLTGLLEE"
FT   gene            453817..454668
FT                   /locus_tag="Calhy_0406"
FT   CDS_pept        453817..454668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0406"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: ate:Athe_2439 integrase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06154"
FT                   /db_xref="GOA:E4QBY0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBY0"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADQ06154.1"
FT                   /translation="MQEFFNWLLGKGKMESTAKTYIRAVENFLKWYSESYDREFDGKVL
FT                   PLHIRNYRSYLMTVKKLNAKTINNNLSAIKSYCDFLVEKGVIETNPVLDDYFIDVQEPG
FT                   VSPAKLENKDFNKLEEAVVHYGSARDIAIFYTLAYTGVRVSELCNIRLNDIVKDELIIY
FT                   YGKGGKQRKIPLNRTVREAIDNWLKERGKYKYSHLDYLFISERGKLDRSTVYRIIKEYC
FT                   RIAKIEPIGPHQLRHYFCKRALEKGFTITEVAALAGHSRITTTQVYINPSLQELKEKIE
FT                   RL"
FT   gene            454734..454850
FT                   /locus_tag="Calhy_0407"
FT   CDS_pept        454734..454850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0407"
FT                   /product="type II site-specific deoxyribonuclease"
FT                   /note="KEGG: ate:Athe_2438 type II site-specific
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06155"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBY1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2438"
FT                   /protein_id="ADQ06155.1"
FT                   /translation="MDQTAKGKAFEYACIIEFENYLKNEIQQKVVVQETRAL"
FT   gene            454899..455714
FT                   /locus_tag="Calhy_0408"
FT   CDS_pept        454899..455714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0408"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.4"
FT                   /note="KEGG: ate:Athe_2438 type II site-specific
FT                   deoxyribonuclease; PFAM: Restriction endonuclease, type II,
FT                   HaeIII"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06156"
FT                   /db_xref="GOA:E4QBY2"
FT                   /db_xref="InterPro:IPR019059"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBY2"
FT                   /inference="protein motif:PRIAM:3.1.21.4"
FT                   /protein_id="ADQ06156.1"
FT                   /translation="MLKAANAAAKIISKCEPHLVCKNHTNEIILRLQEDAAGQRGDVRD
FT                   MLAIRILEPATKWEIGISCKHNHLAVKHPRLSPKLDFGKRWLGIPCSQNYFDEIKKVFF
FT                   EIEIQMREKKYWNEIEEKEETVYVPLLNAFVKELIRIEKENKSLEETIPSRLLKYLLGK
FT                   NDFYKVISLENTKSTMVQAFNLNGLLNQPCCDRKPEFKIGPKLKLPTKFQNIYFKEDSK
FT                   NTVHVVCDNGWTISFRLHNASSKLELSLKFDIQLVGHPQKLFSHIESWE"
FT   gene            455761..456600
FT                   /locus_tag="Calhy_0409"
FT   CDS_pept        455761..456600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0409"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: ate:Athe_2437 D12 class N6
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06157"
FT                   /db_xref="GOA:E4QBY3"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBY3"
FT                   /inference="protein motif:PFAM:PF02086"
FT                   /protein_id="ADQ06157.1"
FT                   /translation="MLKNVLRYPGGKSKALKYILPNLPVGFREYREPMVGGGAVALAVK
FT                   QLYSNVKVKINDLNYDLICFWKQLRDRPTQLIEEISKIKENYRDGRKLYELLTNQDKGD
FT                   EFERAVRFYVLNRITFSGTVDSGGYSQQSFENRFTWSAISKLKQAAEIVKDFEISCGDY
FT                   ERLLFEPGEDVFIFLDPPYYSTAESRLYGKNGDLHLNFDHERFAFNMKKCPHLWMITYD
FT                   DSPEVRKLFKFANIYEWELQYGMNNYKQLKAEKGKELFITNYKLEELRQKEKYALGL"
FT   gene            complement(456640..456885)
FT                   /locus_tag="Calhy_0410"
FT   CDS_pept        complement(456640..456885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0410"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ate:Athe_2436 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06158"
FT                   /db_xref="GOA:E4QBY4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBY4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADQ06158.1"
FT                   /translation="MLELSESAIAKYEEGQRSPDLNTLIKIAKFFDVSTDYLLGLTNIP
FT                   KPEMDLSPELKQLLAIALRMPEDKLNLLIKLLERLF"
FT   gene            complement(457158..457475)
FT                   /locus_tag="Calhy_0411"
FT   CDS_pept        complement(457158..457475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0411"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: ate:Athe_2435 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06159"
FT                   /db_xref="GOA:E4QBY5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBY5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADQ06159.1"
FT                   /translation="MFDVGKRIKELREQCGLSMSKLAKIAGVGQSTLSYIENGERSPTI
FT                   DVIMKICNALGITLVEFFGGEEKTHLESPKVRELLVYAQKLSEKELEYLCRFLEEVSKE
FT                   R"
FT   gene            457611..457844
FT                   /locus_tag="Calhy_0412"
FT   CDS_pept        457611..457844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0412"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: ate:Athe_2434 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06160"
FT                   /db_xref="GOA:E4QBY6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBY6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADQ06160.1"
FT                   /translation="MVGKKLRELRIQKRLSQQQLAKIAGVPQSTIWYIESENRNPTIKT
FT                   MKRLATALGVSIEEFLDSETKEMITNGSQKND"
FT   gene            457822..459498
FT                   /locus_tag="Calhy_0413"
FT   CDS_pept        457822..459498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06161"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBY7"
FT                   /inference="similar to AA sequence:KEGG:Athe_2433"
FT                   /protein_id="ADQ06161.1"
FT                   /translation="MARKRMIDPSIWSDEKLGLLSPLHRLLFIGLFSNADDEGRLPGHP
FT                   NYIKSLIFPYDNDITPQNVEAMLNDLNSKGFILTYMVNGQRYIQVVNFLKYQKINRPTP
FT                   SKIPPPPVETTVKNATSCFSESSLNTHGVLNEYSLNTHEVFTENSLNTHEQFTAQIEKE
FT                   KEKENKNNKDVVTNVTTSRTGSDEPACVAEEYKISTSTQEKKLEGEQGMAVTSEPEQVT
FT                   ETAVQLDTNNNALNTTGEDELEQLLEEFFEDEGEPAENQDTAKTKEPLAATGEGEKEKS
FT                   SDPVEVPGNQETAKSKEHLIITGVELEDSEECSTIPQAQDTAITDEIELLEGFFKDSSD
FT                   QCTTIDTATCDSTPFAERKDTATACMTVAESMDSKVVEIGDFVRGVVENFKQELETSPA
FT                   SEPVTQDKLKEISQILQQNKIECRKRDAPATNDDDFQEEEKEIQELTNQKLIARLVGKY
FT                   RRVTGMKSKDDFPRIGHLYLEFNYAIVEQAIGVIEKRIKQNVKIKDPVAYLYKVCEGIE
FT                   KKMEERHEKYKKKENKGRHYSLINFSPEVLKIVEGGYQNDL"
FT   gene            459488..460783
FT                   /locus_tag="Calhy_0414"
FT   CDS_pept        459488..460783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0414"
FT                   /product="DnaB domain protein helicase domain protein"
FT                   /note="PFAM: DnaB domain protein helicase domain protein;
FT                   KEGG: ate:Athe_2432 DnaB domain protein helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06162"
FT                   /db_xref="GOA:E4QBY8"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBY8"
FT                   /inference="protein motif:PFAM:PF03796"
FT                   /protein_id="ADQ06162.1"
FT                   /translation="MIYEAQDYVIACWLLNDEFRHKILETSMDDFEELSLAQQMFKLIR
FT                   EEYLKNPKFDISDIMLSPAGKRYQDYIRDVTIEIPTTQLFPHYYERFKKDSQQRKVRKY
FT                   LAELCLSNSDIDIPEVVQKLLEIATGEEKTKSAGPRELAIELYDFLEEAYNLKGKLPGI
FT                   STGYKALDCAIGGILDNMYIILGGRPSMGKSAFAINLAFNVLKNKGKVLYVSVEMSKKQ
FT                   ILARIVARVIKLPLNDVKFGVFGDEQWIKITKQLIPFLAQSGFHILEGETKISEILNEA
FT                   KRLKAKYGKLDLLVIDYLQTLRLGETKRSEYEKVSEISRALREFAKQEHIPVLGVAQLN
FT                   RDCEERENKRPVLSDLKESSQLEQDADVIMFLYRPAYYDEEFEDKTLTELIIAKNRDGQ
FT                   TGTILYSWLEQYQVFVERENVHKTISQAEQGK"
FT   gene            460797..461285
FT                   /locus_tag="Calhy_0415"
FT   CDS_pept        460797..461285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: api:100168682 similar to CG41389 CG41389-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06163"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06163.1"
FT                   /translation="MLEFQKVLQRVIQLAEEREKAYMRYCTLLYGQYNNTSSIALDKVM
FT                   EKEFSCPTEIESCREVWLTKEIKLRRFLYGLPERTVQMIVTVAYFGRDRDPSILNWLRG
FT                   SRHWERKEIEIDQIVSKLRLGKYLRDGLELLQNPKFKGMFLKNAGIYNNEQQIGQKGE"
FT   gene            461288..461887
FT                   /locus_tag="Calhy_0416"
FT   CDS_pept        461288..461887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0416"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; zinc finger SWIM domain
FT                   protein; KEGG: ate:Athe_2428 ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06164"
FT                   /db_xref="GOA:E4QBZ0"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBZ0"
FT                   /inference="protein motif:PFAM:PF00075"
FT                   /protein_id="ADQ06164.1"
FT                   /translation="MYKGYFDGASKGNPGPAGAGIVIVNPAGNVILEYSKELGIKTNNE
FT                   AEYLALIELLQKALELGIKELEILGDSQLVINQVFGSWNINMPHLYALYEQATELLEKF
FT                   DKVKAKWIPREKNQLADSLSNKAITRPTPNIFPVEKLEQITDHIFIAHGTEDYAVDLLH
FT                   RACTCPDFVMRHRECKHLLAAYRVVDRPKKQIETTG"
FT   gene            461944..463003
FT                   /pseudo
FT                   /locus_tag="Calhy_0417"
FT   gene            463021..463338
FT                   /locus_tag="Calhy_0418"
FT   CDS_pept        463021..463338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06165"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBZ1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2427"
FT                   /protein_id="ADQ06165.1"
FT                   /translation="MANFQLTYRTKKSAKIHKITIQANSVQEAQEKLEKAIDFVDESYD
FT                   RAVTTVEPWMLWDGWGMSVGCEKCILYGRKAPCWGKAQCHGFTNGCTCKKCEKKYKKKL
FT                   A"
FT   gene            463351..463524
FT                   /locus_tag="Calhy_0419"
FT   CDS_pept        463351..463524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_4071 glycoside hydrolase family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06166"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06166.1"
FT                   /translation="MDLWMYCETCGYFEGWTTCYGFCHYYNRDVSRWDYCDWHTKNNPD
FT                   GPWVAEIVNDEW"
FT   gene            463550..463855
FT                   /locus_tag="Calhy_0420"
FT   CDS_pept        463550..463855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH0633 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06167"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06167.1"
FT                   /translation="MAIFIGTVHEVNERYVKIRVEKHPEREFSGFVVFNKEFIPLDFQP
FT                   IKVGDEFFIDIAVNEQFTKNLRILKEALNRHEEKSQLPTAHRSGACQQGWTADRSA"
FT   gene            464043..465458
FT                   /locus_tag="Calhy_0421"
FT   CDS_pept        464043..465458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0421"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: ate:Athe_2472 HNH endonuclease; PFAM: HNH
FT                   endonuclease; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06168"
FT                   /db_xref="GOA:E4QBZ4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBZ4"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADQ06168.1"
FT                   /translation="MLLFTIDRNGKPGHPTRRFDMVRKLVKRRRAKIIGGGASGKPPVV
FT                   MFLDREFDYSKTVSRKLIIVLDPGYHCIGFVVCELKGGKLIVYCTGILVSRIPEIKELI
FT                   TERKAHRRNRRYYSRCKKKRLSARQNRVLLKFKVPRTVRDRDRLNATLRHGIETHLNLY
FT                   KKLLKFFPFPAEQVVFVMEDNIFDVRTMTWGKTDGTGYQKSPRVPAEKKCIICGSKEKL
FT                   QKHHLIQRKYGGTDIRENVVYLCRDCHEDVHAGRVYIPVEGVRQWRALGTVNAIIGRLR
FT                   EIPWLKFVPASDVAQMRKRLGLEKGHANDALATAAVFCNCTETDRTHMIELTLVKFRRH
FT                   NRARIHAVRDRLYKVNGKIVAKNRRKRTDQKEPSFADISPLSPEIQRKLKVYPGTKILN
FT                   PLRKETPTIAGDVWIYEPTGKRFVATGVVSQKYLYSPQLEKIVGKTYVKPEECKRVLRN
FT                   EGIVVMYNSLYHN"
FT   gene            466485..467105
FT                   /locus_tag="Calhy_0422"
FT   CDS_pept        466485..467105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0422"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="KEGG: ate:Athe_2423 putative RNA polymerase, sigma
FT                   70 family subunit; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06169"
FT                   /db_xref="GOA:E4QBZ5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBZ5"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADQ06169.1"
FT                   /translation="MFKLSFDEQKELVCRIKQGDKKAAEELICAYEPLIISFAAKYNKP
FT                   EIFEDLKQEGYCAILQAARKFNVSLGVSFITLAVYYIKRNMDRCVNRDRTIRPPFNKPS
FT                   TEIPQVISMDAPVNTNNYDDEELRVKDTIQSSTADVEEKVMYNETLRKLVELLSNEERK
FT                   ILLLRLKQYSYKEIAEKLGLTEKQVATKAQKIRAKLQCLLKAS"
FT   gene            467582..467776
FT                   /locus_tag="Calhy_0423"
FT   CDS_pept        467582..467776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06170"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBZ6"
FT                   /inference="similar to AA sequence:KEGG:Athe_2420"
FT                   /protein_id="ADQ06170.1"
FT                   /translation="MTIFNACKIEDGKIYYFNWFVGIVKGIKALVLERYWCRELECFLE
FT                   ESGLVPVWVSSLPEVEKTG"
FT   gene            467839..468087
FT                   /locus_tag="Calhy_0424"
FT   CDS_pept        467839..468087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06171"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBZ7"
FT                   /inference="similar to AA sequence:KEGG:Athe_2419"
FT                   /protein_id="ADQ06171.1"
FT                   /translation="MSLQKRRLQRYLQRLVLRNYKLLDKGKKTIAFADARGVFVSYYFD
FT                   AVELKTGKSVKLKVETFYYLGEKHATPEEVWYSLGGK"
FT   gene            468438..468719
FT                   /locus_tag="Calhy_0425"
FT   CDS_pept        468438..468719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06172"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06172.1"
FT                   /translation="MFIDFTTADNCRNPWAYEICVKCNACGRINKDSMLQDRLKVLEEY
FT                   LQERKSFDRWSDDKEIRKIQEQNLRTQIKELEEEIEKIKKQLAKGKQG"
FT   gene            468774..469391
FT                   /locus_tag="Calhy_0426"
FT   CDS_pept        468774..469391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06173"
FT                   /db_xref="InterPro:IPR041329"
FT                   /db_xref="UniProtKB/TrEMBL:E4QBZ9"
FT                   /inference="similar to AA sequence:KEGG:Athe_2417"
FT                   /protein_id="ADQ06173.1"
FT                   /translation="MPNWCRNVLVVSGSEEDVMKFDRQFYNIPQVYPGHKKPTRKQYTF
FT                   SALRPIPDTILKKGYWDPSPEGFKKWKEFINKYDKADIFYIASLPDEEFPNGYEWQCAK
FT                   WGTKWDLVDDEDVDVKVIKDNAGNATIMYTFDTAWSPVAPLVVHVEKKYPNLKFELEFV
FT                   EDCGGFFGYYRNGGYAEYTFEDLKQKPELLADFKYIRIHDYL"
FT   gene            469469..470599
FT                   /locus_tag="Calhy_0427"
FT   CDS_pept        469469..470599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0427"
FT                   /product="phage recombination protein Bet"
FT                   /note="KEGG: ate:Athe_2416 phage recombination protein Bet;
FT                   TIGRFAM: phage recombination protein Bet; PFAM: DNA
FT                   single-strand annealing protein RecT-like"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06174"
FT                   /db_xref="GOA:E4QC00"
FT                   /db_xref="InterPro:IPR010183"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC00"
FT                   /inference="protein motif:TFAM:TIGR01913"
FT                   /protein_id="ADQ06174.1"
FT                   /translation="MSDVKELAKIEGGTVEYDTESGKVRLSPEIVKRYLVSGDPSKVTD
FT                   AEVLMFLKLCQYQKLNPFLREAYLIKYGDEPATIVVGKETFTKRASKCELCAGWQAGVI
FT                   VRKYNRVNEIKRKLIEKIKTVAANEDEKKLLMDFVNYVVELIKTSEYELEYRVGTLVQS
FT                   DEELVGGWAKVFRKDWAVPIEISVSLQEYIRKKKDGQPTRSWREMPATMIRKVALVQAL
FT                   REAFPEQFQGMYAPEEMPVDSAQLPTEPVSTIENYYQEPTIGTISTSYTEQANRQEEKV
FT                   VPLPAKESKVEETQQSAQSTVIELHNVGVIGDPVIMQSKKGTDYMKVKVIADEGEFEVI
FT                   INQKEIMEQVEKGFIFSRVTIKKLSSGLLFVTSVEE"
FT   gene            470676..471017
FT                   /locus_tag="Calhy_0428"
FT   CDS_pept        470676..471017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06175"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC01"
FT                   /inference="similar to AA sequence:KEGG:Athe_2414"
FT                   /protein_id="ADQ06175.1"
FT                   /translation="MAKFVNCTPHAINIQTEQGIVTIPPSGISIRIESQQTQIGEINGI
FT                   PVVRTVYTGLNLPEPEPDTVYIVSTVVLQAAREMGIQRNDLVAPDTGPQSAVRDGTGQI
FT                   VAVRRFQVL"
FT   gene            471087..471410
FT                   /locus_tag="Calhy_0429"
FT   CDS_pept        471087..471410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06176"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC02"
FT                   /inference="similar to AA sequence:KEGG:Athe_2413"
FT                   /protein_id="ADQ06176.1"
FT                   /translation="MSDIKNYRELYNFVTEQDPNALEKLMIFEKFLLVRCGFEWLSDDT
FT                   QDQIVEKLHSVYAEMADKVKLSDFLSAVYELIYEDLKGKPEKILRFQKKHILDKIDSFL
FT                   CTA"
FT   gene            471570..471716
FT                   /locus_tag="Calhy_0430"
FT   CDS_pept        471570..471716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06177"
FT                   /db_xref="GOA:E4QC03"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06177.1"
FT                   /translation="MGVEIAKVLIIAVTVVAAGLVIGLTKANYTISIKIGTMQIDIKKE
FT                   VVS"
FT   gene            471947..472093
FT                   /locus_tag="Calhy_0431"
FT   CDS_pept        471947..472093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gla:GL50803_2338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06178"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC04"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06178.1"
FT                   /translation="MDRVIIELIARSLTLIAIAFAALFVRANVDIEISLKPFKVHIKKK
FT                   VVR"
FT   sig_peptide     471947..472030
FT                   /locus_tag="Calhy_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.810 at
FT                   residue 28"
FT   gene            472191..472370
FT                   /locus_tag="Calhy_0432"
FT   CDS_pept        472191..472370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06179"
FT                   /db_xref="GOA:E4QC05"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC05"
FT                   /inference="similar to AA sequence:KEGG:Athe_2412"
FT                   /protein_id="ADQ06179.1"
FT                   /translation="MLMQILKVVATVLDWALWLSILGFVLLVGYCLAFKKNVQWKFRNF
FT                   EFVINTKDQQADHQ"
FT   gene            472428..473396
FT                   /locus_tag="Calhy_0433"
FT   CDS_pept        472428..473396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06180"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC06"
FT                   /inference="similar to AA sequence:KEGG:Athe_2411"
FT                   /protein_id="ADQ06180.1"
FT                   /translation="MVETWVGSYSKLALFEKCPRAYYYKYVQGLEYSTPALELGKKVHE
FT                   GIAKFITTGVCSVEIAEFITPRVRQKQGIGTECVEKSIRFQVDDVTVEAVIDLITPDEI
FT                   IDWKTNWVKNADPRQLILYHYGAKRVGLAGVGNKVYFHYLRYNEDEEVDISTNATAITL
FT                   DWVKATYAAISETQFEYDLTEDIGIFNKTDNPKNCLTCPYRTVCKNVNTTEDAIKLARE
FT                   IEELEALLELKKEMLRDYIEEYGEIQTEANLWKLTVVNNWDFDTRKVYDYIQSLGKDPL
FT                   QFLNCTLTNLKKLKIPEQELERLGTKKITYRLAKSKIKEAR"
FT   gene            473457..473786
FT                   /locus_tag="Calhy_0434"
FT   CDS_pept        473457..473786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06181"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC07"
FT                   /inference="similar to AA sequence:KEGG:Athe_2410"
FT                   /protein_id="ADQ06181.1"
FT                   /translation="MDYVKVFEKGSFNEVHITKLNLDELRILRTDLTIILSKINFYLNY
FT                   GVYPEYPTKKYTIRVLRNDVFVPRKNADQQIVKEQLTELIKYIDWRIQDMELDLQEQEK
FT                   ERKTA"
FT   gene            473843..474064
FT                   /locus_tag="Calhy_0435"
FT   CDS_pept        473843..474064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06182"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC08"
FT                   /inference="similar to AA sequence:KEGG:Athe_2409"
FT                   /protein_id="ADQ06182.1"
FT                   /translation="MIKFALVRLNPTGATNLYILSNPTTIDSDEIKNRLRKVPVKLLLN
FT                   YIIDAEKGQLITRFVFAVPESLVRRFAA"
FT   gene            474135..475094
FT                   /locus_tag="Calhy_0436"
FT   CDS_pept        474135..475094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0436"
FT                   /product="domain of unknown function DUF1738"
FT                   /note="PFAM: domain of unknown function DUF1738; KEGG:
FT                   ate:Athe_2408 domain of unknown function DUF1738"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06183"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC09"
FT                   /inference="protein motif:PFAM:PF08401"
FT                   /protein_id="ADQ06183.1"
FT                   /translation="MSDKSDKIFFGSKVSQIVTDRIIKKLEQGVIPWRQSWTSSGLPVN
FT                   WETKRPYSGVNLLLLDPGAEYLTFNQIKKLGARLKKGAKALPVVFWKVDTIEIEKPGDK
FT                   TQNEQEEIEVVEETEKTIKTVYLLRYYLVYDVRDVEGLPKRKGQQEKIQPDYTHRTQKA
FT                   LTIVKEWSKICTIKHGSNYTPSYCPLTDTIYMPTFDKFVGAHKIEEYFSTIFHEITHST
FT                   GHRNRLNRIKHSKYGDWHYSLEELTAEIGSAMLLNICGLDVPEVLDNNAAYISYWLEQL
FT                   RNDKTLVVRAAGRAEKAIEYILEKVDEKQDKQLQQASA"
FT   gene            475197..475427
FT                   /locus_tag="Calhy_0437"
FT   CDS_pept        475197..475427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06184"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC10"
FT                   /inference="similar to AA sequence:KEGG:Athe_2407"
FT                   /protein_id="ADQ06184.1"
FT                   /translation="MKKVIDFAEAKKKLLQKKKDEELKKFNQDVNFFVEWIEANMSEEE
FT                   KRRRQELEEEIERALQELMSKSTQKPTQKGV"
FT   gene            475430..475918
FT                   /locus_tag="Calhy_0438"
FT   CDS_pept        475430..475918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06185"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC11"
FT                   /inference="similar to AA sequence:KEGG:Athe_2406"
FT                   /protein_id="ADQ06185.1"
FT                   /translation="MQFYNAEKMIEDFIYAWGCCTVEHIRELVHPAPENKIRRLIKGLL
FT                   IEEQDGVLRPIFSQLSYLETQRTLKFLDFLVKYLQDKVTDYKPAQYPYVAIVRTTKGKN
FT                   AFVCYVMAGEETIIRDVINTAPPENIIFILEKPETKEILQSVNCKLKTFLNAQSGEKV"
FT   gene            476289..477374
FT                   /locus_tag="Calhy_0439"
FT   CDS_pept        476289..477374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0439"
FT                   /product="zinc finger CHC2-family protein"
FT                   /note="PFAM: zinc finger CHC2-family protein; KEGG:
FT                   ate:Athe_2405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06186"
FT                   /db_xref="GOA:E4QC12"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC12"
FT                   /inference="protein motif:PFAM:PF01807"
FT                   /protein_id="ADQ06186.1"
FT                   /translation="MRELVDITMQDVLDRVRITVLKQRGNELNCLCPYCDEPHRREGHL
FT                   YINIAKDTFICHKCGRQGNALQLYALLTNQDTKEAYKELAQEIASGSQRLHHIQYKLQT
FT                   REAQPKYIAPPEVRDKVYREFLKLLTLNEKHKADLLRRGLSETAIRVKGYKTLFVEKEK
FT                   RLEICRTLQTKGYSLEGIPGFFKHKTTGEWDFIPYQGYAIPVKNLNGQIIGLQVRMDEP
FT                   CLSKYRWFSSSSSKDVGTPAEANLHVTGSCSDDVVYITEGVLKADVAAYLSGKMFIGLP
FT                   GVSSCHKQLIQTLQQLQPKLVILAFDMDYREKKEVAYNLEKIKSMLAENGFKFKQIEWD
FT                   ARFKGIDDYLLHLKQTQKRSA"
FT   gene            complement(477500..477592)
FT                   /locus_tag="Calhy_R0012"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(477500..477592)
FT                   /locus_tag="Calhy_R0012"
FT                   /product="tRNA-Ser"
FT   gene            complement(477685..479160)
FT                   /locus_tag="Calhy_0440"
FT   CDS_pept        complement(477685..479160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06187"
FT                   /db_xref="InterPro:IPR011205"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC13"
FT                   /inference="similar to AA sequence:KEGG:Athe_2404"
FT                   /protein_id="ADQ06187.1"
FT                   /translation="MSDEFLNELEKSTNISRTENNALTFQSTLNANLDWFSMSGGLRFQ
FT                   PEDRIISLFMKAFYEDKQLAMKNLFFTRDIKKGLGERRVFRVVLKHLAKTHPDIVRKNI
FT                   VFIPFFGRWDDLYELIDTPVENSMWFFIKQQLSEDLKSENPSLLAKWLKSENTSSKESV
FT                   KLAKKTRKALSMTPKEYRKTLAELRKRIDVLERRLSEKDYTFDYEKVPSQAMLKYRKAF
FT                   LRNDKDRYTQYIEKVIQEKKKINTNTLSAVQIVRQILIDRGKMSLEEKKHLDLLWQNIP
FT                   KIDTSENALVVADTSGSMFYACGQYALGIAASIGLALYYAENNKGIFHNRFITFSAKPK
FT                   LQKIQGKTIYEKVKFLENADWECNTDIEAVFTLILNIAINKNLAQEDLPKKLYIVSDME
FT                   FDEATRVSPDAPLFDAIRERYKNHGYELPTLVFWNVSSRHNNIPVTKETPNVLLVSGMS
FT                   QKIFENLIKNQLPDPVEFMLEVLNNERYSVIQI"
FT   gene            479770..480042
FT                   /locus_tag="Calhy_0441"
FT   CDS_pept        479770..480042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0441"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   ate:Athe_2403 protein of unknown function DUF1021"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06188"
FT                   /db_xref="GOA:E4QC14"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC14"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ADQ06188.1"
FT                   /translation="MVDKLHLQQLKKDIEALKGEKVLIRANKGRKKMIEVEGILENTYS
FT                   NIFVVKFPVDRECKQYRCVTYTYSDLITNTVEIILCRTNTKVGVM"
FT   gene            480229..481764
FT                   /locus_tag="Calhy_0442"
FT   CDS_pept        480229..481764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0442"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="KEGG: ate:Athe_2402 peptidoglycan-binding LysM;
FT                   PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06189"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC15"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADQ06189.1"
FT                   /translation="MEKRFEKVEYMNVYGTDSQKVIVEGEILLPEIKPDAVKVLQTDSE
FT                   ILITNVEVLNDKVIVQGEIEFRVIYLSSDPQRKVASVSSSAEFSKTFDMLGVRPTMAYE
FT                   VKDDLIYTFCSLLSPRKLSAKAIAEITVLIKAPATVEYLADIEEDSIKYLKEKISISNP
FT                   RTMTEEISKREILEIPQGKPSIREILRCFARLSDKNIKFDRKKITFDLKVDLKTLYSPD
FT                   VGQNPIEMVEHEVLIQHYSELPDSPDDVEPVVKFYIKSFKVLPKTDEIGELRRIEYDIT
FT                   IEAEITFHDVKTIEPIVDAYSTAYEIKDSKKLLSVEQFVGKGRHVHLLKDTVTLPTEPE
FT                   QVFSVSGRIEIDLIKPEKNKVNIKGVAVIFLIYLSKDLQDIIKNTTTQIPFDVKLDMEG
FT                   AEETDRAFANIEIENISFSIISTSEVELRIHLAVEVWVKRALSREILSDVEFVEEMKKE
FT                   DERLASVYIYTVQKGDTLWKVAKKYRTTVEKIIDFNQIEKEEIVPGQKLLIVK"
FT   gene            complement(481815..483182)
FT                   /locus_tag="Calhy_0443"
FT   CDS_pept        complement(481815..483182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0443"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="KEGG: ate:Athe_2401 UDP-N-acetylmuramate/alanine
FT                   ligase; TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06190"
FT                   /db_xref="GOA:E4QC16"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC16"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ADQ06190.1"
FT                   /translation="MNKYFFIGIGGISMSAIALILKNQGFCVEGSDIQESATTKMLREN
FT                   GINVYIGHDESHIHGDETVIYTAAISKDNPELLAAKRMNLKIYERAEFLGLLMRNFKNV
FT                   IAIAGTHGKTTTTSMIGYILKKANYNPTILVGAFVKQLGGNFVIGSKDYLVVEACEYVD
FT                   SFLKFNPTIGVILNIDNDHLDYFKDIDSIKNSFKKFAQKIPTSGFLVANCDDKNVKDII
FT                   SKFHTQVVCISTKEKADIFADNISCNDGYYEFDVKNNNNEILAHIKLNIPGFHNVYNAL
FT                   AAFAVASKLRVESLTIEQALSEFCGASRRLEKVGEFNGIYLYDDYAHHPTEIKATLATL
FT                   KKISEGKVLAIFQPHTFSRLKTLLNEFAESLKLADKVIVTDVYAAREKNIFGITSEKLY
FT                   LKLKEIGIDCEYISNFDDIACYVVKEAKKGDIIATIGAGDVNKCIDIILKKAPVKS"
FT   gene            483592..484602
FT                   /locus_tag="Calhy_0444"
FT   CDS_pept        483592..484602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0444"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ate:Athe_2311 transcriptional regulator, LacI
FT                   family; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06191"
FT                   /db_xref="GOA:E4QC17"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC17"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADQ06191.1"
FT                   /translation="MKYTIKDIAKITGYSVATISRALSGKEGVSEEKRKEILKIIDQLG
FT                   YIPNQSARRLRSKETKNILVMIPDIENYFFNKLIKGIETEAREKGYNIILGDFSDSQEI
FT                   EEEYYRMMKGQIADGILIVGSLSEPQKVVEISRQFPMVVISDYFSDELVTVCVDNFKAS
FT                   YDATMFLYKCGYRRIAKITGKIGAMLSQDRLKGYKMALENLGLVSDEKYIKYGDFKYES
FT                   GYKLAKELLKMTPAPDAIFCSNDEMAVGACDAAKELGFSIPDELGVMGFDDIELSSMVT
FT                   PKITTVHQPRYEMGKLAAQLLINILAGEEVSKGKYILDTSIIQRDSTKMQISQNK"
FT   gene            484818..486095
FT                   /locus_tag="Calhy_0445"
FT   CDS_pept        484818..486095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0445"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2493 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06192"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC18"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ06192.1"
FT                   /translation="MKRFIAVVILIAMSVGLFLAFGPADSNAASKKQVTITYVRGKDET
FT                   HATEKIIKEFMKKNPDIKVIYKENPSDTGQNHDQLVTVLSAGGSDIDVFDMDVIWPAEF
FT                   AQAGYTLPLDRFIKRDKINLNDYIKGTIDAARFKGQMWAFPRFIDAGLLYYRKDIVPQN
FT                   ELPKTWDDLIKVAKKYKGKKGTKYGFLMQAKQYEGLVCDAIEYIASYGGRVVDESGNIV
FT                   VNNKGTIDGLTMMRKVITSGIVPPNVNTFTEIETHTAFINGLAVFARNWPYMWAMVNGP
FT                   QSKVKGKVGVLPLPAGSKGSAAALGGWMVGINKYTKNPEASWRLLKFLVQKEGQKLMAI
FT                   YNGNVPVYKPLFNDKDVIKANPLIGDKKFVEAILAAVPRPVSPIYPKISDVMQIELSNI
FT                   VNGKKDVKTAVLDLDKKLKELVKTQK"
FT   sig_peptide     484818..484904
FT                   /locus_tag="Calhy_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.731 at
FT                   residue 29"
FT   gene            486176..487459
FT                   /locus_tag="Calhy_0446"
FT   CDS_pept        486176..487459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0446"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2309
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06193"
FT                   /db_xref="GOA:E4QC19"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC19"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ06193.1"
FT                   /translation="MDRKEKLFGYLFLLPAVLIFIFVAVIPLVQVFVFSLFDIQLNNPT
FT                   KSEVSLSYKIDVENYANTLFTASSIIDGINIESLNDSQKKTIARIKSLLPMMEKSIFNT
FT                   KTRIDRLNKVNDLLNNFQPVDSKLKYLPVAAKEINQYNAYVDKIINLTNSLPNTQEMND
FT                   LKQAILAFDQVIVKPNFVGLQNYSYYLKDSRLFSAVKNTLLFTVVTVFFELVFGLMLAV
FT                   VMHKVANLKNVFKSIVLLPWAIPTVISALMWKFMYDGQVGILAKFFADIGLIKSPADLL
FT                   SSTTNAMIAAMTADIWKTTPYIAILLVAGLQTIPESLYEAAKVDGANAVYQFFRITLPM
FT                   LKPTILVALLFRTLDAFRVFDLIYVLTGGGPANSTETVSIYTYKTLFNQLDFGRGSTLA
FT                   VLIFIMVTIISFIYIKILGAEVFSHQKR"
FT   gene            487469..488320
FT                   /locus_tag="Calhy_0447"
FT   CDS_pept        487469..488320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0447"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2491
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06194"
FT                   /db_xref="GOA:E4QC20"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC20"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ06194.1"
FT                   /translation="MKNKKKLTGEKIAKIVMNIIIVLALIVILFPFYWLLLTSIRPKSE
FT                   IFNISSLITLKPHIGNYKMVFTERPFARYILNSFVIGLETTVISIVIASFAAYAIAKTN
FT                   ISPKIKNLVLSLSLAVSMFPQITIVSPIYVMVKNLGLRNSFFGLLIPYTTFSLPLAIWY
FT                   LTTFYQGVSHEIDEAAKIDGCNTFQIFYKIITPLIAPGIFTAAILIFISAWNEFLFALV
FT                   INTDDIWRTVSVGIVMFQGRFTIPWDEISAAAIVVMIPLVLMVFVFQQRIVSGLTAGAV
FT                   KE"
FT   gene            488539..489528
FT                   /locus_tag="Calhy_0448"
FT   CDS_pept        488539..489528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06195"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC21"
FT                   /inference="similar to AA sequence:KEGG:Csac_2488"
FT                   /protein_id="ADQ06195.1"
FT                   /translation="MQQKVPHNQYDLTFKRLFQFKEVFLNFLRSNINREWVNRIDAESL
FT                   EFVDRSFIKDEFVEKEADVIYRARLEDTDIYFYVLIEPQSTADKSMPRRLFEYMSLVWK
FT                   RHMEEKADELFPPIVPIVLYNGRSSWNIPTQIFKGFDIFKDDMFNYILVDVNRLDDEKL
FT                   RSRLDLLSIILYLEKSRRNAEEFVEKLSEVSEYVCKLPQPQLKVFCSWLLRIVKPQVRE
FT                   EMKSRIDELLEKIEAEGVEDVGEFIFNVQQLIQEYYKEAEEKGKEKGYEEGIQEGIQKG
FT                   IQEGIQRKEEEIVRRLIQKGFDDNFIAEATGVEIERIKKIREEYTKYS"
FT   gene            489672..491231
FT                   /locus_tag="Calhy_0449"
FT   CDS_pept        489672..491231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0449"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: csc:Csac_2487 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: Cache domain protein; chemotaxis
FT                   sensory transducer; SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06196"
FT                   /db_xref="GOA:E4QC22"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC22"
FT                   /inference="protein motif:PFAM:PF02743"
FT                   /protein_id="ADQ06196.1"
FT                   /translation="MQVVLTILGAFALSVVFSVLILKIFVDKTLSILHGKNNLNAIEKL
FT                   FLKPVKDWAASFQGFLSEIFKEIDLAYNKILSVAYDIESSAEKNQQQSNIVLTNSKDIQ
FT                   TSISGLLVGLKLVLQHIESAYENVSSLEEFMTHFKEKNQNIQEDIQKLLAEVSTDLESM
FT                   VSENTAYTQKMADQITKLKTVFKKVEDFLGTIVKISEQINILALNASIESAKLESVLGE
FT                   NFKTGFHVIADQIRKLSNDTKSTADEIGDFIIEISGIVDGISSLSEKSKDIISRQVEYG
FT                   KTTFQKLNQVSQLVDYINKKISQASEKLSVQYSIVNDLKHYVTRLENSYIAVDSSTNKI
FT                   LSSVEVSKKIAERLMRLMNRLVDVCREFESVRNDISAKITKRVEIEVNQQRVAEAIETI
FT                   ENEVIPQLVLSWQKELNHKEVIDQSLQKFSNIFEALWTNNPDGTFIYSNPPEGIENAKV
FT                   REWFTKAMAGHTYVSSAYISAITRNYCITISMPVYDGFGRLLGVIGADIKLSIVKCSQT
FT                   GL"
FT   gene            491357..492748
FT                   /locus_tag="Calhy_0450"
FT   CDS_pept        491357..492748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0450"
FT                   /product="Conserved carboxylase region"
FT                   /note="PFAM: Conserved carboxylase region; pyruvate
FT                   carboxyltransferase; KEGG: csc:Csac_2485 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06197"
FT                   /db_xref="GOA:E4QC23"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC23"
FT                   /inference="protein motif:PFAM:PF02436"
FT                   /protein_id="ADQ06197.1"
FT                   /translation="MKRIYITETVLRDAQQSLIATRMPYEDFEGILEKIDKAGYYSIEC
FT                   WGGATFDSCLRYLNEDPWERLRKIRSKVKNTKLQMLLRGQNLLGYRHYPDDVVRMFVRK
FT                   SIENGMDIIRIFDALNDLRNIEVAVDETIKAGGHAQGTIVYTISPIHNLEMYVKIGKEL
FT                   ESMGVHSICIKDMAGIMSPKEAYELVKALKENVKIPVFLHTHSTTGLGILTYLKAVEAG
FT                   VDGIDTAISSFSGGTSQPPTETLNYALKQMGYDTNLDSKLLKEINDFFKPVKDKFIKNG
FT                   ILNPFVLSTDTDALIYQIPGGMLSNLIAQLKQQNALDKLDEVLMEVPRVREDLGYPPLV
FT                   TPMSQMVGTQAAANVLAGERYKVILKEVKAYIRGEYGKPPGKINPELVKEVLGDEKPIE
FT                   GRFADTLEPVFEKTKEQVKDFARSDEDVLSYILFPQVAEEFLKNRGKKKESRERKIEYT
FT                   IEGIS"
FT   gene            492777..493133
FT                   /locus_tag="Calhy_0451"
FT   CDS_pept        492777..493133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0451"
FT                   /product="sodium pump decarboxylase gamma subunit"
FT                   /note="PFAM: sodium pump decarboxylase gamma subunit; KEGG:
FT                   csc:Csac_2484 sodium pump decarboxylase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06198"
FT                   /db_xref="GOA:E4QC24"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC24"
FT                   /inference="protein motif:PFAM:PF04277"
FT                   /protein_id="ADQ06198.1"
FT                   /translation="MEYSTLGERFILGLEVTVIGMLIVFAVLALLCGIISLLSKVLQRF
FT                   EKPKKATESELSSLEIDETQEYKPVEKTGFTSGEVNVLDAEDEEVAAILAAVAFDSDIP
FT                   LSELKIKSIKRLKE"
FT   gene            493164..493514
FT                   /locus_tag="Calhy_0452"
FT   CDS_pept        493164..493514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0452"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: csc:Csac_2483 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06199"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC25"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ADQ06199.1"
FT                   /translation="MKYIVTINGKKFEVEVERVSNGNGQVDVSKDSKKVSNNEISKTIS
FT                   GGIKVSAPMPGKILSVNVQEGQKVKKGDVLFILEAMKMENEIMAPEDGMVEKVLVSKGS
FT                   QVASGDILAILK"
FT   gene            493533..494669
FT                   /locus_tag="Calhy_0453"
FT   CDS_pept        493533..494669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0453"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="TIGRFAM: sodium ion-translocating decarboxylase,
FT                   beta subunit; KEGG: csc:Csac_2482 sodium ion-translocating
FT                   decarboxylase, beta subunit; PFAM: Na+transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06200"
FT                   /db_xref="GOA:E4QC26"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC26"
FT                   /inference="protein motif:TFAM:TIGR01109"
FT                   /protein_id="ADQ06200.1"
FT                   /translation="MEFFHMITKAISDILTTSGFAKITLGQAIMLAISCILMYLAIGKK
FT                   FEPLLLLPIAFGMMLANLPLSFLSSHDKGGLVYYLYQGVKLGIYPPLIFLGVGAMTDFG
FT                   PLIARPSSLFLGAAAQFGIYFAFMIALLIGFTPQEAASIGIIGGADGPTAIFLTTKLAP
FT                   HLLGAIAIAAYSYMALIPLIQPPIMRLLTTKEERMVKMDQLREVSKLERIVFPIAVTII
FT                   VSLLLPSVAPLIGMLMLGNLFRECGVVERLSDTAQNALINIITIFLGLSVGATATADKF
FT                   LNPKTLAIIFLGLLAFIFATVGGVVFGKIMYKLSGGKINPLIGSAGVSAVPMAARVSQV
FT                   VGQKENPSNFLLMHAMGPNVAGVIGSAVAAGVLLTLFK"
FT   gene            494843..496948
FT                   /locus_tag="Calhy_0454"
FT   CDS_pept        494843..496948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0454"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: ate:Athe_2304 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06201"
FT                   /db_xref="GOA:E4QC27"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC27"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADQ06201.1"
FT                   /translation="MSKKDPLSFFKKFILKQGLGRKLSLLVVGVLLIPIIIIDVISISM
FT                   SVNSVINESKKSYLAATEANSHYFQLVFETVRDLAMQLMSNDVIQKLYSESRQLTLEDY
FT                   EKYKLKNDADKMLQNIFLTNQMLSKAYILVNKDNSLAYPYFSVEDLDFNKLKSASWYKK
FT                   IIEKDGPIYLENHHEALDELSPTIPQYAFSVGLPFKDLSSSETLGVLMLDVSLLWFRNA
FT                   LQSTNISQQGGYMLAVSPSGKVILPSEWETTRKLSPKADTPFIKKILAEAKGKNPKGAF
FT                   NTVFDGKPFLVTYSRIPEQEWIIVSMIPVEMLLSSARKLELFVIVLTIIFTLAALAVGI
FT                   FFALRMVKDLELVTNTFAVAEKGDLTVALNIERNDEIGFLSHSFNNMIKNIKGLIEKGV
FT                   KLSDQVTSSISTLSTIAGETAAASNEVAKAISEIAEGASNQAKEATNVVEIVSKFGEKV
FT                   ETIVDASNKMEKLSKNVAELSTKGENTVSILDSVSHDTMQITDTMISTINQLAEYSRSI
FT                   GKIIQVLSSISEQTKLLALNASIEAAKAGEAGRGFAVVASEIRKLADQSKESTREVEDM
FT                   IKRIVSQTKAAQDVADKVEDVIEKQNEAVRNVSLAFSSIKSAMDELIDGIENINQSILA
FT                   IDKEKDTIVRSIENISAISQETAASSEEVSASTQEQLAAIEELRAMAESLNKLAQDLKE
FT                   AMQVFKV"
FT   gene            497109..500189
FT                   /locus_tag="Calhy_0455"
FT   CDS_pept        497109..500189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0455"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: ate:Athe_2303
FT                   S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06202"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4QC28"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ06202.1"
FT                   /translation="MKKFKRLIAIVTVLLFALSIIAPAFAQDEATTEETGSVYDQAAKI
FT                   LQDKGILKGNEQGDLMLDKELTRAEILAMIIRATGQEDVVKDYVYAEQSFSDVPNTHWA
FT                   FAYVEAGKDLGIVNGYPDGTFKPDKSVKFEELCKMLVAAKGENPASGKWPLNYVRKALE
FT                   LGFFNGIEDDVGIGDVVKRGQAAVAFANAFFPPEKTIAVKDVKVVANDTIEVYVDVYLN
FT                   NEPATLEDGDVIPLDFEIKDAKDDTKTVAVTQIDTDKSDFANGKIVLKTAAQTANATYK
FT                   LYFKGKDTGKTFVAVPVPLTVTKVEALNYKEIKVTFNKPVDDASAATNKDNYTVYLGNA
FT                   KATISSVILSSDKTNVRLFLSNTMSSDLTTKVTVAKAVGLAEDYTSTIQPFVDSTAPTV
FT                   ENVVPIGLMKLKVIFSEPVLNSGNTANYIVDNSYYPVKADPDTSDYRSVVLTFGFALSA
FT                   GNHVIEFNKYSTNTDYMIKDYAQYLLINTPKTFTMSSDTTALTTPTVISATQTSVQLKF
FT                   NKGIADITSVSASPSGTWDGVESIDVNDPSIVTLNFYSGSPLPAYGVTLTITAVDISGT
FT                   SATLSVSIPTVTVDVTPPTITSYSIDSPTQISLIFSENVIAPSGDWSNYVTITDSNNAL
FT                   HPVIDIKRDDANNNKNKLIVTIDPNYPLPTSGTISVSVKNVVDDTPRYNPMVATTLTIN
FT                   AVDKTAPTVSSVVYDATSKKVYVIFSEAVNATTALNPYNYVLNSAGSLLIPTSANFKLL
FT                   ADGKTVVMDFAIAGTDLSKLTQVQIVNVQDLAGNTMAGQLVAATPVDTSTAPTVETAAQ
FT                   IATNQIKLDITSGSVFSPTLSAGDFIVKDGQTQITITGIKLDDNGDIIITLATSLGTDA
FT                   GGGDVTVTLNPAGLSTRDIYDRKIRFVDNSGQAITTLTVGDGCAPTITTVEATYQTVVG
FT                   QTYVTINFSENVNVASFTYLDDYTQQFRVYIDGSLTAIDGFDNSVPNKLIFKFNGDKRY
FT                   KSIRVDYVPPYDVTKRIKDLSVNNNELAATSVNATWK"
FT   sig_peptide     497109..497189
FT                   /locus_tag="Calhy_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(500491..501723)
FT                   /pseudo
FT                   /locus_tag="Calhy_0456"
FT   gene            complement(501881..502033)
FT                   /pseudo
FT                   /locus_tag="Calhy_0457"
FT   gene            502256..503548
FT                   /locus_tag="Calhy_0458"
FT   CDS_pept        502256..503548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0458"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: ate:Athe_2262 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06203"
FT                   /db_xref="GOA:E4QCA7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCA7"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADQ06203.1"
FT                   /translation="MSANEIYEFRDPVHGFIQVNDLELKIIDSFPFQRLRNIKQLAFSH
FT                   YVYHGAEHSRFGHSLGVMHLVTKAFMTVVEKTNIFDIPQKEWYTQILRLIALIHDIGHA
FT                   PFSHASEELFPDDLKHEDYSCMIATQTEIGDYIHEIGERFKKLYGKDYDITPELICSIY
FT                   KGENIENPDFMFLRKFMDSELDCDKMDYLLRDSLYCGVSYGKFDLERLINTLTIWKNDE
FT                   GILHLAIEKGGMHAFEEFVLARYFMFTQVYFHKTRRFLDNMLFSFLKSALKEGKYPKDI
FT                   NEFLEYDDVTISELIREKSKENECAERLLKRKIMSCIYETPPHANKDQESIHNLIKNSL
FT                   IQKIGKENLLFDSADKMIHQIPVKYELDSEKAIPIIDEKNKEVMSISIASEVIKKMTEP
FT                   INIKRIYVTEDKKEEAEEIVNEIQNMMKRSN"
FT   gene            503573..504136
FT                   /locus_tag="Calhy_0459"
FT   CDS_pept        503573..504136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06204"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCA8"
FT                   /inference="similar to AA sequence:KEGG:Athe_2261"
FT                   /protein_id="ADQ06204.1"
FT                   /translation="MKENKDLILWYLIKEFTKHCSRTGNKVGKKFLQKVVYLLQRKGLN
FT                   LNYNFSIHYYGPYSSQLEYDIHRLEMNRLVRIDPKDGYTHEIIPEEVSDDEKYLSHHDI
FT                   EMIDSKEIKDLIKNLSSFNASELELIATVDYVINQLKIRGTDELNKKEIIEKVKRLKGN
FT                   KYTEKKIEEAIKFLEENGFVKIEG"
FT   gene            504353..505174
FT                   /locus_tag="Calhy_0460"
FT   CDS_pept        504353..505174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06205"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCA9"
FT                   /inference="similar to AA sequence:KEGG:Athe_2299"
FT                   /protein_id="ADQ06205.1"
FT                   /translation="MRMPKSLKAYMCLMLVSTFITAVLILPWNISHAQSNSTQNSQPDL
FT                   IGVVKSLSGSKITIYIAKLSSQSDGRGFGRGRIELTNKTQTITVSSKTSIVTRVFQNGQ
FT                   VTEKKLLTKDLKTNNILYIWYADSKKKTISRILIQGTYDPYQTPEAIGVIKKVESNKIT
FT                   ITVATIQRPQPRQNTSNNQPQQRMASQPPQGGFGRGMMNLKLSSQTKTIAISKSTVIVT
FT                   RTFQNGQMTEKKLTVKDLKANNIVYIWYSDSKKTTAKRIMVMGTYSQSSSK"
FT   sig_peptide     504353..504454
FT                   /locus_tag="Calhy_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.898 at
FT                   residue 34"
FT   gene            505209..507200
FT                   /locus_tag="Calhy_0461"
FT   CDS_pept        505209..507200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0461"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: ate:Athe_2298 efflux transporter, RND family,
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein;
FT                   biotin/lipoyl attachment domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06206"
FT                   /db_xref="GOA:E4QCB0"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCB0"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADQ06206.1"
FT                   /translation="MAFKIKSLKSPKIKIGFKNKAAKRIIVSILVVAILAAGGFGIYKF
FT                   IQGKKNQTQTVQQRTARVTRGDITVTVSGSGPIESAQSVDLTSTVSSTITRVNFNDGDT
FT                   VKKGDIIFELESQDAKDKIDSIKSQIDDVNSSIADVQESIKNLVITAPISGYVKNLNAQ
FT                   EGDRISKGSTVLTIIDTSKLKVTLPFSAALFGKVKIGAPAVVYIPDISQSIQGTVSYLG
FT                   NTTYTNDYGGKVFDVEITISNPGALQEGMKASAEIKVGAEVYLSTQDATLEYVDKENVK
FT                   AKVDGEVEEIFARNNQFVEKGAVLLKLSNDDLSKQLKNYQTQLKNLQDQLKDAEDNLEN
FT                   YYIKAPFDGVVTNINFKKGDNIKAGEVLATVFDNKNLVFRVDIDELDIAKIKVGQKVNI
FT                   TVDALPETQTNPLTGKVSKIPLEGTTQNGVTTYSVTISIDNPKNLKIGMNANAEIIVNQ
FT                   KQDVLMVPLEAVQKFGNRYFVFVKSSSQNSSQQEQTGGFFPQGGFGNNQQSSAQGSQNW
FT                   RQRWQQEGSNTESAQQSGNSQSRGSWSQNSQGTGSSSQLRTRRMASLLNNSYYKGAVLR
FT                   PVEVGINNDSYIEIVSGLSEGDIVVLPPLSTGSTSTQTQTQQGFNIMGGFGGPGGGMPG
FT                   EFRQFRQNQSGTGRTNQSSGSQGSNTNR"
FT   gene            507226..507903
FT                   /locus_tag="Calhy_0462"
FT   CDS_pept        507226..507903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0462"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: csc:Csac_2447 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06207"
FT                   /db_xref="GOA:E4QCB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCB1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ06207.1"
FT                   /translation="MIELYDIYKIYKMGENEVYALNGINLKINVHEFVAIVGPSGSGKS
FT                   TLMNIIGCLDTPTSGTYILDGHEVSRLNDNQLAEIRNSKIGFVFQNFNLIPQLTALENV
FT                   ELPLIYKGVPASMRHKLAKEALARVSLEHRMHHRPRELSGGQQQRVAIARALVTNPAII
FT                   LADEPTGNLDSKSGAEIIQIFKELHAQGSTIVLITHDNNIAAQARRIVRIQDGQIIEDK
FT                   EVS"
FT   gene            507907..509085
FT                   /locus_tag="Calhy_0463"
FT   CDS_pept        507907..509085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0463"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ate:Athe_2296 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06208"
FT                   /db_xref="GOA:E4QCB2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCB2"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADQ06208.1"
FT                   /translation="MAQFALAFKMAIKSILSNKLRSFLTMLGVIIGIWAVIAVVGLAQG
FT                   STKSITDRLQRLGTNLIQINITGRNSNRNVTYEELQQFAEQHQDDIEAIAPTVSSSVTL
FT                   KYGTNTHDTTLVGTTADYSTVRDVNVSSGRFILPIDVDYRQKVALVGTYIVKDLFNGQN
FT                   PIGKKIKINGQIFTVVGVLEERANSQEQSDDDQVIVPVTVAQRLTRNAIIRNFAIKITD
FT                   GNRSEAVMNYLNDFLMKIYNDSTAFRVFNTAQLLDTLNSVTQTLTLMLAGIAAISLIVG
FT                   GIGIMNIMLVSVTERTREIGIRKAIGAKRRNILVQFLIEASVVTGLGGVVGIILGFVTI
FT                   RVMSKLNIATAIFSIPWAVLAFTISLAIGIVFGLFPASKASRLNPIEALRYE"
FT   gene            509106..512333
FT                   /locus_tag="Calhy_0464"
FT   CDS_pept        509106..512333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0464"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: csc:Csac_2445
FT                   S-layer domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06209"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCB3"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ06209.1"
FT                   /translation="MRKKFLAVILLLGFVLVNFGLSSAFAAYKDIPANASYKQAVEKLN
FT                   KLGILVYKDYFKPSANITRGEFAAAIVKISNAEDEANLQKGYSQYPDIKPNTVLCGYVN
FT                   WAVKKKYMTPMADNRFHPNDPLTFAQATTAIIRMLGYSDSDLSGIWPQNYIDKASELGL
FT                   IKGINLSASQKVPRWALALMLSRLLDTEVKTGGNQAQSTQSALSGVSASNQSSSGTKFS
FT                   EYVGLYKSYVVLDTGKTSSKLLTNEVLTDSGVLVNATKTQLEVGKKYMLQVDSNKITKV
FT                   FGIETDSFQIVSTKADGKTVYYKESGKKKSITLPSSATYYYNGSKQSYDTIENVLKPNQ
FT                   KISFIYSEDRSKVDFVVIFDIYAQEIYGNYDEVLILATPKTSSSLEENQVQTDKGIYFV
FT                   ASSIKPENLEIGAKYGVYIKDDTITVALQKVWVSDKFTIKNIDDYTLDVEQNGKTQKIQ
FT                   LSSKPVYYYQGTKQSYENLPNILKEDQILYVSKDPDTGKIMAYVIQDPYGTQYGNYIEA
FT                   IVLQDALLNSSLENNQVMTDKGIFYLPSADTKLELGAKYGLYVKNDKITLVVKKLNNTA
FT                   QYEVTDVVSDTNVKLKGAQGQENIILPQKPVYYYNGTKTNYTELKNVLKAGQKIYFGYA
FT                   KDGKTYEYVVIQDPYSLEYGTYTEVIVMADAVSSSKLATNEVLTDKGIYVVSSTAGKLS
FT                   VGAKYGVYIKNDTITKVVKKLNNVESAEITAVVNDTNVKLKKGSTENTMLLPQKPMYYY
FT                   NGNKLSYDQLKSILKTGQKIYFGYNQTGSSYEYAIIQDPYYDEYGTYMEVIVMGTSKVT
FT                   KGLAENEVLTDKGILTLPSNQNVNLELGAKYGLYVDSNNQITLVYKKFNSTDGMTVVYA
FT                   LGSKVTVDKGGTQVEMTLPQNITYYYSGTKIDYSAALQKMQRATSLVFGISTQKNGYDY
FT                   CVIFDPVYSKPYLANEQTYLTLKAGDLDISGSNKVIKDGDVVDYSYIQKNDVVYAVTDI
FT                   WGGNKIILVVDDRVEGYIKSYQPTRFTPKSIVVSVVDLTTGKLVDKTYEVSEDFDPSVL
FT                   LSDTFKVGQRVYLILGYDGKVVSMVNP"
FT   sig_peptide     509106..509186
FT                   /locus_tag="Calhy_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.675 at
FT                   residue 27"
FT   gene            512486..513463
FT                   /locus_tag="Calhy_0465"
FT   CDS_pept        512486..513463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0465"
FT                   /product="Carbamoyl-phosphate synthetase large chain
FT                   oligomerisation"
FT                   /note="PFAM: Carbamoyl-phosphate synthetase large chain
FT                   oligomerisation; KEGG: ate:Athe_2294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06210"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCB4"
FT                   /inference="protein motif:PFAM:PF02787"
FT                   /protein_id="ADQ06210.1"
FT                   /translation="MSENLPPKEHDSTFKFLFEEKEDILLLVKDILKYKWAEMIDEDSI
FT                   ELVKTNYLTQDFMQIEADVIAKARLREREVYFYILIENQSTVKRDMQLRILKYMISLWA
FT                   QEIRKGVEVLPAIIPIVVYNGIDERWNISTNLMEAFDIFRDDIFKYRVVDIIELDMKKF
FT                   LEKQEDVLGPIVFYLEQVREDKNELVKRLYEIEANLKSLSRRNIDRFLNWAHYIIRPRL
FT                   AEDLKAEYDKIVARIKEGGAGKMGDFVSNVARLLDETKTKEFNMGIQQGIQQGIQQGIQ
FT                   QGIYRAKVEMAKKLIQKGYSDDEIAELTELEIDEIRKLRKELIP"
FT   gene            complement(513507..514271)
FT                   /locus_tag="Calhy_0466"
FT   CDS_pept        complement(513507..514271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0466"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /EC_number="2.1.1.36"
FT                   /note="KEGG: ate:Athe_2288 tRNA methyltransferase complex
FT                   GCD14 subunit; PFAM: tRNA methyltransferase complex GCD14
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06211"
FT                   /db_xref="GOA:E4QCB5"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCB5"
FT                   /inference="protein motif:PRIAM:2.1.1.36"
FT                   /protein_id="ADQ06211.1"
FT                   /translation="MEQSFDTKRVIIGPEGFKKVVDISVPKRVNLPTGYIESDKLAKIS
FT                   PGGSFFANDVEYYVFPCDTFDYVMHFLKRHTQIVYPKDGAYILMRLDIHPGKRVGEAGT
FT                   GSGAFTLYLSMAVGPEGKVYTYEQREEFYKMAEKNIKNFSKFENVVMHNKSIVEGIEEK
FT                   DLDAFFLDIREPEEAISAVREALKPAGHLGILVPTTNQVSEILTALQAHRFYVSEVVEI
FT                   MIRQYKPVPERLRPDDRMIGHTAYMIFARKIL"
FT   gene            complement(514345..514716)
FT                   /locus_tag="Calhy_0467"
FT   CDS_pept        complement(514345..514716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0467"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="KEGG: ate:Athe_2287 CBS domain containing protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06212"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCB6"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADQ06212.1"
FT                   /translation="MLSNIINHDFIKLLPTDTVKYALEQMQKRKKSVAVVVDENDFLKG
FT                   IIVKADIYRFLSQPGHFETYPVELAMTKAVITADKNDDIKDVAKLLRQHDISAVPVLDN
FT                   GKVVGLVGLEDIVDYFINM"
FT   gene            514916..515689
FT                   /locus_tag="Calhy_0468"
FT   CDS_pept        514916..515689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0468"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; KEGG: ate:Athe_2286
FT                   ATPase involved in chromosome partitioning-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06213"
FT                   /db_xref="GOA:E4QCB7"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCB7"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADQ06213.1"
FT                   /translation="MHPIPKNEFTDVKKMYTIVSGKGGVGKSLVTSLLAVGLRREGFEV
FT                   GILDADITGPSIPKMFGVSGAKIESDSKAIYPVRTHNDIRIMSMNLLLNKEDAPVIWRG
FT                   PLIAKTIEQFWTEVGWGVLDYLFIDMPPGTGDVALTVFQSLPIDGIIIVTSPQDLVSLI
FT                   VKKAYNMAKQMDIPIIGIVENMSYVICPHCGKEFDIFGKSKLEDVAEQLDLRILGRIPI
FT                   DSELTKLCDKGEIEKARNLYLDSCIEVLKRDVVEG"
FT   gene            515896..516120
FT                   /locus_tag="Calhy_0469"
FT   CDS_pept        515896..516120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06214"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCB8"
FT                   /inference="similar to AA sequence:KEGG:Csac_0221"
FT                   /protein_id="ADQ06214.1"
FT                   /translation="MPWGFEPGFYGRGCARGFGGGFGFGRGLGICKWLYLTGSENVPFA
FT                   KEALEYEKQVLEQRLKLIDKLLSKEQKQE"
FT   gene            516376..516828
FT                   /locus_tag="Calhy_0470"
FT   CDS_pept        516376..516828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0470"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   ate:Athe_2706 transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06215"
FT                   /db_xref="GOA:E4QCB9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCB9"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ADQ06215.1"
FT                   /translation="MINIWFRYTIKLVMTMKFDTNKHSVFLLYYHLILVTKYRRDVIDE
FT                   KISKRLKEIFEYIQPNYNITLVEWNHDKDHVHVLFKATPTTSLSKFINAYKSASSRLIK
FT                   KEFPEIRQKLWKEYFWSRSYCLLTSGGAPVEVIRKYIESQGEKRKC"
FT   gene            516822..517973
FT                   /locus_tag="Calhy_0471"
FT   CDS_pept        516822..517973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0471"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: csc:Csac_0189 IS605 family transposase OrfB;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: putative
FT                   transposase IS891/IS1136/IS1341 family; transposase IS605
FT                   OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06216"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCC0"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADQ06216.1"
FT                   /translation="MLKAYRYQIYPTKAQEEFFEKTFGCCRFVWNKMLEEKLEALKQGK
FT                   KVPRITPARYKKEYPFLKEVDSLALANVQLEQEKAFKDFLKNSKHFGMPKFKRKKDKQS
FT                   YTTNNQQTKSGNETIRVDFEKGILYLPKVKSGIKAVFHREFEGKIKSATVVKTKAGRYY
FT                   VSILVDVQDPRNKRENRNFENEVIKRENFICGIDTGLISFVTIANDTGISKIEYPKYLI
FT                   KAEKRLRRLHRQLSRKKKGSKNWEKARERLAKEYEYVKNSRDDFLHKLSRTIIDENQVV
FT                   VVESLNVKGLSKTRLSKHILDSSWSKFLKYLKYKADWYGRKVIEADRRFPSSKMCSRCG
FT                   YINKELKLKDRVWRCPKCGTVHDRDENAAKNLRNYGIFCISNK"
FT   gene            518082..518702
FT                   /pseudo
FT                   /locus_tag="Calhy_0472"
FT   gene            518724..519206
FT                   /locus_tag="Calhy_0473"
FT   CDS_pept        518724..519206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06217"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCC1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2283"
FT                   /protein_id="ADQ06217.1"
FT                   /translation="MSNYKKRNLKNNQICEMIIYYLKENNNFVKKQSLIRSLIKWASLS
FT                   TIYRGISRLEKKGLTVACDVDNDKYIAYIGSRPNKSLNLAFFVCDVCKQKFWLKLNDCA
FT                   LDKISRKIKKFYDFDSKFVLYEFRGVCRSCLLSKKSNSLNLKKEEINHENSSYANR"
FT   gene            519178..519576
FT                   /locus_tag="Calhy_0474"
FT   CDS_pept        519178..519576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0474"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: ate:Athe_2282 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06218"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCC2"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADQ06218.1"
FT                   /translation="MKIAVMLIGDKISPHFGGSEKVCIYTVENGAIVNKEYFDMPEHRA
FT                   GLFAKFIKQKGADVVIAGSIGERARYIFDNLGIRYFIGVLGHPDEAVEKLLKGQLKSNE
FT                   ALANEIHEHEEGLHHHSHGHSHEHHHIS"
FT   gene            519800..520222
FT                   /locus_tag="Calhy_0475"
FT   CDS_pept        519800..520222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0475"
FT                   /product="protein of unknown function DUF134"
FT                   /note="PFAM: protein of unknown function DUF134; KEGG:
FT                   ate:Athe_2281 protein of unknown function DUF134"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06219"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCC3"
FT                   /inference="protein motif:PFAM:PF02001"
FT                   /protein_id="ADQ06219.1"
FT                   /translation="MPRPIRCRRVEFLPRFNYFSPREGSNDEVLLKVEELEAIRLKDLE
FT                   GLIQEECAQKMQVSRQTFQLILEEARKKVADALVNGKAIRIEGGNYVFGNCKYTCLNCG
FT                   KVFESDKDECPECHSSHVVCHRGKGRGHCFRHHGGW"
FT   gene            520379..522838
FT                   /locus_tag="Calhy_0476"
FT   CDS_pept        520379..522838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0476"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: ate:Athe_2280 heavy metal translocating P-type
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; copper ion binding
FT                   protein; cadmium-translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC; PFAM:
FT                   E1-E2 ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06220"
FT                   /db_xref="GOA:E4QCC4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCC4"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADQ06220.1"
FT                   /translation="MEKKTLSVTGMTCASCARAIEKSVSKVEGVSNASVNFATEKLIVE
FT                   FDESKASIEKIKEAVERAGYGVLDDGEENIREVSIPISGMTCASCARAIEKSISKLNGI
FT                   KELSVNLASEKARVVYDSSQVRLSEIKNAIVKAGYTPLEIEKTSYEDSHQERKQKEINS
FT                   LFRRFVIASIFAVPLLLIAMAHVVGVPLPEIISPEKHPLNFALVQAILEIPIVIAGYKF
FT                   YTVGFSRLFKFHPNMDSLIAVGTGAAILYALFAIYQIAMGNYQYVKEMYFETAGVIIAL
FT                   VLLGKYLEAVSKGKASEAIKKLMGLAPKTAVVVQGDNEIVIPIEEVEVGDILLVKPGEK
FT                   IPVDGEVIEGRSFVDESMLTGESIPVEKTPGSKVIGATINKNGTLKIKATKVGKDTVIA
FT                   QIIKLVEDAQSSKAPIARLADVISGYFVPVVILIAVISATAWYFVDNSFIFALRIFITV
FT                   LVIACPCALGLATPTAIMVGTGKGAEHGILIKSGDALETLHKITMVVFDKTGTITEGKP
FT                   KVTDIIPANGWERERLLQIVASAERLSEHPLGEAIVAAAKEKNLQLFEASQFEAISGHG
FT                   IEAVVDGQTVLVGNIKLMKDKGIEIDFLLDVEKLSQQAKTPMFVVQNGKFAGIIAVSDV
FT                   IKQNSRRAIELLHSMGIKVAMITGDNSKTAKAIAKQVGIDRVLAEVLPQDKANEVKKLQ
FT                   GEGKKVAMVGDGINDAPALAQADVGIAIGSGTDVAIESADVVLMKNDILDVVNAILLSK
FT                   KTIQNIKQNLFWAFFYNTLGIPIAAGVLHIFGGPLLNPIIAALAMVFSSVSVVSNALRL
FT                   KRFKPVN"
FT   gene            522879..523088
FT                   /locus_tag="Calhy_0477"
FT   CDS_pept        522879..523088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0477"
FT                   /product="copper ion binding protein"
FT                   /note="KEGG: ate:Athe_2279 copper ion binding protein;
FT                   TIGRFAM: copper ion binding protein; PFAM: Heavy metal
FT                   transport/detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06221"
FT                   /db_xref="GOA:E4QCC5"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCC5"
FT                   /inference="protein motif:TFAM:TIGR00003"
FT                   /protein_id="ADQ06221.1"
FT                   /translation="MTKKIYIKGMTCDHCVRRVENSLKAIEGVSSVKVDLQGKVATVEL
FT                   SKDVKDEEFVRAIDDAGYEVARIE"
FT   gene            complement(523138..524217)
FT                   /locus_tag="Calhy_0478"
FT   CDS_pept        complement(523138..524217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0478"
FT                   /product="protein of unknown function DUF1646"
FT                   /note="PFAM: protein of unknown function DUF1646; KEGG:
FT                   csc:Csac_0228 cation transporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06222"
FT                   /db_xref="GOA:E4QCC6"
FT                   /db_xref="InterPro:IPR012443"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCC6"
FT                   /inference="protein motif:PFAM:PF07854"
FT                   /protein_id="ADQ06222.1"
FT                   /translation="MVDILLIIILLLVFILPFIFRKIEHNLELFLLVMGILATVVSKTL
FT                   SFHLLGHVFSNYLLYLVTAVVLVMGFVFNLTVSKLKTAINSILSRIKIEIFVSLVILFL
FT                   GLISSIITAIVATLILVEIIHLLPLKHQTKVKVAIIGCFSIGFGAALTPVGEPLSTIVV
FT                   SSLNAEFLYILKNLGMYIVPTIIILSLLSYFILLYERKRGCILPTYEELLTEEEDIVKA
FT                   EERAILDLEARKDVILRAGKIFMFIVALELLGNGFKPFIDKYVVKLGDKLLFWINVISA
FT                   ALDNATIAAAEITPSLSTGQVKAILLSLLASGGILIQGNIPNIIAANKLEIKSKEWVQL
FT                   GLPLGLILLLAFYLILFVV"
FT   gene            complement(524233..524652)
FT                   /locus_tag="Calhy_0479"
FT   CDS_pept        complement(524233..524652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0479"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: csc:Csac_0229 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06223"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCC7"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADQ06223.1"
FT                   /translation="MLNVDNKLPDLINFFKARDDIVAVWIVGSYGTKYQTENSDIDLAI
FT                   LFSKEISFFDELDLEVQISDILQTDKVDIINLNKAPLTLQFKAISEGREIIKKDPIKVA
FT                   DFEEVVLDLYQDHEYFYRKFHEELKERNHHESQYR"
FT   gene            524828..525148
FT                   /locus_tag="Calhy_0480"
FT   CDS_pept        524828..525148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06224"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCC8"
FT                   /inference="similar to AA sequence:KEGG:Csac_0230"
FT                   /protein_id="ADQ06224.1"
FT                   /translation="MISRKKMKIHIVESDVQNMEAKIELIKKYLETETKENLLSFVISL
FT                   LDALKDIPFDLFPARLKDILIEWAETAEICLDDELMDRLKEAEEEFKSGGGIKWEPPTS
FT                   SI"
FT   gene            525121..525357
FT                   /locus_tag="Calhy_0481"
FT   CDS_pept        525121..525357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0481"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="KEGG: ate:Athe_2275 addiction module toxin,
FT                   RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06225"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCC9"
FT                   /inference="similar to AA sequence:KEGG:Athe_2275"
FT                   /protein_id="ADQ06225.1"
FT                   /translation="MGTSNKFNIILSKNAYKYLQRLPQNIKKRIATILEEELSQDPFSS
FT                   SKIKPLHGKLEGFYRYKEGDLRIIYNSLLNKRD"
FT   gene            525454..526401
FT                   /locus_tag="Calhy_0482"
FT   CDS_pept        525454..526401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0482"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   csc:Csac_2323 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06226"
FT                   /db_xref="GOA:E4Q9D1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E4Q9D1"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADQ06226.1"
FT                   /translation="MSNFIKTQKQKFLKILMTIEKVIKALGLKIKSSRRGRPKKFKLSH
FT                   IIACFVYKVKNKINSFRELEYKINEDEEFKKAIGIEKSPDHSYFSKWAKVIEEGYIEGI
FT                   ARILVREIVPQTKVCAIDSTPLRSSRGDKEAEVGVCVSLGFYNGYKLHVLATVEDEVIP
FT                   IVWWLTRANIHDSKVVELLYEAKIFGPEVILADAGYDCAKWFEVADRLEIKFVAAVNKR
FT                   NSKDFSNVKNILRVKNMEFLRSEEGQRLYKQRTKIERLFGKLKGEYNLEQIRLRGFRTY
FT                   KRHVDWIMITYLIEVYIQKIENCKFSFKYTWNNL"
FT   gene            526828..528057
FT                   /locus_tag="Calhy_0483"
FT   CDS_pept        526828..528057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0483"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   KEGG: ate:Athe_2274 lysine 2,3-aminomutase YodO family
FT                   protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06227"
FT                   /db_xref="GOA:E4QCD1"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="InterPro:IPR030801"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCD1"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ADQ06227.1"
FT                   /translation="MEKLNVINNNERFEKLKEAIKDYLEVRDTIKTGIEDEEKIEYQKR
FT                   KILSYFGASEKDWGNYKWQLKNRITSAKILKDLLNLDEKEAQQIEQVGKIYRFAISPYY
FT                   LSLIDPNDPNCPIKRQSVPSSLELVEKGDLDPMDEEHTSPTKIVTQRYPDRLIIKVTNI
FT                   CGMFCRFCQRRRFIGETDTHASLDDITDAIEYVAQNPHIRDVLITGGDALMLSDEILEW
FT                   ILRSLRQIPHVEIIRIGTRAPVTLPQRITKDLVDMLKKYHPIYINTHFNHPREITKESK
FT                   RACEMLADSGIPLGNQMVLLNGVNNDKFVVRKLNQELLKIRVKPYYIFHPKRVKGTSHF
FT                   WVTIEEGMEIIESLRGRTSGMAVPTYIINAPKGKGKTPIMPNYLLYFGKDKVVFRNWEG
FT                   EVFEVENTSL"
FT   gene            complement(528138..529613)
FT                   /locus_tag="Calhy_0484"
FT   CDS_pept        complement(528138..529613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0484"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2268 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06228"
FT                   /db_xref="GOA:E4QCD2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCD2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ06228.1"
FT                   /translation="MAIMLKNISKKFDDFYALKDINLEFFEGQVNVILGKNGSGKTTLT
FT                   KIINGSTAPTNGKVLIDGKEFSSLNPMLAKSLGIFTVHQELLYFPHLSVAENIFIDNKP
FT                   KNKLGFVSYKAMIKHAAEILSKMGVYINPEALCKNMGQSQLQVIEICRALVQNAKVLIF
FT                   DEPTAGLTTYEIENLFKIIKELKEKGIVIIFVTNMVEEALSIADRVTILRDGEVVASDN
FT                   VTSFNLSKAISLIFGSVNRTYPKLKVEKGSTIFSVKNLTKRGIIENISFDVREGEIFGI
FT                   AGLVGSGRSFLAKALFGAEKLDSGEIYMNGNLLKLSSPADAIKNGIAFMSEDRIGTGLF
FT                   KTLNIADNIISSNIWNIANGFFVDSSRQEKIANLYIKKLGIKPKEITQKIAFLSGGNQQ
FT                   KVLIAKWLFSRSNVFILDEPTKGLDLASKVEVYNIINELARIGCAIIFISSDFSELIGM
FT                   CDRILVLHRGKAVHEFSKKEMDYDKILKTAMGI"
FT   gene            complement(529619..530398)
FT                   /locus_tag="Calhy_0485"
FT   CDS_pept        complement(529619..530398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0485"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: ate:Athe_2267 transcriptional regulator, DeoR
FT                   family; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06229"
FT                   /db_xref="GOA:E4QCD3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCD3"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADQ06229.1"
FT                   /translation="MLVAERLKKIKEILLQKKHIDVATLAELLNVSEVTIRRDLDRLES
FT                   EGFLIKTYGGAILKEEAAKILSPTISEDSEKEAIAKVCSYMIESNQAIILAGGNILRLV
FT                   PKYIKEKQNIIVLTNDLLLAIECGKLSIQTIVTGGYIVGNTFTLAGPMLVNPNMDIFVD
FT                   KAFIEVDGVSLERGFTVNNVEFANAYKYFKSIAKETIIVADSSKFDKISLFQIARVDEI
FT                   KKVISDTNVPDEYKSFFFENGTQIFCSFDFSDLEREV"
FT   gene            530688..532187
FT                   /locus_tag="Calhy_0486"
FT   CDS_pept        530688..532187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0486"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2266 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06230"
FT                   /db_xref="GOA:E4QCD4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCD4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ06230.1"
FT                   /translation="MKSSTDSELLRLHGITKIFPGTVALSDVSFSVNKAEIHAIVGENG
FT                   AGKSTLMNIISGSLLPDKGEIYLEGKKVNIRSPRDAQNLGISIVHQELALCPHLTVAEN
FT                   IYIGRLPEKSAKIVDFKKLNQMSQEVLSLFDEVNIKPTDKVANLNVAQQQIVEIAKAIT
FT                   FNCKLLILDEPTSALSEADAAVLFKIIKDLKAKGISILYISHRLREIFELADRITVLRD
FT                   GRYITTLNTAETNPDQVVSLMVGREIKEMYPPKSSKIGREVFRVENISSDKVQNVSFAL
FT                   HEGEILGFAGLVGSGRTELAQTICGILPKHCGEIYLEGKKIEINSFEDAIRHKIGYVTE
FT                   DRKQYGLFLKLPVAHNVSAIHLKYDYKRLLIDRQKELSLAQEFVKKLNVKTSSYVQLVM
FT                   SLSGGNQQKVMIAKWLAIKPRILILDEPTRGIDVGAKAEIHSLLRELAKNGIGIILISS
FT                   ELPEIIGMCDRVLVMREGRITGELSGSSITEENIMQLAAHK"
FT   gene            532216..533202
FT                   /locus_tag="Calhy_0487"
FT   CDS_pept        532216..533202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0487"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ate:Athe_2265 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06231"
FT                   /db_xref="GOA:E4QCD5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCD5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADQ06231.1"
FT                   /translation="MSTLSSNQAANKSFLKKVMGFREITLIFIIIVISAIISVLSPNFL
FT                   TAENLITTALGLAADGILAIGMTVVLVSGGVDLSVGSVLGLSAVIAGGLYLSYGVNIWI
FT                   GSLIALVICALIGLFNGYFIARIGIPPLIVTLAMMGIARGAAYVLTQGSPLSLYGNLKG
FT                   FDFLGQGKVLGIPFFILFFIILIILFDFLMRKSAPFRLVYYVGSNENAAKLSGINVPKV
FT                   KISVYVLMSVLAGIAGIFTLSRFSVAAPTAGNGSELNAISACVIGGASLAGGEGTVLGA
FT                   ILGTILVGIINNALVLLNVSVYWQNLVSGVILIAAVTIDYLTHQKKS"
FT   gene            533317..534354
FT                   /locus_tag="Calhy_0488"
FT   CDS_pept        533317..534354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0488"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ate:Athe_2264 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06232"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCD6"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADQ06232.1"
FT                   /translation="MKKNFYKYLSIFLAVALIVSLAYALVPSSKDVTQASSGNPKLKGS
FT                   PKEEYYMVTFVSGIEYWKGCFKGMKAAADLYGVKAIYTGAPQFDVNQEVTVLRQVIAKK
FT                   PAGILVTCANPDALKAPIDEAIKKGIPVITFDADSPKSNRYSVLETGNYNAGAMAARYL
FT                   GKLLGGKGEVGISTVAAQLNHEQRKQGFIDTLKKEFPGIKVVAIVNDENDQTKAARQIS
FT                   AMLQAHPNIKGIFCTDALGGVGAATAIKEANKVGKVKIVSFDTDKGTLDLIKQGIIDAS
FT                   IAQGTWNMGFWGMTFLFYLKHGIVNPVDNWQKYGINPLPPYVDTGTMVVTKQNVDAFYK
FT                   VNVIK"
FT   sig_peptide     533317..533391
FT                   /locus_tag="Calhy_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.947 at
FT                   residue 25"
FT   gene            534484..534786
FT                   /locus_tag="Calhy_0489"
FT   CDS_pept        534484..534786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE2030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06233"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCD7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06233.1"
FT                   /translation="MIRYVKIKILFYYKKSYNKSEVKTVVRVMNNLLRNKLKEIVDSLH
FT                   EEELTEVINFIEYLKFKEEKEENEILNDVELMESIKRGLKDIENGDVYDFEDVFE"
FT   gene            534852..535033
FT                   /pseudo
FT                   /locus_tag="Calhy_0490"
FT   gene            535135..536190
FT                   /locus_tag="Calhy_0491"
FT   CDS_pept        535135..536190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0491"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: pjd:Pjdr2_1659 transcriptional regulator, LacI
FT                   family; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06234"
FT                   /db_xref="GOA:E4QCD8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCD8"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADQ06234.1"
FT                   /translation="MATIKDIAKKANVSPATVSYVLNNSAQISPETRERVLKAAQELNY
FT                   QPNNLAKSLRKKKSMTIGVIAEDITVFSAPEIIDGINRYLEEKGYHIILNNLRLVKKVG
FT                   NNYSKVIEHLEEIKKSIEVLLTRQVEGMIYIGFHMRDVAPFIKGIKIPIVCTYCYSSLG
FT                   HISVNCDDYQGAYEVTKYLLENGHRKIGLITGPNDSLPSQERLKGFKDALSDFGVKLDN
FT                   KLIRVGNWEYESGYENTMSILKENREVTAIFAMNDLMACGVMDAAKELGIKVPDQLSVV
FT                   GFDDREFSYFHDPKLTTVKMPLDKMGEEAAKLILECISGDKLICTEDEKEIRNLKLKCT
FT                   VIERKSVKKVL"
FT   gene            536433..537695
FT                   /locus_tag="Calhy_0492"
FT   CDS_pept        536433..537695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0492"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tle:Tlet_1140 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06235"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCD9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ06235.1"
FT                   /translation="MKKFERFIAVLVVFALALTLFVAFRPSEAISSSKKVTISTSMWGD
FT                   INAKYDFIAAFEKKYPNIKVNVIKAPENYSEKLQAMIAANKAPDVPLVWECDIGRFAKN
FT                   GVIIPLDPYIKKTKAFTMNDFIPAFAKLTKMQGAVYGLPWCFATEIMYYNKTLFDKAKV
FT                   PYPTDKWTWDDVLNAAKKLTIVKGGKTIQWGIDYPRFVGIWYALIGAAGDDVADEKGNV
FT                   ALGKGVKIAVQWVYDLVNKYKVMPAPSTSMGVTDLFASGKAAMAFTGSWMISTYRDIKD
FT                   FKWDIAPLPKKVRQYSNLHTGFYTISKTSKYKEESWKFIEFMLSEEGQKILSQGYNNPS
FT                   ARKSLMAKGYYKVAGPNGPTNWKAMDDTAQFAQLGYVLLPPGGTDKFVKRLESAVAKQV
FT                   LIDQAINEGIKELKEITASYK"
FT   sig_peptide     536433..536522
FT                   /locus_tag="Calhy_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.682 at
FT                   residue 30"
FT   gene            537807..538709
FT                   /locus_tag="Calhy_0493"
FT   CDS_pept        537807..538709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0493"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: str:Sterm_0718
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06236"
FT                   /db_xref="GOA:E4QCE0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCE0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ06236.1"
FT                   /translation="MKSNKELKENLTAYLFLLPWIIGFILFTGGPIIYAFVLGFMKWDL
FT                   VSKPIFVGIENFKNLLVNNQSFYNSLKVTLIYTLFAVIFTNLWALFLAVLLNQRVRLIG
FT                   IFQFFYFIPAVLPTVALAFVFQIMLDKEVGVLNYLLSLIGITNGPNWLMDSKWVIPTLI
FT                   ALSIYTYSSGQMMLIYNSALKEVPKELYEAFEIDGGNAFQRFIHVTLPSISPIILFNLV
FT                   VSTIAILNNSFTFIYPLTGGGPNEVTNVLSLDIYRNAFQLFRMGYAAAEGVILFIIVAL
FT                   LTLAQFVLSKKWVYYESEG"
FT   gene            538715..539551
FT                   /locus_tag="Calhy_0494"
FT   CDS_pept        538715..539551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0494"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ttr:Tter_2216
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06237"
FT                   /db_xref="GOA:E4QCE1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCE1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ06237.1"
FT                   /translation="MKRQNLIANILIYMLMLLIAIIMFFPIMWIISSSFKTLTSITSYP
FT                   PKLIPKEPQLSNYIEVLTRRNALIYLRNTLILIVGNTVGTLISSSLVAYPLARMKFKGK
FT                   RIVFSLILATMMVPSAVTIIPQFILFRYLNWIDTLYPLFVPAFFAYPYNVFLFRQFFLT
FT                   IPKELDEAAMIDGCSRFKIFYKILVPLAKPIFITIGILSSIYWWNELFTPLIYINSEHL
FT                   KPLTTALISFKAEGQFVTQWNLVMAMATLMIIPPMILYMLGQRYLVEGIKMSGLKG"
FT   sig_peptide     538715..538825
FT                   /locus_tag="Calhy_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.648) with cleavage site probability 0.351 at
FT                   residue 37"
FT   gene            539578..541548
FT                   /locus_tag="Calhy_0495"
FT   CDS_pept        539578..541548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0495"
FT                   /product="protein of unknown function DUF1680"
FT                   /note="PFAM: protein of unknown function DUF1680; KEGG:
FT                   ate:Athe_2242 protein of unknown function DUF1680"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06238"
FT                   /db_xref="GOA:E4QCE2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCE2"
FT                   /inference="protein motif:PFAM:PF07944"
FT                   /protein_id="ADQ06238.1"
FT                   /translation="MQQEMSFLKLLNVPKIRDIKINSDFWNRYINLIKEVVVPYQWDIL
FT                   NDKVDGVEKSSAIRNFKIAAGLEQGDFYGMVFQDSDVYKWLEAASYVLESHYDEELDRK
FT                   INEVIDLIEKAQWDDGYINTYFTIKEPQNRWTNLQECHELYCAGHLIEAAVAYYNATGN
FT                   DRLLNIAKKFVDHINSIFGPEEGKLKGYPGHQEIELALIKLYEVTKEEGYLNLARYFIE
FT                   ERGKDPYYFDLEWEKRGRTEHWPGLIRNFGREYAQTHLPVRKQREAVGHAVRATYMYSA
FT                   MADIARITKDEELLDTCKALFKDIVTRKMYITGGIGASAYAESFSFEYDLPNDRAYAET
FT                   CASVGLIFFAHRMFLIEQSSHYYDIIEQTLYNNIIASMSLDGRSYFYVNPLEVVPRACE
FT                   KRHDTQHVKVPRQRWFGCACCPPNVARLLSSIGKYVYAHSANELYVNLYISNEYELNMN
FT                   GDEVKIYINSEYPFGDNVFIKIDTKKPVYFDLKLRIPKWCESFKVYINDREEGKIVKEK
FT                   GYIVLSRIWNGNDEILLKLTTLPKKIRSHPRVRDNIGKITIMKGPILYCLEEADNGPNL
FT                   HELFISKDSKLELKFEPEILNGLYVIYADGFRIDEEDFGDELYRDEYEYKLLPVKLKFI
FT                   PYYAWANRGKGEMRVWISEIR"
FT   gene            complement(541762..543141)
FT                   /locus_tag="Calhy_0496"
FT   CDS_pept        complement(541762..543141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0496"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /note="KEGG: ate:Athe_0644 glutamate synthase (NADPH),
FT                   homotetrameric; TIGRFAM: glutamate synthase (NADPH),
FT                   homotetrameric; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06239"
FT                   /db_xref="GOA:E4QCE3"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCE3"
FT                   /inference="protein motif:TFAM:TIGR01316"
FT                   /protein_id="ADQ06239.1"
FT                   /translation="MEVLKRVSIKEQEPEKRVNNFDEVCLGYSSDEAVQEALRCLECKN
FT                   APCIKGCPVEVKIPEFIRLIKEKKFKESYLKILETNLLPAICGRVCPQETQCEKNCVRG
FT                   IKGEPIAIGKLERFVADWFRQNCEFEFEKPESNGKKVAIIGSGPAGLSCASSLAKLGYE
FT                   VVIFEAFHKLGGVLYYGIPEFRLPKEVVEWEIENLKKMGVEFRTNMVFGKTFDLEDLKQ
FT                   EGFEAVFISSGAGLPNFLNIEGELLNGIYSANEFLTRVNLMKAYKFPEYDTPIKLGKKV
FT                   GVIGGGNVAMDAARVARRLGSEVYILYRRTEAEMPARKEEIDHAKEEGIKILELVSPVR
FT                   FMGDETGHVRALELVKMQLSQPDSSGRRSVKPIDGSNFIFEADNFIVAIGQSPNPLVKK
FT                   AIPELELNPNGSIKVNENLMTNVEGVFAGGDIVTGAATVILAMGMGKKAAENIDKYIMC
FT                   S"
FT   gene            complement(543147..543989)
FT                   /locus_tag="Calhy_0497"
FT   CDS_pept        complement(543147..543989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0497"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulphur cluster binding domain; KEGG:
FT                   ate:Athe_0645 oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06240"
FT                   /db_xref="GOA:E4QCE4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCE4"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADQ06240.1"
FT                   /translation="MNEIVIKQNIVPNVWLMGIYSPQVAKKAKPGQFVILRVTETGERI
FT                   PLTIADFDSDKGIVFIIFQVVGKTTSILSTLNIGDSIADFVGPLGMPYEQDSNDKSYLF
FT                   IAGGLGIPAIYSKVKMLHSQGKDIEIIVGGRSKENIFFEEELRKYCSSLYISTNDGSYG
FT                   QKGLVTDILTQLLENGKRYDEIFAVGPVLMMKAVVDITKKYGIKTLVSLNPIMVDGTGM
FT                   CGGCRVKIGNEIKFACVDGPIFNGFEVDFDGLMKRNSYYQDLENLSYKEHKCKIGLGE"
FT   gene            544743..546029
FT                   /locus_tag="Calhy_0498"
FT   CDS_pept        544743..546029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06241"
FT                   /db_xref="GOA:E4QCE5"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCE5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1977"
FT                   /protein_id="ADQ06241.1"
FT                   /translation="MAIIGDYTEIIKMLNEVKLPKFVKVRQVFEAPVINNISEVLINEL
FT                   NKEKIKKMLKPKMKIALAVGSRGIANLASIVKTTVDFLKSCDTEPFIIPAMGSHGGATA
FT                   EGQKRVLAEYGITEQTIGVPIKSSMEVEQIGTVDGTPVYVDKFALSADGVILINRIKPH
FT                   TAFRGIIESGLIKMSVIGLGKQKGAESCHQLSMKDFDKRLIEMSKVIFSKVKILFGIAI
FT                   IENAYDQTAEIHAIPSSEILEVEPKLLIKAKSLMPKILFNPLDILIVDELGKDISGDGM
FT                   DPNVTGRFSTRYAKGDLEVERIVVLRLTEKTEGNANGIGAADITTLKVFENMNMAKTYI
FT                   NAITAAFPPTVRIPMVMPNDEYAIKCAAKTSYCLDYEKLRIVRIKNTLQVGEIYISESL
FT                   LPEARKNPQIEILSEPEPLKFDEEGNLIL"
FT   gene            546067..546825
FT                   /locus_tag="Calhy_0499"
FT   CDS_pept        546067..546825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0499"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: tpd:Teth39_1975 IclR family transcriptional
FT                   regulator; PFAM: Transcriptional regulator IclR ;
FT                   regulatory protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06242"
FT                   /db_xref="GOA:E4QCE6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCE6"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ADQ06242.1"
FT                   /translation="MSNIQVLERAINILELLGEKPKGIGISEISRELNLPKSTVHRILD
FT                   TLLQKGYVEKNMENDKYKLGLRIVELSNKILSNMELRNEAHPYLEELMNYSNEVVHLCV
FT                   LRDGEMVYIDKVECPNPIRLYSQIGRRVPVHCTAVGKATLAFLPREEVISILQRKGMSR
FT                   RTKNTITDMQKLLNQLEEIRELGYAVDDVENEEGVRGIGAPVFNYTGRVVAAISIAGPV
FT                   SRITKERIPDLAEKLKETAQKISERLGYFK"
FT   gene            546944..547705
FT                   /locus_tag="Calhy_0500"
FT   CDS_pept        546944..547705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0500"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="KEGG: tpd:Teth39_1973
FT                   5-carboxymethyl-2-hydroxymuconate delta-isomerase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06243"
FT                   /db_xref="GOA:E4QCE7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCE7"
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /protein_id="ADQ06243.1"
FT                   /translation="MNLFCRFEKDNKINYGIVKDNIVQSIEGNIFGDWKVGNESYLLGE
FT                   VKLLPPVEPSKIVCVGLNYHSTIKRLNAAVPEEPVIFLKPPSAIIGDGDNIIFPSDVKE
FT                   LGYEVELAVIIKDKIKSVNYNEALKHVFGYTIANDLTAKDKMTGGPWTKAKSYDTFLPL
FT                   GPWIATDLDPNNAKLEMYINGNMTQNGNTSDMVFDVAYLISYISKIMTLCPGDVIITGT
FT                   PPGAGLLNPGDYVEAKIEGIGVLRNYVVKEC"
FT   gene            547709..548659
FT                   /locus_tag="Calhy_0501"
FT   CDS_pept        547709..548659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0501"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: tpd:Teth39_1972
FT                   ribokinase-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06244"
FT                   /db_xref="GOA:E4QCE8"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCE8"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADQ06244.1"
FT                   /translation="MLDVVTIGEAMVVFNPTASGPLRYVNNFVKKVGGAEANFAIGIVR
FT                   LGHKAGWISKLGNDEFGKCILSVIRGEGVDTSQVKFDPEAPTGIYFKEIREYGETKVYY
FT                   YRRGSAASRLTPEDLDPDYIGSAKYLHVTGITPALSESCYLTIKEAIKIAKSRGVKISL
FT                   DPNIRLKLWSKEQARRVIMELAEQADIVLPGITEGEILVGEKNPENIAKKFLDLGVSIV
FT                   VVKLGEKGAYYATKDESGYVSGFPIEKVVDPIGAGDGFAAGFIAGLLKNYSLKEAVKLA
FT                   NAVGAIATTVIGDFEGLPTMEEVEAFMGIREDVSR"
FT   gene            548855..549853
FT                   /locus_tag="Calhy_0502"
FT   CDS_pept        548855..549853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0502"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: tpd:Teth39_1970 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06245"
FT                   /db_xref="GOA:E4QCE9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCE9"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADQ06245.1"
FT                   /translation="MTQLKVVVTDFEYSDLRYEEEVFNSAGITLIPAQCRTEDELITVC
FT                   KEADGLLSQYAQITRRVIESLPKCKVIGRYGVGVNTIDIEAATEKGICVVNVPDYCMDE
FT                   VSDHALALILTLARKIVLLNNSVKKGIWDYKISKPIYRLRGKVLGLVGFGRIPRTLAQK
FT                   AKSIGFNILVYDPYISPNDAEAYGAKLVSLDELMTQSDFISIHVPLNKETYHLIGPQEL
FT                   KLMKPTAFLINTARGPVIDEKALIEVLLEKRIAGAALDVTEVEPIQSDNPLLKMDNVII
FT                   TPHVAWYSEEAEAELRTKAAQGIADVLLGYWPRYLVNKEVMSKINLKEKEN"
FT   gene            549882..549995
FT                   /locus_tag="Calhy_0503"
FT   CDS_pept        549882..549995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06246"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06246.1"
FT                   /translation="MLHKRELFDRIIEEILQSYIQYAKIIIESKINVNLFY"
FT   gene            550030..550848
FT                   /locus_tag="Calhy_0504"
FT   CDS_pept        550030..550848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0504"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pmo:Pmob_0444 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06247"
FT                   /db_xref="GOA:E4QCF1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCF1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADQ06247.1"
FT                   /translation="MDIEKELKDKVVVITGGGGILCSEMAKAFAKYKSKVAVLDLYKEK
FT                   TEKVVEEIKNNGGQAIGIGANVLDKESLEKAKEIILDTFGTVDILINGAGGNHESATTS
FT                   SEKTFFDLNIDDISKVFNLNFLGTVLPSQIFGKIMAEKKKGIIINISSMAAIRPLTRTI
FT                   AYSAAKAAVSNFTQWLAVYMNQEYSPHIRVNAIAPGFIITDQNRYLLIDKETGDLTQRG
FT                   RNVINATPMGRFGMPSDLIGIVLFLCSESASFINGAIIPVDGAFSAYSGV"
FT   gene            551191..552219
FT                   /locus_tag="Calhy_0505"
FT   CDS_pept        551191..552219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0505"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="KEGG: dtu:Dtur_1774 TRAP dicarboxylate
FT                   transporter-DctP subunit; TIGRFAM: TRAP dicarboxylate
FT                   transporter, DctP subunit; PFAM: Extracellular
FT                   solute-binding protein, family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06248"
FT                   /db_xref="GOA:E4QCF2"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCF2"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ADQ06248.1"
FT                   /translation="MKKIRVISLITAILFAIAISVSWIGFENSKAQSKAQSKAKYVIKL
FT                   NHVLAPTEPYHQGFLKWAANVKKRTNGAVEIQVFPSAQLGVEEDIIEQIRQGANIAQNT
FT                   DAARLGMYVPQIAVMNAPYFLDSIEEVQKLKNLSLVKKWLKELEDKFGIKVISFSWVQG
FT                   FRHMLTNKPIRTPKDLKGLRIRTPGAPIWQESIRALGATPVAMNFGDVYMGIQQKAIDG
FT                   AELVYRNITGNKLYEVAKYVSETKHILLINFIIMSKKYFDKLPPAYQKILIEECDKAGI
FT                   ETSKLMEQEIAKIKQELKAKGVTIVENVNISEFKKLGENAYRKLNLLTVRNQIYRELGK
FT                   KY"
FT   sig_peptide     551191..551286
FT                   /locus_tag="Calhy_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.811) with cleavage site probability 0.358 at
FT                   residue 32"
FT   gene            552288..552749
FT                   /locus_tag="Calhy_0506"
FT   CDS_pept        552288..552749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0506"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: trq:TRQ2_0610 tripartite
FT                   ATP-independent periplasmic transporter DctQ"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06249"
FT                   /db_xref="GOA:E4QCF3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCF3"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ADQ06249.1"
FT                   /translation="MKKIDEIVFRCEKILAQILIISMSAAVFLAAIARTIGRPIQWGID
FT                   LATFLFAWCVFISGDVALRENKLMNVDFLLKKLPYNVRKWIEVFNYVIILIFLLTLIVF
FT                   GFYLSYTTRYRTFQGIPNFSYTWVTISVPIGSLLMVRTVVLKIKNLLKN"
FT   gene            552781..554064
FT                   /locus_tag="Calhy_0507"
FT   CDS_pept        552781..554064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0507"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="KEGG: trq:TRQ2_0609 TRAP dicarboxylate transporter,
FT                   DctM subunit; TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06250"
FT                   /db_xref="GOA:E4QCF4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCF4"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ADQ06250.1"
FT                   /translation="MIYAIIAFFLFLILGMPIAFVLGISGLIYFLLNSSELSLTVPVQL
FT                   SVSQTQNFSLLAIPLFVLSGNLLNESGITKRLLHLASVLAGRLPAGLAQANIVLATLMG
FT                   GITGSAIADASMQARVLGEPMVEKKYSRGFVASVLAFASLIVIAIPPGIGLVLYGTIAE
FT                   VSVGRLFAAGIVPGLLFAIIFMIITAIIGKKRGYKPEKDKVTFGEVIHTLIRCIWAFLF
FT                   PFLLIFGLRMGLFTPSEVGAFAVVYAILVGILAYRELSFKKFMEATEKTIGDIGMVMLI
FT                   LIFSTIFGYGFTWEMIPQKMAEALLHFTSSPTIIMLIMMFMLFILGMFVDSTALILLLT
FT                   PILAPVARAVGADMVHFGLILVFSAATGLITPPVGAVMYIVCSVLKCSVGEYIKEGWPF
FT                   MLAVILVLLLILFVPNTVLIIPNAIFGK"
FT   gene            554090..554857
FT                   /locus_tag="Calhy_0508"
FT   CDS_pept        554090..554857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0508"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   dtu:Dtur_1771 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06251"
FT                   /db_xref="GOA:E4QCF5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCF5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADQ06251.1"
FT                   /translation="MNFKDKVVLITGATSGIGRTTAVLYAKYGAKVAVNGRELNKDKNG
FT                   ETTIDEIRKIGGECIFIQGDVSKNDDAQRIVMETVEKYGKIDILVNNAGIVLPGRVDNM
FT                   SEEDFDKTMAVNVKGAFLVSKYAVLQMKKQGKGVIVNVASVAALKGHTDRSAYSASKGA
FT                   IVSLTKAMAADYVKDNIRVNCVCPGTTLTPAVEEKIVNAPDPEAMRAAFIARQPMGRLG
FT                   RPEEIAFAILFASCDEAEFMNGSIIVIDGGMTI"
FT   gene            complement(554940..555653)
FT                   /pseudo
FT                   /locus_tag="Calhy_0509"
FT   gene            555938..557221
FT                   /locus_tag="Calhy_0510"
FT   CDS_pept        555938..557221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0510"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: ate:Athe_2262 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06252"
FT                   /db_xref="GOA:E4QCF6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCF6"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADQ06252.1"
FT                   /translation="MKEKLYEFRDPVHGFIYVRPLELKIIDSSPFQRLRNIKQLAFSHY
FT                   IYHGAEHSRFGHSLGVMHLVTKAFNTVAEKTQAFDEAKRKWYTQILRIIALVHDLGHAP
FT                   FSHASEELFPEGCTHEDYTCLIVTQTEISDFIKEIGEEFKKNYGDEYDITPELICSIYK
FT                   GENIENPDFIFLKKFMDSELDCDKMDYLLRDSLYCGVNYGRFDIERLINTLTVWEDEDH
FT                   MLYLAIEKGGMHAFEEFVLARYFMFTQVYFHKTRRFLDNALFNFLKEVLPNGQYPKDVY
FT                   DFLNYDDMYIFQLMKDNIRQNKWAERILKRKIMSKVYETPEHAEKREQDIFNFIKNELS
FT                   ERIGKENLLLDSADKLIHQMPIRYEVDSEKAIPLIDDIEEKPIPVSIASEVIRKMTEPI
FT                   NIKRIYVTEDKKDEAINIVSGILRKMSR"
FT   gene            557245..557793
FT                   /locus_tag="Calhy_0511"
FT   CDS_pept        557245..557793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06253"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCF7"
FT                   /inference="similar to AA sequence:KEGG:Athe_2261"
FT                   /protein_id="ADQ06253.1"
FT                   /translation="MVDSQKLLKLFDLINEVSDFCTQSGNKVGKKLIQKIVYLLQRKGI
FT                   DFGYTFSIHYYGPYSSQLEFDIHRMELNGLINIESDGYTHKIIPVENRKDVLNSKETLN
FT                   NKELIKSLCNFTARELELIATVDYVISQMKLDKLDNKTEKILIERIFKLKGNKYSEEEI
FT                   KNAIEFLIKYNFLKPDKIQ"
FT   gene            557922..558596
FT                   /locus_tag="Calhy_0512"
FT   CDS_pept        557922..558596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06254"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCF8"
FT                   /inference="similar to AA sequence:KEGG:Csac_0697"
FT                   /protein_id="ADQ06254.1"
FT                   /translation="MPQGLPWLADNSCPYKMRAGVFCFIKEFKAFLKALGGWTLDIVYF
FT                   EMIENFKEDKCIVCHLKNKAMDKFFDDFLYESVNDYNLRDKIRKGGICPKHARKLESLG
FT                   DVLAHAIIYSDLLSNSRNRDSTEILPCKRKTQRQQNMCIFCEKEQGFEDTYTRAFSHFF
FT                   ATQPQFKSAFAERGFMCQRHLNQVLEKTASVSVQKELLSVMGAKIVYLIAPAHNIFDFM
FT                   YV"
FT   gene            558689..561103
FT                   /locus_tag="Calhy_0513"
FT   CDS_pept        558689..561103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06255"
FT                   /db_xref="GOA:E4QCF9"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCF9"
FT                   /inference="similar to AA sequence:KEGG:Csac_0698"
FT                   /protein_id="ADQ06255.1"
FT                   /translation="MRKRLVVVLFIFLFLLIGKSITYANNSIEITNIEYGIDNKVNLYN
FT                   LIELKITLQNKSQDYFKGKISVEWWEPKNDAFATPVASRPKEKKFSFSKEFELAANSKK
FT                   SIILPMCFGDMIYSATYVKIYNSKGDVILNKQIVPPKKGYNLSIGLLSDQKDKVKYLIK
FT                   PSQQATSSITVVLLDSSNFPITSSLLERFDTIIIHNYKTSNLSADQYRALKNYIIRGGK
FT                   LIIFLGENYQKNLSIFKDNFLEGKIMGIKKGDISLNIDEQQLNYTSVVVDKENSEDIVL
FT                   NDTRFVDFVLKDGEKISQLHIQRKIIGNGVVLVTSFDPFELDIPAEKRDKLLGFLLQSC
FT                   YSEYSKLFQGIITNSTSYSYSLGVSNSIYNLAVNVKWPQNGLIIILIVIYIFIISFGNY
FT                   LILKKFNRRHLTWQFILFGSIVWTGVIFGVANVYKIKQPSITETNFIVYNTDRKGYIVN
FT                   KYYQIFTPLKSSFEVEATDSQKIEPLVKSFKAFVVNLDYANDFEYYPWEKIIFKNVPAF
FT                   SVKFVRDLETYELPSPLVEMKLNLKDILKPSVEIENKSNYEINHLFVFLSNNMAYVENL
FT                   KPYAKVVKSFSNIGTDIANGIRNQLYNFNKNRQLNYMYINRLVDLCITSIPENNYSTFY
FT                   AIGYIKNFNDLQLKVNSKLVKTRGEAIFRVDIKPTWLVDGKMVIPYGIIVPVIIKNTFQ
FT                   NSTSYGPGVQVSYYGKGEIEIEYNVASVLEDVKKVSVRNDSLYGRNNVNEFIYNFKSKK
FT                   WDRVDLSKAILISESDFGKYLYRGKLRIKVVGFDNSSVATIPLISVEGGGK"
FT   gene            561106..562038
FT                   /locus_tag="Calhy_0514"
FT   CDS_pept        561106..562038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0514"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: csc:Csac_0699 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06256"
FT                   /db_xref="GOA:E4QCG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCG0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ06256.1"
FT                   /translation="MPLLEIEGLTKFYGKKKAVDNLSFSVEEGQIFGFVGPNGAGKTTT
FT                   MKIMCGLLRADGGCVKINGMDISKNLSKVKSLIGYMPDFFGVYDNLKVNEYLEFFAHAY
FT                   RIKGTKAQKMIDDLLELVRLTDKKYDFVDSLSRGMKQRLCLARCLIHNPLLLVLDEPAS
FT                   GMDPQSRIEMKEILKNLKDMGKTIIISSHILPELSELCTHVGIINQGRMVAQGDIAQIT
FT                   MLAHGTKRIKVRFVEDFKEALTVFKEFPAVSNVQVIENGYILSFDGDDNDMFLLIKGLI
FT                   DRGARVCEVGLVEGSLEEAFMKAIQAVEN"
FT   gene            562070..562969
FT                   /locus_tag="Calhy_0515"
FT   CDS_pept        562070..562969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0515"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: csc:Csac_0700
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06257"
FT                   /db_xref="GOA:E4QCG1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCG1"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADQ06257.1"
FT                   /translation="MQRVNKFLNSIFANPIVTKEIKQRTRSMKFALTLAGWLLLITVFS
FT                   FIFLKNFAKEFVEVEIYKTNAIGFQTFLIILLTAFFGMLMVILTSQAIAKERENQTLDI
FT                   LLSTTMSNFEIVIGKMIAAAGEVIILFFATFPVYALLYLYGLMKFQDILGMFVYIFVLI
FT                   LFYGSLGLLMSTVLKKSIGATVVVIVVVVVIVLISYISVVALSDVISTLPSQPPRKADL
FT                   IKLLLTSLSPLFALVEYIFTQIGRSDLFFTYSYKVKGYQVHFLLCLIGTFINIALSSYF
FT                   LNPLRRGFFRKDTRAKGV"
FT   sig_peptide     562070..562231
FT                   /locus_tag="Calhy_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.747) with cleavage site probability 0.721 at
FT                   residue 54"
FT   gene            562972..564459
FT                   /locus_tag="Calhy_0516"
FT   CDS_pept        562972..564459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06258"
FT                   /db_xref="GOA:E4QCG2"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCG2"
FT                   /inference="similar to AA sequence:KEGG:Csac_0701"
FT                   /protein_id="ADQ06258.1"
FT                   /translation="MKDGGDLILEFLKRVQKRQMFCIFLSKLWIFVVICSVQNLIIEFL
FT                   SRKVPVYFKWHFQIGISIFLFLGYLIYIIKSKPSLEKTALLIDSFGFKEIITTSLELID
FT                   SCDEISKYVKSSAAHIIRNIDLRKVIKPQLDVRKWTAALFVVLSFTVILSIPNPKMKEA
FT                   ERLHVFNVEKKNEINKIEGVKKEVFKNLKLNGLEKRKIDEIIMKMKKEIKIAKSKGEMN
FT                   LAKQKAWFLLENLKKENLKASVLVSAATRLQDYITKGKDAGKKRNEYVALQNSSAKNNS
FT                   KDSNSSLLNGQDTTWKDSSNKKDSTGNSKTKARSTEETAESSASSSSFSQNQDSSTSSE
FT                   QSSFKGQQDSNKSGANTEGQGSKESSSENSTSNGQSNNNLPEGSGSQIQTNNTVNMGSG
FT                   LGAAIPPTSSLVSPPQIFTKNLHDIEASNQAVLNTGKESGKLVQKEGVGERGQKLNFNS
FT                   VFSEYKKEANEYLETDEVPAWAKEITKRYFESLENSR"
FT   gene            564461..565444
FT                   /locus_tag="Calhy_0517"
FT   CDS_pept        564461..565444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0517"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="KEGG: csc:Csac_0702 ATPase; PFAM: ATPase associated
FT                   with various cellular activities AAA_3; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06259"
FT                   /db_xref="GOA:E4QCG3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCG3"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADQ06259.1"
FT                   /translation="MDLILQNIEYTMEVLNKIEGEITKVIIGQKDIIRKVLIAIFCGGN
FT                   VLLEGLPGVGKTHLVKSIAKVLNLKFSRIQFTPDLMPSDIVGTNIISKDKDGFLNFTFQ
FT                   KGPIFANIILADEINRATPKTQSALLEAMQEKTVTVMGTTYKLDEPFFVLATQNPLEQE
FT                   GTYPLPEAQQDRFMFKVDVPLPSFDEMIEIVNLTTESQMPEPNKIIEAQEIIQIGEIIR
FT                   KVPIARPVLEYAARLVMSTQPHIDQNEIAKKYLRFGAGPRALQHIVLGAKANALFEGRP
FT                   NVAFDDIKSLAKSVLCHRIGLNFEAISEGKKPADIVEEILQSLKEW"
FT   gene            565438..566337
FT                   /locus_tag="Calhy_0518"
FT   CDS_pept        565438..566337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06260"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCG4"
FT                   /inference="similar to AA sequence:KEGG:Csac_0703"
FT                   /protein_id="ADQ06260.1"
FT                   /translation="MVKKVISKSGDILMFGGLVDDKLLASISNLKFKFNISITSQFEGQ
FT                   QKAKGRGNSLEFSDHREYIPGDDFRKVNFKIYAATQRLYVKLFEQERQTTYNFFIDMSK
FT                   SMDFGSSTKKGDMAKALVACLCYIALSQLDGVNIFLIKEDHILHSGHFKSKQSFAKIVK
FT                   FLEDAQFEGLANFDNIKNVFIPRKSISFIFSDFLFEGAENVLKILLRKSSFVYCCQVLD
FT                   KLEAFPQFDYSFCELIDSESNKKVNIEISDALIKQYKHELRNLQKLLKELVQKANGRFY
FT                   EILTSDNLNKILFGMVGV"
FT   gene            566340..568151
FT                   /locus_tag="Calhy_0519"
FT   CDS_pept        566340..568151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06261"
FT                   /db_xref="GOA:E4QCG5"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCG5"
FT                   /inference="similar to AA sequence:KEGG:Csac_0704"
FT                   /protein_id="ADQ06261.1"
FT                   /translation="MRFTQPLYLLFLLSIPVLVVLYMIRPKYKKVVISSTYLWERLKKQ
FT                   KRVSKPAQKLRLSLLLILGILTLAAFSLNLAGPYISITDTKKKVIFAFDVGSTMNCFTH
FT                   DNKTYLEKSKEIARSILDTLPKGSKVSIVTFSDSIEVLAKDVSPSFAKSSIGKVLPTYY
FT                   VTNLKESINVISKLFDASRYTLFLFTDKKVKLQDNIQVFEFPKLDDNVSIDNVSLSTFS
FT                   DGFDAAVEVTNRGIKRASFEIELFADQKLVGAKSMMLLPKQSESVIFEKIKGNYKVVWA
FT                   RINYPDRLREDNIFWTILAPPPTKKKVLYVGKGNFFLEKAFSAFDDVELYKLQDVKNVA
FT                   DGFDIYVFDSVVPKRLPKKGGVIFILQKGKDVSQLLEVSIGNKKDIEGYARFVESTISQ
FT                   NIDGMEFAVQKAISIDDKKFEPVAKVNGKPVISFGVVKNLPTVLIGFAIDDSDLPLKVS
FT                   FPILITNIKNNFVRGNQPFEKMTFYPGEEIKVFSYTDGKAEIILPNSKREVVNFSTYPL
FT                   ILPKNDRLGVYTLNLSNNTSYKFAVNYPTYALDESEEKKTDATLAFSETGAKTNAKVPY
FT                   LLKDILLILSLIFLTFEWMVFMNENKS"
FT   gene            568135..570864
FT                   /locus_tag="Calhy_0520"
FT   CDS_pept        568135..570864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0520"
FT                   /product="protein of unknown function DUF1355"
FT                   /note="KEGG: csc:Csac_0705 von Willebrand factor, type A;
FT                   PFAM: protein of unknown function DUF1355; von Willebrand
FT                   factor type A; SMART: von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06262"
FT                   /db_xref="GOA:E4QCG6"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010768"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCG6"
FT                   /inference="protein motif:PFAM:PF07090"
FT                   /protein_id="ADQ06262.1"
FT                   /translation="MRISLERPLILLLIPILGVVIWLLSKRFYKEGLGKKFVVVLRIVI
FT                   FLLIILALAIPKLTISSDKVATIYLADLSDSNAKNIDKMKDFIQKAIKLKKSNEMQSVV
FT                   VFGQDTNVEFSLKNNPKFSEFGSVVDTSETNIENAIKFAANLFPKDFQKRLVILTDGKE
FT                   TVGNAKTTIDLLNNNGIDVKVLLLKSEKEKDIQFSSLKIPQKVVKNQEFSVFANINSTY
FT                   PASAQLKIFRDGSLIFSQKIMLEKGENRFVIKDKLPKEGIYRYQGVIEAEDDEEDKNNF
FT                   AYAMCQVKKPQKVLVVYQNIDDVKNVRSLLDSYSADYDMVISDNVDFGLDRLMQYSFVV
FT                   LCNVSKNHLTDKFLNDCERYVKDLGGGLLVIGGENSYALGNYSNSVLEKMLPVKMQLKN
FT                   KEKERNVAVVLVIDHSGSMGESNLGNINKLEIAKSAAAKMIDHLESSDSVGVIAFDHNF
FT                   YWASKFGKLKSKNEVIENISGIQIGGGTAIIPPLTEAVNTLRKSKAKDKVIVLLTDGYG
FT                   EEGGYEYPASIAKRNNIKITTIGVGSSINAPILSWMAAYTSGRFYYVKDASNLIDVFLK
FT                   EAKIIKGKYIKEKKFVPKVVETNPINSAFSSYPPLYGYIATTKKDIATSLLVSDEDEPI
FT                   LTVWRYGLGKTAAWCSDLNGSWSRDWVMWDKFSKFFSNLFKWLEKGAEDDSFTFDVQKE
FT                   KGLVVSINGKFKSSATATLKCIYPNGAEKMLKMKRTSPDKFETTAEFMPGNYTFVASVT
FT                   EDGKTKMSTFLYSINYSDEFRVDFDSSRFEQFIALSNAKVVKNPEDIYKGKLKEVYSQQ
FT                   DLSNFLIILCIFLFLLEIAIRRFALYVQIERLLLKTFNTIKKVKHLKIKMDFSRKDLIT
FT                   KANDTRKPGKKVKLLSKKEKKQDEKDHEILDIKKLRRF"
FT   gene            571040..572497
FT                   /locus_tag="Calhy_0521"
FT   CDS_pept        571040..572497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0521"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="KEGG: csc:Csac_0706 glutamyl-tRNA synthetase;
FT                   TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06263"
FT                   /db_xref="GOA:E4QCG7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCG7"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADQ06263.1"
FT                   /translation="MEVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTD
FT                   LERSSIESEKVIIESLRWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAY
FT                   YCYCTEEELEAQRQELLSKGQMPRYTGKCRNLTDEEKRKLEAEGRKPTVRFKVPEGVKI
FT                   VVHDLVRGDVEFLSDDIGDFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPR
FT                   QILIYNALGFELPQFAHVSLILGKDRTKMSKRHGSTWVEQYKEQGYLKEGLINFLALLG
FT                   WSPPEDKEIFDMEYLIENFSLERVSKNPAIFDIDKLNYINSQHIKLKSLDELTQMCIPY
FT                   FVEAGYIKEDEAQSKFEWLKKIVKSVYEGLDYLSQIKDRVDIFFNNEVKIEEDEAKEVL
FT                   KWEHVKDLINVFENKVTQLSELTPEAIKLLFKEIQKETGYKGKNLFMPIRVVLTGKTHG
FT                   PELVEIIEIVGKENILKRLEFFKTWYN"
FT   gene            572539..573243
FT                   /locus_tag="Calhy_0522"
FT   CDS_pept        572539..573243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0522"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   ate:Athe_2254 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06264"
FT                   /db_xref="GOA:E4QCG8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCG8"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADQ06264.1"
FT                   /translation="MFRFFRMIKEEMDVIMEKDPACKSRLETLLYPSLWAIIYHRIAHW
FT                   FYNRRMYFIARWISQRARHKTGIEIHPGAKIGRRVFIDHGMGVVIGETAEIGDDVLIYQ
FT                   GVTLGGTGKEKGKRHPTIGNNVLIGAGAKVLGPFKVGDNTKIGANAVVLREVEENSTVV
FT                   GVPGRVVRKEKKEKPTVEEQLDQVRFPDPLAMQICRLEAKIEALEKKLVEYERRLKEYE
FT                   ALQHSDNDKRGV"
FT   gene            573200..574597
FT                   /locus_tag="Calhy_0523"
FT   CDS_pept        573200..574597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0523"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   ate:Athe_2253 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia ; Cysteinyl-tRNA
FT                   synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06265"
FT                   /db_xref="GOA:E4QCG9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCG9"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADQ06265.1"
FT                   /translation="MKLYNTLTMTKEEFEPLEEGKVKMYVCGPTVYDFIHIGNARPLIV
FT                   FDTLRRYFEYKGYEVIYIQNFTDVEDKMINRANKEGITVFELAERFIQEYYKDADRLNV
FT                   KRATKNPRATEEIEDMIALIQRLIDKGYAYVVDGDVYFRTRKFAEYGKLSHKNIEELMA
FT                   GARVDPNEKKEDPLDFALWKAKKEGEPAWSSPWGEGRPGWHIECSVMAMKYLGQTIDIH
FT                   AGGQDLIFPHHENEIAQSEAATGKPFARFWLHNGYVNINNEKMSKSLGNFFTVREIIEK
FT                   YHPEALRLFMLQAHYRKPLNFSIDLIEQAEVALKRIYTCYENLEFLIQNAASSSENDDM
FT                   LKAAIEDLKAKFIDAMEDDLNTAEATGYLFEMVREINTYANSCSKETLTFAKDTLKELC
FT                   SILGILEQYSEKEEAIPQEILELVKKRNQARKAKNFAEADRIRDELKSLGYIVLDTPQG
FT                   TKIERIK"
FT   gene            574763..575128
FT                   /locus_tag="Calhy_0524"
FT   CDS_pept        574763..575128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0524"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   ate:Athe_2252 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06266"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCH0"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADQ06266.1"
FT                   /translation="MSEVKLSTQQMKFHNLKELVSHMISISELSRGRASKIIDEVAKKK
FT                   KNFLVIKNNKPQAVIIPIDLYDQLVETQEDYKLLLLALKRTENLKQEDCSTFEQVVEEA
FT                   GFTLEEIDKLAESVEIE"
FT   gene            575130..575504
FT                   /locus_tag="Calhy_0525"
FT   CDS_pept        575130..575504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0525"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   csc:Csac_2646 plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06267"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCH1"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ADQ06267.1"
FT                   /translation="MWQVTFLPEAKKELFKLDKQTQKIVLAGIWKVSKNPLSQSRGGYG
FT                   KPLGSKHTTNLTGFFKIKFKDIGIRVVYALVPSKKVMNIVAVLPREDEYCYKVAEKRKK
FT                   KYGKDLFTKSFKSLENKDLH"
FT   gene            complement(575572..577584)
FT                   /locus_tag="Calhy_0526"
FT   CDS_pept        complement(575572..577584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06268"
FT                   /db_xref="GOA:E4QCH2"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCH2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2250"
FT                   /protein_id="ADQ06268.1"
FT                   /translation="MSLSKSWINKRFFFVTLKRFWFVGVIYFLALSVIPFSIILFELPL
FT                   LSRYPNYHIISKDVVLRTQGYCIFVSLLISFALCSLVFNYLHSKDAADYIHSLPPKRIS
FT                   LYISNVLSSLLLLMLPIMINTSILILLKLALENKFQIELNEILIWGLNITALSLLFFSV
FT                   ATCCAIITGTPFVQIFLSFVVLMLPSFLYYTFISNLKSWVFGYYPSPSSTVVEKINPLL
FT                   RIIAPVPPSSSLKSIEYAAYFSISIFLIVLGAMLYKLRKIESAGQSIVFEFFKHIFRYG
FT                   AALCGALLVGLYFPYLNQEKYYALAILGYLIASFICFLFAEMILSKRINVFNRSLLRYI
FT                   YFVIFLLIVIGVIKSDLFGFEKYVPQEEEIQSVVFKDYIFLWNTFEEGNIHKNPEIIKM
FT                   ITNLHREIIRQKQVLLRQKDSNSPFNTTLYITYNLKDGKKIKRMYEIDVLQLSSYLKPL
FT                   YENHAFKYNIYTILKISPSNVKSISFDKYYNYSPASVYQNSKFSIKPFDISEFLKILKN
FT                   EIYNEKFEDIINQTKIPWGYICIELKKAIRTGKIPSFDVAVPFEKSFTKLEKWLTKKGY
FT                   IRFARIMPDEISYAIIGKYDKPEKLMDTLMADINFGAIKQVKKIKDNTLIDKYLRLCEN
FT                   PNHFSSYKTSKKEIYYIIFFGKSQRILYVGILKDL"
FT   gene            complement(577559..578458)
FT                   /locus_tag="Calhy_0527"
FT   CDS_pept        complement(577559..578458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0527"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2249 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06269"
FT                   /db_xref="GOA:E4QCH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCH3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ06269.1"
FT                   /translation="MIKVENVYKRFDEVEALKGVTLKIQRGSIFGIVGRNGAGKTTLLK
FT                   ILTGVYKQDSGIVSIESKSVFENPQVKSKIFFVPDNPYFFGSFSIYDMANFYKGIYNSW
FT                   DSHHFENLLKIFNLPLKKRISKFSKGMQKQCAVLFALSSRPEVLVLDEPFDGLDPVIRQ
FT                   SVKKLLIEDVADRSTTVIISSHNLRELEDYCDTIAILHEGKVLLCSNIEELKLDTCKIQ
FT                   AVFKKNFLPESLSRFKVISYSKKGNIEVIIAKGNREEILDTLKGFEPVVLDILPLSLEE
FT                   IFIYEMGGLKDELVQILD"
FT   gene            complement(578455..578841)
FT                   /locus_tag="Calhy_0528"
FT   CDS_pept        complement(578455..578841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0528"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: ate:Athe_2248 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06270"
FT                   /db_xref="GOA:E4QCH4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCH4"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADQ06270.1"
FT                   /translation="MFEIDWKSRIPIYKQLVERIKELILKEVLKENEQLPSVRSLSKEL
FT                   TINPNTIQKAYQELEREGYIYSIPGKGNFVAPVKSKIKAEKEEKIKSQFKKIVFEALFI
FT                   GISKDELIKLIEEIEKELKGGDNS"
FT   gene            complement(579014..579370)
FT                   /locus_tag="Calhy_0529"
FT   CDS_pept        complement(579014..579370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0529"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: ate:Athe_2246 AIG2
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06271"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCH5"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ADQ06271.1"
FT                   /translation="MYLFVYGTLLSHNSHNYLLSGCKFIGKAVLEGYGLYKVSWYPAIV
FT                   PKEGSKVAGEVYEVDETLIKEIDNFEDEGELYRRQEVEVILNDAEVLRTWTYVYLLDVD
FT                   EKDYIPFEKQPWRE"
FT   gene            complement(579425..579811)
FT                   /locus_tag="Calhy_0530"
FT   CDS_pept        complement(579425..579811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0530"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   ate:Athe_2245 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06272"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCH6"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADQ06272.1"
FT                   /translation="MSQKQKVKEATCEIEVAFEVIGGKWKPLILWYLGEYGTLRFAQIQ
FT                   HLIPDITHRILTKQLRELEEHGLIRRKVYPEVPVKVEYSLTEKGKEVLPILDMMCDWAD
FT                   KYDYFGYKIKYNLCNEELCNLQEE"
FT   gene            579960..581147
FT                   /locus_tag="Calhy_0531"
FT   CDS_pept        579960..581147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0531"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   ate:Athe_2244 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06273"
FT                   /db_xref="GOA:E4QCH7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCH7"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADQ06273.1"
FT                   /translation="MENLVFNYFIPTKILFGPGSLNRLKDENLPGKKALIVISAGTSMK
FT                   KYGYLDRLTAILKEKGIEYVVFDKILPNPIKKHVMEGAKIAKEEKCDFVIGLGGGSSID
FT                   SAKSIALMAKHDGDYWDYIVGGTGKGKVPVNGALPIVAITTTAGTGTEADPWTVITNEE
FT                   TNEKIGYGNQNTFPTLSVVDPELMLSVPPHLTAYQGFDAFFHAVEGYIAKIATPVSDMF
FT                   ALKSVELIAKYLPLCVKDGTNIEARTYVALANTLAGFVESTSSCTSEHSMEHALSAFYP
FT                   DLPHGAGLIMLSEAYHTFFASKVPQRYIQLARAMGVDVDSLPEDERPFAFVKAMKKLQE
FT                   ECGVGNLKMSDYGIKEDEIEKLADNAIKTMGGLFEVDPYKLSFEETVGIMRNAYK"
FT   gene            complement(581230..583119)
FT                   /locus_tag="Calhy_0532"
FT   CDS_pept        complement(581230..583119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0532"
FT                   /product="amino acid transporter-like protein"
FT                   /note="KEGG: ate:Athe_2243 amino acid transporter-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06274"
FT                   /db_xref="GOA:E4QCH8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCH8"
FT                   /inference="similar to AA sequence:KEGG:Athe_2243"
FT                   /protein_id="ADQ06274.1"
FT                   /translation="MFEKLKRILIGKPLPNEAEKTEKYGVLWGLPILSSDAISSVAYAG
FT                   QEILYVLLPTIGFLAFKEISVVTAAIIILLFILMLSYRQTIENYPNGGGAFIVAKDNLG
FT                   VLAGIVAGAALSVDYILTVAVSISSGVDQIVTALEFLKPYKIALCLFLVLFLMIGNLRG
FT                   IRESSRIFGIPAYAFMFSILALIIGGYIKLKTGYVPPEPKINYSPHPVTLVLLLKAFAS
FT                   GCTALTGIEAVSNAVPNFKDPATKHAKTVLLLLSLIILVLFGGTTLLATHYHIVPTEGA
FT                   MLVLMAQEIFGKSIMYYIVAATTFIILVFAANTAFSGFPMLVAVMAKEEFVPRQLSMKG
FT                   DKLSYSNGIIILALVSALLIVAFNGNVTALIGLYAVGVFISFTLSQSGMFVRWLKNKGS
FT                   HWHIKAFINGFGALTTFVVVIIIAITKFKEGAWIVVLLIPLLVFAMIKVKLHYIAVADQ
FT                   LRVTPEDKELLDVEHNIYRNRVIVPIESLNKASIRALRFAKTISDNVIAFNVSINEEQA
FT                   KKLQERYKILNCSIPLVIRYSPYRKILEPLLEYIKSEEYNYQKGDMITVIIPKFTVQRW
FT                   WQKILHNHTWLFIEKELLKHKHIVVSVMPLQLKDDDVVLKKKNKPLWKILEED"
FT   gene            583535..585499
FT                   /locus_tag="Calhy_0533"
FT   CDS_pept        583535..585499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0533"
FT                   /product="protein of unknown function DUF1680"
FT                   /note="PFAM: protein of unknown function DUF1680; KEGG:
FT                   ate:Athe_2242 protein of unknown function DUF1680"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06275"
FT                   /db_xref="GOA:E4QCH9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCH9"
FT                   /inference="protein motif:PFAM:PF07944"
FT                   /protein_id="ADQ06275.1"
FT                   /translation="MKDKDFISYLNSPRIKDVSITDALWKKYIDLVKDVVVPYQWEILN
FT                   DNVDIPVKSHAIKNFRIAAGFEEGEFEGFVFQDSDVAKWLEAASYVLEKYPNPDLEKKI
FT                   DEVIELIGKAQWEDGYLNTYFTIKEKGKRWTNLEECHELYTAGHMIEAGCAHFLATGKT
FT                   SLLEIVKKLADHIYSIFGKEEGKIPGYDGHPEIELALVKLYEVTGDRKYLELAKFFVDE
FT                   RGQEPYYFDIEYEKREKKSHWPGFKSLGREYLQAHKPLRQQKEAVGHAVRAVYLYSGAA
FT                   DVAAYTQDKELFDVCKTLFDDIVKRKMYITGAIGSSAHGEAFTFEYDLPSDAAYAETCA
FT                   SVGLIFFAHRLNKIEPHAKYYDVVERALYNTVIGSMSQDGKKYFYVNPLEVYPKEVEKR
FT                   FDRHHVKPERQPWFGCACCPPNVARLLASLGRYVYSYNHDGIYVNLYIGSSVQVEVGGV
FT                   KVLLQQVSSYPFEDMVKIDLKPSKEARFKLYLRIPGWCENYEVYVNGKKEEMQKLPSGY
FT                   VCIERLWKENDQVVLKIPTEVKMVSSHPQVRSNVGKVAVVKGPVVFCAEEADNGKDLHL
FT                   VFVDVNGKCKLEFDSNILGGLYTVEVDGFRMAEDDFGEELYKSHRPKFVPAKIKLIPYY
FT                   AWANRGTNEMRVWLWRSSF"
FT   gene            585588..586664
FT                   /locus_tag="Calhy_0534"
FT   CDS_pept        585588..586664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0534"
FT                   /product="Ethanolamine utilization protein EutH"
FT                   /note="PFAM: Ethanolamine utilisation protein EutH; KEGG:
FT                   csc:Csac_0718 ethanolamine utilization protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06276"
FT                   /db_xref="GOA:E4QCI0"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCI0"
FT                   /inference="protein motif:PFAM:PF04346"
FT                   /protein_id="ADQ06276.1"
FT                   /translation="MQLSKILFMLFSIAFATGVIDKIFGDKLKLGSKIEEGFIIMAKAV
FT                   FSMLGILYLYPFLGMLLVKPSKFLAQLFHTDSAILISCFLPIDMGGYHISQQVSKDEMA
FT                   KVIGGILLSSNLGATIGFTYPVAFGILKGESKEDFIKGSLIGIGCIPIAVVFTSMLWGY
FT                   NVLRTLKLVAIVVIVTFVLAIGVSRGWRFLITAMKFLGSTMTFVNLVGLALLGYHILTS
FT                   KALFPIKTALQDCIVLPLKMAVLIGGSYVFFTVIYNFLINRFRLLKGSYTLNQAGLEGM
FT                   LMLLVNCVPTLYLFDKMDKRSKILASALCMTAASALGPQLAFVATFAPAHVSLFLLNKL
FT                   ISAAVAVAATLIYLKFGK"
FT   gene            complement(586739..586888)
FT                   /pseudo
FT                   /locus_tag="Calhy_0535"
FT   gene            complement(587095..588147)
FT                   /locus_tag="Calhy_0536"
FT   CDS_pept        complement(587095..588147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06277"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCI1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2240"
FT                   /protein_id="ADQ06277.1"
FT                   /translation="MIRAARVLSVIVTICFITFSLSSSIFAISSQQAQASLLEKTFKAE
FT                   LSKILNPDSPLSCDIITTSTGQKSFGYGLNLIVNETKTYKVSFDRKNKKFFVQTKKDSV
FT                   NKIVFLNGQNIYTQDPKDNKYVLSTIPATFWISINMLDSSISQPISKFYQSILNYLNSQ
FT                   SSSIVKSAYKTTTSVGSKKISCWQLSATLPSKVLEPAFKEFLSTSSKSALSQLSIMLDV
FT                   YLKSLTDDEKKALRSLNIDVSKLSSSEISKQLESNLSKLISSIKLDDYKISFYVDEKTG
FT                   KVVKIIIKNSLATGGGVSSRVEITNILTGNDVKFPQISQNMIKQQSSQVDLVGLLKLIE
FT                   NFVTKMQQIK"
FT   sig_peptide     complement(588040..588147)
FT                   /locus_tag="Calhy_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.678 at
FT                   residue 36"
FT   gene            588619..590352
FT                   /locus_tag="Calhy_0537"
FT   CDS_pept        588619..590352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0537"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   ate:Athe_2238 diguanylate cyclase/phosphodiesterase; SMART:
FT                   EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06278"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCQ9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADQ06278.1"
FT                   /translation="MKETSVDLWIKDFIELTDTQFERFEQAIKSERGFWLYDIKEKKIY
FT                   LSDGVVYLTIQSENIEDYVKKLMAENEFIHLLNLAKESIENKQNGFSIRVKLKEGRWIF
FT                   VCATILYKKGIPFRIVGTFEDVTPHVSCDLRLNRYIELIAYYDDVTGLPNRNFLNEKIR
FT                   ERIEESKKENSKFWVIFIEVGNFSYINEIFGHAVGDEFLKSIAMEIKKFLPREWIFSRF
FT                   GGDEFVVVTTDVEKASVVQIVENLVERFSRSWSVMGKWLYTNINIGIAGYPQDGTEADT
FT                   ILQNAEIALTMAKKRGKDMGKSLYEFYERSMTEEILRRVEIESEILRGIQNKQFFLVYQ
FT                   PKVSRDGRTVVGFEALLRWNSQRGILTPDKFIQIAEESGLVYDLNRLILDIVCRDIKYI
FT                   KENGFKKVPVAINLSGKEFAMYNMIGILSEYLEKHDVTSKDIEIEVTERIILNNLELSK
FT                   EIFNELYEKGIKISIDDFGTGYSSLELLLTLPIHALKIDKKFISRIEFFGNEYVIVKNI
FT                   IYMAKEMNLKTIAEGVERKEQYEILKELGCDEFQGYYFSKPMRIEEVAELRKQDESLEI
FT                   Q"
FT   gene            590632..592302
FT                   /locus_tag="Calhy_0538"
FT   CDS_pept        590632..592302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0538"
FT                   /product="L-ribulokinase"
FT                   /note="KEGG: ate:Athe_2229 L-ribulokinase; TIGRFAM:
FT                   L-ribulokinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06279"
FT                   /db_xref="GOA:E4QCR0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCR0"
FT                   /inference="protein motif:TFAM:TIGR01234"
FT                   /protein_id="ADQ06279.1"
FT                   /translation="MAKFSIGIDFGTQSGRAVLVNVETGEEVATSVKEYTHGVMDESLP
FT                   DGTKLPHDWALQHPQDYIEVLATTVPDVLKKAGVSKDDVIGIGIDFTACTMLPIKKDGT
FT                   PLCMIDKFKSHPHAYVKLWKHHAAQKYANRLNQIAQERGEKFLQRYGGKISSEWLFPKI
FT                   MQILEEAPEIYEEADKFIEAADWVVMKMTGVEKRNSCTAGYKAIWSKREGYPSKEFFMA
FT                   LHPRLENVVDEKLSRDIYPIGQKAGELTEEMAKLMGLNPGTAVAIANVDAHVSVPAVGI
FT                   TDIGKMLMIIGTSTCHMLLWNEEKMVPGICGYVEDGILPGFYGYEAGQSCVGDHFEWFV
FT                   ENCVPPTYYDEAKQKGLNIYQLLKEKAKVLRPGQSGLLALDWWNGNRSILVDADLTGMM
FT                   LGMTLTTKPEEMYRALIEATAYGTKIIIDNFNEHGIEVRELYACGGIAEKDELLMQIYA
FT                   DVTGLEIKVSASPQTPALGSAMFGAVAAGKEKGGYDSIFEAAKKMAKLKDYSYKPNPQN
FT                   HEIYKKLYREYRILHDYFGRGANDVMKRLKEIKEEVSKI"
FT   gene            592417..593511
FT                   /locus_tag="Calhy_0539"
FT   CDS_pept        592417..593511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0539"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="KEGG: csc:Csac_0722 regulatory protein GntR, HTH;
FT                   PFAM: regulatory protein GntR HTH; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06280"
FT                   /db_xref="GOA:E4QCR1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033532"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCR1"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADQ06280.1"
FT                   /translation="MIKINLYGQDDDKMSKTKYEIIKDFIIEGINSGKFKEGEKIYSEN
FT                   MLSRKFKVSRHTVRRAIMELEFEGLLVSQKGRGTFVAKKSADSSKCIAVLTTFISDYIF
FT                   PLIIRGIEKVIAHEGYGLLLFSTDNSYEFERYHLESIINNPNIDAVIIEPTKSTLPSKN
FT                   QELYRKLIQKDIPVIFINTILEEIAQNYIITKDQSAVYRLTCSLIKSGCKKLLGIFKGD
FT                   DLQGIKRYSGFEKACREAQAEFDAIFFTSEEYNFVHNRAAEVISRERFDAAVCYNDKIA
FT                   LPLCVKLKEMGFRIPQDISVTGYDNSLLSTLTDIKLTTVEHPKEKLGEMAAKAAVAMIK
FT                   KNRKGVKEEVECEIIFRNSTKGGF"
FT   gene            593514..594158
FT                   /locus_tag="Calhy_0540"
FT   CDS_pept        593514..594158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0540"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: csc:Csac_0723 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06281"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCR2"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADQ06281.1"
FT                   /translation="MLESLKELVCKYNLYLPKFGLVTWTSGNVSARDPETNLVVIKPSG
FT                   VMYDDLTPDKMVVVDMDGNIVEGNLKPSTDTLTHLYVYKHMPHINAVVHTHSNYATAFA
FT                   ALGQPIKVYLTAIADEFGCEIPCGPYAQIGGEDIGKVIVEYIGSSPAILLQNHGVFTIG
FT                   KTVDEAVKAAVMVEDVAKTVFIAKMMGEPIEIPPEEVKRAHERYMTKYGQK"
FT   gene            complement(594243..595601)
FT                   /locus_tag="Calhy_0541"
FT   CDS_pept        complement(594243..595601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0541"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   ate:Athe_2226 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06282"
FT                   /db_xref="GOA:E4QCR3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCR3"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADQ06282.1"
FT                   /translation="MNVKFNQKTHILEIEYQFRDVEEPNLFRNIYPYNEVPRLVFNHRI
FT                   VPMNVPEKLYITDTTFRDGQQSRSPYTVDQICRIYDYLHELDNGSGVILHTEFFVYSKQ
FT                   DKEAVLKCLEKGYDFPKVTAWIRAKKEDFEIVKSLGIKETGILVSCSDYHIFKKLKMTR
FT                   SQAMKQYLEIVSSALEAGIIPRCHFEDITRADFYGFVLPFINELMKLSKEANMPVKIRA
FT                   CDTLGLGSPIPGVALPRSVPQIIYGIVNYGEVPSEWLEWHGHNDFYKAVINSTMAWLYG
FT                   ASMVNTSLLGIGERTGNTPLEAMVMEYIQIRGSADGMNVAVISEIAEYFKKEIGYEIPP
FT                   MTPFVGENFNATRAGIHADGLMKDEEIYNIFDTGKILGKPPKVIIDAYSGIAGIVIWIN
FT                   RYFKDSGIDIQVDKKDPRVQKVKEWVDSQYENGRNTSISDEELKEVVSRIFGL"
FT   gene            complement(595820..596941)
FT                   /locus_tag="Calhy_0542"
FT   CDS_pept        complement(595820..596941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0542"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /note="KEGG: csc:Csac_0727 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06283"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCR4"
FT                   /inference="similar to AA sequence:KEGG:Csac_0727"
FT                   /protein_id="ADQ06283.1"
FT                   /translation="MAKSKVYFTDFKTKPGYNMLDKLENLVKKAGIETIDFKNKFVAIK
FT                   VHFGEPGNLAYIRPNYVARIVKLIKSLGGKPFVTDANTLYTGRRSNALDHLEAAYENGF
FT                   NPLVLGCHVIIADGLKGTEYREIEVNLKHTQKAKIGSAIADADIIISMNHFKGHEMTGF
FT                   GGAIKNIGMGSGSRGGKLFMHSSSKPVIKTSKCVGCGMCVKSCAQLAITLNEKKKAVID
FT                   YEKCVGCGQCVAVCQFGAATVKWDEAASIASEKIAEYAYAVLKDKPHFHINFVMNISPD
FT                   CDCWSHNDIPIAPDIGIAASFDPVALDKACVDLVNSSAFTPAGSAFEKAKHIEVDGKID
FT                   RFKSIHPDTDWRVALKHAQEIGLGSLEYELVKV"
FT   gene            597177..597740
FT                   /locus_tag="Calhy_0543"
FT   CDS_pept        597177..597740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0543"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: ate:Athe_2218 glutamine amidotransferase of
FT                   anthranilate synthase; TIGRFAM: glutamine amidotransferase
FT                   of anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06284"
FT                   /db_xref="GOA:E4QCR5"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCR5"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADQ06284.1"
FT                   /translation="MKVLIVDNFDSFTYNLYNYFLRLKVSTTVINRDKLTIEDIYKLNP
FT                   THIVLSPGPGRPTDDKILFEIIDKFKESKNILGVCLGHQAIGMFFGAKLKKAKRPMHGI
FT                   VDTVFHDQKGVFENLKNPLSVVRYHSLVIDDVDSTQLTITAVSKEGEVMGIRHKRFKIE
FT                   GVQFHPESIATQHGLLMLKNFLKG"
FT   gene            597750..599069
FT                   /locus_tag="Calhy_0544"
FT   CDS_pept        597750..599069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0544"
FT                   /product="Chorismate binding-like protein"
FT                   /note="PFAM: Chorismate binding-like; Anthranilate synthase
FT                   component I domain protein; KEGG: ate:Athe_2217
FT                   anthranilate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06285"
FT                   /db_xref="GOA:E4QCR6"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCR6"
FT                   /inference="protein motif:PFAM:PF00425"
FT                   /protein_id="ADQ06285.1"
FT                   /translation="MQIAVYNMVPDPFLIFCHLKSDFSVLLESSMLSKRYGRYSFLFLK
FT                   PKEVYILSEDDDVFEYLEILSNKIERNKNTSNFVFNGGFAGYFSYNFGVDLFEVERKKD
FT                   TSLVPKAYFGYFEDFVVIDHFEKKTYASFTSKALAMEFEGILKNENLALTSFKKSEVER
FT                   AWCNFEKSEYMQAVKRIKDYIFEGDVYQVNLSQRFFVKGVFDPDFLYFDLRKRNYGCYH
FT                   AYIKFPKASIISTSPELFLRKRGDTIITKPIKGTSKRGKTPEEDRILKERLYNDIKCRS
FT                   ELLMIVDLERNDFAKICLPESIEVEKLFDVEEYSTVFHLVSTIKGKLLNGMDLKRIIEA
FT                   TFPGGSITGAPKLNAIKIIEELEKCPRGIYCGSIGYISNNFNMDFNIAIRTLVVEDDTA
FT                   YFSVGGGIVWDSQEEEEWWETIHKGKPFFEILGISDFAGA"
FT   gene            599086..599838
FT                   /locus_tag="Calhy_0545"
FT   CDS_pept        599086..599838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0545"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: ate:Athe_2216
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06286"
FT                   /db_xref="GOA:E4QCR7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCR7"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADQ06286.1"
FT                   /translation="MEESFQSYGFGLFPFETIYFDREGAHFLEDHYLRFKRTFWILGVK
FT                   FHLDFEKFKESIEKYILSTERDYGGVRVAYVHDRLVIELKEIRYNKVLFQKGFELAIAR
FT                   TKKDSKNILNYIKTSNIGINLIEEKRANKKGFDSCLFLNQDGFICEAAFANIFFRKDKV
FT                   IYTPHILCGLLPGIVRKHVIRVSEKLGYMVKKAYLEIGDIKDMDECFITSSIAGIFPVL
FT                   RIENIEFKQRGFAEYLLSMEKFDRPWVC"
FT   gene            complement(599903..601186)
FT                   /locus_tag="Calhy_0546"
FT   CDS_pept        complement(599903..601186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0546"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG:
FT                   cbe:Cbei_4492 FMN-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06287"
FT                   /db_xref="GOA:E4QCR8"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCR8"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ADQ06287.1"
FT                   /translation="MTKKVMPTQILRFFIQLISFIFFPLSFAMLLSQIKSLYLAFLGKE
FT                   NFQFNQNFIMLIVTLIITIFLGRFFCGWVCAFGSILEWIHFLGKKIFKKTFEMPKKLDS
FT                   FLKMIKYLVLVYLIVIVWTFGKTFYADPWDAFDNLLSLNFDIKTYLPSFVFFVFVLILS
FT                   LFVNRAHCRYFCPLGAIFNIISRAKLLFVKKVDKNCGKCRICTSACPMGIDMNNVENYK
FT                   GECIACVKCVESCPRLNIELNIAKTKIDPRYTSAAAIAGVFSVASFFATSSIEPLNQKF
FT                   TSSKPSTTFSQSIQSENNSGLQENQTESENTGLATQNSQETTTQNSASKIYKDGTYTGE
FT                   GFGYRPGLVVQVTIKNDKITDIQIISHHETPSFAQLPFEIIPKEIIESQSTNVDIISGA
FT                   TRTSYGIIMAVEDALSKAKIENDESAQN"
FT   gene            complement(601183..602163)
FT                   /locus_tag="Calhy_0547"
FT   CDS_pept        complement(601183..602163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0547"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: ate:Athe_2215
FT                   ApbE family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06288"
FT                   /db_xref="GOA:E4QCR9"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCR9"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADQ06288.1"
FT                   /translation="MISNETKIIKSIFALGTDIHFIFYQPNFESAFDRAHSLILDMENK
FT                   LSVFKPKSLVAKLNRYGNYIPIKVCPEVYELIKKSVEYSLFSEGYFDITVKRLIDVWKE
FT                   AKQKNQMPAKEEVELAFLYTGSENIQLLSNYRVKLKNKVKLDFGAIAKGFLADKIREIF
FT                   EQEGINSAIVDLGGHILTVGKKHDESLWKVGIRHPFKTREDVLGFLELGSTSVVTSASY
FT                   ERYFTIDNKKLSHIINPKTGFPVKDDIASITVVDTNSTFADAMSTALFAMGFKKAINFI
FT                   QDSKTIEAVVATSFREIYITPGLAQRFTLCDSSFRVIKTNEVIVL"
FT   gene            complement(602297..602902)
FT                   /locus_tag="Calhy_0548"
FT   CDS_pept        complement(602297..602902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0548"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ate:Athe_2214
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06289"
FT                   /db_xref="GOA:E4QCS0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCS0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADQ06289.1"
FT                   /translation="MLLRKEGRKREQKKIIKENRLLDAAYSLFIEKGITATAIDEIVKK
FT                   AGVAKGTFYLYFKDKEDILEKLILKKSSEIVKKALQEVSIREFTSPVDKFLYFLEYIID
FT                   YLSKNRVLFKFLKKDFSWVFYKKITDNEQFAELKRAKEMFLKNFNTNYTQEELEIVVFM
FT                   ILELVSSLTYSSIVNNEPAPIEKVKPLLLSTIRKILEN"
FT   gene            complement(602944..603747)
FT                   /locus_tag="Calhy_0549"
FT   CDS_pept        complement(602944..603747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0549"
FT                   /product="esterase/lipase-like protein"
FT                   /note="KEGG: ate:Athe_2213 esterase/lipase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06290"
FT                   /db_xref="GOA:E4QCS1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCS1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2213"
FT                   /protein_id="ADQ06290.1"
FT                   /translation="MIPLWENQNDIPLFDPANPFVPHLVPYILESSKQLPCIIVFPGGG
FT                   YTHRAQHESEPVCLWLNSIGISAFVLNYRVQPYKHPAPLLDAKRAIRLIRYFSKKWNID
FT                   PNRIGVLGFSAGGHLASLVGTHFDSGDKKNNDPVERVSCRPDCMVLCYPVISLAEYAHE
FT                   GSKKALLGENPDPVLVWTLSSHNMVSSKTPPTFLWHTSDDSSVLVENSLLFAMALKKHG
FT                   VPFELHIFPHGRHGLGLASDTLYVKEWTKLCEKWFESIGFIGYNV"
FT   gene            603918..604961
FT                   /locus_tag="Calhy_0550"
FT   CDS_pept        603918..604961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0550"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein; KEGG: ate:Athe_2212 C4-dicarboxylate
FT                   transporter/malic acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06291"
FT                   /db_xref="GOA:E4QCS2"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCS2"
FT                   /inference="protein motif:PFAM:PF03595"
FT                   /protein_id="ADQ06291.1"
FT                   /translation="MKNIIRNFYPSWFVVCMGTGIIANLFKAIGQDYLSYTFTLINIIF
FT                   FAIIFLIWFLRWFVGFENVKKDVENPLLSNYFATMPISLMIIGLNILVNKLYFGSDFSV
FT                   AFAKFSFYTGSFLMVVFSIITFVVHLSHKEIPSSILNFAYFMPPVGNIIAPILGNEIIN
FT                   RATLDSQEKSAVLFINLAMFGIGFMLFLTYLPIIKGRFLLQEPIEKGHFPTMFILLAPV
FT                   GASIVAIKGFAQSFKVAGLVNDTFLPTLFNILATMLWGFGLWIFIALIVLWIRSLKTKI
FT                   PFSLAYWAYIFPVGIFALASFKVNSSFNFSTINWFSKAIVWILLIVWIYNILMTLKNVF
FT                   NKKLLTR"
FT   gene            complement(605055..605354)
FT                   /locus_tag="Calhy_0551"
FT   CDS_pept        complement(605055..605354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0551"
FT                   /product="protein of unknown function DUF1634"
FT                   /note="PFAM: protein of unknown function DUF1634; KEGG:
FT                   ate:Athe_2211 protein of unknown function DUF1634"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06292"
FT                   /db_xref="GOA:E4QCS3"
FT                   /db_xref="InterPro:IPR012861"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCS3"
FT                   /inference="protein motif:PFAM:PF07843"
FT                   /protein_id="ADQ06292.1"
FT                   /translation="MENRKTATMEDIISIVLRAGVLLSIIVICAGLFLHIVLKLAVGSL
FT                   IIKIGLYILFLTPFARLVVSLFMFLIEKDLIYFAITLAIIVIIVVSNLLVSAKI"
FT   gene            complement(605355..606185)
FT                   /locus_tag="Calhy_0552"
FT   CDS_pept        complement(605355..606185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0552"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   ate:Athe_2210 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06293"
FT                   /db_xref="GOA:E4QCS4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCS4"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADQ06293.1"
FT                   /translation="MIAEVFVVSIIAGFIGSLLGIGGGLIVIPFLSIVFKFNMHQAAAA
FT                   GLVSVIATSSGAASAYVKDRLTHLRIGMFLQLATVIGGVLGAILSGFLPAKVLSLIFGI
FT                   LLLYNSFLMIKNRKSDEKPQPSSLQISKWAKKLKLYGSYFDKIQNREIEYSAQNITGGF
FT                   LMMTLAGILSGLLGIGSGIFKVLALDTIMKLPFKVSTATSNFMMGVTALASISIYLARG
FT                   DIVYDACGAVAVGVLVGSAIGARLMPYIKSKYLRVAFALILIYTSIEMIRKGLF"
FT   gene            606387..606656
FT                   /locus_tag="Calhy_0553"
FT   CDS_pept        606387..606656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06294"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCS5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ06294.1"
FT                   /translation="MYRFAAKRAQCNIQVFIKQREVDGMGEFVSNVARLLDETKTKDFM
FT                   AGKLEATIEFAKRLIQKGFSDEEIAELTELEIERIKELRKSMLN"
FT   gene            complement(606726..606818)
FT                   /locus_tag="Calhy_R0013"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(606726..606818)
FT                   /locus_tag="Calhy_R0013"
FT                   /product="tRNA-Ser"
FT   gene            607025..607423
FT                   /locus_tag="Calhy_0554"
FT   CDS_pept        607025..607423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0554"
FT                   /product="thioesterase superfamily protein"
FT                   /note="KEGG: ate:Athe_2209 thioesterase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06295"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCS6"
FT                   /inference="similar to AA sequence:KEGG:Athe_2209"
FT                   /protein_id="ADQ06295.1"
FT                   /translation="MKKPELQVGLKFEIEEVVSDNMLASHFQSGLLDVFATPSMIALME
FT                   KAALLCVENYLEEGYTTVGSKVDILHLAPTPKGMKVKAVAQLIAIEDRKLTFKVEAYDS
FT                   FEKIGEGVHERFIVNRERFLNKTYQKVR"
FT   gene            607433..609094
FT                   /locus_tag="Calhy_0555"
FT   CDS_pept        607433..609094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0555"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="KEGG: ate:Athe_2208 formate--tetrahydrofolate
FT                   ligase; PFAM: formate-tetrahydrofolate ligase FTHFS"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06296"
FT                   /db_xref="GOA:E4QCS7"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCS7"
FT                   /inference="protein motif:PRIAM:6.3.4.3"
FT                   /protein_id="ADQ06296.1"
FT                   /translation="MKSISKVQETTLEPISKIAEKIGLDEDEIELYGKYKAKISLDVLK
FT                   KKAEVEDGKVILVTSINPTPFGEGKTTTAIGLSMAINRMGFKSIVTLREPSLGPFLGLK
FT                   GGATGGGACQILPSIDINLHFTGDIHAVTSANNLLCAAIDNHIYHGNSLGINPKSITIK
FT                   RAMDMNDRSLRHIIVGFSNDQKGAIREDGFVISVASEVMAVLCLSMSYDELKEKLGNIL
FT                   IGFTYDKKPLYAKDLNVHGSMALLLKDALKPNLVQTSENTAAIVHGGPFANIAHGTNSI
FT                   VATKIAQKLADYVVVEAGFGSDLGAEKFINIVARKSGIYPHAAVLVVTTKALKHHARIE
FT                   ENGGLQSDVNSIQRGLENLEKHIENLKIMGLETVVALNKFPDDTEEEIELIRSFCEQKG
FT                   VEFSVSNAYAHGSEGVLDLAEKVIEMSNKRKKINFVYEDSDPVEEKIKKVATIIYDAKD
FT                   VKFSKAAVSKLELIKNLKIEHFPICMSKTQYSLSDDPKLLGRPKDFVLNVTDIEIKNGA
FT                   GFVVVMCGDIIAMPGLGKDFAALHLDIDSSGNPIFK"
FT   gene            609153..610403
FT                   /locus_tag="Calhy_0556"
FT   CDS_pept        609153..610403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0556"
FT                   /product="Glycine C-acetyltransferase"
FT                   /EC_number="2.3.1.29"
FT                   /note="KEGG: ate:Athe_2207 glycine C-acetyltransferase;
FT                   PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06297"
FT                   /db_xref="GOA:E4QCS8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCS8"
FT                   /inference="protein motif:PRIAM:2.3.1.29"
FT                   /protein_id="ADQ06297.1"
FT                   /translation="MIDTTKFSLADFMKSEDKNIMELAKEFWEYKEDYVRRRHYQYRRV
FT                   SITGSGPTMKIIDHYTGQIKEMINLASNDYLNLTKHPRTIKAGIEAVKKYGTGAGSVPL
FT                   LGGTLDIHVELEKKLAKFKGCEDALIYTSGYGSNLGTISAILHEKDVAILDMYVHASII
FT                   DGCRNTNVEFFRHNNMDSLEKVLKKVKDKYNTKLVIVDGVYSMDGDIAPLDQIIEIAHA
FT                   YGAFVMVDEAHATGVIGKNGRGTPEHCNVEGKVDIVAGTLSKALGAVGGFIATNKELVN
FT                   YLHFYSRAYMFSTAPTPQATASLIEALNVIEEEPELRQRLWDNIRYFRENLLKLGFNLG
FT                   NQQTAIFPIIIGDDYKVKEMCRELHEAGIYVNPVFYPAVPRRLSRIRMSVTAGHTKEHL
FT                   DRTLDVLEHLGKKYGII"
FT   gene            610503..611720
FT                   /locus_tag="Calhy_0557"
FT   CDS_pept        610503..611720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0557"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   ate:Athe_2206 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06298"
FT                   /db_xref="GOA:E4QCS9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCS9"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADQ06298.1"
FT                   /translation="MKAVVFDANVAKYIRTLLLGKISKKFFYNRFSCILLKDIPEPELP
FT                   SENYVKIKTTYAGICGSDLNLIFLHDSPSTSPFASFPFVIGHENLGVIVEKGKAVSEFE
FT                   IGDRVIVDPVLDCDARELPRCPSCQEEEFSTCLNITEGKLSPGTIMGACSTTGGSWGEY
FT                   FVAHKSQVIKVPATVKDQEAILVDPLASALHPVMRNFPKDSEKVLVYGAGIIGLLVIWS
FT                   LRKLGSSADITAIAKYDFQADLAIEFGANRVVKPKEGYLDELAKVAYAKVFQPMIGDKV
FT                   LLGGFDKVFDCVGSKKTIRDGMWLTKQRGSYILVGLASTVKDLDLTPIWFKELNVKGAY
FT                   CYSTENVNEYRMSTYQLALSLIQQHGIPYEKLITHYFKLEDYQKAIEVASSKGREKSIK
FT                   VVFRFL"
FT   gene            611891..612805
FT                   /locus_tag="Calhy_0558"
FT   CDS_pept        611891..612805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06299"
FT                   /db_xref="GOA:E4QCT0"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCT0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2205"
FT                   /protein_id="ADQ06299.1"
FT                   /translation="MREKFGKVYGIITFTELLLFFGLVLYIQLQTHTYSIVSWILICTS
FT                   LSLIVAAGYVFGILPIINEFGGRVKKIEDVLKILNKNFEFSVEDDIQFENSLQTIQSKL
FT                   HLLEEEREKENFFISAYKEMIIRNVQLIYEIAAEKRQKEIEGLARSLLDMLETSVYSNR
FT                   IFVPLWYEVTLFQTILSGCIYSLKNNFEIVVNFHDDSLKERFILHGTLSFIAKLFTSCS
FT                   ERQLPIKSVIQLSIFELSGMLNIRIYYNDVIKNYEKIEEVMNILKNKFALYYPEGTYLL
FT                   TYSTGDNHFVIEMTLPEIKSFES"
FT   gene            612915..613928
FT                   /locus_tag="Calhy_0559"
FT   CDS_pept        612915..613928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0559"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ate:Athe_2204 transcriptional regulator, LacI
FT                   family; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06300"
FT                   /db_xref="GOA:E4QCT1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCT1"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADQ06300.1"
FT                   /translation="MVTIKDIAREAGVSPSTVSRVLSGKAKISPETTKRVMEAIEKLGY
FT                   IPNASAKSLVMKKAYSVGIFMPRRLEQTLTSTFFDQVVSGICSYINATEYEIVLSIVPP
FT                   EKEKESLERLIKSKKVDGFILLTSRINDYAIKYLRNLKFPFVLIGSPDKDKDYVNWVDN
FT                   DNKKAAFDATEYLIRLGHTQIGFLGGMENLVLTQDRLSGYKSALAKYKIPVENQYIMFT
FT                   EFDEQSSYEKAKQMLQLSNRPTAIVCIDEVVAYAAIRACRELDLKVGYDVSVIGFNESI
FT                   FSKLSSPRLTTINTNVFYLGYYAAEMLIKELEEPYKTYKRLIVEHSIIEGETCRAI"
FT   gene            613947..614705
FT                   /locus_tag="Calhy_0560"
FT   CDS_pept        613947..614705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0560"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: csc:Csac_1229
FT                   alpha/beta fold family hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06301"
FT                   /db_xref="GOA:E4QCT2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCT2"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADQ06301.1"
FT                   /translation="MQKHVEIKNKIGQVLRGYLHTPGEYEGKIPAVAIFHGFTGNKMEP
FT                   HFIFVKLSRLLEQHGIASVRFDFAGSGESDGEFYDMTVTREIDDARCILEYLFSLDFVD
FT                   KQKISIVGLSLGGAISSYLAGEYKEKLYKVVLWAPAGNMKEIAKNVVETNPTIKEKGYI
FT                   DLGGLLLSQDFYYDLQKYDFFEEIKRYPGKVLILHGTNDQAVPIEVGRKYKQILGNRAE
FT                   LIEIEGADHTFNKYEWERLVLDKTVEFLKD"
FT   gene            complement(615129..615317)
FT                   /locus_tag="Calhy_0561"
FT   CDS_pept        complement(615129..615317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0561"
FT                   /product="ribosomal protein L28"
FT                   /note="KEGG: ate:Athe_2199 ribosomal protein L28; TIGRFAM:
FT                   ribosomal protein L28; PFAM: ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06302"
FT                   /db_xref="GOA:E4QCT3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCT3"
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /protein_id="ADQ06302.1"
FT                   /translation="MAMCEVCGKKVAFGNKVSHSNKKSRRTWKPNVKKIKVLLQNGQRK
FT                   RIYVCTSCIKAGKVVRA"
FT   gene            complement(615401..616468)
FT                   /locus_tag="Calhy_0562"
FT   CDS_pept        complement(615401..616468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0562"
FT                   /product="protein of unknown function DUF43"
FT                   /note="PFAM: protein of unknown function DUF43; KEGG:
FT                   ate:Athe_2198 protein of unknown function DUF43"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06303"
FT                   /db_xref="GOA:E4QCT4"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR014435"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCT4"
FT                   /inference="protein motif:PFAM:PF01861"
FT                   /protein_id="ADQ06303.1"
FT                   /translation="MDVLKGAVDFVQNKTKVEINQRDIEKILSALNSTNHFWEVIFLSQ
FT                   KPFAVVRETINYLISIDFVKTDESGNLILTEKGKEFISANNIPVVKNYTCSYCEGRGIV
FT                   FSEIKDAYEKFKEIVKTRPDAIVEYDQGYVTEETAYSRIALMIKKGDLVGKRLIVFGDD
FT                   DLVSIAAALTKLPKEVIVLEIDKRLVDFINQAAKEHNLNLKAIEYDFRNKLPDDFVKSF
FT                   DTFTIDPPETIEALDLCFTRTISSLKGAGCAGYFGLTNIEASLSKWHEFQKLLLNKFNA
FT                   VITDIIENFNHYVNWNYLLPSLESSLTFVNVQPKLNWYTSSMYRIELVKDVDIKNEYIN
FT                   CELYIDKEAILYKEN"
FT   gene            616586..617773
FT                   /locus_tag="Calhy_0563"
FT   CDS_pept        616586..617773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0563"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   ate:Athe_2197 tRNA pseudouridine synthase D TruD"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06304"
FT                   /db_xref="GOA:E4QCT5"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCT5"
FT                   /inference="protein motif:PFAM:PF01142"
FT                   /protein_id="ADQ06304.1"
FT                   /translation="MWILKGDNSLKIKVLPEDFVVREKLRLEIKPSGKYKIYLLTKRHW
FT                   NTVDALRFISKENKIPLEKIGCAGRKDRHALTFQYISVPREYTINFNKENVKAQFIGYS
FT                   DDFVSPLILEGNFFEITIRKLKNKDERILRRLNEVQQFGFPNYFDDQRFGSSQSEDEFI
FT                   GEKIVKKHYNGALKLYFTTIHPEDKKEEKERKKKISELWGDFEKILPLCKTKVERDIIK
FT                   TLLNGKSRHYLIEALNLIPKEEMSIFLSAYQSYIWNRTLIAVLPYYVDLLKPVKGKIMD
FT                   YLIYTTLSTKSLNSLKNLQIPTISSKIPYVSDIVNNAILEILNERGVKPSDFDTKKIRS
FT                   WYFKSFLRPAIVFPEKLEVSDFEEDDFYSGYYKLRIKFYLPAGSFATMLIKSLTV"
FT   gene            617805..618218
FT                   /locus_tag="Calhy_0564"
FT   CDS_pept        617805..618218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0564"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ate:Athe_2196 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06305"
FT                   /db_xref="GOA:E4QCT6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCT6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADQ06305.1"
FT                   /translation="MIIREMNPDDWSKVISLWQNTEGIGIGRSDTKEGLEKFLNRNKGM
FT                   SFVCEIDGKIIATIMCGHDGRRGFIYHLAVAENFRLQGIGKRLVEKALEELKNQGIHKC
FT                   HIFVMKNNEKGKSFWSKMGFQKRDDIEVFSIDI"
FT   gene            618339..618415
FT                   /locus_tag="Calhy_R0014"
FT                   /note="tRNA-His1"
FT   tRNA            618339..618415
FT                   /locus_tag="Calhy_R0014"
FT                   /product="tRNA-His"
FT   gene            618428..618503
FT                   /locus_tag="Calhy_R0015"
FT                   /note="tRNA-Gln1"
FT   tRNA            618428..618503
FT                   /locus_tag="Calhy_R0015"
FT                   /product="tRNA-Gln"
FT   gene            618523..618598
FT                   /locus_tag="Calhy_R0016"
FT                   /note="tRNA-Lys3"
FT   tRNA            618523..618598
FT                   /locus_tag="Calhy_R0016"
FT                   /product="tRNA-Lys"
FT   gene            618708..620240
FT                   /locus_tag="Calhy_0565"
FT   CDS_pept        618708..620240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0565"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: ate:Athe_2193 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06306"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCT7"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADQ06306.1"
FT                   /translation="MLAKVLTSSYLGIKGYIVTVETDMSNGLPSFDIVGLPDVTIKEAK
FT                   ERIRVAIKNSGFDFPNRKIIVNLAPASTRKEGSSFDLPVAISVLKSSEQISPKISPQEI
FT                   AIIGELSLDGSVKRVDGALLMTIAALENGIKKIIVPYENRAECGVVRGIDVFPVKTLKE
FT                   AVEILDNPQSATPHKVEIDEMNLLDTFTYDVDFSEVKGQEYVKRAVEVAVAGMHNLLLI
FT                   GPPGSGKTMIAQRIPTILPQMTFEESLEVTKIYSCAGLLKDGQALVTARPFRSPHHTSS
FT                   SIAIIGGGKVPKPGEVSLAHNGVLFLDEFPEFDKKTIEVLRQPLEDGYVTISRVNASIE
FT                   YPARFMLVCAMNPCKCGYFLSDERECTCTPAQIKQYLGRISGPILDRIDVQVEVKSVKL
FT                   ENFNSSICKDSAAMRKEVERARQIQLERFKGLGIFYNSQMKGSLVNKFCKLSKKEKQLL
FT                   EKAFNTLGLSLRGYTKILKVARTIADLEESEEIKAEHLQEAISYRLLERRLI"
FT   gene            complement(620233..621048)
FT                   /locus_tag="Calhy_0566"
FT   CDS_pept        complement(620233..621048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0566"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: ate:Athe_2192 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06307"
FT                   /db_xref="GOA:E4QCT8"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCT8"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADQ06307.1"
FT                   /translation="MLQYEFMQRAFLAGVLVSIMTSLAGNFLVLKRFSQMGDSLSHTAI
FT                   VGVAAALLLNFSPTIGAIVSTVAFALAIEYFKSRFKRFEEVSLALVSITALGLASVLFG
FT                   ILKSSSNLMSFLFGSIVTIGNEDVWIILAVCLVTVTFIAMFRKRLILATFDEVSAKVSG
FT                   INTKLLDFLLSIVSATIIAVSIKIVGGLLISSLIVFPTAIAMRFSKNFKMLQVVSLSVS
FT                   LIAIISGLTSSYYIDIPPGGATVLIFVLIFFIAEIINIARKRSLAKTFK"
FT   gene            complement(621068..621820)
FT                   /locus_tag="Calhy_0567"
FT   CDS_pept        complement(621068..621820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0567"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2191 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06308"
FT                   /db_xref="GOA:E4QCT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCT9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ06308.1"
FT                   /translation="MIELIDVNFYIDQKRILKDINLKIQKGEFAAIVGPNGSGKTTLLN
FT                   IISGIYTPTSGKRLIFGKQHLTPQDRQKISFVPQKVTNFNQSFPLSVFETVLLGLVPKK
FT                   GLLQRFSKQDFEKAESILEKLQIKQLKNRLIGQLSGGQQQRVFLARALISDPQILLLDE
FT                   PTVGIDSLSEQLLFEILGEKKKEGTTILMVTHDVYAVTQHADTIICMGDGMIYTACSAK
FT                   DFSPSKFESVYKYKIKKIEHRHSYTKKE"
FT   gene            complement(621844..622707)
FT                   /locus_tag="Calhy_0568"
FT   CDS_pept        complement(621844..622707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0568"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   ate:Athe_2190 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06309"
FT                   /db_xref="GOA:E4QCU0"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCU0"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADQ06309.1"
FT                   /translation="MKRIKLLFIVLLVSTIVFLSGCKNEALTTTKGTVYTTIYPLYSIT
FT                   KLIAGQKLTVEKLVKDGAEIHSFEPSSRDIAKLTSAKAVIYLGLVDEWVKKPLEGTKVK
FT                   IFRASEGIEFIDSDPHIWTSPRLLKKIARNIENALISLDPKNKSYYQENASKLIASLDK
FT                   LDKEFSSVVKSSKRKEFLIAHPSFGYLARDYSLKQYSITGVNEEEEPSAQKMKEIVQLI
FT                   KEKNIKYILVDPNENLPAVKTIAKDTGVKIVNIYGMGIVNSSQAKNETILSLMEKNLKA
FT                   FEMVLK"
FT   sig_peptide     complement(622633..622707)
FT                   /locus_tag="Calhy_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.235 at
FT                   residue 25"
FT   gene            complement(622707..623129)
FT                   /locus_tag="Calhy_0569"
FT   CDS_pept        complement(622707..623129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0569"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: ate:Athe_2189
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06310"
FT                   /db_xref="GOA:E4QCU1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCU1"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADQ06310.1"
FT                   /translation="MKHQDVKSILNSHNIKATRQRVEIYKVLQNSQQCLSADEILQLLK
FT                   TQNLNIDLATVYRNLELFVQNGIAVKSTINRKHFFEIKKSSHHHYFVCIKCNAKAEIVD
FT                   CKINLIEEELNKMNFKILDHNLEVYGICDKCCGREE"
FT   gene            complement(623283..623600)
FT                   /locus_tag="Calhy_0570"
FT   CDS_pept        complement(623283..623600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0570"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: ate:Athe_2186 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06311"
FT                   /db_xref="GOA:E4QCU2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCU2"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADQ06311.1"
FT                   /translation="MTRLNEILYALSDTTRLRILNILAHREQNVSSLVQLIQESQPKVS
FT                   RHLAYLKNVGLIEARNHAQKRIYSIKEDVFEKYPFLKALIQDLAKVDIFANDLRLLSSL
FT                   S"
FT   gene            623766..625163
FT                   /locus_tag="Calhy_0571"
FT   CDS_pept        623766..625163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0571"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: ate:Athe_2185 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06312"
FT                   /db_xref="GOA:E4QCU3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCU3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADQ06312.1"
FT                   /translation="MELPKKIIGEAVLKQVIRYLANNPEENIGKILDLTEKIVRRDRDK
FT                   WYIQSAKKYLLDPNSSWHHYAMRIIKETNPRVRERILINFFLNAGFIGVPKQLELIKKY
FT                   DINIPYAILIDPTAACNLHCKGCWAGEYHKAAKLDYEILDRVVKEAQELGIYFIIFSGG
FT                   EPLLRKDDILKLCEKYEDTVFLSFTNATLIDDDFIDKVAKVGNLAFAISIDGFEKSTDE
FT                   RRGQGVFKKVVTAMEKLKEAGVVFGFSTTYHRYNVEEVSSDEYIDFLIEKGAKFGWYFT
FT                   YVPVGKDADISYMATPEQRAYMYKRIEEIRWSKPIFVLDFWNDGEPAGGCIAGGRRYLH
FT                   INANGDVEPCAFIHFSNVNIKECSLLDALKSPLFMAYRRNIPFNENHLRPCPMIDNPLK
FT                   LKKIVEESGARPTQIGGETETAEELANKLIEYSEAWGRVADKLWEQRKQGIPQNKVDLS
FT                   VIQEIKS"
FT   gene            complement(625195..625824)
FT                   /locus_tag="Calhy_0572"
FT   CDS_pept        complement(625195..625824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0572"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   ate:Athe_2184 protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06313"
FT                   /db_xref="GOA:E4QCU4"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCU4"
FT                   /inference="protein motif:PFAM:PF02660"
FT                   /protein_id="ADQ06313.1"
FT                   /translation="MKMKEFVFYSLAFLIGSIPFSYIITKKFFNKDITHFYDNNPGATN
FT                   AFRVAGIKAGIPSLILDISKGYFTIYIANTIFYSQKLPVYVCAFMVVLGHAYSIFLKLK
FT                   GGKSIASTMGILLFLYGFLPVIFFCLGTFFGLLVFRKDNIGTVLGIWSVILFAMLFNAN
FT                   ANDIIFLSMLCLFLTYRQLRTPSIPIDIIKEIKNTIKKASHPFLGK"
FT   gene            625920..627275
FT                   /locus_tag="Calhy_0573"
FT   CDS_pept        625920..627275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0573"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   ate:Athe_2183 protein of unknown function UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06314"
FT                   /db_xref="GOA:E4QCU5"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCU5"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ADQ06314.1"
FT                   /translation="MKKIRDGVYTNDYAIFFMTEEILKDLDEGVLQQAKNASQIPNVEF
FT                   LGYTPDAHIGKGTSIGTIIVWDMSKAWISPTIVGVDIGCGMRLILTDKFADDIDKALLK
FT                   RIMDEVEDLIPTGVGKKNKKIALSKAKYEEYLQNTEIDKDISDKMVLIHEFDLDTIPDE
FT                   AYEIGKEQFATLGGGNHFIEFQKLHVIDKIIAEKWGLFDGQFVVMIHSGSRRFGAVIGD
FT                   YYQKKFKDVMKSKGITTPDPQLTFLPIDNKVAKDYIKAMQSAAIYAKINRHYMSNFIIS
FT                   VLEKHSIDAWVLYDVAHNIAYMERFANREKLVIRKGATRALPPNHYLIPNPKFADTGHP
FT                   VILPGSMGSSSYLMRGIQDNIISYHTVNHGAGRVLSRTKAKKTISIDEFSKALKQGQDG
FT                   EILINTKNLKDFLDESPQSYKDIELVINSVITSRLATPVAKMEPLGVIKGKD"
FT   gene            627307..628404
FT                   /locus_tag="Calhy_0574"
FT   CDS_pept        627307..628404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0574"
FT                   /product="DNA protecting protein DprA"
FT                   /note="KEGG: ate:Athe_2182 DNA protecting protein DprA;
FT                   TIGRFAM: DNA protecting protein DprA; PFAM: SMF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06315"
FT                   /db_xref="GOA:E4QCU6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCU6"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ADQ06315.1"
FT                   /translation="MNREELIYSLWLYSIKGIGPKKFRQIKNKYKTLKEAYFNRKELEV
FT                   EGIFGHLKDEIKNSDTAEAEKILEFCERNSINIILEDDRLYPDEFKVFDHAPVMLFVKG
FT                   DAKLLKFPRKISMVGTREPTYYGKRVAKELASLLASLGILVVSGMARGIDSFCHTGALE
FT                   NGKTVAVLGCGVDIVYPKENLKLYRQIIENGCVVSEFLPGTLPEKMNFPQRNRIVAMFS
FT                   PCLVVIEASTKSGTFSTVDFALEQGKEVFAVPGNIFSQKSSGTNRLIKEGARIICSYED
FT                   FLEDIKEIYSLKPAQLSFADKEDEEELTDDEKRLIKLLDENGEMHVESLIALTGWDPGK
FT                   IASLITSLEIKSKVVRDRGNIISKL"
FT   gene            628435..630516
FT                   /locus_tag="Calhy_0575"
FT   CDS_pept        628435..630516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0575"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain protein;
FT                   TIGRFAM: DNA topoisomerase I; KEGG: ate:Athe_2181 DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain protein; DNA topoisomerase
FT                   type IA zn finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06316"
FT                   /db_xref="GOA:E4QCU7"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCU7"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADQ06316.1"
FT                   /translation="MKKLVIVESPAKAKTIAKYLGKEFKVEASMGHVRDLPKSDLGVDI
FT                   ENGFAPKYINIRGKADVINRLKKSAESAEKVYLATDPDREGEAISWHLATILGLDVNDN
FT                   VRITFNEITKKAVQESLKNARPIDQNLVNAQQARRVLDRLVGYKLSPFLWEKVKGGLSA
FT                   GRVQSVATRLVVEREEEIENFKPEEYWTLEAVFKKDAQEFKAKFYGDKKGKIELKNQGQ
FT                   VQEIEEKIKNKEFKVVKIKVSEKKKNPPPPFITSTLQQEASRKLRFTPAKTMAVAQMLY
FT                   EGVEIKGEGSVGLITYMRTDSTRISEEAQQAARNLILQKFGKEYLPEKPRVYKTKKDAQ
FT                   DAHEAIRPTYLDMDPESIKDSLTPDQYKLYKLIYDRFLASQMESSIYEVLSAELEVEGY
FT                   IFKLTGSKLKFAGFMEVYVEGKDTEDEEEENQLPEIREGEVLKPIKLESKQHFTQPPSR
FT                   YTEATLIKALEEKGIGRPSTYAPTIQTILERGYVVKEDRFLKPTELGKLVTNILKEYFK
FT                   DIIDIEFTAELESNLDKIEEGKLEWTEVVRKYYQPLEKELEIARATLLKVKVEDEETDI
FT                   VCENCGRKMVIKKGRYGKFLACPGYPECKNTKPYYDYLDVLCPKCGKRVIEKKSKKGKR
FT                   YYTCEGYPDCDLILWEKPAKNCPKCGSLMFEKGRKGNRKLVCSNENCAYEEKIGEKGE"
FT   gene            630522..631832
FT                   /locus_tag="Calhy_0576"
FT   CDS_pept        630522..631832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0576"
FT                   /product="gid protein"
FT                   /EC_number="2.1.1.74"
FT                   /note="TIGRFAM: gid protein; KEGG: ate:Athe_2180 gid
FT                   protein; PFAM: glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06317"
FT                   /db_xref="GOA:E4QCU8"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCU8"
FT                   /inference="protein motif:TFAM:TIGR00137"
FT                   /protein_id="ADQ06317.1"
FT                   /translation="MEIVVIGAGLAGVEAANVITKFGIKVKLFEMKPKKFSPAHKIDTF
FT                   AELVCSNSLKSKLLTNASGLLKEEMKVFGSLVMEAAQATSVEAGQALAVDRYKFSEYIT
FT                   QKIKQNELIEVIHEEVTEVPRDKVVVVCTGPLTTESLLSDISKLCSSKNLYFFDAAAPI
FT                   VLKDSIDFSKAFFASRYNKGSNDYINCPMTKEEYERFYWELVNAEVIEVKDFEKDLLFE
FT                   GCMPIEEMARRGIDTIRFGPLKPVGIIDPRTGKMPYAVVQLRKDTQDGKLYNMVGFQTR
FT                   LKWGEQKRVFRLIPGLENAEFVRYGVMHKNSYINSPEVLTKYLFLKKYPNIFFAGQITG
FT                   VEGYLESAATGIIAGINAARQVLGKEPVSLPPNTCIGALIEYITTPKKDFQPMNANYGI
FT                   ISIDNEIAKVKDKEKRKLLIAQKSLDICKEVANEIFE"
FT   gene            631856..632386
FT                   /locus_tag="Calhy_0577"
FT   CDS_pept        631856..632386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0577"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   ate:Athe_2179 20S proteasome A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06318"
FT                   /db_xref="GOA:E4QCU9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCU9"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ADQ06318.1"
FT                   /translation="MFHATTIVAVKKGESVAIAGDGQVTFSQNMIMKSTAKKVRKLYNG
FT                   RVLVGFAGSVADAITLCEKFEEKLEQNSGNLQKSVVELAKEWRQDKVLRRLEALMVVAD
FT                   KEHLFVVSGSGEVVEPDDNIAAIGSGGPYALAAARALLQSTDLSAAEIAKKALEIAASI
FT                   CVYTNNNITVLEL"
FT   gene            632397..633794
FT                   /locus_tag="Calhy_0578"
FT   CDS_pept        632397..633794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0578"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; Clp ATPase-like;
FT                   KEGG: ate:Athe_2178 heat shock protein HslVU, ATPase
FT                   subunit HslU; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06319"
FT                   /db_xref="GOA:E4QCV0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCV0"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ADQ06319.1"
FT                   /translation="MMELTPQEIVRELDKYIVGQERAKKCVAIALRNRYRRAKLPKELQ
FT                   DEITPKNILMVGPTGVGKTEIARRLAKLVNAPFVKVEATKFTEVGYVGRDVDSMVRDLV
FT                   ENAISLVKSEYMERMKERAKALVEDRILEILIPEPQSRKAGFKNPFEALFGATSQEMEQ
FT                   SYQTTDDYIRTQREILREKLRSGELEDKVIEVEVEDTVKPPFEMIMGTISDEMGISFQD
FT                   VFGSLFPKKKKKKKMTIREAREVLEQEEYNKLIDMDEVIKEAIQRAEQHGIIFIDEIDK
FT                   IAGKGSSVGPDVSREGVQRDILPIVEGSTVMTKYGPVKTDHILFIAAGAFHVAKVSDLI
FT                   PELQGRFPVVVELNPLTEEDFKKILTQPKNAIIKQYIELMKTEGVNITFTDDAIEAIAK
FT                   VAVKINEQSENIGARRLHTVVEKIMEDISFEYANVEKPVDLVIDKDYVYSKVSDIIKDK
FT                   DLSRFII"
FT   gene            633844..634638
FT                   /locus_tag="Calhy_0579"
FT   CDS_pept        633844..634638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0579"
FT                   /product="GTP-sensing pleiotropic transcriptional repressor
FT                   CodY"
FT                   /note="PFAM: Helix-turn-helix CodY domain protein;
FT                   GTP-sensing transcriptional pleiotropic repressor CodY;
FT                   KEGG: ate:Athe_2177 GTP-sensing pleiotropic transcriptional
FT                   repressor CodY"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06320"
FT                   /db_xref="GOA:E4QCV1"
FT                   /db_xref="InterPro:IPR010312"
FT                   /db_xref="InterPro:IPR013198"
FT                   /db_xref="InterPro:IPR014154"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCV1"
FT                   /inference="protein motif:PFAM:PF08222"
FT                   /protein_id="ADQ06320.1"
FT                   /translation="MQQSLLEKVRKLNRVIQSKDKEVLDFDRLCSVVGDVTDSSVFFID
FT                   KDGRVICKYIMPFVNVDIKLSEEKKIGDNLQKFFWWFVDTRANMKFSDITRIAEIENKV
FT                   GSEKELLCTSVPVIGGGRRFGTVLAFKSFSAFTEEDIIVLEYASTVIGLELLNLSKEED
FT                   EEEKKKREMIKSAIETLSVSELEALVHIFDELKGNEGLLVASRIADKVGITRSVIVNAL
FT                   RKFESAGLIETRSLGLKGTYIKVLNEMVRDEIQKQKEKLKLK"
FT   gene            634794..635192
FT                   /locus_tag="Calhy_0580"
FT   CDS_pept        634794..635192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0580"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="KEGG: ate:Athe_2176 flagellar basal-body rod protein
FT                   FlgB; TIGRFAM: flagellar basal-body rod protein FlgB; PFAM:
FT                   flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06321"
FT                   /db_xref="GOA:E4QCV2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCV2"
FT                   /inference="protein motif:TFAM:TIGR01396"
FT                   /protein_id="ADQ06321.1"
FT                   /translation="MINMFDKIDLYKKALDWAWKRNEIISNNIANADTPGYKAKDLNFE
FT                   AYLQRSLNQEEGLQLFTTNERHIKESSSPDNSIEVLDSSLQMRLDQNTVDIEQEMGKLL
FT                   QNSLYFDGVSLQLSREINKWKTVIKEGR"
FT   gene            635199..635642
FT                   /locus_tag="Calhy_0581"
FT   CDS_pept        635199..635642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0581"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="KEGG: ate:Athe_2175 flagellar basal-body rod protein
FT                   FlgC; TIGRFAM: flagellar basal-body rod protein FlgC; PFAM:
FT                   protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06322"
FT                   /db_xref="GOA:E4QCV3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCV3"
FT                   /inference="protein motif:TFAM:TIGR01395"
FT                   /protein_id="ADQ06322.1"
FT                   /translation="MGMFDAINISSSALTAQRVRMDVIAQNIANANTTKTENGQPYRRK
FT                   VVVFEERRQSFAEILSQKIGQAQASSYGGVRVKAILEDPSPFKKVYDPTHPDADQNGYV
FT                   NYPNVDIVTEMVNMIEASRSYEANVTALNITKSMITRTFEIGK"
FT   gene            635663..635977
FT                   /locus_tag="Calhy_0582"
FT   CDS_pept        635663..635977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0582"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="KEGG: ate:Athe_2174 flagellar hook-basal body
FT                   complex subunit FliE; TIGRFAM: flagellar hook-basal body
FT                   complex subunit FliE; PFAM: flagellar hook-basal body
FT                   complex protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06323"
FT                   /db_xref="GOA:E4QCV4"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCV4"
FT                   /inference="protein motif:TFAM:TIGR00205"
FT                   /protein_id="ADQ06323.1"
FT                   /translation="MVGNINFDSITKAFEKQFSSINTNSASTQNSQVSFVDFLYKALEG
FT                   VDGLQKEADYQNNLFLLGLSANPQDAIVASEKASIALQLTLQIRNKILDAYNEIMRMQV
FT                   "
FT   gene            636010..637692
FT                   /locus_tag="Calhy_0583"
FT   CDS_pept        636010..637692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0583"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="KEGG: ate:Athe_2173 flagellar M-ring protein FliF;
FT                   TIGRFAM: flagellar M-ring protein FliF; PFAM: Flagellar
FT                   M-ring domain protein; secretory protein YscJ/FliF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06324"
FT                   /db_xref="GOA:E4QCV5"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCV5"
FT                   /inference="protein motif:TFAM:TIGR00206"
FT                   /protein_id="ADQ06324.1"
FT                   /translation="MPQFLNDFLKNIKEKWSSLSKSQKIMLVVSSSIILLSVIAAIYIT
FT                   TRPHYVTIFSGLDPKEAAEIQNILSEQKIDSKAANGGTTILVRDTDVDRAKMAAAQAGY
FT                   PKNSSITFEDALKLSSSMTATEADKRRTFIKLKESEIQQALKQMSDYIEDAVVNLSIPE
FT                   DYTFALKSEATKPTASVKLTLKKSLSSDQIEGIQRFVAASVEGLLPENVVIIDNKGNYL
FT                   SSNSSDTTEGLSSKQLQLKIATKNEIEKKVKELLGSYVSSPEDVKVSVNLDMNFDMQKI
FT                   SETKYSPVLEDSGIVVSKKTTKEEAQSTNSSSSGVPGTDTNPTQNTTQYPISSQGGQST
FT                   YTKTDETVNYQNNEKKIETIKAPGTINYDKSSIAVVLYRYVTYTQEDFEKSDQAKNMSW
FT                   AQFKLQNQNNKRSFLTDQKEVETIVNLIKSATGIQNVTVEGYEIPTFVDKPQRQIPVDY
FT                   IYVALAFLLLMVFAASLLIKASKSKPRTVELAGVGPVEISEEKPVAEEILQEAEKRKKA
FT                   EVEEINVEEFGVSQYEKQIDKLLKEKPEIVAQLLRNWLNEDWE"
FT   gene            637702..638709
FT                   /locus_tag="Calhy_0584"
FT   CDS_pept        637702..638709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0584"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="KEGG: ate:Athe_2172 flagellar motor switch protein
FT                   FliG; TIGRFAM: flagellar motor switch protein FliG; PFAM:
FT                   flagellar motor switch protein FliG; MgtE intracellular
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06325"
FT                   /db_xref="GOA:E4QCV6"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCV6"
FT                   /inference="protein motif:TFAM:TIGR00207"
FT                   /protein_id="ADQ06325.1"
FT                   /translation="MVKSGISGKQKAAMLLIALGPERSAKIFKHLKEEEIEELTLEIAN
FT                   IRTVSPEQKQAILEEFYNLCLAQEYIAEGGIDYAKEVLEKALGPEKAREVIEKLTVSLQ
FT                   VRPFDFIRKADASQILNFIQNEHPQTIALVISYLKPQQAAQVLASLPQEKQADVARRIA
FT                   LMDRTSPDVIREVEKVLEKKLSSVVMQDYTVVGGIQAIVDILNAVDRGTEKRILEALEL
FT                   EDVELVEEIRKRMFVFEDIVKLDNRSIQRILREVENNTLAIALKGTTEEVRKVIFSNMS
FT                   KRMAEMIQEDMEYMGPVRIRDVEEAQQKIVNIIRKLEDAGEIVISRGGGDEIIV"
FT   gene            638702..639457
FT                   /locus_tag="Calhy_0585"
FT   CDS_pept        638702..639457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0585"
FT                   /product="H+-transporting two-sector ATPase, E subunit"
FT                   /note="KEGG: ate:Athe_2171 H+-transporting two-sector
FT                   ATPase, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06326"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCV7"
FT                   /inference="similar to AA sequence:KEGG:Athe_2171"
FT                   /protein_id="ADQ06326.1"
FT                   /translation="MSNVIRNNQVLIQNPVETNYKVLLEKLIKARAEIEHYERRLKEQE
FT                   EEFEKQKNRAEVLQKEAEEVLKKAKEEAQRIVDEANVRAQLILQQAQEDGYREGFEKGL
FT                   LDAQKEYGKMLENIEIQKAMILKEREDILKDLESKVLILVPQILEKVLEREIKDRSFLE
FT                   QYIKNAILQLSIRSSLTIRVSEEDFGYVNEKLDEILQGIDGIDKVDVKIDKALKSGDVL
FT                   IETPYGFVETGVRMRLEKIQEIVLSMIGD"
FT   gene            639459..640754
FT                   /locus_tag="Calhy_0586"
FT   CDS_pept        639459..640754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0586"
FT                   /product="ATPase, FliI/YscN family"
FT                   /note="TIGRFAM: ATPase, FliI/YscN family; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; KEGG: ate:Athe_2170 ATPase, FliI/YscN
FT                   family; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06327"
FT                   /db_xref="GOA:E4QCV8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR013380"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022425"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCV8"
FT                   /inference="protein motif:TFAM:TIGR01026"
FT                   /protein_id="ADQ06327.1"
FT                   /translation="MIEKLKSKIENANFYQFTGFVNQVIGLTIESQGPAVSIGTLCRIK
FT                   AAKTETLAEVVGFKENKVLLMPYSDLVGVFPGCKVIAQDSMFEVKVGKELLGRILDGLG
FT                   QPIDGKGEIKSKIKYPVENRAPNPLERPRIDTIMPLGIKAIDALLTIGKGQRVGIFAGS
FT                   GVGKSTLLGMIARNAKADVNVLALIGERGRELKEFLEKDLKEEGLKRSVVVVATSDESA
FT                   LKRVKAAYVAMAIAEYFRDQGLDVLFLMDSLTRFAMAQREIGLAVGEPPVSRGYTPSVF
FT                   SVMPKLLERAGKNKRGSITALFTVLVDGDDFNEPITDTARGILDGHIVLSRAIANKNHY
FT                   PAIDVLASISRVMNDIVEPSHRELANETKRVLAVYRETEDLINIGAYTKGSNPEIDRAI
FT                   ELVPRINQFLRQEVDERFDFEEEIEMLKAIIS"
FT   gene            640783..641241
FT                   /locus_tag="Calhy_0587"
FT   CDS_pept        640783..641241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0587"
FT                   /product="flagellar export protein FliJ"
FT                   /note="TIGRFAM: flagellar export protein FliJ; KEGG:
FT                   ate:Athe_2169 flagellar export protein FliJ"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06328"
FT                   /db_xref="GOA:E4QCV9"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCV9"
FT                   /inference="protein motif:TFAM:TIGR02473"
FT                   /protein_id="ADQ06328.1"
FT                   /translation="MERFRFEQLLKIKTQFEEIKKSELAKQNQILNEYIAKKLELEENA
FT                   KKVKEDLKSLCLNGFSPQQMKVYSQFLSMLKKRVDVQNQLIYYQQIRVEEKKKEVIESM
FT                   IEKKKFEKLKEKYLINLMNEIKQLENKELDRVVSYKIYKGIGDRSGRD"
FT   gene            641228..642049
FT                   /locus_tag="Calhy_0588"
FT   CDS_pept        641228..642049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06329"
FT                   /db_xref="GOA:E4QCW0"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCW0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2168"
FT                   /protein_id="ADQ06329.1"
FT                   /translation="MAETKVVEDLTTENKPKKKEKKKRKGLLIFLIIFLILAGASFAAV
FT                   YFNLFGAKNALDVFLKKTPFAKSTNKTQTVDMQKVYEKQIADLQKQKEALKSKLSLLEK
FT                   QNANLQKQIEDLTVKITDLTSKQLDAQNKTKYFASLLQNMDSKKAAKILENLLDTDSQV
FT                   ANDVLSAIPSETASEILSNIAPEKTIKLLGISNSNQKTNSEDISILTNIYKNIDPKVAA
FT                   SIFENMMSDNTKYALVIRILKSLDTKTSSQIISNMSAENAAKVTSSLSALR"
FT   sig_peptide     641228..641359
FT                   /locus_tag="Calhy_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 44"
FT   gene            642094..643635
FT                   /locus_tag="Calhy_0589"
FT   CDS_pept        642094..643635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0589"
FT                   /product="Flagellar hook-length control protein-like,
FT                   C-terminal domain protein"
FT                   /note="PFAM: Flagellar hook-length control protein-like,
FT                   C-terminal domain; KEGG: ate:Athe_2167 flagellar
FT                   hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06330"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCW1"
FT                   /inference="protein motif:PFAM:PF02120"
FT                   /protein_id="ADQ06330.1"
FT                   /translation="MGTQSIVNTSMLFFKTPTATSKTKDRQESSISFKDVFKKTSGDAG
FT                   DVDNKSSVLPRKVVTGSCRAAIVSSQGQAQKDKANFQEDKPFSQELPNGTSSDLENQVQ
FT                   PQVLQAQMMEFLQLIFNLLQSGESLDKFNLEQLFQNSSIQGTDFLNLQLRSVQMDMNLA
FT                   QYLNLNANLSDKIAISELLQNIVQKIEQKTQNQQVLSFSFVQGNGITTENIFKLLEELI
FT                   FGKEGQKPFFEVKSDDSSLLKSLRNLFAQEGQSFKVLSEANDGAEILEQVLKELENIVK
FT                   KSNDQKTVNSFNLENSEKVEIGEKGTSNFNGIGSNDNDFNKVFSTLLRKENNTSVNDEK
FT                   GESKTLDLRQHAFAFQNKVENIENTMSYQDNKRIKELRMSIISQLADKISVINKQNLTT
FT                   LQVSIKPEWLGSVVIELSKDSSGKIFGNLIVTTPQVKEIIEGSLSNLLTILKDQGINIS
FT                   QLNVSLGGNSTGQQYQEQQRFSQRRNLVVQGNEDSSRSIESLIYEMSESILNLRA"
FT   gene            643647..644141
FT                   /locus_tag="Calhy_0590"
FT   CDS_pept        643647..644141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0590"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   ate:Athe_2166 flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06331"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCW2"
FT                   /inference="protein motif:PFAM:PF03963"
FT                   /protein_id="ADQ06331.1"
FT                   /translation="MADMMVSSNTNVSNSTQSLAASSAKNVLGKQEFLNLLVTQLRYQD
FT                   PLKPMEDKEFVAQLAQFSALEQMQNLNESVELLKAQSMIGRYVVATSPQDASKLIEGRV
FT                   DSIKIDGSKVYLKVNGTEVLSDNVKEVYHTYSEEILSSILNKVPSKEDLLEILSSLQKG
FT                   E"
FT   gene            644147..644506
FT                   /locus_tag="Calhy_0591"
FT   CDS_pept        644147..644506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0591"
FT                   /product="flagellar operon protein"
FT                   /note="TIGRFAM: flagellar operon protein; KEGG:
FT                   ate:Athe_2165 flagellar operon protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06332"
FT                   /db_xref="InterPro:IPR013367"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCW3"
FT                   /inference="protein motif:TFAM:TIGR02530"
FT                   /protein_id="ADQ06332.1"
FT                   /translation="MIVNNIRGITGGKHEGFVSTTPKQATESFAGILSSSLKISKHASE
FT                   RLKFQNINLDEATLGKLEEALKKAEQKGLKNDVLVLDGDRAYIVNIKNKVIVTVKDMSS
FT                   LKDNIFTNIDGVLMI"
FT   gene            644632..646092
FT                   /locus_tag="Calhy_0592"
FT   CDS_pept        644632..646092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0592"
FT                   /product="fagellar hook-basal body protein"
FT                   /note="KEGG: ate:Athe_2164 protein of unknown function
FT                   DUF1078 domain protein; TIGRFAM: fagellar hook-basal body
FT                   protein; PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body FlaE domain protein;
FT                   flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06333"
FT                   /db_xref="GOA:E4QCW4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCW4"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADQ06333.1"
FT                   /translation="MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFASVF
FT                   ASVLKSASAPDTASGRGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFF
FT                   VVGGDGRAPRFTRAGNFSLDKMGNLVTATGLNVLGWMYDPVNNQIDTTKSPSKINILAF
FT                   PTLPPKATDKISFDGNLSADTKIYSGQITNYEDLLNVPADSKYSTSFKIYDSQGKEHTL
FT                   QLTFVKTSDNTWEWFVDAPRVKKNIGTAQNPDEKYVYVDEMLDANNDYDNFIARGTITF
FT                   GQAGKVLDDENTTDVEGIAITGGRITGNGTFTIKFKNDVVNPITFKVNSAEFDVNDNTN
FT                   IAFFLKNITQFGNMESSIRVAQMTGYSAGSLQGFNVDASGKITGVYSNGLNQLIGQIAI
FT                   ATFANPAGLQRIGDNLYINTVNSGDPEIGTPGSGSRGTISQGTLEMSNVDLAKEFTDMI
FT                   VTQRGYQANARVITASDELLQDLVNIKR"
FT   gene            646213..646440
FT                   /locus_tag="Calhy_0593"
FT   CDS_pept        646213..646440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0593"
FT                   /product="flagellar FlbD family protein"
FT                   /note="PFAM: flagellar FlbD family protein; KEGG:
FT                   ate:Athe_2163 flagellar FlbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06334"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCW5"
FT                   /inference="protein motif:PFAM:PF06289"
FT                   /protein_id="ADQ06334.1"
FT                   /translation="MIKLRRINNKEFVVNADFIEFVESTPDTVITLTNGVKLVVKESVD
FT                   EVIEKVIEYKKRIFEGIIFNIQPLQKEHEG"
FT   gene            646437..646907
FT                   /locus_tag="Calhy_0594"
FT   CDS_pept        646437..646907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0594"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: ate:Athe_2162 flagellar basal body-associated protein
FT                   FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06335"
FT                   /db_xref="GOA:E4QCW6"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCW6"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ADQ06335.1"
FT                   /translation="MKGEKMNSIILILLVLLLLMMVGMGIGFLTVVKNLSPTSSAAKTT
FT                   PVEKKPEKLYTYDVNDGKALMSNLQDTQTNAGRIIRVTVQLEVTDKKLPETMKEKNIVI
FT                   ADIIDSVLRSKTADELLKPEGKEKVRKEIKDRLNEIFENKVYNVNFGEFIIQ"
FT   sig_peptide     646437..646514
FT                   /locus_tag="Calhy_0594"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.226 at
FT                   residue 26"
FT   gene            646930..647919
FT                   /locus_tag="Calhy_0595"
FT   CDS_pept        646930..647919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0595"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="KEGG: ate:Athe_2161 flagellar motor switch protein
FT                   FliM; TIGRFAM: flagellar motor switch protein FliM; PFAM:
FT                   flagellar motor switch protein FliM; surface presentation
FT                   of antigens (SPOA) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06336"
FT                   /db_xref="GOA:E4QCW7"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCW7"
FT                   /inference="protein motif:TFAM:TIGR01397"
FT                   /protein_id="ADQ06336.1"
FT                   /translation="MGDILSQSEIDELLRSLTSGELSIEEIQKPKQEKNIRVYDFKRPS
FT                   KFAKDHLRTLQMIFENYARIVTTFLSGYLRTVVQMDVLSVEQLTYYEFSNSLSNPVVMG
FT                   IVNFSPLKGSIVFEMAPEIAFAMIDRVLGGFGKGIDKVRTFTEIELVLIERLLQQLINY
FT                   FQEAWENIVDLRPRLEKIETNPQFTQIVSPNETVALVTIAMKVGEVEGMANICLPHMVI
FT                   EPIMPRLSTKFWFSTSAKETSEETKEYLQKKIERTRVTVKAVLGRTQITVREFLELQVG
FT                   DVLRLDRRKNQEIEVFVGNKLKFYGVPGRKEGRIAVKITRVEEGEDFR"
FT   gene            647916..649046
FT                   /locus_tag="Calhy_0596"
FT   CDS_pept        647916..649046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0596"
FT                   /product="CheC, inhibitor of MCP methylation / FliN fusion
FT                   protein"
FT                   /note="KEGG: ate:Athe_2160 CheC, inhibitor of MCP
FT                   methylation / FliN fusion protein; TIGRFAM: flagellar motor
FT                   switch protein FliN; PFAM: surface presentation of antigens
FT                   (SPOA) protein; CheC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06337"
FT                   /db_xref="GOA:E4QCW8"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCW8"
FT                   /inference="protein motif:TFAM:TIGR02480"
FT                   /protein_id="ADQ06337.1"
FT                   /translation="MSDLLSQDEIDALLRGMSETSSSPTISDQDKDVLGEIGNISMGTA
FT                   ATTLSILLNQKVNITTPIVSVLKWEELPKEFPVPYVAIKVVYKEGLDGVNLLILKKEDV
FT                   EIIADLMMGGTGQIEFTEELTELQLSAIQEAMNQMVGSASTSLSSMLNLKIDINPPEAF
FT                   VIDFAQNAEEMIPELKRADEIVKVAFRMTIGDLIDSQIMQLIPVDFAKQLVDAMLKNAL
FT                   GTPAQIETSAQSQQESVKEEVLRQPSSQPTKSQKAAPQPSYTPPPKKEQPQQVYNVSPV
FT                   QFESFDEEEERRYPENIELILDVPLEITVELGRTQKLVREILEFSTGSIIELEKLAGEP
FT                   VDILVNGKVIAKGEVVVIDENFGVRITDIVNPSNRL"
FT   gene            649133..649495
FT                   /locus_tag="Calhy_0597"
FT   CDS_pept        649133..649495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0597"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: ate:Athe_2159 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06338"
FT                   /db_xref="GOA:E4QCW9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCW9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ06338.1"
FT                   /translation="MAKRILIVDDAAFMRMMLKDIITKNGYEVAGEAENGAKAVEMYKE
FT                   LKPDLVMMDITMPEMDGIQAVREIKKIDPQAKIIMCSAMGQQAMVIESIQAGARDFIVK
FT                   PFQAERIVEAIKKVLG"
FT   gene            649528..649923
FT                   /locus_tag="Calhy_0598"
FT   CDS_pept        649528..649923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06339"
FT                   /db_xref="GOA:E4QCX0"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCX0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2158"
FT                   /protein_id="ADQ06339.1"
FT                   /translation="MELGFRVVLALGAICLLIYITYYVLRIVNKKMFGRKGEFLKVIDL
FT                   LPLSQDSMLVLVEIGDKVILLGKTQKSITFLKEFSKDQLLNFEEQHQSFKKIIDNQMNS
FT                   SFDLKNKVLNLYNLIKDSEGKEDDEKK"
FT   gene            649907..650668
FT                   /locus_tag="Calhy_0599"
FT   CDS_pept        649907..650668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0599"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="KEGG: ate:Athe_2157 flagellar biosynthetic protein
FT                   FliP; TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06340"
FT                   /db_xref="GOA:E4QCX1"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCX1"
FT                   /inference="protein motif:TFAM:TIGR01103"
FT                   /protein_id="ADQ06340.1"
FT                   /translation="MMKKNKSLYIISTLLLILITACVKKEIAFATASLNINLGSPQNPK
FT                   DVSSALQLIIFLTILTLAPSILIMMTSFTRILIVLGFVRNALGTQQMPPNQILIGLALF
FT                   LTFFVMAPVTDKIYTQAYQPYINGRITSQEALKRAEEPLKEFMLKNTRKKDLDLFVKLS
FT                   NVNPNTNVKDLPLRVVVPAFIISELKSAFEMGFLIYVPFLIIDMVVASILMSMGMLMIP
FT                   PVMISLPFKILLFILVDGWNLVVESLVRSFK"
FT   sig_peptide     649907..649981
FT                   /locus_tag="Calhy_0599"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.692) with cleavage site probability 0.500 at
FT                   residue 25"
FT   gene            650692..650961
FT                   /locus_tag="Calhy_0600"
FT   CDS_pept        650692..650961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0600"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="KEGG: ate:Athe_2156 flagellar biosynthetic protein
FT                   FliQ; TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06341"
FT                   /db_xref="GOA:E4QCX2"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCX2"
FT                   /inference="protein motif:TFAM:TIGR01402"
FT                   /protein_id="ADQ06341.1"
FT                   /translation="MDTTLVLEIARQAILTAFYVAGPILLVSMVVGIVVSILQATTQIN
FT                   EQTLTFVPKLIAIALSLLIFGQWMLTKVVEFTRYLWTNINQFVK"
FT   gene            650982..651764
FT                   /locus_tag="Calhy_0601"
FT   CDS_pept        650982..651764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0601"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="KEGG: ate:Athe_2155 flagellar biosynthetic protein
FT                   FliR; TIGRFAM: flagellar biosynthetic protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06342"
FT                   /db_xref="GOA:E4QCX3"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCX3"
FT                   /inference="protein motif:TFAM:TIGR01400"
FT                   /protein_id="ADQ06342.1"
FT                   /translation="MTDIINTFLNSSYIFFLVLARMSGLFIASPIFGRRNIPAYFKIGF
FT                   AFFLSLLVVTTYRFSYSVPANLLEYIFAVIKEFIVGLLVGYISYMIFSAILLAGQIIDN
FT                   AIGFGMANVIDPMSEIQVPLLGNFLYLYMLVVFFGTDAHHLLIRAVVYSYKLVPIGHES
FT                   FRSEFTWSFLRFFSELFLIGVEISLPILMSMLIVDIILAVLSRAVPQMNVFMVGLPIKI
FT                   AIGFLVLVIILPFMNKMIFVLIDKIAVYTFEFLRGSIK"
FT   gene            651761..652861
FT                   /locus_tag="Calhy_0602"
FT   CDS_pept        651761..652861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0602"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="KEGG: ate:Athe_2154 flagellar biosynthetic protein
FT                   FlhB; TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06343"
FT                   /db_xref="GOA:E4QCX4"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCX4"
FT                   /inference="protein motif:TFAM:TIGR00328"
FT                   /protein_id="ADQ06343.1"
FT                   /translation="MKLKFDIQLFSEASAKTEKATPRKRQEARKRGMVAKSREVTSAFA
FT                   LLISVLFLKFGYSLIIEPLQQGSKYFFSNLNYNLEDVRDASRLLSFIITTSLKMVLPFC
FT                   LTIMFVATIVEWAQSSFLITAQSLKMSFQKINPIEGFKRIFSINSVVELIKSILKVLII
FT                   GYTGYSYTQSFAKKLLEMYEMNVLTIVKFSFDSAINLILWMAVMFFGIAVIDFIFQRQQ
FT                   YEKKLMMTKEEVKEEFKQTEGNPQIKSKIRERQRRISLQRMFQQLPKADVVITNPTHYA
FT                   VALLYEPEKFDAPRVIAKGKDYIALKIKQEAIKHRIEIVENRELAKALYNMCEIGDFIP
FT                   PELYQAVAEVLAYVYSLKNYQKVNIR"
FT   gene            652858..654894
FT                   /locus_tag="Calhy_0603"
FT   CDS_pept        652858..654894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0603"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="KEGG: ate:Athe_2153 flagellar biosynthesis protein
FT                   FlhA; TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06344"
FT                   /db_xref="GOA:E4QCX5"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCX5"
FT                   /inference="protein motif:TFAM:TIGR01398"
FT                   /protein_id="ADQ06344.1"
FT                   /translation="MNLKGATFSIFAIVIVLSMILPIPPSLLDVLIAINLSLALVIFLN
FT                   SINIKEALDFSVFPSLLLFTTLLRLALNISTTRQILTGQGENVRIVYTFGNFVIGSNIV
FT                   VGVIIFFIIIIIQFIVITRGAERVSEVAARFTLDAMPGKQMAVDADLNAGIITEEEARE
FT                   RRKKIQKEADFYGAMDGASKFVKGDAIAAILITFINALGGLIIGVAMRGEDVTEAIQKY
FT                   LLLSVGDGIAAQIPALLISTATGIVVTKAADASKLSESLIKQLFEFHPKVLYTVGGILA
FT                   ALALIPTMPKLSLFFLSGAMFAMGFRMDSSLKKIESIEEKQVEQKEVEELKKPENVVNL
FT                   LYVDPIEVEFGYGIIPLADKDQGGDLLERVVMIRRQLALELGIIVPTIRLRDNMALKPY
FT                   EYRINIKGVEVARAELMSDSLLAINPGFVTEQIEGIPTKEPAFGLDALWISSSMKERAE
FT                   MAGYTVVDLPSVIATHLTEIIRRHAHELLTRQDVQKLIDNVKETNPVLVDELIPKLMTV
FT                   GEVQKVLANLLKERISIRDMVTILETLADWAPTTKDTDVLTEYVRQAMARYITKKYVSG
FT                   NVLEAIALSPEVEEMIMNSIQKTEQGSFLNLPPDYVQKLINNLSNILEKLVNVSAQPIV
FT                   ICSPIVRIYFRRLIENIFPDVVVLSYNEILPSVQIKTVGMVEF"
FT   gene            654897..656015
FT                   /locus_tag="Calhy_0604"
FT   CDS_pept        654897..656015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0604"
FT                   /product="flagellar biosynthetic protein FlhF"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhF; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   KEGG: ate:Athe_2152 GTP-binding signal recognition particle
FT                   SRP54 G-domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06345"
FT                   /db_xref="GOA:E4QCX6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCX6"
FT                   /inference="protein motif:TFAM:TIGR03499"
FT                   /protein_id="ADQ06345.1"
FT                   /translation="MRIKRYLAHDMQEALIRIKADLGKDAVILSTKKVRQKGLFGFFKK
FT                   PLIEVTAACEDEKIVKKEEESIRQESLALSLQMTQIKELEKKIDSLEKALKEVIKKEQE
FT                   EGISQTKELSKKNFLNVMRENLIKNGVENEIVDMLLSNLSAEASINSVVNNMYKEIKNM
FT                   LGAAAPLSFNSKLPKIVFFVGPTGVGKTTTIAKIAAKLMFEDGKKVGFITADTYRIAAV
FT                   EQLKTYAEIMNIKTKVWYEVDEYDRIIENFSDSDVVLVDTAGRSHKNQEHMDELKAFVT
FT                   KANPDEVFLLLSATTQPSVFKEVVNTYSFLDDYKVIITKVDEVSTYGNILNIRYFTQKP
FT                   IAYITTGQNVPDDIEQFNPEQFAKLIIGSKVL"
FT   gene            656012..656908
FT                   /locus_tag="Calhy_0605"
FT   CDS_pept        656012..656908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0605"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /note="KEGG: ate:Athe_2151 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06346"
FT                   /db_xref="GOA:E4QCX7"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCX7"
FT                   /inference="similar to AA sequence:KEGG:Athe_2151"
FT                   /protein_id="ADQ06346.1"
FT                   /translation="MRDQAQGLRNLVRKAEISANIPVYQGAPSKVVTITSGKGGVGKTN
FT                   LTVNLAIALKKIGKRVLIIDADLGLSNVEVLLGTSPKYNVKDVLEGKKDIFSIVEEGPL
FT                   GINFISGGSGIVDLANLDEERLLRLIECAQLINRSFDIVLIDTGAGISRNVMEFVMMSD
FT                   EVIVITTPEPTSITDAYAIIKAIIARDFNHKINLLINRVNGIKEAEEIFFRLNGVIKRF
FT                   LQREVEYIGYIEENSIVSKSVIKQVPFMISYEKSNISREVENVARKLVMSSESVEGKNR
FT                   GGFSRFIDSIIKRLREQ"
FT   gene            656924..657625
FT                   /locus_tag="Calhy_0606"
FT   CDS_pept        656924..657625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0606"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   ate:Athe_2150 type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06347"
FT                   /db_xref="GOA:E4QCX8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCX8"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ADQ06347.1"
FT                   /translation="MRKIFKVGDKIEIVRIDRRTWEEKDMQYISKIADIKDEYFYIFTP
FT                   IKEGVYVTFYIDEILRVYKVSSDGVWMFDGVVEERFKEPEYMIKVKQISDVRKIQRRMF
FT                   FRLPINLDIFVKLLNSGQMQRADTPAAEAADEFSEGKIVKALTKDISGGGVCFITQEEF
FT                   ETGDLILTKIPIEQEELILKAQILRKERVQHPTYRFMYGCKFVEARQNEIDKIVRFIFA
FT                   QQQKMRQKGLL"
FT   gene            657677..659677
FT                   /locus_tag="Calhy_0607"
FT   CDS_pept        657677..659677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0607"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="KEGG: ate:Athe_2149 CheA signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; P2 response regulator binding domain protein; Hpt
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; CheW domain protein; SMART: CheW domain
FT                   protein; Hpt domain protein; ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06348"
FT                   /db_xref="GOA:E4QCX9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="InterPro:IPR037052"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCX9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADQ06348.1"
FT                   /translation="MDMSQYLGMFIEEARDHIQSLNDNMLKLEENPEDLQLVNEIFRSA
FT                   HTLKGMAGTMGFVNMQKLTHAMENVLAAARDGKLKVNPNIMDILFKTVDALEAYLDVIV
FT                   ATGTEGQEANSHLVNALNAILGKPAEDMAVSSTSKAGKKYEYDEFVVRAIERAWTQGFN
FT                   VYKFDVELDQNCLLKSARAYLVFRAVEEFGEIIHSKPSVQDIEDEKFDFEFSITVISKQ
FT                   PLEKIRERILSISEIREVKALEIKSGEVGRAEEKEEIEEVQQETQVQETVKVVRQQKQE
FT                   PVQKTSKTVRVDIERLDVLMNLVSELIIIKSRIEGLAKKYNDRQYEESIEYLERITTSL
FT                   HDAVMKVRMVPVERVFSRFPRMMRDLARELGKEFELVMSGEDTEVDRTIVDELGDPLIH
FT                   LLRNAADHGIEDPEERVKNGKPRSGLIKLSAYHDGNNVVIEVEDDGKGIDLEKVKQKAI
FT                   EKGLLKEDQIDLSDQEIIDFLFMPSFSTKDKVTNLSGRGVGLDVVKTKIEQLGGMVEVK
FT                   TQKGKGTKFIIRLPLTLAIIQALLVTVHDEIYAIPVASIREIVDVAKEDIKVVQKGKEI
FT                   IMLRNQVIPIKHLHSIVGLEPVLDKKKFTVVIVRRGEKLTGIIVDRLLGQQDIVIKSLG
FT                   KYLEGIRLISGATILGDGAVAMILDPNMLTV"
FT   gene            659707..660129
FT                   /locus_tag="Calhy_0608"
FT   CDS_pept        659707..660129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0608"
FT                   /product="CheW protein"
FT                   /note="KEGG: ate:Athe_2148 CheW protein; PFAM: CheW domain
FT                   protein; SMART: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06349"
FT                   /db_xref="GOA:E4QCY0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCY0"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADQ06349.1"
FT                   /translation="MEQYLIFRLADEHYGLSVNHIENIEKLMPITRVPHTKEYVKGVIN
FT                   LRGEIVPVIDLCEKIGVEKEEFGEETRILIVNWKGEFKVGLIIDEVLDVVYLSKEDFDQ
FT                   ATRDRNEFKFSIAKYNGLLINIINLEDVLFEKAEEV"
FT   gene            660135..660752
FT                   /locus_tag="Calhy_0609"
FT   CDS_pept        660135..660752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0609"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: CheC domain protein; KEGG: ate:Athe_2147 CheC,
FT                   inhibitor of MCP methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06350"
FT                   /db_xref="GOA:E4QCY1"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:E4QCY1"
FT                   /inference="protein motif:PFAM:PF04509"
FT                   /protein_id="ADQ06350.1"
FT                   /translation="MNLSNSEINEMYLDVLKELGNIGTGNAVSALAMMIGRKINMKVPV
FT                   VKMVKLQEVPEILGGAEIPVVGILLNVEGDIEGFIMFVMSQASAHLLVNMLMGTALNGY
FT                   SEFTEIEKSALMEIGNILAGAYLTALSTLTGFKMIQSVPQLAEDMAGAILSFPAIQFGE
FT                   TGDTALYIETEIFEESSRIVADFFLIPTIESYQKMLKALGVA"
FT   gene            660756..661238
FT                   /locus_tag="Calhy_0610"
FT   CDS_pept        660756..661238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0610"
FT                   /product="CheD"
FT                   /note="PFAM: CheD family protein; KEGG: ate:Athe_2146 CheD;
FT                   stimulates methylation of MCP proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06351"
FT                   /db_xref="GOA:E4QD56"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:E4QD56"
FT                   /inference="protein motif:PFAM:PF03975"
FT                   /protein_id="ADQ06351.1"
FT                   /translation="MMEIIKVGMADLNVTSYPNALTTLGLGSCVGVCIYDTKTKIIGMI
FT                   HIMLPYSWGVKNNTNPAKFADTGIPLLIEKMEELGAAKKNMVAKLAGGAQMFEVTRSEF
FT                   MNIGKRNVEAAKKVLQEQNISIVAEDTGGNYGRTIIFYSEDGRLEIKTIGKGTKTI"
FT   gene            661256..661447
FT                   /locus_tag="Calhy_0611"
FT   CDS_pept        661256..661447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ate:Athe_2145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06352"
FT                   /db_xref="GOA:E4QD57"
FT                   /db_xref="UniProtKB/TrEMBL:E4QD57"
FT                   /inference="similar to AA sequence:KEGG:Athe_2145"
FT                   /protein_id="ADQ06352.1"
FT                   /translation="MKGEQLLPEIIALVGGSIVLIACLVTRKSGEYTFFATAVVSIIGY
FT                   VFGSVVKNILNDSKDHNP"
FT   gene            661465..662211
FT                   /locus_tag="Calhy_0612"
FT   CDS_pept        661465..662211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calhy_0612"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   subfamily"
FT                   /note="KEGG: ate:Athe_2144 RNA polymerase, sigma 28
FT                   subunit, FliA/WhiG; TIGRFAM: RNA polymerase sigma factor,
FT                   FliA/WhiG family; RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calhy_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ06353"
FT                   /db_xref="GOA:E4QD58"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT