(data stored in SCRATCH3701 zone)

EMBL: CP002221

ID   CP002221; SV 1; circular; genomic DNA; STD; PRO; 1742932 BP.
XX
AC   CP002221;
XX
PR   Project:PRJNA41547;
XX
DT   18-OCT-2010 (Rel. 106, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Hydrogenobacter thermophilus TK-6, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Hydrogenobacter thermophilus TK-6
OC   Bacteria; Aquificae; Aquificales; Aquificaceae; Hydrogenobacter.
XX
RN   [1]
RP   1-1742932
RX   DOI; 10.4056/sigs.1463589.
RX   PUBMED; 21677850.
RA   Zeytun A., Sikorski J., Nolan M., Lapidus A., Lucas S., Han J., Tice H.,
RA   Cheng J.F., Tapia R., Goodwin L., Pitluck S., Liolios K., Ivanova N.,
RA   Mavromatis K., Mikhailova N., Ovchinnikova G., Pati A., Chen A.,
RA   Palaniappan K., Ngatchou-Djao O.D., Land M., Hauser L., Jeffries C.D.,
RA   Han C., Detter J.C., Ubler S., Rohde M., Tindall B.J., Goker M., Wirth R.,
RA   Woyke T., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P., Klenk H.P.,
RA   Kyrpides N.C.;
RT   "Complete genome sequence of Hydrogenobacter thermophilus type strain
RT   (TK-6)";
RL   Stand Genomic Sci 4(2):131-143(2011).
XX
RN   [2]
RP   1-1742932
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Zeytun A., Detter J.C., Tapia R., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Wirth R., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (24-SEP-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ea3327fbed002bc9043cf53b7805b9c5.
DR   BioSample; SAMN00191234.
DR   EnsemblGenomes-Gn; EBG00001227407.
DR   EnsemblGenomes-Gn; EBG00001227408.
DR   EnsemblGenomes-Gn; EBG00001227409.
DR   EnsemblGenomes-Gn; EBG00001227410.
DR   EnsemblGenomes-Gn; EBG00001227411.
DR   EnsemblGenomes-Gn; EBG00001227412.
DR   EnsemblGenomes-Gn; EBG00001227413.
DR   EnsemblGenomes-Gn; EBG00001227414.
DR   EnsemblGenomes-Gn; EBG00001227415.
DR   EnsemblGenomes-Gn; EBG00001227416.
DR   EnsemblGenomes-Gn; EBG00001227417.
DR   EnsemblGenomes-Gn; EBG00001227418.
DR   EnsemblGenomes-Gn; EBG00001227419.
DR   EnsemblGenomes-Gn; EBG00001227420.
DR   EnsemblGenomes-Gn; EBG00001227421.
DR   EnsemblGenomes-Gn; EBG00001227422.
DR   EnsemblGenomes-Gn; EBG00001227423.
DR   EnsemblGenomes-Gn; EBG00001227424.
DR   EnsemblGenomes-Gn; EBG00001227425.
DR   EnsemblGenomes-Gn; EBG00001227426.
DR   EnsemblGenomes-Gn; EBG00001227427.
DR   EnsemblGenomes-Gn; EBG00001227428.
DR   EnsemblGenomes-Gn; EBG00001227429.
DR   EnsemblGenomes-Gn; EBG00001227430.
DR   EnsemblGenomes-Gn; EBG00001227431.
DR   EnsemblGenomes-Gn; EBG00001227432.
DR   EnsemblGenomes-Gn; EBG00001227433.
DR   EnsemblGenomes-Gn; EBG00001227434.
DR   EnsemblGenomes-Gn; EBG00001227435.
DR   EnsemblGenomes-Gn; EBG00001227436.
DR   EnsemblGenomes-Gn; EBG00001227437.
DR   EnsemblGenomes-Gn; EBG00001227438.
DR   EnsemblGenomes-Gn; EBG00001227439.
DR   EnsemblGenomes-Gn; EBG00001227440.
DR   EnsemblGenomes-Gn; EBG00001227441.
DR   EnsemblGenomes-Gn; EBG00001227442.
DR   EnsemblGenomes-Gn; EBG00001227444.
DR   EnsemblGenomes-Gn; EBG00001227445.
DR   EnsemblGenomes-Gn; EBG00001227446.
DR   EnsemblGenomes-Gn; EBG00001227447.
DR   EnsemblGenomes-Gn; EBG00001227448.
DR   EnsemblGenomes-Gn; EBG00001227449.
DR   EnsemblGenomes-Gn; EBG00001227450.
DR   EnsemblGenomes-Gn; EBG00001227451.
DR   EnsemblGenomes-Gn; EBG00001227452.
DR   EnsemblGenomes-Gn; EBG00001227453.
DR   EnsemblGenomes-Gn; EBG00001227454.
DR   EnsemblGenomes-Gn; EBG00001227455.
DR   EnsemblGenomes-Gn; EBG00001227456.
DR   EnsemblGenomes-Gn; EBG00001227457.
DR   EnsemblGenomes-Gn; EBG00001227458.
DR   EnsemblGenomes-Gn; EBG00001227459.
DR   EnsemblGenomes-Gn; Hydth_R0001.
DR   EnsemblGenomes-Gn; Hydth_R0002.
DR   EnsemblGenomes-Gn; Hydth_R0004.
DR   EnsemblGenomes-Gn; Hydth_R0005.
DR   EnsemblGenomes-Gn; Hydth_R0006.
DR   EnsemblGenomes-Gn; Hydth_R0007.
DR   EnsemblGenomes-Gn; Hydth_R0008.
DR   EnsemblGenomes-Gn; Hydth_R0009.
DR   EnsemblGenomes-Gn; Hydth_R0010.
DR   EnsemblGenomes-Gn; Hydth_R0011.
DR   EnsemblGenomes-Gn; Hydth_R0012.
DR   EnsemblGenomes-Gn; Hydth_R0013.
DR   EnsemblGenomes-Gn; Hydth_R0014.
DR   EnsemblGenomes-Gn; Hydth_R0015.
DR   EnsemblGenomes-Gn; Hydth_R0016.
DR   EnsemblGenomes-Gn; Hydth_R0017.
DR   EnsemblGenomes-Gn; Hydth_R0018.
DR   EnsemblGenomes-Gn; Hydth_R0019.
DR   EnsemblGenomes-Gn; Hydth_R0020.
DR   EnsemblGenomes-Gn; Hydth_R0021.
DR   EnsemblGenomes-Gn; Hydth_R0022.
DR   EnsemblGenomes-Gn; Hydth_R0023.
DR   EnsemblGenomes-Gn; Hydth_R0024.
DR   EnsemblGenomes-Gn; Hydth_R0025.
DR   EnsemblGenomes-Gn; Hydth_R0026.
DR   EnsemblGenomes-Gn; Hydth_R0027.
DR   EnsemblGenomes-Gn; Hydth_R0028.
DR   EnsemblGenomes-Gn; Hydth_R0029.
DR   EnsemblGenomes-Gn; Hydth_R0030.
DR   EnsemblGenomes-Gn; Hydth_R0031.
DR   EnsemblGenomes-Gn; Hydth_R0032.
DR   EnsemblGenomes-Gn; Hydth_R0033.
DR   EnsemblGenomes-Gn; Hydth_R0034.
DR   EnsemblGenomes-Gn; Hydth_R0035.
DR   EnsemblGenomes-Gn; Hydth_R0036.
DR   EnsemblGenomes-Gn; Hydth_R0037.
DR   EnsemblGenomes-Gn; Hydth_R0038.
DR   EnsemblGenomes-Gn; Hydth_R0039.
DR   EnsemblGenomes-Gn; Hydth_R0040.
DR   EnsemblGenomes-Gn; Hydth_R0041.
DR   EnsemblGenomes-Gn; Hydth_R0042.
DR   EnsemblGenomes-Gn; Hydth_R0043.
DR   EnsemblGenomes-Gn; Hydth_R0044.
DR   EnsemblGenomes-Gn; Hydth_R0045.
DR   EnsemblGenomes-Gn; Hydth_R0046.
DR   EnsemblGenomes-Gn; Hydth_R0047.
DR   EnsemblGenomes-Gn; Hydth_R0048.
DR   EnsemblGenomes-Gn; Hydth_R0049.
DR   EnsemblGenomes-Gn; Hydth_R0050.
DR   EnsemblGenomes-Tr; EBT00001796027.
DR   EnsemblGenomes-Tr; EBT00001796028.
DR   EnsemblGenomes-Tr; EBT00001796029.
DR   EnsemblGenomes-Tr; EBT00001796030.
DR   EnsemblGenomes-Tr; EBT00001796031.
DR   EnsemblGenomes-Tr; EBT00001796032.
DR   EnsemblGenomes-Tr; EBT00001796033.
DR   EnsemblGenomes-Tr; EBT00001796035.
DR   EnsemblGenomes-Tr; EBT00001796036.
DR   EnsemblGenomes-Tr; EBT00001796037.
DR   EnsemblGenomes-Tr; EBT00001796038.
DR   EnsemblGenomes-Tr; EBT00001796039.
DR   EnsemblGenomes-Tr; EBT00001796040.
DR   EnsemblGenomes-Tr; EBT00001796041.
DR   EnsemblGenomes-Tr; EBT00001796042.
DR   EnsemblGenomes-Tr; EBT00001796043.
DR   EnsemblGenomes-Tr; EBT00001796044.
DR   EnsemblGenomes-Tr; EBT00001796045.
DR   EnsemblGenomes-Tr; EBT00001796046.
DR   EnsemblGenomes-Tr; EBT00001796047.
DR   EnsemblGenomes-Tr; EBT00001796048.
DR   EnsemblGenomes-Tr; EBT00001796049.
DR   EnsemblGenomes-Tr; EBT00001796050.
DR   EnsemblGenomes-Tr; EBT00001796051.
DR   EnsemblGenomes-Tr; EBT00001796052.
DR   EnsemblGenomes-Tr; EBT00001796053.
DR   EnsemblGenomes-Tr; EBT00001796054.
DR   EnsemblGenomes-Tr; EBT00001796055.
DR   EnsemblGenomes-Tr; EBT00001796056.
DR   EnsemblGenomes-Tr; EBT00001796057.
DR   EnsemblGenomes-Tr; EBT00001796058.
DR   EnsemblGenomes-Tr; EBT00001796059.
DR   EnsemblGenomes-Tr; EBT00001796060.
DR   EnsemblGenomes-Tr; EBT00001796061.
DR   EnsemblGenomes-Tr; EBT00001796062.
DR   EnsemblGenomes-Tr; EBT00001796063.
DR   EnsemblGenomes-Tr; EBT00001796064.
DR   EnsemblGenomes-Tr; EBT00001796065.
DR   EnsemblGenomes-Tr; EBT00001796066.
DR   EnsemblGenomes-Tr; EBT00001796068.
DR   EnsemblGenomes-Tr; EBT00001796069.
DR   EnsemblGenomes-Tr; EBT00001796070.
DR   EnsemblGenomes-Tr; EBT00001796071.
DR   EnsemblGenomes-Tr; EBT00001796072.
DR   EnsemblGenomes-Tr; EBT00001796073.
DR   EnsemblGenomes-Tr; EBT00001796074.
DR   EnsemblGenomes-Tr; EBT00001796075.
DR   EnsemblGenomes-Tr; EBT00001796076.
DR   EnsemblGenomes-Tr; EBT00001796077.
DR   EnsemblGenomes-Tr; EBT00001796078.
DR   EnsemblGenomes-Tr; EBT00001796079.
DR   EnsemblGenomes-Tr; EBT00001796080.
DR   EnsemblGenomes-Tr; Hydth_R0001-1.
DR   EnsemblGenomes-Tr; Hydth_R0002-1.
DR   EnsemblGenomes-Tr; Hydth_R0004-1.
DR   EnsemblGenomes-Tr; Hydth_R0005-1.
DR   EnsemblGenomes-Tr; Hydth_R0006-1.
DR   EnsemblGenomes-Tr; Hydth_R0007-1.
DR   EnsemblGenomes-Tr; Hydth_R0008-1.
DR   EnsemblGenomes-Tr; Hydth_R0009-1.
DR   EnsemblGenomes-Tr; Hydth_R0010-1.
DR   EnsemblGenomes-Tr; Hydth_R0011-1.
DR   EnsemblGenomes-Tr; Hydth_R0012-1.
DR   EnsemblGenomes-Tr; Hydth_R0013-1.
DR   EnsemblGenomes-Tr; Hydth_R0014-1.
DR   EnsemblGenomes-Tr; Hydth_R0015-1.
DR   EnsemblGenomes-Tr; Hydth_R0016-1.
DR   EnsemblGenomes-Tr; Hydth_R0017-1.
DR   EnsemblGenomes-Tr; Hydth_R0018-1.
DR   EnsemblGenomes-Tr; Hydth_R0019-1.
DR   EnsemblGenomes-Tr; Hydth_R0020-1.
DR   EnsemblGenomes-Tr; Hydth_R0021-1.
DR   EnsemblGenomes-Tr; Hydth_R0022-1.
DR   EnsemblGenomes-Tr; Hydth_R0023-1.
DR   EnsemblGenomes-Tr; Hydth_R0024-1.
DR   EnsemblGenomes-Tr; Hydth_R0025-1.
DR   EnsemblGenomes-Tr; Hydth_R0026-1.
DR   EnsemblGenomes-Tr; Hydth_R0027-1.
DR   EnsemblGenomes-Tr; Hydth_R0028-1.
DR   EnsemblGenomes-Tr; Hydth_R0029-1.
DR   EnsemblGenomes-Tr; Hydth_R0030-1.
DR   EnsemblGenomes-Tr; Hydth_R0031-1.
DR   EnsemblGenomes-Tr; Hydth_R0032-1.
DR   EnsemblGenomes-Tr; Hydth_R0033-1.
DR   EnsemblGenomes-Tr; Hydth_R0034-1.
DR   EnsemblGenomes-Tr; Hydth_R0035-1.
DR   EnsemblGenomes-Tr; Hydth_R0036-1.
DR   EnsemblGenomes-Tr; Hydth_R0037-1.
DR   EnsemblGenomes-Tr; Hydth_R0038-1.
DR   EnsemblGenomes-Tr; Hydth_R0039-1.
DR   EnsemblGenomes-Tr; Hydth_R0040-1.
DR   EnsemblGenomes-Tr; Hydth_R0041-1.
DR   EnsemblGenomes-Tr; Hydth_R0042-1.
DR   EnsemblGenomes-Tr; Hydth_R0043-1.
DR   EnsemblGenomes-Tr; Hydth_R0044-1.
DR   EnsemblGenomes-Tr; Hydth_R0045-1.
DR   EnsemblGenomes-Tr; Hydth_R0046-1.
DR   EnsemblGenomes-Tr; Hydth_R0047-1.
DR   EnsemblGenomes-Tr; Hydth_R0048-1.
DR   EnsemblGenomes-Tr; Hydth_R0049-1.
DR   EnsemblGenomes-Tr; Hydth_R0050-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP002221.
DR   SILVA-SSU; CP002221.
DR   StrainInfo; 160150; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086749
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Hydrogenobacter thermophilus TK-6, DSM 6534
CC   collection_date     :: Missing
CC   lat_lon             :: 34.856 138.938
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Japan
CC   environment         :: Missing
CC   num_replicons       :: Missing
CC   ref_biomaterial     :: DSM 06534, IAM 12695
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Missing
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi03025
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 1208
CC   Funding Program     :: DOE-GEBA 2007
CC   Isolation Site      :: Soil near hot-spring in Izu Peninsula, Japan
CC   Temperature Range   :: Thermophile
CC   Temperature Optimum :: 70C
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1742932
FT                   /organism="Hydrogenobacter thermophilus TK-6"
FT                   /strain="TK-6"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Izu Peninsula"
FT                   /lat_lon="34.856 N 138.938 E"
FT                   /isolation_source="soil near hot spring"
FT                   /db_xref="taxon:608538"
FT   gene            51..182
FT                   /locus_tag="Hydth_0001"
FT   CDS_pept        51..182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0001"
FT                   /product="hypothetical protein"
FT                   /note="manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44411"
FT                   /protein_id="ADO44411.1"
FT                   /translation="MATYKPVNKVMKIRTFLMGYSPVGWLKIEQKQKKRNIWRGRIF"
FT   gene            161..1360
FT                   /locus_tag="Hydth_0002"
FT   CDS_pept        161..1360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0002"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation; InterPro
FT                   IPR020591:IPR001957:IPR013317:IPR013159:IPR
FT                   003593:IPR010921; KEGG: aae:aq_322 chromosome replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase; SPTR: A8UU23 Chromosomal replication
FT                   initiator protein dnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: domain; Bacterial dnaA
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44412"
FT                   /protein_id="ADO44412.1"
FT                   /translation="MERQDFLSFIEQADKFAVGIFRQFKIEERDNSVILIAPTEAYKRW
FT                   AMEYIKSRVFNYGKRIEVRSAGEREKNEAYPSNLIEKYSFDNFVVGKANELVYKVCIEV
FT                   AEYPGSSFNPLFIYGKVGLGKTHLLHAIGNRARDGGYKVIYSPITDFSDEMIAYLKKGQ
FT                   IEAFRNKYSSVDVLLLDDVQFLSGKERTQIELFRVFESIYSKDKQMVLVSDRHPKDLKD
FT                   ISDRLISRFESGLVIEIGLDDETKLSIIKQKLILYGMPLDQKVIDHIFENTGYNVREIE
FT                   GAIKTLKVVGIKETPKKKSVKDINFVVEFTARHFKLKPEDLKKEGKERKIINARHIAMY
FT                   LCKMVLGTSYAEISRYFGKKDHTSAIYSIRKVEEKIRQDRKFKYMMTFLERHLRKELEL
FT                   "
FT   gene            1382..2350
FT                   /locus_tag="Hydth_0003"
FT   CDS_pept        1382..2350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_2175 hypothetical protein; SPTR: O67924
FT                   Uncharacterized protein aq_2175; PFAM: Bacterial cellulose
FT                   synthase subunit; NapC/NirT cytochrome c family, N-terminal
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44413"
FT                   /protein_id="ADO44413.1"
FT                   /translation="MKRLIILLGAGCTFAQPLIKPQLADRLFPYITYSSVWSGTPAALK
FT                   DVAVPNILIVYGEKEDPQVVAQAGKIAYYLGQWTDDIGFGAQEVKMSKIPELLITDKQL
FT                   KSIDYKNIVVVGTNNHVVRELGLSFDRPTIEVIQKDGKNIMVVGGKDSQEVIQAAKYLA
FT                   DVRLNFKAGAYRTFFSFVALRGYIERGEFDAAYRLVKNPAGLSACGKNMSLAAPMVANW
FT                   SDDVKNVVKVRNAILYTELPKALEEKNKEKAVELWQKAMFTCYQCHQGIGIPQMRKFKP
FT                   LEEIHSKHQRIAESFGLVKVVGDQKSCIACHRGDTQIRGYK"
FT   sig_peptide     1382..1426
FT                   /locus_tag="Hydth_0003"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            2352..2981
FT                   /locus_tag="Hydth_0004"
FT   CDS_pept        2352..2981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0004"
FT                   /product="integral membrane protein TIGR01906"
FT                   /note="InterPro IPR010178; KEGG: aae:aq_2036 hypothetical
FT                   protein; SPTR: O67827 Uncharacterized protein aq_2036;
FT                   TIGRFAM: integral membrane protein TIGR01906; PFAM: Protein
FT                   of unknown function (DUF1461); TIGRFAM: integral membrane
FT                   protein TIGR01906"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44414"
FT                   /protein_id="ADO44414.1"
FT                   /translation="MVKRAVIILLFPFVLVLFCVRLAFTEFFVEWEYSKKNFPEDRWGL
FT                   SKDVRLHIAKLGLRAVLSDEGMREFKASGFFSSREIKHMEDVKRFLSIIFPAFYLLSAI
FT                   LFALLISLGSLKETGRMLMLGGLLVDVIAFVFFSLSLIDYNWLFVNFHNLVFDPYSWRF
FT                   RDYDMLLRVYPMKFWFDATVSVIVLTLILAAILQAVGFLLVKINRN"
FT   sig_peptide     2352..2420
FT                   /locus_tag="Hydth_0004"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(2958..3629)
FT                   /locus_tag="Hydth_0005"
FT   CDS_pept        complement(2958..3629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0005"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002347:IPR002198:IPR016040;
FT                   KEGG: rxy:Rxyl_2798 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Q1ASB7 Short-chain dehydrogenase/reductase SDR; PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44415"
FT                   /protein_id="ADO44415.1"
FT                   /translation="MNVVITGGSRGIGKATVIRFIKEGHQVCTCSRNEEALKFLWEELG
FT                   KPENLFIKACDVSERQSAKEFVKFCAKLMGKFDVLINNASVLGLRESIEHYPEDVWEEV
FT                   IRVNINGVFYITKYAIPFMKDGGIIINLSSGAGKRPAPYWGAYAVSKFGIEGFSLLLAE
FT                   ELKSRNIKVYAFNPGATRTQMRALAYPQEDPSTLKPPEKVADFLIKLVNLRPNLVSIDF
FT                   Y"
FT   gene            complement(3633..3708)
FT                   /locus_tag="Hydth_R0001"
FT   tRNA            complement(3633..3708)
FT                   /locus_tag="Hydth_R0001"
FT                   /product="tRNA-Val"
FT   gene            3766..3848
FT                   /locus_tag="Hydth_R0002"
FT   tRNA            3766..3848
FT                   /locus_tag="Hydth_R0002"
FT                   /product="tRNA-Leu"
FT   gene            3860..4663
FT                   /locus_tag="Hydth_0006"
FT   CDS_pept        3860..4663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0006"
FT                   /product="metallophosphoesterase"
FT                   /note="COGs: COG1692 conserved hypothetical protein;
FT                   InterPro IPR005235:IPR004843; KEGG: aae:aq_1794
FT                   hypothetical protein; PFAM: metallophosphoesterase; SPTR:
FT                   O67663 Putative uncharacterized protein; TIGRFAM: conserved
FT                   hypothetical protein TIGR00282"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44416"
FT                   /protein_id="ADO44416.1"
FT                   /translation="MRLFVAGDIIGKPGRRALRYMLKQYRQVVDLVIVNVENAAGGFGI
FT                   TKKVYEELKSMGVDLMTSGNHIWDNKEVFGFIDEVDDLLRPANYPDGVPGRGYGIFEKS
FT                   GVKFVLINLMGRSLLDSNLDNPFKTFDRIYQEVSKETNIILVDFHAETTSEKWAFGIYA
FT                   DGRASLVYGTHTHVPTADQIVLKHGTGYITDVGMSGCWYSAIGMKPKEAIERFLTGIPQ
FT                   KYQVEEQEDVVFNGILVEIDPFTGKTTAIERLQRYIKREELLGVL"
FT   gene            4663..5232
FT                   /locus_tag="Hydth_0007"
FT   CDS_pept        4663..5232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0007"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="COGs: COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase; InterPro IPR004507:IPR003382; KEGG:
FT                   hya:HY04AAS1_1506 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; SPTR: A8UT15
FT                   Phenylacrylic acid decarboxylase; TIGRFAM:
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase; PFAM:
FT                   Flavoprotein; TIGRFAM: polyprenyl P-hydroxybenzoate and
FT                   phenylacrylic acid decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44417"
FT                   /protein_id="ADO44417.1"
FT                   /translation="MKEDILLCITGASGSIYGYRLLEVLYESFHVHLVISPSGSLVMKE
FT                   ELGLGREDLLKRFPRLHLIPHSKVDSEVASGSRLINYRGVIVAPCSMSTLACIANGINQ
FT                   NLIHRSCEVALKERVPLVLLLREMPYSIIHIENMLKVAKAGAVVMSASPGFYHKPKSLQ
FT                   ELVDFVVGKVLDSLGIDHHLYQRWKA"
FT   gene            complement(5229..6608)
FT                   /locus_tag="Hydth_0008"
FT   CDS_pept        complement(5229..6608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0008"
FT                   /product="Na+/solute symporter"
FT                   /note="COGs: COG0591 Na+/proline symporter; InterPro
FT                   IPR001734; KEGG: lic:LIC20188 sodium/solute symporter
FT                   family protein; PFAM: Na+/solute symporter; SPTR: Q75FJ4
FT                   Sodium:solute symporter family; PFAM: Sodium:solute
FT                   symporter family; TIGRFAM: SSS sodium solute transporter
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44418"
FT                   /protein_id="ADO44418.1"
FT                   /translation="MLILFVILYMLITIGIGLVASRFVKSTKDFLLAGRSLPLYISAAA
FT                   LFATWFGSETVLGASSKIAKDGLYGVIEDPFGAALCLFLVGLFFAKPLYRMNLLTFGDF
FT                   YRVLYGRKVEVVASIMLSLSYLGWIAAQMVAIGIILQVTLSIPKEVGILVGFGVVLFYT
FT                   FLGGMWSVSLTDFIQTVMIVVGLVFVLHEVSHGFSQLIPVLESQPPGFYKFFPDNNIKD
FT                   ILSYIAAWITIGLGSIPQQDVFQRIMSSRSERVAVLSCFVAGFMYLTVAMIPLILALFA
FT                   KAYYPELLQLDAQLLLPRMVMDHTSLLTQVLFLGALLSAIMSTASGALLAPSAVLSENL
FT                   IKPLFRQLSDRAFLWVTRVCILFVALLSLLFAFMGESIYELVAASSALSLVSLFVPLVA
FT                   GLYFKSSNSVSAISSILLGFVSWLTVYPLSAEYSLLVGLLFSTVGYLLPLVVKRAYAKA
FT                   F"
FT   gene            complement(6610..7791)
FT                   /locus_tag="Hydth_0009"
FT   CDS_pept        complement(6610..7791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0009"
FT                   /product="aminotransferase class I and II"
FT                   /EC_number="2.6.1.1"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro
FT                   IPR001176:IPR004839:IPR015424:IPR005829:IPR 015421; KEGG:
FT                   aae:aq_1969 aspartate aminotransferase; PFAM:
FT                   aminotransferase class I and II; SPTR: O67781 Aspartate
FT                   aminotransferase; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44419"
FT                   /protein_id="ADO44419.1"
FT                   /translation="MNLSKRVSHIKPAPTLQISAKINELKAKGVDLVGFGAGEPDFDTP
FT                   DFVKEACIRALKDGKTKYTPSAGILELREALSEKLQRENSVQYSPSEIVVTAGAKMALY
FT                   LIFMTVLEEGDEVLLPSPYWVTYPEQIMLCGGIPVVVPLKEEKGFVLSVDDIKPHVSKR
FT                   TKMLVLNSPCNPTGAVVPEEELRKVVEFCIENNILIISDECYEAFLYDGKRFVSPASFS
FT                   KEAREITFTVNAFSKTYSMTGWRVGYVAAPAKYAKVMADINSQTISNATSFAQYGALEA
FT                   LKNPKAKEFVKEMKWTFERRRNLAYQLLLEIPNISLVKPEGAFYIFPNLSAYLGKLGSD
FT                   IKLVEYLIEKGRAACVPGSAFGAEGYVRLSYCVSEDTIREGIRRIKQALEELS"
FT   gene            complement(7788..8603)
FT                   /locus_tag="Hydth_0010"
FT   CDS_pept        complement(7788..8603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0010"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.3.1.9"
FT                   /note="COGs: COG0623 Enoyl-(acyl-carrier-protein); InterPro
FT                   IPR002347:IPR002198:IPR016040; KEGG: aae:aq_1552
FT                   enoyl-[acyl-carrier-protein] reductase (NADH); PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR: O67505
FT                   Enoyl-[acyl-carrier-protein] reductase [NADH]; PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44420"
FT                   /protein_id="ADO44420.1"
FT                   /translation="MGILEGKRALITGIANEKSIAYGIAKAFHREGAELAFTYANEKLK
FT                   SRVEEIAHEFGSHLTFECDVSKDEHIKAIGSALRSAWGSLDILVHSIAFAPREEFKGGV
FT                   IDTTREGFKIAMDISVYSLIALTRELLPLMRSGGAILTLTYYGAEKVVPHYNVMGIAKA
FT                   ALESTVRYLAYDIAKYELRINAISAGPVKTLAAYSITGFHLLMEHTTKVNPFGRAITIE
FT                   EVGDTAVFLCSELSRAITGEVLHVDNGYHIMGVFGREEEIKREVFGESS"
FT   gene            complement(8616..9413)
FT                   /locus_tag="Hydth_0011"
FT   CDS_pept        complement(8616..9413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0011"
FT                   /product="predicted phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="COGs: COG1830 DhnA-type fructose-1 6-bisphosphate
FT                   aldolase; InterPro IPR010210:IPR002915:IPR013785; KEGG:
FT                   aae:aq_1554 fructose-bisphosphate aldolase; PFAM:
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PRIAM: Fructose-bisphosphate aldolase; SPTR: O67506
FT                   Uncharacterized aldolase aq_1554; TIGRFAM: predicted
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM:
FT                   DeoC/LacD family aldolase; TIGRFAM: predicted
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44421"
FT                   /protein_id="ADO44421.1"
FT                   /translation="MTSVGKAVRLERIIDRNTGNTIIVPMDHGVSSGPIEGIVDIRSAV
FT                   NDVAEGGANAVVLHKGMVKAGHRGRGKDIGLIVHLSASTDLSPTKNDKVLVCTVEEAIK
FT                   LGADGVSVHVNIGADMEREMLRDLGYVSRVCEEWGMPLLAMVYGRGKDINQYDPKVIAH
FT                   CARIGAELGADIVKVPYSGDPESFRRVVEGSPVPVVIAGGPKMKTDREVLEMVKGAMQA
FT                   GARGLSVGRNIFQAKDRVKMVRALAHIVHKGGTLEEAMAILNQ"
FT   gene            complement(9417..10124)
FT                   /locus_tag="Hydth_0012"
FT   CDS_pept        complement(9417..10124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0012"
FT                   /product="TonB family protein"
FT                   /note="InterPro IPR006260; KEGG: aae:aq_1982 hypothetical
FT                   protein; SPTR: A8UXI4 Predicted repair protein; TIGRFAM:
FT                   TonB family protein; PFAM: Gram-negative bacterial tonB
FT                   protein; TIGRFAM: TonB family C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44422"
FT                   /protein_id="ADO44422.1"
FT                   /translation="MEDRMHFEDLFYWLISTFVNLVLFTFLSYLLLLKINIKEEMPPLN
FT                   VSLETPKEVLQEVKFSKGRHMYIKPKEGKHTLAKGKGSASLTPMVMERKEGDAALPSGK
FT                   ETQEDVSILSSVEEKVKGRKETQEEGVPAKEVGEVSAVISKGSVGFGGGAGRGILYVPP
FT                   LPKLVSEELPSTLRIRVWVEPSGEVSRVQILQRSGVPDIDERLAQFVRRIKFEPIKENV
FT                   VQTGILTFRFKGG"
FT   gene            complement(10134..10544)
FT                   /locus_tag="Hydth_0013"
FT   CDS_pept        complement(10134..10544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0013"
FT                   /product="molybdopterin-guanine dinucleotide
FT                   biosynthesis-containing protein MobB region"
FT                   /note="COGs: COG1763 Molybdopterin-guanine dinucleotide
FT                   biosynthesis protein; InterPro IPR004435; KEGG: aae:aq_1326
FT                   molybdopterin-guainine dinucleotide biosynthesis protein B;
FT                   PFAM: molybdopterin-guanine dinucleotide biosynthesis MobB
FT                   region; SPTR: A8USU4 Molybdopterin-guainine dinucleotide
FT                   biosynthesis protein B; PFAM: Molybdopterin guanine
FT                   dinucleotide synthesis protein B; TIGRFAM:
FT                   molybdopterin-guanine dinucleotide biosynthesis protein
FT                   MobB"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44423"
FT                   /protein_id="ADO44423.1"
FT                   /translation="MPKIVGVVGYHNTGKTTLIEKLSKELSLRGYKVGYIKHDPKGHGI
FT                   TDKEGSDTYRLFKVLDKVALLTEGKLTLWERVEDDPLHIVERYFSDFDVVILEGWKSLK
FT                   GVKKIVLGDLPIEGFHMDESTSLEEVISYVML"
FT   gene            complement(10547..11929)
FT                   /locus_tag="Hydth_R0003"
FT   CDS_pept        complement(10547..11929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_R0003"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterPro
FT                   IPR005841:IPR005844:IPR005845:IPR005846:IPR
FT                   005843:IPR016055:IPR018252:IPR016066; KEGG: aae:aq_501
FT                   phosphoglucomutase/phosphomannomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase; SPTR:
FT                   A8UR33 Phosphoglucomutase/phosphomannomutase; tmRNA as
FT                   predicted by Rfam (RF00023), score 141.83; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_R0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44424"
FT                   /protein_id="ADO44424.1"
FT                   /translation="MQVKFGTDGWRAVIGEDFTFENVKRVAFAHAKVLSEQGKKKVIVG
FT                   YDHRFMSEMFAQEVCRVFKAMGFEAYITNRSCTTPMVSFAIKYMGFDGGVMITASHNPP
FT                   EYNGYKIKDSFGGSATEGLVKRVEQELSSAEIVDTRGIKVESINVWGEYIRKVKDFINT
FT                   ELFYEKEVLIVHDAMYGSSVNTYSQVLAGTKISTIPIRSYRDPLFGGHAPEPVEKHLLP
FT                   LMEKVRSVGAFLGIANDGDGDRIALVDERGKFVNAQLVYVLLLYHLLKNKGIKDGIVVK
FT                   TVSTTYLADRICQREGVELKEVAVGFKNINELILQEKVIFGGEESGGYGIVHFLPERDG
FT                   LFSGLNILELLLLKDKNLSQIIEEIFKNYGSAYYRRYDMRAEEDKKKKLAELKSHPPER
FT                   LAVHKVKKINTSDGLKLVFENDGWILFRASGTEPLIRVYVEMPTEEEVERVLQEGIKLF
FT                   EG"
FT   gene            complement(12325..12990)
FT                   /locus_tag="Hydth_0015"
FT   CDS_pept        complement(12325..12990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0015"
FT                   /product="protein of unknown function DUF45"
FT                   /note="COGs: COG1451 metal-dependent hydrolase; InterPro
FT                   IPR002725; KEGG: tex:Teth514_1824 hypothetical protein;
FT                   PFAM: protein of unknown function DUF45; SPTR: B0K2F5
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44425"
FT                   /protein_id="ADO44425.1"
FT                   /translation="MEIDKIIRSKRKTITLQITDNATLIVKAPFEVSEETIRKFVIKHS
FT                   KWIEEKKKEILSRDPKFAKKEFVSGEGFLYLGKSYKLYIVNQQDTPLKFDNGFFLLRDY
FT                   QPLAKGLFIKWYKERAYEKISERVQLYAQKRGFIYNKVSITKAEKRWGSCSSSGNLNFS
FT                   WRLIMAPLPVIDYVVVHELVHLIEKSHGKAFWDKVKVLMPDYEKHREWLKNNGHLLRL"
FT   gene            complement(12980..16147)
FT                   /locus_tag="Hydth_0016"
FT   CDS_pept        complement(12980..16147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0016"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="COGs: COG0610 Type I site-specific
FT                   restriction-modification system R (restriction) subunit and
FT                   related helicase; InterPro
FT                   IPR004473:IPR014021:IPR007409:IPR006935:IPR
FT                   014001:IPR018247; KEGG: pmo:Pmob_1070 HsdR family type I
FT                   site-specific deoxyribonuclease; PFAM: protein of unknown
FT                   function DUF450; type III restriction protein res subunit;
FT                   SMART: DEAD-like helicase; SPTR: A9BG33 Type I
FT                   site-specific deoxyribonuclease, HsdR family; TIGRFAM: type
FT                   I site-specific deoxyribonuclease, HsdR family; PFAM: Type
FT                   I restriction enzyme R protein N terminus (HSDR_N); Type
FT                   III restriction enzyme, res subunit; TIGRFAM: type I
FT                   site-specific deoxyribonuclease, HsdR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44426"
FT                   /protein_id="ADO44426.1"
FT                   /translation="MYAKLDEEYYVENPFLAQLQKIGWKIYRQNKNNPEDVKEIISFDS
FT                   NGEPIYGNSVKFRESFREVILEDELKKSIKRINPWIEDDQINEVVRRITTPQANSLIEA
FT                   NREIHDLLIENTSVSENRKTGEKSPTVRYIDFKNPDNNSFIAISQFKVNIPGTGKHIIP
FT                   DIVLFVNGLPLVVVECKSPAITDPITEAITQLMRYSNRRGAKEGNEKLFWYNLFMIATS
FT                   KQVAKLGTITSGYEHFNEWKDPYPYTLLDINKNGTITSQDVLIQGTLTKNNLLDILRIF
FT                   TLFVEDSKGPGVIKIVPRYHQFRAVKKIVKRIKEGQTPEEKGGIVWHTQGSGKSLTMML
FT                   TVRAINKDPELSKFKIVFITDREQLEKQLRATSKSVGYTVNHADSIEKLKELLRTDTPD
FT                   LVMAMIHKFQERDLSAKFPTLNESPNILVLIDEAHRTQYNILGANLRKALPNSVKIAFT
FT                   GTPIEKTEQTFGDYIDKYTIKQAVEDGVTVEIVYEGRAHLAEISDEEAANAKFESVFYA
FT                   FDNEEKQLILGKYTWKSYLENENVIKEKAKDIIEHYITHIFPNGFKAQVIAVSRLAAVR
FT                   YKEKLEEALKEKIAELEKNNPNNIDIDTLKRLKVAVIISGTPNDDPQIYKKEYTDVNEH
FT                   DKNIKSFKMPFNKSDEKIGINGDVGIIVVNEMLVTGFDAPIEQALYLDNVLKGHRLLQA
FT                   IARVNRVYKNKYCGYVVDYVGVFNHLKEALAVYSDSDIEEISQTVVNKSKIKDELKYIH
FT                   NQIEDFFKKFKISNWRENIDECIDLLEDEEIREEFITLVRKFNSTLDKLLPDPEALKYT
FT                   KDLKVINFIKEAARQRYRDDKLSIKDVSNKIREIVEQYLVSKGIDPKIPPIPLLSDEFT
FT                   IKLKQKPPKAKAVELEYAIKEHIEKHFEEDPELYERFSDKLKKILEEYKENWDLLAEKL
FT                   ENLRIEIKKGREEENTYELDPKKEMPFLGLLKDMILGKEPLEKYSPDQVEFLVKLTKDI
FT                   LKIIKGKIKIVDFWENYTKQKELIGEIISHLLKQGRDNNIFNKRNEIAQRLLELAYHIY
FT                   GGKTDGN"
FT   gene            complement(16149..16274)
FT                   /locus_tag="Hydth_0017"
FT   CDS_pept        complement(16149..16274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fno:Fnod_0505 hypothetical protein; SPTR:
FT                   A7HKD6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44427"
FT                   /protein_id="ADO44427.1"
FT                   /translation="MSKKRTLKIILQDIIEEIEKIKKFKLPELEKAVNFLLEKES"
FT   gene            complement(16267..16557)
FT                   /locus_tag="Hydth_0018"
FT   CDS_pept        complement(16267..16557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0018"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="COGs: COG1669 nucleotidyltransferase; InterPro
FT                   IPR002934; KEGG: csc:Csac_2676 DNA polymerase beta subunit;
FT                   PFAM: DNA polymerase beta domain protein region; SPTR:
FT                   A4XMW2 DNA polymerase, beta domain protein region; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44428"
FT                   /protein_id="ADO44428.1"
FT                   /translation="MKNKIHQILQEHKSYLAEKFGVKEIAIFGSYARGEESSESDVDIL
FT                   VDFKEGYKTFDNYMDLKFYLEELLGKRVDLVIKSAVKPRLKTSIFEEAVYV"
FT   gene            complement(16554..17834)
FT                   /locus_tag="Hydth_0019"
FT   CDS_pept        complement(16554..17834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0019"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="COGs: COG0732 Restriction endonuclease S subunits;
FT                   InterPro IPR000055; KEGG: mja:MJ1531 type I
FT                   restriction-modification enzyme, S subunit, putative; PFAM:
FT                   restriction modification system DNA specificity domain;
FT                   SPTR: Q58926 Uncharacterized protein MJ1531; PFAM: Type I
FT                   restriction modification DNA specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44429"
FT                   /protein_id="ADO44429.1"
FT                   /translation="MGEDVKLPEGWKKVKLGEVIEKLRNGYVYSFSEIRKEGLPITRIE
FT                   TISEGKIDKSKLGYITEELRYKVNKYQMQRGDILFSHINSIEHIGKCAIYDGSIPTLIH
FT                   GMNLLLLRTKKHILDPFFLINFLKKEDIRSRLRNLSGQAVNQVSIKPSELAKFAIPLPP
FT                   LPEQQKIAEILETVDRAIEKTDKIIEKYKRIKQGLMQDLLTKGIDENGKIRSEKTHKFK
FT                   DSPIGRIPEEWEVVRLGEVCFIIMGQSPSSVLINKKEKGIPFLQGNAEFTSKYPNPINW
FT                   IEKPLKIAKKESILLSVRAPVGALNIANREYCIGRGLCSIVTNKSITHNLFIWYYLQFS
FT                   INNLINLSQGSTFEAISSRELKNYSIPLPPLTEQQRIAEILSQIDNVIEKEQAYRQKLE
FT                   RIKKGLMEDLLTGKVRVNKLIKEEDKK"
FT   gene            complement(17827..20268)
FT                   /locus_tag="Hydth_0020"
FT   CDS_pept        complement(17827..20268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0020"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /EC_number="2.1.1.72"
FT                   /note="COGs: COG0286 Type I restriction-modification system
FT                   methyltransferase subunit; InterPro
FT                   IPR002296:IPR004546:IPR003356:IPR002052; KEGG:
FT                   csc:Csac_2680 type I restriction-modification system, M
FT                   subunit; PFAM: N-6 DNA methylase; PRIAM: Site-specific
FT                   DNA-methyltransferase (adenine-specific); SPTR: A4XMW6 Type
FT                   I restriction-modification system, M subunit; TIGRFAM: type
FT                   I restriction-modification system, M subunit; PFAM: N-6 DNA
FT                   Methylase; HsdM N-terminal domain; TIGRFAM: nitrate
FT                   reductase molybdenum cofactor assembly chaperone; type I
FT                   restriction system adenine methylase (hsdM)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44430"
FT                   /protein_id="ADO44430.1"
FT                   /translation="MEKKKITLRELETHLFKAADILRGKMDASEYKEYIFGMLFLKRMS
FT                   DVFDEEREKLFKEYKNLGYSDEEIKEILEDPNIYSETFFVPEKARWEYILTLKEDVGNQ
FT                   LNKALAALEEANPELEGVLKHIDFNAVKGKTRLKDQQLIDLIHHFNKYRLRNEDFEFPD
FT                   LLGAAYEYLLKEFADSAGKKGGEFYTPPSVKTLMVRLVKPKEGMRIYDPTVGSGGFLIE
FT                   ARQYVEEKGQNPKNLALYGQENNGVTWSICKMNMILHGIPDAQIENEDTLTNPKFVENG
FT                   YIKQFDIVLANPPFSQNYTRANMHFPERFKYGFTPETGKKADLMFLQHMIASLKPDGIM
FT                   ATVMPHGVLFRGGQEKVIREGIVKDDLIQAIIGLPPKLFYNTGIPACIIVINKRKPDHL
FT                   KNKILFINADREYGEGRNQNYLRPEDIEKIVTVFDNNLEIPKYSRLVDIKEIEENDFNL
FT                   NIRRYVDNSPEPEIENVHYHINGYIPKQELELYKPQMKKFNISLDNLFIEIDKDSLDFI
FT                   PYINEKSKIKEVIENYEGVKQTYDIHFQKLNEWWENVEKDIEAFAKNNNLWSFREKALE
FT                   DLKESLLPLGVLDEFKIAGVFVNWWENLRYDFKTIVSSGWSKTLIDDEMIERKFFAKEL
FT                   EEIEEIESNIAQVEGELNEILEEVEDWDEEDLGEKTTKKMKEFIKQTINDLLSNGNEAA
FT                   VKEAQKWKDLAEKINEKEKELKNLNKELKQKQQELAKIIREKRETLTEEEAKGLVLEKF
FT                   KESIKQELEKYINAEKKEVIKIFEKLWDKYKISLNQLITERDEEVKKLNEFLKQLGYIN
FT                   G"
FT   gene            complement(20271..21173)
FT                   /locus_tag="Hydth_0021"
FT   CDS_pept        complement(20271..21173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0021"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro
FT                   IPR016366:IPR011703; KEGG: aae:aq_240 hypothetical protein;
FT                   PFAM: ATPase associated with various cellular activities
FT                   AAA_3; SPTR: A8UV33 Putative uncharacterized protein; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44431"
FT                   /protein_id="ADO44431.1"
FT                   /translation="MDVQKIVQDVSSVLKGKEEVITYSLVCFLSGGHLILEDVPGVGKT
FT                   TLALAISKVLGLSFARVQFTSDLLPSDITGVSVYDQSKKTFVFKQGPIFHNIVLADEIN
FT                   RATPKTQSALLEAMAEGKVSVDGITYELPFPFFVIATQNPVEQYGTYPLPESQLDRFSM
FT                   RLSLGYPDPDTEVQIIMGENPIEKVSRLNPAVKPQELISAIQQIKRFYVSPDVGKFVVE
FT                   IVNQTRNHPDVLLGVSTRGAIHLVSCARALAYVKGRDFIVPEDVIELAPLVLPHRIITR
FT                   TDSDPKAIIEEILTKVEVP"
FT   gene            21205..21678
FT                   /locus_tag="Hydth_0022"
FT   CDS_pept        21205..21678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0022"
FT                   /product="protein of unknown function DUF150"
FT                   /note="InterPro IPR003728; KEGG: aae:aq_260 hypothetical
FT                   protein; PFAM: protein of unknown function DUF150; SPTR:
FT                   O66619 Ribosome maturation factor rimP; PFAM:
FT                   Uncharacterised BCR, YhbC family COG0779"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44432"
FT                   /protein_id="ADO44432.1"
FT                   /translation="MQINEKSIVEKVRQLAEPIIKNLGFKLFDVEFKPERGWVLRVILD
FT                   KDGGITVNDCEEVSKRLSALLDVEDIIPTSYILEVSSPGLTRELTKPEHYEFFKGRLIR
FT                   LVLREALEGKRELKGYIVDVKEGILQLREKDSGKMFHTPLSIVARAHLEIEGW"
FT   gene            21672..22655
FT                   /locus_tag="Hydth_0023"
FT   CDS_pept        21672..22655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0023"
FT                   /product="transcription termination factor NusA"
FT                   /note="COGs: COG0195 Transcription elongation factor;
FT                   InterPro IPR010213:IPR004088:IPR003029:IPR013735:IPR
FT                   009019:IPR016027:IPR012340:IPR015946; KEGG: aae:aq_259
FT                   transcription elongation factor NusA; PFAM: RNA binding S1
FT                   domain protein; NusA domain protein; SPTR: A8UT94
FT                   Transcription elongation factor NusA; TIGRFAM:
FT                   transcription termination factor NusA; PFAM: NusA
FT                   N-terminal domain; S1 RNA binding domain; TIGRFAM:
FT                   transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44433"
FT                   /protein_id="ADO44433.1"
FT                   /translation="MVKNLKKLIEQVAKEKNLPEWIVEGALKNAIALAVKKDRKLKEHL
FT                   QVELLEEGIKVYIVKRNNSETVRFPLEISTEDVNRIAAYAAKEEFLKELEKAEEERGYL
FT                   EFVEQEGEITVGIVRRVLENGDVLVDLGRVMGVLPKREQIPKESYRQGERIKALVLEVR
FT                   KHRGRYEIILSRTHPKFLRKLLEAEVPEIKSGEIEIKAITREPGERAKVLVHAKDMKMD
FT                   PVGVIVGLRGSRINPVSKELSGEKIDVIRWTENVEELIKKSLSPAPVTKVRLIPKDKRA
FT                   EVAVPKEKLSLAIGKHGVNVKLANRITGWYIDVLSEEDFEKLSALR"
FT   gene            22652..23914
FT                   /locus_tag="Hydth_0024"
FT   CDS_pept        22652..23914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0024"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="COGs: COG2265 SAM-dependent methyltransferase
FT                   related to tRNA (uracil-5-)-methyltransferase; InterPro
FT                   IPR001566:IPR010280:IPR016027; KEGG: aae:aq_257 RNA
FT                   methyltransferase; PFAM: (Uracil-5)-methyltransferase;
FT                   SPTR: A8UT95 RNA methyltransferase (TrmA-family) protein;
FT                   TIGRFAM: RNA methyltransferase, TrmA family; PFAM: tRNA
FT                   (Uracil-5-)-methyltransferase; TIGRFAM: 23S rRNA
FT                   (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44434"
FT                   /protein_id="ADO44434.1"
FT                   /translation="MKVLPELSIKKIVYGGYGLAEYKGKKVFVRYAAPMELLSAQVIKE
FT                   KGDHIEATAKEVIISSPSRKDPPCRYYYYCGGCQLQHIDTDQQVRIKEDILIESLRRIG
FT                   NLEISALGESIRSKQDFGYRTRVQFKVSNGSLGFFAWGTHELVKIDQCLLVHPAMNDLI
FT                   PSLQELSKKIPHLQELHVLYSPSEDEFLLKVITPTIYDAEKLRKLKENVLPKKVVGIGN
FT                   YSKLGDHLLKRYHIGRSFTFMQVKNYRYRVSNDSFFQINFTLWEDLLNSVVVRDKRRVI
FT                   ELHCGAGFFSIPLSEGNHFVISSDTNATAIKDAQYNAKLNSRDNIVFFHESAHQTLKKH
FT                   AGETIDLLFLDPPRGGLTTDELSLVLQNKPKEIVYVSCNPTTLARDLGKMVRGGYSLKS
FT                   VRLIDNFPQTYHIESVAYLEL"
FT   gene            24062..26440
FT                   /locus_tag="Hydth_0025"
FT   CDS_pept        24062..26440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0025"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /note="InterPro IPR000788:IPR013346:IPR005144:IPR013509:IPR
FT                   008926; KEGG: aae:aq_094 ribonucleotide reductase alpha
FT                   chain; PFAM: ribonucleotide reductase large subunit;
FT                   Ribonucleotide reductase large subunit domain protein;
FT                   ATP-cone domain protein; SPTR: A8URA6
FT                   Ribonucleoside-diphosphate reductase; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   Ribonucleotide reductase, all-alpha domain; ATP cone
FT                   domain; Ribonucleotide reductase, barrel domain; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44435"
FT                   /protein_id="ADO44435.1"
FT                   /translation="MAIYRRAGYKYTSHRLLTAYERERAMYVTKRSGVGEPMDISKIRI
FT                   VIDFACRGLRVDPLELEADAQIQFREGISTKEIQQLLIRTAAEKVSPENPDWQYVAARL
FT                   LLYDLYKDVGHIRGYKVKDKINGRYKPYNPESFYNLVKNYAEKGIYGEYLLREYSKEDF
FT                   QALASYIKPDRDLLFNYTGIKVLYDRYLVRDEEGNVIELPQEMYMLISMSLALPEKKEE
FT                   RIKWVKTFYDLMSKHEVSLATPTLMNARRPHTQLSSCFVLTVDDDLYDIFDNVQKAGQI
FT                   SKFAGGLGIYLGKVRATGSPIRKFKGASSGVLPVVKILNDVMVYVDQLGMRKGSASITL
FT                   DIWHKDVMDFLEVKTNVGDERKKAHDIHPAISIPDIFMKRLKNREKWTLLDPYYCKNVK
FT                   DGKNLEDFYGEEFEELYQRLERELPPNAKKEVDAFELWKRLLTVVFETGEPYIFFRDTA
FT                   NRLNPNKHCGVVYSSNLCHEIVQNMSASQHIEDSLDPQTGEIVHRKKSGDVVVCNLGSI
FT                   NLGKVYTKEDMERVVPLLVRMLDNVISINYYAIKEAEYTNRRYRAIGIGVSNYHYCLVK
FT                   NAIQWESEEHLKFANALFERIAYYAIKGSMELAKERGRYPLFEGSDWSKGVFFGRDAEE
FT                   NQRMSEKNGNNLNWIELAEEVKTYGLRNAYLLALMPTGSTSLIIGATPSVDPIFAKFYK
FT                   EENMSGILPQVPPEIDRYFWHYKSAYSIDQEWIIRAASERQKWIDQAQSLNLFIDPEHV
FT                   DGPTLSKLYELSWELGLKTVYYCRSKSLTEIEECESCSS"
FT   gene            26453..27481
FT                   /locus_tag="Hydth_0026"
FT   CDS_pept        26453..27481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0026"
FT                   /product="ribonucleotide reductase"
FT                   /note="COGs: COG0208 Ribonucleotide reductase beta subunit;
FT                   InterPro IPR000358:IPR009078:IPR012348; KEGG: aac:Aaci_1600
FT                   ribonucleoside-diphosphate reductase; PFAM: ribonucleotide
FT                   reductase; SPTR: A8URA5 Ribonucleotide reductase beta
FT                   chain; PFAM: Ribonucleotide reductase, small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44436"
FT                   /protein_id="ADO44436.1"
FT                   /translation="MDRTIIFNPQGDRETSKRKVIFGNPTNIMELNNVKYQWAFDLYKT
FT                   MGFTNFWVPEEIPMHEDKKQYEKDLSPYEKRAYEMVLSFLIALDSYQVNMLKEFARYIT
FT                   APELVMALTSQEFQEALHSYSYQFILESVVEPQVADEIYNYWRQDTVLMERNQVIAQLY
FT                   NEFIRHPTEENFIKATFGNYVLESLYFYSGFAFFYTLGRQGKMRNTVQQIKYINRDELT
FT                   HVTLFRNIIQTIKQENPELFTPELEKWVYEFFKYATDAEIKWGQYVTQNQILGINNTLI
FT                   DRYIKYLANLRLTQLGYKPLYPEITENPMKWIDQFRTINDTKTDFFQAKPQTYAKRSEL
FT                   KW"
FT   gene            complement(27605..29095)
FT                   /locus_tag="Hydth_0027"
FT   CDS_pept        complement(27605..29095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0027"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR001411:IPR004638:IPR011701:IPR016196; KEGG:
FT                   hya:HY04AAS1_0985 drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   B4U960 Drug resistance transporter, EmrB/QacA subfamily;
FT                   TIGRFAM: drug resistance transporter, EmrB/QacA subfamily;
FT                   PFAM: Major Facilitator Superfamily; TIGRFAM: drug
FT                   resistance transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44437"
FT                   /protein_id="ADO44437.1"
FT                   /translation="MVWFYTFLVVLGTFLAVLGITSTNVAIPKMIAPLQTDIYGIEWVA
FT                   ISYIVATAITIIVFNFASARLGLKNTYILGLALFSLGSALSGQASSLEEMIAFRFLQGV
FT                   GEGFLIPSSQSILFNLFPPEKRGTAMGFYAMAVAFAPGLGPTVGGYMVEFLSWRWIFYM
FT                   NLPVVVLLLPVAYLMLPDLGERRKLPFNFFSFLFLSLASIAFIVFLSKGESWGWFYSMK
FT                   TFTAFCVFVASLLLFALSELTSRHTLIDYSVFKEPNYLYALITFVVVYGLVFFQVIYLL
FT                   PIYLESLKGVPTFQTGTTFLGFAILLGTFALIGGRLSDRTEPKLLLLISQSVLFLTLFF
FT                   FLSHVDYYTPRWKIALYMCFMGVAMGFFFAPLTALAFKSLKPHQIPIGTALYNYARLIG
FT                   ASIATSLATYTLETHRALHFDQINELRSALSSPAFVSYMQKLSGLEAFRYMVALGQFQN
FT                   LLAGTYAVQDAFKLASYMSILSIIITITFLLRYRKTRF"
FT   sig_peptide     complement(29021..29095)
FT                   /locus_tag="Hydth_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(29071..30618)
FT                   /locus_tag="Hydth_0028"
FT   CDS_pept        complement(29071..30618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0028"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR004638:IPR011701:IPR016196; KEGG: aae:aq_1062 major
FT                   facilitator family transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: O67160 Major facilitator family
FT                   transporter; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: Major Facilitator Superfamily;
FT                   TIGRFAM: drug resistance transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44438"
FT                   /protein_id="ADO44438.1"
FT                   /translation="MQERPLYELVSPFERVMLTFSLMMGVFMAILDTTIVDIVVPKMMA
FT                   PLSTDLYGVQWVITSYMMAAASGILLVESLERYVGLRNVFISGLFLFTVASFLSGQAPS
FT                   LDWMIASRSLQGFGEALIVVSAEALLFSAYPPEKRGLAMGIYGLGVSFAPALGPTLGGY
FT                   ITEYINWRWVFYINLPVGIINLVLALSFLPDYKPQNAHGRLNLVSFLFLSSATVFLLIT
FT                   LSKGQQQGWWNSDFILYTSLISLFSFLLFFLSELASKESLIDYSIFSIKEFVVAILVYC
FT                   FLLGFSMYQVFYLIPLYYENLKGIGTLMTGIHILPLALAIGFSSPIAGVLGDKKGEILP
FT                   LGIAVLTYLYAVLFVMPQFNYFTPAWESSLKMILLGIGMGFFFAPITNLALKKLGEKTT
FT                   LGVSLMHYIRFVGGSFGTAIATNDLQKYMWESFQKTSEVQSYSAVSQYLLSLFHLGEER
FT                   AKAFFYGIEQLYAYSNAFESTFFSAGLWGLLGSLPIFYLLWTYLIRRARIWSGSTPS"
FT   gene            complement(30618..31745)
FT                   /locus_tag="Hydth_0029"
FT   CDS_pept        complement(30618..31745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0029"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="COGs: COG1566 Multidrug resistance efflux pump;
FT                   InterPro IPR003997:IPR006143:IPR011053; KEGG:
FT                   sul:SYO3AOP1_1379 secretion protein HlyD family protein;
FT                   PFAM: secretion protein HlyD family protein; SPTR: C4FIK8
FT                   Multidrug-efflux transporter, MFS family; PFAM: HlyD family
FT                   secretion protein; TIGRFAM: efflux pump membrane protein
FT                   (multidrug resistance protein A)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44439"
FT                   /protein_id="ADO44439.1"
FT                   /translation="MKRKVGLTIVISLMMVFSVIAFRWIKHRMEYAVTDAVFVKADQLS
FT                   NVGFQKVSGRVIKLYKDLGDEVKKSEVIAEIDPTDYQLNLQNIRAKIESLEAQKEQLLT
FT                   QLTRVSQELSVNYSMSDISAKEVKKREQALEKQLSQVQAQLELAQKDRERYKNLLERGV
FT                   IPRRTFEEADTRYKVLKDQEESLLKSLEELRLSYKKSLENVSLSRIAFLKQKELKAQVE
FT                   ALEKEIESLKKQEELAQNYLSNTKLTAPFDGVVAKRYVSVGDVVSPGSPVYAIVKPDSM
FT                   YVEVLLEESKLRGVQKGCKAYVRLDAYPNKVFEGVVEEISPASAATFALVPRDISAGEF
FT                   TKVVQRIPVKIRIIKGDASLLRVGMGGEVEIKRVR"
FT   sig_peptide     complement(31683..31745)
FT                   /locus_tag="Hydth_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(31742..33013)
FT                   /locus_tag="Hydth_0030"
FT   CDS_pept        complement(31742..33013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0030"
FT                   /product="outer membrane efflux protein"
FT                   /note="COGs: COG1538 Outer membrane protein; InterPro
FT                   IPR003423; KEGG: saf:SULAZ_1241 outer membrane efflux
FT                   protein; PFAM: outer membrane efflux protein; SPTR: C1DVS4
FT                   Outer membrane efflux protein; PFAM: Outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44440"
FT                   /protein_id="ADO44440.1"
FT                   /translation="MKLIVFFLTFSFAFSLTMEEAIQSAIEKNPEIRSQRHAVSSAFYS
FT                   YRADTNLYLPNFFASASFSRLSQKQSLHIPPFGPFPPLSVESAKQNYRAFSIGLREVLY
FT                   DGGAREGRVNISSSEVRLQQDLYGEKLEDIKLQVIKAYLDVLSSQEIVDVYRKQLEAID
FT                   SQYRRAEAFYKEGLVAITDMLQAKVRLAEVQRDLRKAEGDYSVALANLSKLTGIPQEKL
FT                   KDLQLPQIADYQVPDLESLYLKALERRLILRAYSERVYQAKKLQDIERSKYLPKVFAQA
FT                   EYTYSDQNPVISPKGVYTLSLGLSLEFQTLEPYYRVLSRLEEEKRARWELENLKEAIKL
FT                   EIKKAYEDVLTAKDNLRVAEDALRYAEEFYKLSQEQYKNQIISSTDLLLAEASLTQARK
FT                   NKVLSYYEYLKAYYELMRAVGGEI"
FT   gene            complement(33010..33582)
FT                   /locus_tag="Hydth_0031"
FT   CDS_pept        complement(33010..33582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0031"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647:IPR009057:IPR011075:IPR012287; KEGG:
FT                   saf:SULAZ_1240 transcriptional regulator, TetR family;
FT                   PFAM: regulatory protein TetR; SPTR: C1DVS3 Transcriptional
FT                   regulator, TetR family; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44441"
FT                   /protein_id="ADO44441.1"
FT                   /translation="MDTKEKLLNSAKKLFSKKGYYETRVSDIVADAGLSQGAFYLYFKS
FT                   KEDIFIELVKSMSNKVVKLLKDYASMEMDPEEVIKNSTFDFFRVMYEERPIAYIFLFQL
FT                   VGTNEKFRKLYMDKNKKVRELLHIIVEKGVKSGVFSYKNTENIVNILMGYVRIVYLEYL
FT                   LKDNIPLEDILSLVSEGIDVILKGVKG"
FT   gene            complement(33582..34811)
FT                   /locus_tag="Hydth_0032"
FT   CDS_pept        complement(33582..34811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0032"
FT                   /product="outer membrane efflux protein"
FT                   /note="COGs: COG1538 Outer membrane protein; InterPro
FT                   IPR003423; KEGG: aae:aq_1332 hypothetical protein; PFAM:
FT                   outer membrane efflux protein; SPTR: O67351 Putative
FT                   uncharacterized protein; PFAM: Outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44442"
FT                   /protein_id="ADO44442.1"
FT                   /translation="MRCFMVILLLVLSVSWSMTLEEAINVALKNNTQVKLSELDLKRVE
FT                   EDIRKARAGILPQVSLSYSYTKLDKSLAFGFTPTERQSYVFEVNQSIFDKAVFDAIKLS
FT                   KLAKDLQAYILEDIKRTVENQTKQLFYALLYKKEVVKLYQDNLREENYKLTKVQYEAGV
FT                   VPMVNLLRSKAQLQTAEAQYQQALADYKKSLEDFKAYLRWEGDIQPEGSLEFKPFQEDY
FT                   PTLRKLLLERNSTLLVAKKSVEVYEKRIDVAKDAYYPTISGFVTYQGNTGRRSLSGGTE
FT                   WIRGYTFGFQLNYHLFDGFQREANIAQANIDYLKQKEVYIDTLYTQDAQMKKTLEDINS
FT                   LKAQIRALESSLEAAKEALRLSTERYRYGVTNQLEVLESRANYNQTLQNYYLLLYQYMS
FT                   DLANIERLTK"
FT   sig_peptide     complement(34746..34811)
FT                   /locus_tag="Hydth_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(34808..35851)
FT                   /locus_tag="Hydth_0033"
FT   CDS_pept        complement(34808..35851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0033"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COGs: COG0845 Membrane-fusion protein; InterPro
FT                   IPR006143; KEGG: sul:SYO3AOP1_0062 efflux transporter, RND
FT                   family, MFP subunit; PFAM: secretion protein HlyD family
FT                   protein; SPTR: B2V6H8 Efflux transporter, RND family, MFP
FT                   subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: HlyD family secretion protein; TIGRFAM: RND
FT                   family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44443"
FT                   /protein_id="ADO44443.1"
FT                   /translation="MIRCLALISLLVLLSCQKKESPPPAPQAVQISVYTVKPESVEVFY
FT                   TANGYFEAIKDVVLRPEVSGRVLELLTDEGQLVRQGQPLLKIDPSDYQNTLRQLEANLM
FT                   QARANYENQRAIYERRKFLYEQNLIAREDFENAKTQLKVYQDQVSAIEAQLRNARLQLS
FT                   RTTLRAPFSGYIAQKFVNVGDYITPQSQTFRLVTLDPIKVVFEAPQELQPKLKLGSLVY
FT                   LQVEGAGNYEGRINFVSPTANASRMLTIKALVKNPKGELKPNMYAQVHVPISSTEAFKI
FT                   PETALVLIGNQKAVWKVVGDKVFPVKVDIVKQGDGYVYAKADLKEGDAIAVENAYLLNQ
FT                   TSRVKVR"
FT   sig_peptide     complement(35798..35851)
FT                   /locus_tag="Hydth_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            35900..38908
FT                   /locus_tag="Hydth_0034"
FT   CDS_pept        35900..38908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0034"
FT                   /product="acriflavin resistance protein"
FT                   /note="COGs: COG0841 Cation/multidrug efflux pump; InterPro
FT                   IPR001036; KEGG: sul:SYO3AOP1_1383 acriflavin resistance
FT                   protein; PFAM: acriflavin resistance protein; SPTR: A8UTN1
FT                   Cation efflux (AcrB/AcrD/AcrF family) protein; PFAM:
FT                   AcrB/AcrD/AcrF family; TIGRFAM: The (Largely Gram-negative
FT                   Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44444"
FT                   /protein_id="ADO44444.1"
FT                   /translation="MYKFFIHRPVTTIMFMLSFVLLGLYTYTKMPVDRLPNVDFPIVTV
FT                   NTTYTGANPDVVDTNVTRYIEDEVSTISGIDAIVSQSYAGLSRVTIVFTLDKNIDVGTQ
FT                   EVRDAVQRAYRRMPVGVDPPVVRKVDTGSFPILAVHLHSKSVDYQTLAYYADKVIKREF
FT                   QKVNGVGDVGLGGFRDNVLWVRLYPERLYSYGITPVDVLSAVSKNHLEVPTGTIYGKDK
FT                   EYIIRLYGKVKDPKELENTYLKGNLRLRDVGFVEFTEDEKRGIARFKGEQSVALIVYKQ
FT                   SGFNTVEVADAVKARMAELNRELPPGMRMDITFDASVFPKEGAHAAVEEIIIGSLLTAL
FT                   VVFVFLGSLRLTLIPVFAIPVTLLSAIIFLYYTGNSLNTFTLLALAVAVGIVIDDAIVV
FT                   IESIYRRREMGLAPLEAAEVGTRIVVFALLASTTSLVIVFLPIIFLKGVIGSFFGSFAL
FT                   TLAVAIGVSYIVAISFTPMAGARLITQTQENVFMRAYEKFELFFDRVLRWSLDHKLVVL
FT                   LFSIATVYIGFLFLKATNKEFFPLTDEGAFIVRFETPIGSSFEYTDQKAKEVEAVLSRN
FT                   PYIDRFGIAIGQGVAGRPDVNGGQAFIFLKDRSVRPHQKVIMDQLRKELAKIKGITVSV
FT                   EAFPIVAGAGRQTDITYAIRGSSLEELQKIANKMVAEFRQKPGYKDVDTDLRLNEPQIQ
FT                   IKVNREKLGDLGISVEDVGTTLNILFGKYKFGTYEVGGESYDAYIKAQPEFVKNWENLK
FT                   KVYLRAKDGSLVPLTDVVSLTIAPGYHVINRYDRQYSFTFFANLSGKALGDATAEIESW
FT                   LRSNLPPGYSFEPTGQTREFARAFKGLAFALTVALVGIYMVLASLFESYRHPFTVLLTV
FT                   PLSLSGTFGLLYLTGTSLSVPSYFGIILLIGIVVRDAVLFIERIIQLRKEGYQTRQAIL
FT                   QARRERLRPILMTTLTVVFALLPVSLGLTAGSELRKPLAIAVIGGIATALPLSLLVLPI
FT                   VYELFDGLKLKRR"
FT   gene            38965..39615
FT                   /locus_tag="Hydth_0035"
FT   CDS_pept        38965..39615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0035"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="COGs: COG0177 EndoIII-related endonuclease; InterPro
FT                   IPR003265:IPR003651:IPR011257:IPR004035; KEGG:
FT                   hya:HY04AAS1_0888 DNA-(apurinic or apyrimidinic site)
FT                   lyase; PFAM: HhH-GPD family protein; iron-sulfur cluster
FT                   loop; PRIAM: DNA-(apurinic or apyrimidinic site) lyase;
FT                   SMART: HhH-GPD family protein; iron-sulfur cluster loop;
FT                   SPTR: B4U8W4 DNA-(Apurinic or apyrimidinic site) lyase;
FT                   PFAM: HhH-GPD superfamily base excision DNA repair protein;
FT                   Iron-sulfur binding domain of endonuclease III;
FT                   Helix-hairpin-helix motif; TIGRFAM: endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44445"
FT                   /protein_id="ADO44445.1"
FT                   /translation="MRKEDVEKVIDILRREFPRWNAPVVSLIAQKTGDPFRVLVCALIS
FT                   TRTKDETTAMVCKRLFERIKNVDDLYNIDEEELSRLLYPVGFYKNKAKFLKSIAEEIKK
FT                   NYSSQVPNKLEDLLKLKGVGRKVANLVLSEGYGIPAICVDTHVHRITNRWCLIKSKDPE
FT                   ETERKLTEILPEKYWIEFNKLLVAFGQTLCKPVKPLCGVCPIREYCEYEFKTL"
FT   gene            39634..40491
FT                   /locus_tag="Hydth_0036"
FT   CDS_pept        39634..40491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0036"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: sus:Acid_2517 beta-lactamase
FT                   domain-containing protein; SPTR: Q024S0 Beta-lactamase
FT                   domain protein; PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44446"
FT                   /protein_id="ADO44446.1"
FT                   /translation="MADIKKRLPCNVPGDFFVDASCIDCDICTEIAPAIFGKGKDSACV
FT                   IKQPKAKEEEEKALMALLSCPVGAIGTRSKEGVREVIKKFPAKIEDGVYRCGLSSKKSY
FT                   GAMSYFILHPDGNWMIDSPRENAHLLKNIASLGGLKYIFLTHEDDVADAEFYAKAFNAQ
FT                   VIIHERDAHAYPKADIKVSGDDPTNMGDFTIIPTPGHTAGHMVLLYKNFLFTGDHLWYS
FT                   PERKRLWASEEYCWYSWSHQLKSIKRLLDFRFEWVLPGHGRSIKMSHKEIKRQIKELLL
FT                   MYNF"
FT   gene            40500..41531
FT                   /locus_tag="Hydth_0037"
FT   CDS_pept        40500..41531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0037"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR001633;
FT                   KEGG: aae:aq_083 hypothetical protein; PFAM: EAL domain
FT                   protein; SMART: EAL domain protein; SPTR: O66495 Putative
FT                   uncharacterized protein; PFAM: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44447"
FT                   /protein_id="ADO44447.1"
FT                   /translation="MAKKVLAVFTDSEQTAKMLSEIAERYSLKCKVISSVALLSADNEE
FT                   DILELLLDADREMVKGFRYLLLSSEKPIEVSTDFLLREVPHTLNLEELLDKLIYGVIGD
FT                   VFYNVKIAFHPILDLKNGKVFACEALCRPPIKITDLLEVGRSTSTYTEEFCRSKAIKEA
FT                   GEKLNGEIKLFINFHPRFLTDPFRTFGDFISMAVSYNFKPSRIVIELTEHEKLELSSVR
FT                   GFINFLKEEGVKVALDDVGSGYSGLFYLSELQPDYIKIDMELIRDIHRNNFKKVIVGHL
FT                   IKMAHSEGIKVVCEGIEKKEELDWVKYAGADYGQGYLFTKPTDKPDIAAVEGMAKELLA
FT                   LDA"
FT   gene            41559..42884
FT                   /locus_tag="Hydth_0038"
FT   CDS_pept        41559..42884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0038"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="COGs: COG0014 Gamma-glutamyl phosphate reductase;
FT                   InterPro IPR012134:IPR000965:IPR016161:IPR020593:IPR
FT                   016162:IPR016163; KEGG: aae:aq_1071 gamma-glutamyl
FT                   phosphate reductase; PRIAM: Glutamate-5-semialdehyde
FT                   dehydrogenase; SPTR: A8UUG5 Gamma-glutamyl phosphate
FT                   reductase; TIGRFAM: gamma-glutamyl phosphate reductase;
FT                   PFAM: Aldehyde dehydrogenase family; TIGRFAM:
FT                   gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44448"
FT                   /protein_id="ADO44448.1"
FT                   /translation="MSIEVKSYAEEKVERVRRVLRELVALKTEVKNRALLTAAELINGK
FT                   RSFIKEENAKDVEYAKSIGLSSAVIDRLVLNDKRIDGIIKVLKDVASLPDPVGEITRMW
FT                   TLPNGLKVGRMRVPLGVIFIIYEARPNVTVEAASLCMKSSNAVILRGGKEAINSNRALV
FT                   SILKEASREVGFPEDAIEFIDRPEREIVWELLQMEGKIDVAIPRGGESLIRAVAEKAKV
FT                   PVIKHYKGVCNIYVDEEADLSKAYHIVYNAKVQRPSVCNAVENLIIHRRILRDFFPRMA
FT                   YILGKAGVELRCDEESLSLIKSDPRLSFVKATPAREEDYYEEFLDLILAVKVVGSLEEA
FT                   IEFIEKYGSKHSDAIITENYTKAMKFLNEVDSAAVYVNASTRFTDGNEFGLGAEMGIST
FT                   DKVHARGPMALEELTIQKFIIFGNGQLRDNVGVPEEIMKELL"
FT   gene            complement(42865..44772)
FT                   /locus_tag="Hydth_0039"
FT   CDS_pept        complement(42865..44772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0039"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="COGs: COG0296 1 4-alpha-glucan branching enzyme;
FT                   InterPro IPR006407:IPR004193:IPR006047:IPR006048:IPR
FT                   006589:IPR017853:IPR014756:IPR013783:IPR013781:IPR013780;
FT                   KEGG: aae:aq_722 glycogen branching enzyme; PFAM: alpha
FT                   amylase all-beta; glycoside hydrolase family 13 domain
FT                   protein; alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; SPTR: O66936
FT                   1,4-alpha-glucan-branching enzyme; TIGRFAM:
FT                   1,4-alpha-glucan branching enzyme; manually curated; PFAM:
FT                   Alpha amylase, C-terminal all-beta domain;
FT                   Carbohydrate-binding module 48 (Isoamylase N-terminal
FT                   domain); Alpha amylase, catalytic domain; TIGRFAM:
FT                   alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44449"
FT                   /protein_id="ADO44449.1"
FT                   /translation="MPVYFIFFYMNLSMITDYDIYLFKEGSHCRLYEKLGAHPLEGGVY
FT                   FAVWAPNARYVSVVGSFNSWDRGANPLKLREDGSGIWEGFVEKARVGDLYKYFIVSKSG
FT                   YEAEKADPFGFFFEVSPKTASIVWDLSYQWKDQEWMKERHKKNALDSPWLIYEVHLGSW
FT                   KKKGWESLSYRELAEELVEYIKEMGFTHVEFLPVMEHPFYGSWGYQITGYFAPTSRYGT
FT                   PQDFMYLIDRLHQEGIGVILDWVPSHFPTDGHALAYFDGTHLYEYEDFRKRYHPDWNSY
FT                   IFDYSKPEVRSFLLSSAHFWLGIYHADGIRVDAVASMLYLDYSRKPGEWVPNIYGGKEN
FT                   LEAIEFIRKLNECLYRDFPGIQTIAEESTAWPMVTKPTYLGGLGFGMKWNMGWMHDTLF
FT                   YFSKDPIHRKYHQDKLAFSLWYAFSENFVLVLSHDEVVYGKGSLINKMPKDWWQKFANL
FT                   RLLLTYMYAHPGKKLLFMGGEFGQWDEWNHDRGLDWFLLEHSTHRGVQKLVRDLNRVVK
FT                   ENPALYELDFSHEGFEWIDFSDTDQSVISFLRKDRSGKNIFLSVFNFTPVPRYNYRIGV
FT                   PYRGFWKKIINSDALEYGGSGHGDTEAVHTEDVPFHGRPYSICLTLPSLAGLYFTIALS
FT                   "
FT   gene            44774..45331
FT                   /locus_tag="Hydth_0040"
FT   CDS_pept        44774..45331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF0486 hypothetical protein; SPTR: O29764
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44450"
FT                   /protein_id="ADO44450.1"
FT                   /translation="MEELQTEREDRLEAIIEDIYRSTGHFDIGCSELGCFLCAKGGKKS
FT                   AECQRLQEAVVLLPTENRVIKKLNSACFPEISVNGFSIGFLAPEQDCPFNMDGFCGIHG
FT                   KHPIDCRSFPIVPSVNERGDLIISISLKCPTVPPWDFVKTWVENWKKLWELLPREWFRF
FT                   YSEVPTNPLKPIAIFRLKEKHL"
FT   gene            complement(45312..47813)
FT                   /locus_tag="Hydth_0041"
FT   CDS_pept        complement(45312..47813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0041"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="COGs: COG0249 Mismatch repair ATPase (MutS family);
FT                   InterPro IPR005748:IPR007695:IPR007860:IPR007696:IPR
FT                   007861:IPR000432:IPR016151; KEGG: aae:aq_308 DNA mismatch
FT                   repair protein MutS; PFAM: MutS III domain protein; MutS II
FT                   domain protein; DNA mismatch repair protein MutS domain
FT                   protein; MutS IV domain protein; SMART: DNA mismatch repair
FT                   protein MutS domain protein; MutS III domain protein; SPTR:
FT                   A8UTM4 DNA mismatch repair protein; TIGRFAM: DNA mismatch
FT                   repair protein MutS; PFAM: MutS family domain IV; MutS
FT                   domain II; MutS domain V; MutS domain I; MutS domain III;
FT                   TIGRFAM: DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44451"
FT                   /protein_id="ADO44451.1"
FT                   /translation="MWNTPSEGELTPMLSQYHHFKRLHPDCLLFFRLGDFYELFYKERI
FT                   PMCGVPYHSSTNYITKLVSKGYKVAICEQMEDATQAKGLVRREVIRVITPGTYFEKDLS
FT                   GLACVYVKGKRYFCAYLNPSTGEFVAGSFSQEQVYEFLCKFSPREVLLQRGTHLEPEKY
FT                   IRTYKTELDEEYFSRGLEELIRDFNLHSYRSLGFETQEELIPCGCAYLYLKSTQRGFTP
FT                   FVSKPKPYSDEGYVRIDYRARRGLELLESYEGREDISLFSVIDRTLTGMGRRRLKFHLL
FT                   HPFRSRERILQVQSAVEELTEKRQALKEIREYLKDMPDIERLISRISGNVATPRDFVLL
FT                   KKALFLASRLKEGFSGAEFSSSLLKSLFEDMQDLRELAQDIDNTLVDDPPLHVKEGGLI
FT                   KDGVSHELDRLRYICQNSESLLREYEEKLRKETGVQSLKIGYNRVMGYYIEVTKPNLKY
FT                   VPSYFKRRQTLSNAERFITEELSSLEEKILSAQARIKDMEYEIFASLRERVLSKVEAIA
FT                   RSAQKVGFLDYLQSLAYVALEKGWKKPQITDEKVIKIKEGRHPLIEAFVKDYVPNDTSI
FT                   DERENIMIITGPNMAGKSSYIRQVAVLTLLAHMGSFIPCQEAEIGTVSSIHARIGSGDI
FT                   LALGVSTFMNEMLDVASILNSADERSLIVLDEVGRGTSTYDGISLTKALVEYIAKRVKA
FT                   RTLLATHYLEITKLEEEINGIRNYHMAVSREGERVNFLYRLKRGSAEGSFGIEVAKMAG
FT                   LPQELINRAKEILSEYESMLQLPFLERVYAESVRIANEKSWQEFLDYIESIDIANTTPL
FT                   QALLVLSQLKERLKMLKDASP"
FT   gene            complement(47794..49530)
FT                   /locus_tag="Hydth_0042"
FT   CDS_pept        complement(47794..49530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0042"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG1418 HD superfamily hydrolase; InterPro
FT                   IPR017705:IPR006675:IPR004088:IPR018111:IPR
FT                   006674:IPR004087:IPR003607; KEGG: aae:aq_1732
FT                   phosphodiesterase; PFAM: metal-dependent phosphohydrolase
FT                   HD sub domain; K Homology, type 1, subgroup; SMART: KH
FT                   domain protein; metal-dependent phosphohydrolase HD region;
FT                   SPTR: A8URW9 Putative uncharacterized protein; TIGRFAM:
FT                   YmdA/YtgF protein; metal dependent phophohydrolase; PFAM:
FT                   KH domain; HD domain; Domain of unknown function (DUF3552);
FT                   TIGRFAM: conserved hypothetical protein YmdA/YtgF;
FT                   uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44452"
FT                   /protein_id="ADO44452.1"
FT                   /translation="MSIEVLLMVLLVASVFSGLVGFFLSKLLRKEESQRVPQVDLEKVE
FT                   LEAKHILQRAQAQAEKIRQDAKEETERLIGITKEEAERYRKLAKEEAESLLLRAKEEAH
FT                   RIKEEAEKRRRETEDFIAEKRAELQKLEQSLIQKEHQLERRLEVLERREEELYRREKDT
FT                   RETERQLERLQRELEERLNGILQKEKEVESLRQKEILELQRIASMSMEEARAEVLKRAE
FT                   EEARIDAIRVMKRIEEEAKEKAEFEAKRIITTAIQRLSPEIAINYTTTTVELPSNEFKG
FT                   RIIGREGRNIRTFELLTGVDLIIDDTPDVVTISSFDPLRREIAKEALQILIDDGRIHPA
FT                   RIEEVVNQVKKEMDEKIRKMGEETCTELGLYDINPGLYYYIGKLYFRTSYSQNVLLHSK
FT                   EVAYIAGLMAGELGLDAKMARRAGLLHDIGKSISHELGGSHTDIGIELCKKYGEPDPVL
FT                   NAIKAHHNEEPVRYPEVALVCAADALSAARPGARRESLETYLKRLEKLENIVKSFKGVA
FT                   NAYAVQAGREVRIIVNPEELSDEEAYVLSKEVARKIEEEMEYPGQIKVVVIRETRHVEY
FT                   AK"
FT   gene            complement(49520..50095)
FT                   /locus_tag="Hydth_0043"
FT   CDS_pept        complement(49520..50095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0043"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="COGs: COG0212 5-formyltetrahydrofolate cyclo-ligase;
FT                   InterPro IPR002698; KEGG: aae:aq_1731 hypothetical protein;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; SPTR: O67621
FT                   Putative uncharacterized protein; TIGRFAM:
FT                   5-formyltetrahydrofolate cyclo-ligase; PFAM:
FT                   5-formyltetrahydrofolate cyclo-ligase family; TIGRFAM:
FT                   5,10-methenyltetrahydrofolate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44453"
FT                   /protein_id="ADO44453.1"
FT                   /translation="MKVLKKSELRRAYLNRREAMGEEEVFLYSERIKRGVKSLPDFKGA
FT                   KKILFYCPIKNEPDLTSLIWESISLGKEALLPKVDGDRLRIYKVEHSNQLKPGSFCILE
FT                   PEDGTQVEPEEVGLALVPGIVFDTKGYRIGFGKGFYDRLLKRVKGVKVGVAYSFQVLEE
FT                   IPVDSWDEPVDLLITETYILKGGKKYEY"
FT   gene            complement(50126..50290)
FT                   /locus_tag="Hydth_R0004"
FT   ncRNA           complement(50126..50290)
FT                   /locus_tag="Hydth_R0004"
FT                   /product="6S RNA"
FT                   /note="6S / SsrS RNA as predicted by Rfam (RF00013), score
FT                   36.93"
FT                   /ncRNA_class="other"
FT   gene            complement(50288..52603)
FT                   /locus_tag="Hydth_0044"
FT   CDS_pept        complement(50288..52603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0044"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /note="COGs: COG0072 Phenylalanyl-tRNA synthetase beta
FT                   subunit; InterPro
FT                   IPR004532:IPR002547:IPR005121:IPR005146:IPR
FT                   005147:IPR020825:IPR016027:IPR009061:IPR012340; KEGG:
FT                   aae:aq_1730 phenylalanyl-tRNA synthetase subunit beta;
FT                   PFAM: B3/4 domain protein; t-RNA-binding domain protein;
FT                   tRNA synthetase B5; ferredoxin-fold anticodon-binding;
FT                   SPTR: O67620 Phenylalanyl-tRNA synthetase beta chain;
FT                   TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit; PFAM:
FT                   tRNA synthetase B5 domain; B3/4 domain; Ferredoxin-fold
FT                   anticodon binding domain; Putative tRNA binding domain;
FT                   TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit,
FT                   non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44454"
FT                   /protein_id="ADO44454.1"
FT                   /translation="MKVPYTWLIELVDVQDISPEDIARELTLKSVETSVQKFDADLDGV
FT                   VFGKVVEMREHPTKKNLLVCRLDVGGGYHPTVITGDRSLKLGDGVFLALPGAKVGELCI
FT                   TKREFDGVVSEGMLLSAQELGLEPHSEGVLKIWEEIKPGTSAYDLLGFGEYLLELEITP
FT                   NRGDLLSVRGVAREVCAIFRRNLKKDKEVSFEEFGELDIQIIDRDCKRYRGALIEGVSV
FT                   KDSPLWLRRRLWQCGVRSINNVVDITNYIMLRDGQPLHAFDADKLSGGIRVRSAKKGER
FT                   IALLTGAEKTLTEDNLVIADEEKPLAVAGVVGGQESGVNHSSRRILLESAYFEPYRVRR
FT                   SSKAISTQTDSSYRFERNVDIEGVKRYQDLAIELILEVAGGTLTALRDAYPSPYQPKTI
FT                   FLSLEKYRRYAGETLNREEASEILTKLGIPNSPMRCGVEVYVPSHRSYDMQRDVDIIEE
FT                   ILRIKGYNSLPSEVLSLPSLPFEHKSITDKVRELLKSRGLLEIISFSFEDLSLYELLDI
FT                   EKPTISITNPLVKNQAYMRTSLIPSLLRTCLYNQRQHNYDMALFEVGRVYTHQGEEERV
FT                   GILLTGVRRLYPQEVYTAYDALSLLIDVGRILGLKMESQSSSYGFLHPYVQTDLVLENE
FT                   KVGFVGQLSPRIVNTLELKGKVFIGELRLLHIQQKTKLYKPFSKYPPVIRDLSVVVDKG
FT                   VAVDKLISHTQNLLKEKLEEVKVFSIYTGSELGEGKKSVSFRLVFRSFEGSMSDGEVNG
FT                   LVNKLISSLEDSFGARLR"
FT   gene            52624..53616
FT                   /locus_tag="Hydth_0045"
FT   CDS_pept        52624..53616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0045"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro
FT                   IPR005894:IPR003439:IPR003593:IPR017871; KEGG: kcr:Kcr_0542
FT                   daunorubicin resistance ABC transporter ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   B1L4B6 Daunorubicin resistance ABC transporter ATPase
FT                   subunit; TIGRFAM: daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter; TIGRFAM:
FT                   daunorubicin resistance ABC transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44455"
FT                   /protein_id="ADO44455.1"
FT                   /translation="MLLHAIEVKNLVKVYDGKVRALDGVSLTVQTGQAFALLGPNGAGK
FT                   TTLMRILTTQIKPTHGDAYIYGYSVERQSSQVRKLISYVPQEMSVWTDITVYENLLIYA
FT                   KLFGLSGKDRNRAIERALEDMELREVRDDLVNTLSGGMIRRLEIACAMLIEPKVMFLDE
FT                   PTIGLDPVARKRVWEKLKQFRDNSGVTIFFNTHYMDEVDMYADRVAIINKGRIVVSGTC
FT                   EELKRSVAAEAVLVQTENPHANYNLLKHVPAVREVHTEGDEIKILVDDAEAFLPVLLDI
FT                   LRKAGVRIRRVSVSKPTLDDVFLKYAGTKFESADRISDVRQTRKMLSRM"
FT   gene            53619..54380
FT                   /locus_tag="Hydth_0046"
FT   CDS_pept        53619..54380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0046"
FT                   /product="ABC-2 type transporter"
FT                   /note="InterPro IPR013526:IPR000412:IPR013525; KEGG:
FT                   kcr:Kcr_0543 ABC-2 type transporter; PFAM: ABC-2 type
FT                   transporter; SPTR: B1L4B7 ABC-2 type transporter; PFAM:
FT                   ABC-2 type transporter; TIGRFAM: ABC transporter efflux
FT                   protein, DrrB family; daunorubicin resistance ABC
FT                   transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44456"
FT                   /protein_id="ADO44456.1"
FT                   /translation="MNAIKSILVMMELELRRLKHDRTEIYFRAIQPMLWLVIYGPVMGS
FT                   VKAIPTNGVPYTDYITPGVLIQSTTFVSIFYGLMMVWERDVGILKRLLVTPAPRYSVVV
FT                   GRSMASGLRSLLQVFIILPVAYIIGVRFLPNPLYFVLALGVIFLSSGGFASVSILVASF
FT                   MKTRERFMGIGQAIIMPLFFASNALYPVNLMPPILRELSIINPLTYAVDAVRGLLITGD
FT                   ISKLYLDLGVLITFDILMFTLSSLSFRRIIE"
FT   gene            54401..55231
FT                   /locus_tag="Hydth_0047"
FT   CDS_pept        54401..55231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0047"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro IPR006127;
FT                   KEGG: aae:aq_619 adhesion B precursor; PFAM: periplasmic
FT                   solute binding protein; SPTR: C6PF00 Periplasmic solute
FT                   binding protein; PFAM: Periplasmic solute binding protein
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44457"
FT                   /protein_id="ADO44457.1"
FT                   /translation="MLQLIFLMLSVLSLSFCGEIVATTYPVYYPLKYLVGEKHRLEVLV
FT                   RSQADPHHYELTPKDAERLLGANLVMTLGLESWEWRLLKNLPKGKVVTLSEGINLLKRG
FT                   SFPDPHVWLSPKEYRVVVRNIKDALVRWDPSQRAYYQERYSQYLQRLNSLDRKLESTLK
FT                   TCSYRTLVSTHRAWDYLSRDYGIKTLSLSGVHAEEEPKPSEIKAIVQTVKREGLKYIFA
FT                   EVGQDRKVADFIASQTGTRVLMLNSSLFPQLNSDDYFSIMERNLRALREGLGCR"
FT   sig_peptide     54401..54466
FT                   /locus_tag="Hydth_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            55222..55899
FT                   /locus_tag="Hydth_0048"
FT   CDS_pept        55222..55899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0048"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1121 ABC-type Mn/Zn transport systems
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR017871;
FT                   KEGG: aae:aq_620 ABC transporter; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: A8UUD6 ABC transporter;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44458"
FT                   /protein_id="ADO44458.1"
FT                   /translation="MQVKEALKVKNLSFRYRRDEPLIDDLSFSVLEGEFFGILGPNGSG
FT                   KTTLLRLILGFLKPLSGSIELFGEDVRTFKRWNKVGYVPQRFHVEKAFTGTVGELFRAL
FT                   APKEKVGWIIAYLHLEDLLKKQFTKLSGGQQQKVLLALALTTNPDMILLDEPLTGLDIH
FT                   AQEHIESILKEISRKRTVIVVSHDVGFVLRNADRILCLGMQECRLIKAQELEGMLKELY
FT                   RLH"
FT   gene            55901..56728
FT                   /locus_tag="Hydth_0049"
FT   CDS_pept        55901..56728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0049"
FT                   /product="ABC-3 protein"
FT                   /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
FT                   permease components; InterPro IPR001626; KEGG: aae:aq_621
FT                   hypothetical protein; PFAM: ABC-3 protein; SPTR: A8UUD5
FT                   Putative uncharacterized protein; PFAM: ABC 3 transport
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44459"
FT                   /protein_id="ADO44459.1"
FT                   /translation="MLLLEYAFLWKGLVGGLLISASSSLVGVFLLMKRLSLLGAGLSHA
FT                   AFGGIALAILFNADPTLFTLLYTVLSGLLLQFLIEKRGLPADTVISLFFSLGVALAILV
FT                   LSITQNLGSNVYSYLFGSVLTVSDRELYSALATSLLTFLFVLAYYRKLLLISFNEELAT
FT                   LRGVKVSLLNYLLISIASANIVFAIKAVGLILASSFIAIPPMSALLVAGSFFSTLALSL
FT                   FLSLSATLLGMLLSLELDAPPSATIILCMVFIFLILTLWKGITLLKRRLSQTS"
FT   gene            complement(56691..57470)
FT                   /locus_tag="Hydth_0050"
FT   CDS_pept        complement(56691..57470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0050"
FT                   /product="ribonuclease HIII"
FT                   /note="COGs: COG1039 Ribonuclease HIII; InterPro
FT                   IPR004641:IPR001352:IPR012337:IPR018151; KEGG: aae:aq_1768
FT                   hypothetical protein; PFAM: ribonuclease HII/HIII; SPTR:
FT                   A8US70 Ribonuclease; TIGRFAM: ribonuclease HIII; PFAM:
FT                   Ribonuclease HII; TIGRFAM: ribonuclease HIII"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44460"
FT                   /protein_id="ADO44460.1"
FT                   /translation="MNISLRLPEEYYDKVRAFLKDRGFEERKIEYAIWSLCREGTCATL
FT                   YRSGSLLLQGNGALFLKEEILSLMEEPSGVQIGCDESGKGDVFGPLVLCCVIIPPSHYK
FT                   RVLSLAPKDCKLLKDEVLLKKVEALSPLVEAKCLVYEPEQLNELYSEVRNLNRIMDRAY
FT                   RTLIEDVRKHYHVEITIDAYSSQSPFGKGVVFKKKGERDVAVSVASMFARARFLLWIRE
FT                   HNLPKGAGKDAITKARIMLKDEPHKAKKFVKVFFLEG"
FT   gene            complement(57546..57746)
FT                   /locus_tag="Hydth_0051"
FT   CDS_pept        complement(57546..57746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_0520 hypothetical protein; SPTR:
FT                   A8UUZ7 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2892)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44461"
FT                   /protein_id="ADO44461.1"
FT                   /translation="MTMDRALRLTSGVFLLIVFLFGIRGSDVHWFWKLFLLFMSLNQIQ
FT                   SAFTNWCPVMSLYRKLGIKEC"
FT   gene            57852..59369
FT                   /locus_tag="Hydth_0052"
FT   CDS_pept        57852..59369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0052"
FT                   /product="transcriptional regulator, NifA subfamily, Fis
FT                   Family"
FT                   /note="COGs: COG3604 Transcriptional regulator containing
FT                   GAF AAA-type ATPase and DNA binding domains; InterPro
FT                   IPR020441:IPR002078:IPR003018:IPR002197:IPR
FT                   003593:IPR009057; KEGG: aae:aq_1792 NtrC family
FT                   transcriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; GAF domain protein;
FT                   helix-turn-helix Fis-type; SMART: AAA ATPase; GAF domain
FT                   protein; SPTR: A8UXU7 Transcriptional regulator (NtrC
FT                   family) protein; PFAM: GAF domain; Bacterial regulatory
FT                   protein, Fis family; Sigma-54 interaction domain; TIGRFAM:
FT                   Nif-specific regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44462"
FT                   /protein_id="ADO44462.1"
FT                   /translation="METKRQLSTREVTIINEVAKILSKGMNFLESAGEVLKILYSFWDV
FT                   KYSYVALYRKDLKLLKIVKAFGLKEEEVERGLFKRGEGIIGKVYKSGVPVVLSDLSTNS
FT                   YLNRTGLKERLEGSESFIAVPIRIGGEIIGVLALFKSFDKKESVEKAVELLIILGTMIG
FT                   MLYKLEERINMERQEWEEEKKALTQALGKKYSLEGIIGRSVAIKNLIDLVERVSQTDIT
FT                   LLLTGESGTGKSLIAKAIHFLSHRKEKPFVTINCSAIPEALLEAELFGYEKGAFTGAYT
FT                   SKKGKFEIANGGTVFLDEIGDMPLSLQPKILRVLQEKEIEKLGSERSIKVDVRIISATN
FT                   KDLRQLVQKGDFREDLYYRLSVLPIHIPPLRERKEDIPLLVDHFLNTFNQKYSKNVKID
FT                   AKALELMMEYPWYGNVRELENTIERLVILKDGIVKESDLPSYFFVELSRDEPRNLPSVI
FT                   ELTEREEIIKALERTGYVKSRAAKLLGYTLRQLDYRIRKYGISLKKF"
FT   gene            complement(59439..60629)
FT                   /locus_tag="Hydth_0053"
FT   CDS_pept        complement(59439..60629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_0960 hypothetical protein; SPTR:
FT                   B4U936 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44463"
FT                   /protein_id="ADO44463.1"
FT                   /translation="MGKLREVILLSALVALPSVSSAVDIKVSEDVTLSLGAWLKVWGGY
FT                   LDKGITPDLRLDPTNTQRSYNVNLVYPAWWFMGKAYDKVDFALIWIAPGLVDNKNNALG
FT                   KEMRLIDGFINFNLADEFKITAGQFRAPYTRLHITNEATYVTETGPIYRGFAQGIAVSP
FT                   VYRDKGVALWGNIAGGMFQYRLGLFDGLYNKGDVVNGQNIVKDNLAYTVRVQFSPTMLG
FT                   FSPETDYVLSETYLGKKDVLTVGAGYTAQKWETATNSKTAKMWTVDFQFEKKFGDIVPN
FT                   LGAGYVETKDFLPASSVPADRTDCSQYQKCKLAYAEGQILYDQKVGAGKPGLGLRWEYQ
FT                   KPEGNPGSGIKLNRYQVWLNYYLNGHAAKVMVGADVVDPSQGSTRTNATIAAQVIF"
FT   sig_peptide     complement(60564..60629)
FT                   /locus_tag="Hydth_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            60742..61236
FT                   /locus_tag="Hydth_0054"
FT   CDS_pept        60742..61236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0054"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="COGs: COG0041 Phosphoribosylcarboxyaminoimidazole
FT                   (NCAIR) mutase; InterPro IPR000031; KEGG: aae:aq_1178
FT                   phosphoribosylaminoimidazole carboxylase; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; PRIAM: Phosphoribosylaminoimidazole
FT                   carboxylase; SPTR: O67239 Phosphoribosylaminoimidazole
FT                   carboxylase catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM: AIR carboxylase; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, PurE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44464"
FT                   /protein_id="ADO44464.1"
FT                   /translation="MNPKVAIIMGSLSDWEYLKEAHNLLKEFGVECDVRVVSAHRTPEV
FT                   MYEFAKSAKDNGIEVIIAGAGGAAHLPGMTASLTTLPVIGVPVPSKHLSGVDSLYSIVQ
FT                   MPAGVPVATVGIGNGVNAGLLALRILSIKYPHIAQKLEDYRKSLQEKVERMNQELKNQT
FT                   T"
FT   gene            complement(61224..62795)
FT                   /locus_tag="Hydth_0055"
FT   CDS_pept        complement(61224..62795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0055"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro
FT                   IPR000014:IPR000160:IPR000700:IPR013655:IPR 001610; KEGG:
FT                   tcx:Tcr_0090 diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; PAS fold-3 domain protein; SMART: GGDEF
FT                   domain containing protein; PAC repeat-containing protein;
FT                   PAS domain containing protein; SPTR: A8UVB7 Diguanylate
FT                   cyclase (GGDEF domain) with PAS/PAC sensor; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box; diguanylate
FT                   cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44465"
FT                   /protein_id="ADO44465.1"
FT                   /translation="MDYSAFDFIPLPVLVIDENYQVIFLNRKAKETYGDREGKCYEITH
FT                   SFSQPCYTMENCPCPVKSIEEKGLESYHAVHVHRMAGREAYFYVVAGCIPESKTYIELH
FT                   IDLSHLLTALEGSRLSSQLLVSEGPIVFFFWDNSPGWPVKLVSPNVKDLTGYTVEEFLR
FT                   GDITYADMVHRDDLERVAREVKTYTEGGAPSWTHEDYRIVTKDGKVKWVLDHTTVVKND
FT                   QGEVIGYYGYVMDITEKHEKEEIIRNLSDASPVGIFLRQGKKLLYVNQALAEITGYSSE
FT                   ELIELDDVLNIIHPKDRKMVRNVMLKRDAGIKGVERYEVRIKRKDGKIRWVQISSETIF
FT                   YKGSPAGIGVMVDITERKIAEKKLRRLIMYDGLTQIYNRYALEEFLSRELVKAERYKLP
FT                   FGIVFFDIDDFKRINDTYGHKMGDMVLKRLARLVKGNIRKADIFGRWGGEEFLIILPQL
FT                   EDPAAFAEKIRKMVESTVFDKGIKVTISLGVTTYREGDTVDTILRRVDAGLYRAKREGK
FT                   NRYYVV"
FT   gene            complement(62776..63186)
FT                   /locus_tag="Hydth_0056"
FT   CDS_pept        complement(62776..63186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0056"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="COGs: COG0736 Phosphopantetheinyl transferase
FT                   (holo-ACP synthase); InterPro
FT                   IPR002582:IPR004568:IPR008278; KEGG: aae:aq_813
FT                   holo-[acyl-carrier protein] synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; SPTR: A8UXY3
FT                   Holo-[acyl-carrier protein] synthase; TIGRFAM:
FT                   holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase superfamily; TIGRFAM:
FT                   phosphopantethiene--protein transferase domain;
FT                   holo-[acyl-carrier-protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44466"
FT                   /protein_id="ADO44466.1"
FT                   /translation="MSPFYNFLVLGIDIVKNERIKTAVERFGDRFLSRVYTQKELEYCK
FT                   AQKCFFECLSARWACKEAVLKAFYQRFGIVLKLSQIEVLGDRGKPAKVNILGDDLKGML
FT                   ESVSIWVSISHERDYSVAVALIEAHSYGLLSL"
FT   gene            complement(63202..63645)
FT                   /locus_tag="Hydth_0057"
FT   CDS_pept        complement(63202..63645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0057"
FT                   /product="globin"
FT                   /note="COGs: COG2346 Truncated hemoglobins; InterPro
FT                   IPR001486:IPR009050:IPR012292; KEGG: sus:Acid_7805 globin;
FT                   PFAM: globin; SPTR: C4FJP9 Hemoglobin domain protein; PFAM:
FT                   Bacterial-like globin"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44467"
FT                   /protein_id="ADO44467.1"
FT                   /translation="MRKTALSLMLVFGLFGVGSAEMMHKEKTLYRRLGGYDAISAVVND
FT                   LAVRLVTDKQLGVYFKGLSNDSKRRLIAHLTDFVCSATGGPCIYTGRDMKTVHEGLGIS
FT                   DSDWNRFVELTKETLNKFKVPPKEQQEFLQAVAPLKGVIVEKK"
FT   sig_peptide     complement(63586..63645)
FT                   /locus_tag="Hydth_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(63660..64184)
FT                   /locus_tag="Hydth_0058"
FT   CDS_pept        complement(63660..64184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0058"
FT                   /product="globin"
FT                   /note="InterPro IPR001486:IPR009050:IPR012292; KEGG:
FT                   npu:Npun_R1005 globin; PFAM: globin; SPTR: B2IV60 Globin"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44468"
FT                   /protein_id="ADO44468.1"
FT                   /translation="MRRYILGTLALLASAGFMLSSCGGSSSAQSPFERLGGEAGIRKVV
FT                   DDAVPCLATDPNIGIFFRGLSADSLERIKVCLTKQLCAAAGGPCTFPTTITYTSPVDGV
FT                   QRTFTCRPMRAAHQGMVGPDGKGIANDDVDSFKACVQKSMQKNGVPDDLQQAVLNILES
FT                   QRNDVVDDRNK"
FT   sig_peptide     complement(64101..64184)
FT                   /locus_tag="Hydth_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            64281..64580
FT                   /locus_tag="Hydth_0059"
FT   CDS_pept        64281..64580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_1186 hypothetical protein; SPTR:
FT                   C1DVM0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44469"
FT                   /protein_id="ADO44469.1"
FT                   /translation="MGDFTKAGLDKGDIEKELEHTLTSARMLYRTYLLTIEDYSSEELL
FT                   ADLKEYTHQLETSILPLVRRAEATKVPKLVDMAYEIRYTYEKIIEVIREQLDRT"
FT   gene            64653..66299
FT                   /locus_tag="Hydth_0060"
FT   CDS_pept        64653..66299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0060"
FT                   /product="transposase"
FT                   /note="InterPro IPR010094:IPR010095; KEGG: saf:SULAZ_0797
FT                   transposase, OrfB family; PFAM: transposase IS605 OrfB;
FT                   SPTR: C1DUJ0 Transposase, OrfB family; TIGRFAM: transposase
FT                   ; transposase, IS605 OrfB family; TIGRFAM: transposase,
FT                   IS605 OrfB family, central region; transposase, putative,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44470"
FT                   /protein_id="ADO44470.1"
FT                   /translation="MITLHCKLTFENNKDKEALMDIMRKFSSCFRYAYNKLLEGHSRKD
FT                   LKKHLQKIFNINSRYVDDAIFKAQSLINSCIATYQSPSKVIFGGRRLFELLKNKHINGE
FT                   RRNKLKQKWEERRKHCLYSRGDKTKKGNLNIRIELEKDKLTLRINTGDRNWIKANIKRT
FT                   ANRQNDKWINFIADLIRAEETKEYFPYSVEVRKIDNDFYAFISYQDVKIEEPTITKDNG
FT                   VIGIDINASPFHIAMASVKTDGNLEKIRRISLHHLLGKTKNQREYLSWQITHQITDMAK
FT                   EENKAIAIEKLSNIPKGERGDGNGKLRKRLQQWIYKGLLEKIKTLAKRKRIQVIEVNPA
FT                   YTSVIGALKYAPQYSLDKDTAGAFVIGRKALGFREEIPKNYEKLITEKEYLKFAEERIR
FT                   QEKERTQESLKEEKNQYKRKPIQKKLKELNKNLKIIQSLYSEPQAQEPVNRWKQQVRGL
FT                   SWTSYKLWQIVKVALAIPVLGKSLSRDLSPLKGIIVSGAWDRVARRLAPVSWDRGYGMD
FT                   KYRQLGTCPYLKEAGYKYPSPKCGVLYPRFG"
FT   gene            66311..66859
FT                   /locus_tag="Hydth_0061"
FT   CDS_pept        66311..66859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0061"
FT                   /product="DJ-1 family protein"
FT                   /note="COGs: COG0693 Putative intracellular
FT                   protease/amidase; InterPro IPR006287:IPR002818; KEGG:
FT                   sul:SYO3AOP1_1101 DJ-1 family protein; PFAM: ThiJ/PfpI
FT                   domain protein; SPTR: B2V9U4 DJ-1 family protein; TIGRFAM:
FT                   DJ-1 family protein; PFAM: DJ-1/PfpI family; TIGRFAM: DJ-1
FT                   family protein; intracellular protease, PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44471"
FT                   /protein_id="ADO44471.1"
FT                   /translation="MPKVAIILVDGFEEVEAVAPIDVLRRAGVEVLIVGLSREPVASAR
FT                   GIKILPELSIDEVNLEEIDMVVLPGGAEGVENLKKDKRVEALVKALKDKDKYVSAICAA
FT                   PTALASFGVLEGKKATVYPSLKEEIKPAVFVDDKVVEDGRVITSQGPGTALLFALKLAE
FT                   KLAGKDKAREVAQRMLIDW"
FT   gene            66859..68034
FT                   /locus_tag="Hydth_0062"
FT   CDS_pept        66859..68034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0062"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG1092 SAM-dependent methyltransferase;
FT                   InterPro IPR002478:IPR013216; KEGG: aae:aq_2071
FT                   hypothetical protein; PFAM: Methyltransferase type 11;
FT                   SMART: PUA domain containing protein; SPTR: O67850 Putative
FT                   uncharacterized protein; PFAM:
FT                   S-adenosylmethionine-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44472"
FT                   /protein_id="ADO44472.1"
FT                   /translation="MLQVRVKPGVEEKLKSYFPWVYKPEITSYSKKPQKGDHVVVRDAG
FT                   GHFLGYGYINPQANISIRLLSFEKEKKISYELIKERVEQAYNYRKSLSLNTDAFRLIHS
FT                   EGDFLPGLVMDVYGDYAVVEFTTFGMNAMREWVISAILEVLKPKGIYEKRNEYAQKAEG
FT                   FKTEEGVIYGKVPPEITIYEGDLKYYVNIPQGQKTGFYLDQRKARSMIRQLVKPGYRCL
FT                   DLFCHTGGFALNMRKAGAGEVLAVDISAQALEVAKRNAELNSLDNIVWMEENAFDFMRK
FT                   LHKEGQVFDLVLMDPPSFAKNRASVPNALRGYKELCVRGLHVVKRGGYLVIYSCSFHIT
FT                   MDHLLKVLLDAAKDTRRHLRIVGVSFQDLDHPWVLQMPNTLYLKGIYAEVL"
FT   gene            68034..68801
FT                   /locus_tag="Hydth_0063"
FT   CDS_pept        68034..68801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0063"
FT                   /product="undecaprenol kinase"
FT                   /note="COGs: COG1968 Uncharacterized bacitracin resistance
FT                   protein; InterPro IPR003824; KEGG: aae:aq_2195 undecaprenol
FT                   kinase; PFAM: Bacitracin resistance protein BacA; SPTR:
FT                   A8URP6 Undecaprenol kinase; TIGRFAM: undecaprenol kinase;
FT                   PFAM: Bacitracin resistance protein BacA; TIGRFAM:
FT                   undecaprenyl-diphosphatase UppP"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44473"
FT                   /protein_id="ADO44473.1"
FT                   /translation="MNIHQAIILGIVEGLTEFLPVSSTGHLILTAHLMGLENDNFTKSF
FT                   EISIQMGAILAVLFLYTKRFLRDYQVWKRILVAFFPTGLLGFLLYKFIKNYLVGNDKVV
FT                   VASLFLGGVFLLFADRVCERFCYMEDASKLSLRKAFMIGIFQSLAMIPGVSRSASTIIG
FT                   GMLMGLNRKASAEFSFLLAVPTMLIATSYDVYKSHTTFTNAQWYLLFVGFLSAFLTALI
FT                   TVKVFIGFISRHSFLPFGIYRILISFAYGFYFL"
FT   gene            68803..69888
FT                   /locus_tag="Hydth_0064"
FT   CDS_pept        68803..69888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0064"
FT                   /product="cell cycle protein"
FT                   /note="COGs: COG0772 Bacterial cell division membrane
FT                   protein; InterPro IPR001182; KEGG: hya:HY04AAS1_0212 cell
FT                   cycle protein; PFAM: cell cycle protein; SPTR: A8UWW0 Cell
FT                   division protein FtsW; PFAM: Cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44474"
FT                   /protein_id="ADO44474.1"
FT                   /translation="MDRWILYAVVLLFFMGQTAIVSSNTVPYIFERYADFSIYKKPLYQ
FT                   LFTFLAGLFIVNWLFSRLDYRVLKKKKVVYTLVLLSTASLLAVLIKKFVAHKQVDRWLV
FT                   GTSLQPLEFAKITLIIFIAYYIVEKGSVRQWKYIFWASFIVFLNAFLVSLQPDKGGAIF
FT                   LLVLCGLMLYVGGIPKKVYLPIIGVFFLFIAYLLTSKSGYVAERFSAWKDPFADPEESG
FT                   YQIIQSLFGFAHGGMWGVGIGKGIQKMGALPAADTDYAVSLLAEELGFVGMLVLFSLYL
FT                   LLVGRLFYFTYRVKEPFGKLLLFGIALNFALSFLWNVGMAVNLLPPKGIALPFISYGTS
FT                   NLLFSMISIGLAQSVIRRGLF"
FT   sig_peptide     68803..68871
FT                   /locus_tag="Hydth_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            69902..70654
FT                   /locus_tag="Hydth_0065"
FT   CDS_pept        69902..70654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0065"
FT                   /product="cytochrome c assembly protein"
FT                   /note="InterPro IPR002541; KEGG: aae:aq_055 cytochrome c
FT                   biogenesis protein; PFAM: cytochrome c assembly protein;
FT                   SPTR: A8UTA7 Cytochrome c biogenesis protein; PFAM:
FT                   Cytochrome C assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44475"
FT                   /protein_id="ADO44475.1"
FT                   /translation="MLTLSLILYLLSFFVAILSYYGKIAQKAVLPPLMFAIVSYFIYIL
FT                   HISLKLGSFPFANPYGFSSILGNTMVLTLTIFSLKNSQFLRFSAIFSFIGILSALLALP
FT                   SEPSPYRNPLYSLHILSALFAYVSAFFGGLSSLLRLLLERRLKQKDLPAFSLSINLLRT
FT                   SERIAVNLSFVLLTLTLIFGSFWTRVHFGKHWVNDPKLLFTFILWMYYAFVVHLNLVRG
FT                   LKPKQLSVLILLGSLFSLLNLLFVRHEV"
FT   gene            70644..71153
FT                   /locus_tag="Hydth_0066"
FT   CDS_pept        70644..71153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0066"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="COGs: COG0703 Shikimate kinase; InterPro IPR000623;
FT                   KEGG: aae:aq_2177 shikimate kinase; PFAM: shikimate kinase;
FT                   PRIAM: Shikimate kinase; SPTR: O67925 Shikimate kinase;
FT                   PFAM: Shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44476"
FT                   /protein_id="ADO44476.1"
FT                   /translation="MKFKRVFLIGFMCSGKSTIGKELAKSLSWKFCDLDEEVQKEEGMS
FT                   IKEIFELKGEDYFRKRELEVLKLLVLEDNAVISTGGGLGANKEALELMKRHGLVVWLDV
FT                   SFDAFLQRCKDVQERPLLKKSLGELKKLYQERKKIYSQAHAHIDTTDEPNKIAQRIIQI
FT                   LQDERR"
FT   gene            complement(71122..71547)
FT                   /locus_tag="Hydth_0067"
FT   CDS_pept        complement(71122..71547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0067"
FT                   /product="Nucleoside-diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="COGs: COG0105 Nucleoside diphosphate kinase;
FT                   InterPro IPR001564; KEGG: aae:aq_1590 nucleoside
FT                   diphosphate kinase; PFAM: nucleoside diphosphate kinase;
FT                   PRIAM: Nucleoside-diphosphate kinase; SMART: nucleoside
FT                   diphosphate kinase; SPTR: A8UR46 Nucleoside diphosphate
FT                   kinase; PFAM: Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44477"
FT                   /protein_id="ADO44477.1"
FT                   /translation="MERTLIIIKPDAFQKGATGKIIDRFLSEGFKLRAMKLFRFTKEQA
FT                   QQFYIVHKERPFYAELVEFMTSGPVVACILEGEDAIRRVREIIGPTDSEEARKVAPNSI
FT                   RALFGTDKGKNAIHASDSKESADYEIPFIFSRLEVFE"
FT   gene            complement(71516..72307)
FT                   /locus_tag="Hydth_0068"
FT   CDS_pept        complement(71516..72307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0068"
FT                   /product="Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulfur cluster binding domain protein"
FT                   /note="COGs: COG0543 2-polyprenylphenol hydroxylase and
FT                   related flavodoxin oxidoreductase; InterPro
FT                   IPR019480:IPR017938; KEGG: aae:aq_2098 hypothetical
FT                   protein; PFAM: Dihydroorotate dehydrogenase, electron
FT                   transfer subunit, iron-sulphur cluster binding domain;
FT                   SPTR: O67867 Putative uncharacterized protein; PFAM:
FT                   Iron-sulfur cluster binding domain of dihydroorotate
FT                   dehydrogenase B"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44478"
FT                   /protein_id="ADO44478.1"
FT                   /translation="MFDILSKEQISQDFILLKIHAPHIRHAKAGQFVLLQLKEHSERIP
FT                   VCVFETFDNGFSCLVQVVGRSTLEIKEEGDAFYYIAGPLGKPFPVGNYGKVVIYSKGWG
FT                   IAPAISVGRALKDLGNYVKMVCLDESLSHLLKREGFDEVVYQENIVAYSGFDLVVSVGS
FT                   NMLSKILSQIYDSTPHITMPVVHMLCAAGLCLTCRVKSGLACTDGPWFEAKEINWEDLL
FT                   KRESLYKEQEKLALEEYKKSLLRKQLREEVEYGKDAHHYQT"
FT   gene            complement(72317..73384)
FT                   /locus_tag="Hydth_0069"
FT   CDS_pept        complement(72317..73384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0069"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="COGs: COG0821 Enzyme involved in the deoxyxylulose
FT                   pathway of isoprenoid biosynthesis; InterPro
FT                   IPR016425:IPR004588:IPR011005; KEGG: aae:aq_1540
FT                   4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; PFAM:
FT                   IspG family protein; SPTR: A8UW96 GcpE protein; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;
FT                   PFAM: GcpE protein; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44479"
FT                   /protein_id="ADO44479.1"
FT                   /translation="MSPKRRKTRQISVGWVKIGGDAPIVVQSMTSTKTHQVEETLQQIE
FT                   RLHSAGCELIRVAVPHEEDLEALPDIVKNSPIPVIADIHFAPSYAFRSMEKGVHGIRIN
FT                   PGNIGKEEIVREIVQEAKKKGVAIRIGVNSGSLEKDLLEKYGYPCAEALFESAMRWSEK
FT                   LEKWGFDNFKVSIKGSDVLENIKSNLLFAERTNIPLHIGITEAGMGQSGIVKSSVGIGI
FT                   LLYLGIGDTVRVSLTDDPEVEVKVAYDILRSLGIRRQGVEIVACPTCGRIEVDLPKVVM
FT                   QVKEKLKDIKEPLKIAIMGCVVNAIGEAREADLGLACGRGFAWLFKRGKPIRKVSEGEM
FT                   AQALLEEVLKYKSEL"
FT   gene            complement(73381..74349)
FT                   /locus_tag="Hydth_0070"
FT   CDS_pept        complement(73381..74349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0070"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="COGs: COG0379 Quinolinate synthase; InterPro
FT                   IPR003473; KEGG: aae:aq_1889 quinolinate synthetase; PFAM:
FT                   Quinolinate synthetase A; PRIAM: Quinolinate synthase;
FT                   SPTR: O67730 Quinolinate synthetase A; TIGRFAM: quinolinate
FT                   synthetase complex, A subunit; PFAM: Quinolinate synthetase
FT                   A protein; TIGRFAM: quinolinate synthetase complex, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44480"
FT                   /protein_id="ADO44480.1"
FT                   /translation="MFALEVKKEEVLGKEELKALQEEVRKLAKEKNAVILAHYYQRPEV
FT                   QDVADFIGDSLELSRKASQTDADIIVFCGVRFMCETAKIVNPTKKVLHPNPESGCPMAD
FT                   MITAKDVLRLKEEHPDGEVVAYVNTNAEVKAVSDVCVTSANAIRIVQKLQSKKIIFIPD
FT                   QALGSWVKRHVPDKEFVIWQGFCPPHFEFTAREVQKLKEMYPDAKVAVHPECHPKVIDM
FT                   ADFVGSTSQIINYATTCDTNRVIVITEVGLKYTLMRKNPNKEYIFPEAMNYCGSVYCCT
FT                   MKAITLPKVYETLKYELNQVILPEEIIEKAKRPILRMLELS"
FT   gene            complement(74395..74829)
FT                   /locus_tag="Hydth_0071"
FT   CDS_pept        complement(74395..74829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0071"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="COGs: COG0319 metal-dependent hydrolase; InterPro
FT                   IPR002036:IPR020549; KEGG: aae:aq_1354 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0054; SPTR:
FT                   O67367 Putative metalloprotease aq_1354; manually curated;
FT                   PFAM: Uncharacterized protein family UPF0054; TIGRFAM:
FT                   conserved hypothetical protein TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44481"
FT                   /protein_id="ADO44481.1"
FT                   /translation="MKGQRRNRIQIRLHKRSIKKAQIEQISERIAELLGLERAEISIYI
FT                   TDDETIRHLNRDYRGKDEPTDVLSFPICEKVGNWLILGDIVISFDTAKKQASQMGHSLE
FT                   EEIKRLLAHGFVHLLGYDHELGGEEERKFFELESYVLKNL"
FT   gene            complement(74759..75784)
FT                   /locus_tag="Hydth_0072"
FT   CDS_pept        complement(74759..75784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0072"
FT                   /product="PhoH family protein"
FT                   /note="COGs: COG1702 Phosphate starvation-inducible protein
FT                   PhoH predicted ATPase; InterPro IPR003714; KEGG:
FT                   aae:aq_1351 phosphate starvation-inducible protein; PFAM:
FT                   PhoH family protein; SPTR: A8UXF9 Phosphate
FT                   starvation-inducible protein; PFAM: KH domain; PhoH-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44482"
FT                   /protein_id="ADO44482.1"
FT                   /translation="MSSTEKLEERVDLGSFDESFYAIVGRGDENLKYFSQVFGVKVFAR
FT                   GTEIMIRGEEEKVKQAYDFIKGIIKELKSHPMTAQDVRERAKEYVSKREAKELEDKENI
FT                   IFLTHRRKAILPKTHTQKIYVDAIKNNDIVFGIGPAGTGKTYLAMAMALAHLKENKVNK
FT                   IILTRPAVEAGEKLGFLPGGIAEKVDPYLRPLYDALYDMVDYDKASYMLERNIIEIAPL
FT                   AFMRGRTLNDAFIILDEAQNSTKEQMKMFLTRIGFGSKVVITGDITQIDLPKREHSGLV
FT                   EAIKVLQNIEGISFVWFTQEDVVRHPIVARIIKAYEEFERAKEEQDTDKTSQEEYKESS
FT                   D"
FT   gene            75848..76717
FT                   /locus_tag="Hydth_0073"
FT   CDS_pept        75848..76717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0073"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="COGs: COG0501 Zn-dependent protease with chaperone
FT                   function; InterPro IPR001915; KEGG: aae:aq_1991 heat shock
FT                   protein X; PFAM: peptidase M48 Ste24p; SPTR: A8UXF8 Heat
FT                   shock protein X; PFAM: Peptidase family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44483"
FT                   /protein_id="ADO44483.1"
FT                   /translation="MGYMLRTVILLGALTGLFLFVGHLIGGKTGMTIALILAGIMNFIA
FT                   YWFSDKIVLSMYGAREIPYEEAPWLHQIVEELASRAGIPKPPIYLVPMEQPNAFATGRG
FT                   PGHAAVAVTSGILHLLDRDELRGVLAHELGHIKNRDVLVATMAATIAGAISYLVNMFQW
FT                   MLIFGGGRDEENRGGWAGLVGSLMLIILTPIIAMIIQMAISRSREYLADETGAKISGDP
FT                   LALARALEKIHNYVYQIPAEVNQGTAHLFIENPLSGEGIWELFSTHPSTEKRIERLKEL
FT                   ARKMGVYA"
FT   gene            76714..77241
FT                   /locus_tag="Hydth_0074"
FT   CDS_pept        76714..77241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0074"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="COGs: COG0693 Putative intracellular
FT                   protease/amidase; InterPro IPR006286:IPR002818; KEGG:
FT                   aae:aq_618 protease I; PFAM: ThiJ/PfpI domain protein;
FT                   SPTR: O66869 Protease I; PFAM: DJ-1/PfpI family; TIGRFAM:
FT                   intracellular protease, PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44484"
FT                   /protein_id="ADO44484.1"
FT                   /translation="MKSVCVFLEELVEDVEFIYPYLRFKEEGFEVISAAPEKKDYRGKK
FT                   GMTFTPDATLSEVSGRLFDCLFIPGGYAPDRLRRYPQVLSMVKKHLEEDRLVAAVCHGP
FT                   WVLISAKVVKDRKVTGFYAIKDDLENAGAIYTGKSVEEDGNLITATDPSSMLQMIKLIL
FT                   EKFSQTGSKLAH"
FT   gene            complement(77195..78463)
FT                   /locus_tag="Hydth_0075"
FT   CDS_pept        complement(77195..78463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0075"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="COGs: COG0771
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase; InterPro
FT                   IPR005762:IPR013221:IPR004101:IPR016040; KEGG: aae:aq_2075
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; SPTR: O67852
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase; PFAM: Mur
FT                   ligase family, glutamate ligase domain; Mur ligase middle
FT                   domain; TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44485"
FT                   /protein_id="ADO44485.1"
FT                   /translation="MDRVLVWGLGISGKSAIKLLKAKGYEVYAGDDKDGTDFREYLDLV
FT                   DTVVLSPGIPPRHPLWIEAQKRGLEVIGEMELAYRFFKGRVVAITGTDGKSTVTRMTYL
FT                   ILREHFGNVLEGGNTGTAFSEIVLRDPFSLAVLEVSSFQGKTLKTFRPCCGAFLNFARD
FT                   HLDWHISLEDYLHSKYNIFKHQQEEDFVVLYSRQEEVVNTPTRAKKYFFSSKDAHGFLR
FT                   EGRAYFMGEELFEVSKLKIYGHHNYRNALASAMIAKLMGVPSETIRKVLYEFSGLPFRL
FT                   ELLGEWEGVKVFNDSKATTVNALESALKSMPDKSVILIAGGRDKGGDFESLYDLILQKV
FT                   RLALLIGEAKDKIFQAWRGATILEKVESLEEALKVAKAYSQRGDIILFSPACASFDMFK
FT                   DYIERGQRFNELVYSLFGRTSQV"
FT   gene            78482..78814
FT                   /locus_tag="Hydth_0076"
FT   CDS_pept        78482..78814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0076"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="COGs: COG1324 conserved hypothetical protein
FT                   involved in tolerance to divalent cations; InterPro
FT                   IPR004323:IPR011322; KEGG: aae:aq_1005 periplasmic divalent
FT                   cation tolerance protein; PFAM: CutA1 divalent ion
FT                   tolerance protein; SPTR: O67123 Periplasmic divalent cation
FT                   tolerance protein; PFAM: CutA1 divalent ion tolerance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44486"
FT                   /protein_id="ADO44486.1"
FT                   /translation="MHRYFVVFITTSVDRAEDMAQHIIKEKLGACVNIVREVNSIYWWK
FT                   GNIERGKESLLVVKTAKEKLRDLVDGVKSIHPYTVPEIIAIPIEAGNEDYLKWIDESLG
FT                   ISQESS"
FT   gene            complement(78768..79358)
FT                   /locus_tag="Hydth_0077"
FT   CDS_pept        complement(78768..79358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0077"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="COGs: COG0512 Anthranilate/para-aminobenzoate
FT                   synthase component II; InterPro
FT                   IPR006220:IPR011702:IPR001317:IPR006221:IPR
FT                   017926:IPR000991; KEGG: aae:aq_549 anthranilate synthase
FT                   component II; PFAM: glutamine amidotransferase class-I;
FT                   SPTR: O66825 Anthranilate synthase component II; TIGRFAM:
FT                   glutamine amidotransferase of anthranilate synthase; PFAM:
FT                   Glutamine amidotransferase class-I; TIGRFAM: glutamine
FT                   amidotransferase of anthranilate synthase or
FT                   aminodeoxychorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44487"
FT                   /protein_id="ADO44487.1"
FT                   /translation="MELLVIDNYDSFTYNLVQYFQMLGCHVAVRRNDEITLMDIEKAKP
FT                   DAIVISPGPCSPKEAGISVDVIKRFYRDIPILGVCLGHQAIAYAFGAKIVRAKNLMHGK
FT                   TSLIYHTQEGIFRGIKNPFVAVRYHSLVVERESLPPVLKITAESDDGEIMGLEHRDYPL
FT                   FGVQFHPESVLSESGMDILKNFLEISQEIRLST"
FT   gene            79626..81521
FT                   /locus_tag="Hydth_0078"
FT   CDS_pept        79626..81521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0078"
FT                   /product="acetate/CoA ligase"
FT                   /EC_number="6.2.1.1"
FT                   /note="COGs: COG0365 Acyl-coenzyme A synthetase/AMP-(fatty)
FT                   acid ligase; InterPro
FT                   IPR020459:IPR011904:IPR000873:IPR020845; KEGG:
FT                   saf:SULAZ_1440 acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; SPTR: A8UVH2 Acetyl-coenzyme A
FT                   synthetase; TIGRFAM: acetate/CoA ligase; PFAM: Domain of
FT                   unknown function (DUF3448); AMP-binding enzyme; TIGRFAM:
FT                   acetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44488"
FT                   /protein_id="ADO44488.1"
FT                   /translation="MVEDRSETLLKVEEKYMPPPSIVESAWVRDYETLYQESIKDREAF
FT                   WAKVAEDLHWFKKWDKVLEWNYPYAKWFVGGKTNITYNCLDRHVKNGKRNKVAYIALDE
FT                   DSREKKITYGELLELVNRIANGLKSLGVKKGDRVSIYMPNTVEAVACMLACARIGAIHS
FT                   LVFAGFSEGALRLRIEDAKAKVVITASYTKRRGKKIDLLATAQRAIDGLDFVEKVIVWD
FT                   RDGDVLNGEDKFFVSLDELISTSSPKCEPEVMDAEDPLYILYTSGTTGKPKGVLHTTGG
FT                   YMVGTYYTTKVVFDLKEDDIYWCTADIGWVTGHSYIVYGPLAVGATSLIVEGAPDYPDP
FT                   GRWWSYVEKYRVNIFYTAPTAVRMFMKYGEQWPAKYDLSSLRILGSVGEPINPEAWHWY
FT                   FKNIGREKCVIVDTWWQTETGMHMITTIPSYPAKPGKAGKPFFGIEALVVDRHGNVLPP
FT                   NTIGNLVIKTPWPSMLRTCWGEPERYEKYWNTIPGYYLTGDLASYDEEGYIMILGRADD
FT                   VLNVAGHRIGTMEVESAIVDYPAVAEAAVIGKPHEVKGESIKAFVILKKGYEPSEKLVE
FT                   EIKYHVKQVLGPIAVPDEIEFVEKLPKTRSGKIMRRVLKAQELGLPVGDISTLED"
FT   gene            complement(81473..81955)
FT                   /locus_tag="Hydth_0079"
FT   CDS_pept        complement(81473..81955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0079"
FT                   /product="protein of unknown function DUF583"
FT                   /note="COGs: COG1664 Integral membrane protein CcmA
FT                   involved in cell shape determination; InterPro IPR007607;
FT                   KEGG: tte:TTE0840 hypothetical protein; PFAM: protein of
FT                   unknown function DUF583; SPTR: A8UT29 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function,
FT                   DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44489"
FT                   /protein_id="ADO44489.1"
FT                   /translation="MVSPFQTLQRRVSPFCYILLTMFGKKEEARVSNQEIRTLIGIGCL
FT                   FDGNLTIPEGLTRIDGEIRGNISGKGGLILGERGSVRGDIDLERVVVYGRVQGNIKAQS
FT                   LEIKAGGRVDGNVQVKELIIEKGAVYNGECKMEGGEAPTELQSSRVDMSPTGSPSS"
FT   gene            complement(81965..83992)
FT                   /locus_tag="Hydth_0080"
FT   CDS_pept        complement(81965..83992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0080"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR012910:IPR000531; KEGG:
FT                   aae:aq_529 outer membrane protein C; PFAM: TonB-dependent
FT                   receptor; TonB-dependent receptor plug; SPTR: A8URJ6 Outer
FT                   membrane protein c; PFAM: TonB-dependent Receptor Plug
FT                   Domain; TonB dependent receptor; TIGRFAM: TonB-dependent
FT                   copper receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44490"
FT                   /protein_id="ADO44490.1"
FT                   /translation="MRGILLITATLSVGYAQELLLKEIEVKAKREPFEESLEIREVRES
FT                   SAKDVGEALTKLGGIWKIRKGGIANDIVLRGFYRDNINVLIDGERVYGACPNRMDPPAF
FT                   HVDFSEVEKIEVIKGPFDVKHQGSMAGLVNIITRKPEKGFHLKLNAGVGSFSFINLSPT
FT                   VSYADERFYGLAGYSYKYSKPYKDGDGKKFTEVYPSDSPNRYKPQFINSKAFEINTYWA
FT                   KFGFKPLENHQLELSYTKQDARHVLYPYLLMDAIYDKTDRFNFTYGIDSISDTLKSLNF
FT                   QFYYTKVDHWMDDRYRVSSGMMPWSMATDAKTKTYGGRLEGKIRDFTVGFEAYKRNWDA
FT                   VNYMMSMAQFVIPDVDTKSFGAYGEYRKALFGKLRLVAGIRLDTTKTEADASKANTDLY
FT                   FAYKNTRSTSKTDTYPSGNLQLFYSLSKETELFVGLGHSVRVPDPQERYFALKRMTGSD
FT                   WVGNPNLKPSKNTELDLGVKYSTGKLLTKATIFYSYIKDYITVHDQNKVNMVMGVMNNS
FT                   ARSYENVNAQFFGGELDSRLALTDKVFLFGGLSYVQARKDTKPDKNIYSSKVAEVPPLK
FT                   ARLALRYDRGWYFGEIESILSATQYRVDTDLKEQRTSGYAILNLKVGGSYRGLSITAGV
FT                   DNLLDKKYYDYLSYQRDPFRSGVKVPEPGRTFYVNASYNF"
FT   gene            complement(84006..84437)
FT                   /locus_tag="Hydth_0081"
FT   CDS_pept        complement(84006..84437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dma:DMR_24090 hypothetical protein; SPTR:
FT                   C4XTA3 Putative uncharacterized protein; PFAM:
FT                   DsrE/DsrF-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44491"
FT                   /protein_id="ADO44491.1"
FT                   /translation="MRSIALILTNLLAVLVLTIYAQEAHDKTHQAQKEGAILVVNLTHD
FT                   RGISAEMALTFANISLGRGYETVVWLNSEGVRLADAKAKETQAIKLLREFLSKGGKVYV
FT                   CPVCAQKLKVEKIASGTQWANPDIIFPLITQEKTKIVSW"
FT   sig_peptide     complement(84375..84437)
FT                   /locus_tag="Hydth_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(84526..85773)
FT                   /locus_tag="Hydth_0082"
FT   CDS_pept        complement(84526..85773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0082"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="COGs: COG0019 Diaminopimelate decarboxylase;
FT                   InterPro IPR002986:IPR000183:IPR009006; KEGG: aae:aq_1208
FT                   diaminopimelate decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; SPTR: O67262 Diaminopimelate
FT                   decarboxylase; TIGRFAM: diaminopimelate decarboxylase;
FT                   PFAM: Pyridoxal-dependent decarboxylase, C-terminal sheet
FT                   domain; Pyridoxal-dependent decarboxylase, pyridoxal
FT                   binding domain; TIGRFAM: diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44492"
FT                   /protein_id="ADO44492.1"
FT                   /translation="MLKEYNRYLEYIDGELHLEGVSLKALAEEFGTPLYVYSASHIRDR
FT                   VRAYREAFPDALICYAVKANFNPSIIRVAREEGAGADIVSGGELYASLLAGVEPSRIVY
FT                   AGVGKTLKELEYAIKSDILMFNVESRMELDVLNHLAESLGKKIRIAIRVNPDVDPKTHP
FT                   YISTGMKKSKFGVDIKHAKQEYQYAGKLKNLEVVGIHCHIGSQILDVSPYIEAVEKVVD
FT                   LYHELVRSGFEIRYVDIGGGLGIKYKPDQSNPEPKDLAEAVMPALKGVDAKILLEPGRS
FT                   IVGNAGLLITRVEFLKDKGHKHFVIVDAGMNDLIRPAMYDAYHHIVPVVKRDTGYIKTD
FT                   IVGPICETGDFLALDREIQKVERGDYLAVLSAGAYGFAMSSHYNVRPRACEVLVEKQSY
FT                   KIIRERETYAYIFKGE"
FT   gene            complement(85787..86287)
FT                   /locus_tag="Hydth_0083"
FT   CDS_pept        complement(85787..86287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0083"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="COGs: COG0558 Phosphatidylglycerophosphate synthase;
FT                   InterPro IPR004570:IPR000462; KEGG: aae:aq_958
FT                   phosphotidylglycerophosphate synthase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; SPTR: A8URZ7
FT                   Phosphotidylglycerophosphate synthase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; TIGRFAM:
FT                   CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44493"
FT                   /protein_id="ADO44493.1"
FT                   /translation="MATLITLLRFLITFPAFYAVILGQLRWALVLILLGALSDLLDGSV
FT                   ARKNKEESKWGALLDPLVDKIFFLSILSAFLYMQQINPVAFLLLLIRELLVSFLRSMGA
FT                   EKGYTMQASYLGKTKTFFEFLSLILLSAGSPLGGWMLWIAVLFAYISMYDYLIKYTTFE
FT                   KSS"
FT   gene            complement(86275..87039)
FT                   /locus_tag="Hydth_0084"
FT   CDS_pept        complement(86275..87039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0084"
FT                   /product="protein of unknown function DUF815"
FT                   /note="COGs: COG2607 ATPase (AAA+ superfamily); InterPro
FT                   IPR008533; KEGG: hya:HY04AAS1_0357 protein of unknown
FT                   function DUF815; PFAM: protein of unknown function DUF815;
FT                   SPTR: A8UUC6 Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF815)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44494"
FT                   /protein_id="ADO44494.1"
FT                   /translation="MGINFEEFLAFRFKDGELQPIEHPHIPKFEDLLHIERQKEELRKN
FT                   TLKLVMDLPAHDALLWGDRGTGKSSLVKSMLGLFASKGLRLVQVYQMDILHLSDLYGLL
FT                   RRTSQKFILFFDDLSFERHDQQVNVLKSLLDGDVEERPKNVVVYVTSNRRNLMPENLEE
FT                   EKFPEERRIQIASLVERFGIRLGFFSFSKDEYLDMVRHYAKVRGLKIDAEELEKRALDW
FT                   ARERYGFSGRSAYQLIKDLEGQLMLKSLGWLL"
FT   gene            complement(87030..87851)
FT                   /locus_tag="Hydth_0085"
FT   CDS_pept        complement(87030..87851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0085"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="COGs: COG0061 sugar kinase; InterPro
FT                   IPR002504:IPR016064:IPR017437; KEGG: aae:aq_909
FT                   hypothetical protein; PFAM: ATP-NAD/AcoX kinase; PRIAM:
FT                   NAD(+) kinase; SPTR: A8UR52 Putative uncharacterized
FT                   protein; PFAM: ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44495"
FT                   /protein_id="ADO44495.1"
FT                   /translation="MKVLIFVKDSQTAIETSRKIEEFLKGKGISTEVFVNLRGNRCRLN
FT                   LKDKDLLLVIGGDGTFLAGARLVAKHRIPILGINEGRFGFLTEVEKENAFEVLELLLED
FT                   KLSIQKRMMVCAYIKRGGKQHFLGDYLNDVVVSKSTIARMLELDAYAGKDFMMRVYGDG
FT                   IIISTPTGSTAYALSAGGPIVYPLSENLLFVPICPHTLSNRPLVLPSGFEIRIVNLSPD
FT                   NMAFLTLDGQKGMALKKGEEIIIKKSKHYCLMYPNPKRGFFEILKEKLRWG"
FT   gene            complement(87848..88429)
FT                   /locus_tag="Hydth_0086"
FT   CDS_pept        complement(87848..88429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0086"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="COGs: COG0279 Phosphoheptose isomerase; InterPro
FT                   IPR001347; KEGG: aae:aq_908 phosphoheptose isomerase; PFAM:
FT                   sugar isomerase (SIS); SPTR: O67054 Phosphoheptose
FT                   isomerase; PFAM: SIS domain; TIGRFAM: phosphoheptose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44496"
FT                   /protein_id="ADO44496.1"
FT                   /translation="MEASRRMMELIINSFKESADVKLAFVELYAQQILDVGKIIAQALK
FT                   DGNKLLLFGNGGSAADAQHIAAEIVGRFKKERKALPAIALTTDTSVLTAVGNDYGFETI
FT                   FERQIEALCMPGDVVIGITTSGNSENVIRGLSKAHALGATTVAFTGRKGGKVVDVAHYS
FT                   FIVPSYDTARIQECHITLGHVLCELIDNLL"
FT   gene            complement(88383..89285)
FT                   /locus_tag="Hydth_0087"
FT   CDS_pept        complement(88383..89285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0087"
FT                   /product="Ferritin Dps family protein"
FT                   /note="InterPro IPR008331:IPR009078:IPR012347; KEGG:
FT                   aae:aq_331 hypothetical protein; PFAM: Ferritin Dps family
FT                   protein; SPTR: A8UUC7 Putative uncharacterized protein;
FT                   PFAM: Ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44497"
FT                   /protein_id="ADO44497.1"
FT                   /translation="MNKRELINLLLYDVALEHSAIVQYLYHIFLITDKNITEEIEVIAR
FT                   QEMRHLKWFAQKVVSLGGQVVLDRLEDMIVVGGPDWEDMLSKDVDAEQMAIETYTKQLE
FT                   VVKDESVKRLLERVIKDEEDHRIEFTELKELAKESLLIEGQAQKADPKTLEVLNRFLKE
FT                   EYQTIINYLYQFFHTKDCTYRDIMLDLAIESMTHMGKIGEKIGELGGMPSIEADLSPKP
FT                   LRKLEEQVKQEMSYEQSTGEDYKKVVESLKDPDLQRLFRFIENQEEYHKHMLSEFFKTM
FT                   RRLTVGSLKKDDGADNKLL"
FT   gene            complement(89291..90967)
FT                   /locus_tag="Hydth_0088"
FT   CDS_pept        complement(89291..90967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0088"
FT                   /product="alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="COGs: COG0058 Glucan phosphorylase; InterPro
FT                   IPR011834:IPR000811; KEGG: hya:HY04AAS1_1065 alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35; PRIAM:
FT                   Phosphorylase; SPTR: B4U9E0 Phosphorylase; TIGRFAM:
FT                   alpha-glucan phosphorylase; PFAM: Carbohydrate
FT                   phosphorylase; TIGRFAM: alpha-glucan phosphorylases"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44498"
FT                   /protein_id="ADO44498.1"
FT                   /translation="MIAYFVMELGLEDRIPTYSGGLGTLAGDTLYSFADLSIPAVCITL
FT                   LYKKGYTLQKITHHGMQLDFDTLWDYKKVLTPLDVEVRMHFGDKEQKVRAWEYTLRGHG
FT                   DIKVIFLDTDIPGNEPDIRRLNERLYLDEGLYRLRQEMLLGIGGYRVLKALGYNISVYH
FT                   KNESHSALLVVELLRELGDFQKVRSRCVFTTHTPVPAGHDKFPIDMVKQELKLYDHIDW
FT                   NKEAIDGFLNLSAFALRYSCKVNAVSYKHMFVTKNILIDQVPTEGPCELEYVTNGVYHR
FT                   RWIHPELQELFNEYMPAWDENPVLLNQVYRVPSELLLKKHNKVKNELVNYINKTTGAGF
FT                   SDDVLTIGVARRVTAYKRNNLILRDIDRLIYVAEHFGELQIVFAGKAHPKDSMGKEMIA
FT                   DIFSKIQALKQRTSKVKVAFLENYSIDMAKLLVAGCDVWLNNPKRPYEACGTSGMKAAM
FT                   NGVLNFSTWDGWWLEGGIEGINGWGIGPRPSWSDMSESNDEEDLEDIYGKLAYVILPMY
FT                   YTSKDQWVFMMKNSIATVGPFFNTHRMVSEYISKVYQIGLR"
FT   gene            complement(90964..92625)
FT                   /locus_tag="Hydth_0089"
FT   CDS_pept        complement(90964..92625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0089"
FT                   /product="alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="COGs: COG0058 Glucan phosphorylase; InterPro
FT                   IPR011834:IPR000811; KEGG: hya:HY04AAS1_1065 alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35; PRIAM:
FT                   Phosphorylase; SPTR: B4U9E0 Phosphorylase; TIGRFAM:
FT                   alpha-glucan phosphorylase; PFAM: Starch synthase catalytic
FT                   domain; Carbohydrate phosphorylase; TIGRFAM: alpha-glucan
FT                   phosphorylases"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44499"
FT                   /protein_id="ADO44499.1"
FT                   /translation="MIAYFVMEVGLEESIPTYSGGLGTLIGDTILTFADLGIPAVCVTL
FT                   LYKKGYVYQKIAKDGRQADLEDIWDYQEVLRPLSVEVEVPIGERKQKLRVWEYTVKGKR
FT                   DIKVLFLDGDLDGNDEKVREAFQRLYYSDKERRLIQEVVLGIGGYRALKALGYDIALYH
FT                   INESHSAFLLFELLKESKDVEDVKKKVVFTTHTSLPVGHDTFPLSMVKEYLKMYDGIDW
FT                   EKEATDDGQLDLSLLSARYSSIVNAVSLRHRFITRRSYAFRDVDYITNGVYHRRWVCEE
FT                   MKDLFDRYILGWDDNPALLKQAHDIPSIELLKAHSEAKERLITFINKNYDVSFVPECPI
FT                   LCIARRITAYKRNNLILKDIDRLIRISERFGCLQVVFAGRAHPADSDGKAIIKDINDKI
FT                   SYAKSKTKSLRMVFLENYGIGLAKLLVAGCDVWLNNPKRPYEACGTSGMKAAMNGVLNL
FT                   STWDGWWLEGGIEGINGWGIGPRPSWSDMSESNDEEDLEDIYGKLQHIILPMYYNYQDE
FT                   WVKLMKNSIATVGPCFNTYRMVSEYFVKIYSAGLKL"
FT   gene            92646..93986
FT                   /locus_tag="Hydth_0090"
FT   CDS_pept        92646..93986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0090"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR011701:IPR016196; KEGG: sul:SYO3AOP1_0434 major
FT                   facilitator superfamily MFS_1; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: B2V804 Major facilitator
FT                   superfamily MFS_1; PFAM: Sugar (and other) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44500"
FT                   /protein_id="ADO44500.1"
FT                   /translation="MRFISTDITCRLDSLPWCRFHTMFVLALGITWVLDAFEVVIVSAV
FT                   LKPMSKALNFTPTQSSLMVSGFLLGAIIGSFLFGYLADKYGRKKLFLLTLLLYAGGTFL
FT                   TGFANSFESALFFRIIAGAGIGGEFAAIHSAIDEFVPSRHRGKVDGTISALWNLGSVLA
FT                   SLSASLILSYFHEEFAWRFAFLLGGVLALAVLFVRLYVPESPRWLLSKGRVQEAESIVQ
FT                   RLEKMAGGRYSIQKCDIPVFEGSIWNATKLILSSYRWRFVFSSLMSITILSAYYGLITL
FT                   IPTSFSSAFGFSSQEIPGILLVGSLGGLVGGLAVAFMNDALGRKITGSLVSFLAFLLSL
FT                   LFLSPLDFNNVYFAYSLIAFSFASVAYVSSTEIYPSYLRAYAIGLFSVIGRVSGALSPV
FT                   LLVKLSSLDYAYGVLGLSLFWLLGFLAFLVWAIKGKEAKGKSIEEIT"
FT   gene            complement(94020..95165)
FT                   /locus_tag="Hydth_0091"
FT   CDS_pept        complement(94020..95165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0091"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein; SPTR: C7LLH6
FT                   SIS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44501"
FT                   /protein_id="ADO44501.1"
FT                   /translation="MVHSMAFYVQSNCFRKVCYKISSAVQCKAGHAKGYWVRQAAVFAI
FT                   SLGLLTGGCSQQDQGNKAQESQASKNSVQYSAVELQMDVLEIGKDEKVYNIKQDGNTVD
FT                   SFSVSVKNIEDKQGLRVECILKHRDKSIHKEEECFGLSIKKAFKVGENLLLLLTFATGG
FT                   NTCIVEYAFLTLKPNKEVGLSQRFDNCFPATEVRTEDGSILVKIPSYDEPKLFVYKDGL
FT                   LEEKPDPEFAEPDAKTIKPKDNEKLTLELLKAACLNKVGRSKDGRLECKPCPSFTSFGK
FT                   DSMIEDSLVVEEIYGGDFYPGKKYYIVRYSGCEPNSKGGGGYYMVEETKRGLRFVSVYN
FT                   ESAGKCRVRTKQGRDYLYCTLGECYVKSAGRLGCRFINLDF"
FT   gene            95199..96398
FT                   /locus_tag="Hydth_0092"
FT   CDS_pept        95199..96398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0092"
FT                   /product="arsenite-activated ATPase ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="COGs: COG0003 ATPase involved in chromosome
FT                   partitioning; InterPro IPR003348:IPR008978; KEGG:
FT                   hya:HY04AAS1_1511 arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase; PRIAM: Arsenite-transporting
FT                   ATPase; SPTR: A8UVV6 Anion transporting ATPase; TIGRFAM:
FT                   arsenite-activated ATPase ArsA; PFAM: Anion-transporting
FT                   ATPase; TIGRFAM: arsenite-activated ATPase (arsA)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44502"
FT                   /protein_id="ADO44502.1"
FT                   /translation="MRIILFSGKGGVGKTTISAATAYRLSQLGYKTIVVSLDPAHSLGD
FT                   AFDIPESEKVKAKGLPIKINEKLYIQEIDIQEELDRYWGDVYRFLELLFNTTGLDQVVS
FT                   EELAVLPGMEEVTSLLYVNKYYREKEFDVLVLDLPPTGESLRFVSMPTVLKWYMKKVFN
FT                   VERTILKVARPVARRLTDVPLPDDSYFQALENFYEKLKGVDEILIDPETTSVRIVANPE
FT                   KMVLKESQRAFMYFNLFGVNVDAVIINKVLSPELEGCEHLSRWVLTQKKYLNEMSALFA
FT                   PVPIFRVPLLEDEVVGPERLSILASMIYGDTDPSRVLFKEKPYEFVQEGNRYLVKLRAP
FT                   FLTKEGLTVLKSDGEITIRWRNFKSHIMLPRKLRNYDPVGAKIDKGYLIIELVSEKISS
FT                   "
FT   gene            96454..97491
FT                   /locus_tag="Hydth_0093"
FT   CDS_pept        96454..97491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0093"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="COGs: COG1740 Ni Fe-hydrogenase I small subunit;
FT                   InterPro IPR001821:IPR006311:IPR006137:IPR017909; KEGG:
FT                   aae:aq_965 hydrogenase small subunit; PFAM: NADH ubiquinone
FT                   oxidoreductase 20 kDa subunit; PRIAM: Hydrogenase
FT                   (acceptor); SPTR: A7BI79 Ni,Fe-hydrogenase small subunit;
FT                   TIGRFAM: hydrogenase (NiFe) small subunit HydA; PFAM: NADH
FT                   ubiquinone oxidoreductase, 20 Kd subunit; TIGRFAM: Tat
FT                   (twin-arginine translocation) pathway signal sequence;
FT                   hydrogenase (NiFe) small subunit (hydA)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44503"
FT                   /protein_id="ADO44503.1"
FT                   /translation="MESLYHIYRRRGYTRRDFLKSVLLLSAVLGFPPTSFGQAVKALEL
FT                   KPKPVVIWLEFQDCAGCTESFIRSTSILPSDVLLDYISLEYHETLMSPSGFYAEEAKRE
FT                   AIEKYKGKYILIVEGSVSPRNKGVYCTVSGKSNVELLKEAAQNAGLVIAVGSCASWGGI
FT                   PHAEPNPTGAVPVSQILGDRQVVNIPGCPPISDVMVAVIAGFVITGKPPELDSMGRPKT
FT                   FYGQTIHDRCYRRPFYNAGKLAGSFDDESARKGYCLYKLGCKGPITRNACATIRWNGGL
FT                   SFPIQSGHPCFGCSEPNFWDRGFIYSPLSVVEGGFGWKGILAGVATGVALGAASAAINK
FT                   KFREK"
FT   sig_peptide     96454..96564
FT                   /locus_tag="Hydth_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            97493..98164
FT                   /locus_tag="Hydth_0094"
FT   CDS_pept        97493..98164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_963 hypothetical protein; SPTR: A7BI80
FT                   Putative uncharacterized protein orf22"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44504"
FT                   /protein_id="ADO44504.1"
FT                   /translation="MGDTTFYDLVRGPLLRFALFIFFAGISYRFFRVVFLGLPPDYAKP
FT                   KGNPYYMAVKKIVIKPTMGWTFNEIFSRRAVNFIGGFLFHLGFLGLTFFVPAHALLWRE
FT                   ITGLPIPTIPNLLGDILAYAALGSLLALTIHRMLNPVLKLLTGKDEYFANFLIGAILFT
FT                   GLLATKWAGGGFYVWILSTHMLLADLLIIYIPFSRLSHFVYYFLSVGFMGWNAGKRGVS
FT                   F"
FT   gene            98177..99487
FT                   /locus_tag="Hydth_0095"
FT   CDS_pept        98177..99487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0095"
FT                   /product="heterodisulfide reductase"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR017896:IPR012285:IPR017900:IPR004017:IPR 009051; KEGG:
FT                   aae:aq_961 heterodisulfide reductase; SPTR: A7BI81 Fe-S
FT                   oxidoreductase; PFAM: Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44505"
FT                   /protein_id="ADO44505.1"
FT                   /translation="MLVESKEEIGQEEIEKFYEFCKKSINTEVASYLEACVRCGICAEA
FT                   CLFYMGENVSGRIDPTLTPAYKADLLRDIYKENYTFVGRIKRLLGFGVKITPEDLREQI
FT                   KLAFYTCTNCDRCTKACPMGIDTPKLVSIVRGALTYAGLTPKDLADATNLSVEKGSPLG
FT                   VDIPTFLKRIEFISEEYEVEMPVDKRPSEYLYIPSSIELMKFPSSVASAAKVLNSSGVS
FT                   WTLSTVAHEATNFGLFAQSKEVTKEMIRRVLEGAKELEVKYIIAPECGHAYQSMRFIAP
FT                   NVFPKEWKFEVLNIVEFIDRMIKEGKLTIKRKVLKERATLHDSCQIGRRGGVLREPRKI
FT                   LSIIAENFKDSVVIPEHNICCGGGGGVLVIKDADYYRQKGFISKMTLFDKAGAKTIVCY
FT                   CANCMLALNMGTQELKRDYKFVSIVDLVAEAIKEEEG"
FT   gene            99484..101181
FT                   /locus_tag="Hydth_0096"
FT   CDS_pept        99484..101181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0096"
FT                   /product="Cytochrome-c3 hydrogenase"
FT                   /EC_number="1.12.2.1"
FT                   /note="COGs: COG0374 Ni Fe-hydrogenase I large subunit;
FT                   InterPro IPR018194:IPR001501; KEGG: aae:aq_960 hydrogenase
FT                   large subunit; PFAM: nickel-dependent hydrogenase large
FT                   subunit; PRIAM: Cytochrome-c3 hydrogenase; SPTR: A7BI82
FT                   Ni,Fe-hydrogenase large subunit; PFAM: Nickel-dependent
FT                   hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44506"
FT                   /protein_id="ADO44506.1"
FT                   /translation="MSRLVIDPVTRIEGHLRIEAELEGNRVKSAYSSGTMVRGIEIILK
FT                   GRDPREAWAFAQRICGVCTTVHAFASIRAVEDALKIKVPRNASLIRKLMIGTLFVHDHV
FT                   VHFYHLHALDWVNPIQALKADPVKTSELAQKLSDYEKSSPSYFKEVQDKIRQQVERKQL
FT                   GIFSRGYWDHPDYRLPPEANLMAVAHYLDALNWQTKIVQVHTIFGGKNPHPNFVVGGMA
FT                   CPIDLQSDTAINMDKLGRIKSLIDSMIEFVEKVYLPDLIAIASFYKDWFEKGEGVKNFL
FT                   VLGEPEGDSHREGKFFIPPTFIRDRNLENYEDVDYSKIEEYVTHSYYKYSVGDERGLHP
FT                   FEGETVLHYTGPEPPYQQLNVEGKYSWLKAPRYRGLPAEVGPLARILALYARDEHGARE
FT                   LVNSYLSKLGLPVNALYSTMGRTLARGIETYIYAHAIRSYYDQLVQNVKSGDSTTFNGE
FT                   KWEPSTWEKDAKGLGLMEAPRGSLSHWVHIKDGKIANYQAVVPTTWNGSPRDAKGQPSP
FT                   YEASLVGHELVNPKEPLEIIRTIHSFDPCLACAVHLYSDTEDTIIKIT"
FT   gene            complement(101168..101866)
FT                   /locus_tag="Hydth_0097"
FT   CDS_pept        complement(101168..101866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0097"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="COGs: COG0340 Biotin-(acetyl-CoA carboxylase)
FT                   ligase; InterPro IPR004408:IPR004143:IPR003142; KEGG:
FT                   aae:aq_566 biotin [acetyl-CoA-carboxylase] ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; biotin protein ligase
FT                   domain protein; SPTR: A8UVI3 Biotin
FT                   [acetyl-CoA-carboxylase] ligase; TIGRFAM:
FT                   biotin/acetyl-CoA-carboxylase ligase; PFAM: Biotin protein
FT                   ligase C terminal domain; Biotin/lipoate A/B protein ligase
FT                   family; TIGRFAM: birA, biotin-[acetyl-CoA-carboxylase]
FT                   ligase region"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44507"
FT                   /protein_id="ADO44507.1"
FT                   /translation="MSRFYSLVWLEEVSSTQDWLKEKSINCVVVARRQTKGRGRYGRSW
FT                   QSDEGGLYFSFPLTETFKDEQTLPLAIALSVCQMLEDYGFLASIKWVNDVYIGGKKICG
FT                   ILVEKTKDRTLIGIGLNVNQKRFTESLQATSLLLVSGREYHLADVLLKLLDRIDKNLDL
FT                   LKERGFQVLREEVKKRLLFLGEEVVLYTDPPTVGILADLSPEGYLVLMTAQGEKKVVSG
FT                   DITLRGTMLS"
FT   gene            complement(101863..103209)
FT                   /locus_tag="Hydth_0098"
FT   CDS_pept        complement(101863..103209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0098"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoateaminotr
FT                   ansferase"
FT                   /EC_number="2.6.1.62"
FT                   /note="COGs: COG0161
FT                   Adenosylmethionine-8-amino-7-oxononanoate aminotransferase;
FT                   InterPro IPR005815:IPR005814:IPR015424:IPR015421; KEGG:
FT                   aae:aq_170 DapA aminotransferase; PFAM: aminotransferase
FT                   class-III; SPTR: O66557
FT                   Adenosylmethionine-8-amino-7-oxononanoate aminotransferase;
FT                   TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: Aminotransferase class-III;
FT                   TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44508"
FT                   /protein_id="ADO44508.1"
FT                   /translation="MLDFETLDRWDKEYFWHPFTQMKVYREEENLIFEKGEGVYLYDIK
FT                   GRKFIDAISSLWCNVHGHNHPKLNKAIIDQLQKVAHTTTLGSSNVPAILLAKKLIEIAP
FT                   EGLTKVFYSEDGAEAVEIAIKLAYQYWRNKGERRKTFITLSEAYHGDTIGAVSIGGIDL
FT                   FHGTYKDLLFETLKLPSPYLYCKERYGKLCDECRDELLSMVEEILKERGEDVVAVSLEA
FT                   GIQAAAGMLPFPKGFLKGVRELARKYNTLLIVDEVATGFGRTGSMFYCQQEGVSPDFMC
FT                   LGKGLTGGYLPLAATLTTQEVFEAFLGEFGEKKHFYHGHTYTGNNLACAVALANLEVFE
FT                   EEKTLEKLQPKIEYLTRRLKEFWELKHVGDVRQLGFMAGIELVKDKEKGEPFPYGERTG
FT                   FKVAYRCREMGVFLRPLGDVMVLMMPLVISYEEIDRVINALKQAISFLS"
FT   gene            103388..105055
FT                   /locus_tag="Hydth_0099"
FT   CDS_pept        103388..105055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0099"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="COGs: COG0129 Dihydroxyacid
FT                   dehydratase/phosphogluconate dehydratase; InterPro
FT                   IPR004404:IPR000581:IPR020558; KEGG: aae:aq_837
FT                   dihydroxy-acid dehydratase; PFAM: dihydroxy-acid and
FT                   6-phosphogluconate dehydratase; PRIAM: Dihydroxy-acid
FT                   dehydratase; SPTR: O67009 Dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: Dehydratase
FT                   family; TIGRFAM: dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44509"
FT                   /protein_id="ADO44509.1"
FT                   /translation="MWRSDKVKKGIERSPHRALLRACGLSDEDFDKPLIGIANSYIDII
FT                   PGHVHLREFVKPIKDEVRKAGGVPIEFNVIGVDDGIAMGHYGMHYSLPSRELIADSIET
FT                   VVEAHQLDALICIPNCDKIVPGMLMATARLNIPTIFISGGPMLAGEVNGKKVDLISVFE
FT                   GIGQLKAGKIDEGQLKVIEEHACPTCGSCSGMFTANSMNCITEVLGLGLPGNGTIPAVD
FT                   PRRELLARAAARQIMELLKRDIKPRDILTIEAFDNAFAVDIAMGGSSNTILHLLAIANE
FT                   AGISYPLSRINEISRRTPNICKISPSSEYHIQDLDAVGGIPSLLKELIRGGYLPHPDAM
FT                   TVSLKTHKEIAEEAPDADGSVIRRVEDPYSKEGGIAILFGNLAPEGSVVKTAGVDPNML
FT                   TFRGRAICFDSEEEAIEGILGGKVKPGHVVVIRYEGPKGGPGMREMLSPTSAIMGMGLG
FT                   DKVALITDGRFSGGTRGACVGHISPEAAAGGPIGVVKDGDEILIDIPNRKIELLISQEE
FT                   LKRRLENFVPKTKEVKSSWLRRYIRFVTSASKGAILEA"
FT   gene            complement(105030..105752)
FT                   /locus_tag="Hydth_0100"
FT   CDS_pept        complement(105030..105752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0100"
FT                   /product="protein of unknown function DUF218"
FT                   /note="COGs: COG1434 conserved hypothetical protein;
FT                   InterPro IPR003848; KEGG: saf:SULAZ_1499 hypothetical
FT                   protein; PFAM: protein of unknown function DUF218; SPTR:
FT                   C1DWH8 Putative uncharacterized protein; PFAM: DUF218
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44510"
FT                   /protein_id="ADO44510.1"
FT                   /translation="MFFLKKFLSALLLPPGLFVLALLLISFFERKKRLTYYTSVSLALL
FT                   IYMLSIEPVKDTLLTPLESKYSVPEKFQADAIVVLGGGSYSTGILKEDSMKRLLTALIL
FT                   HKRTGLPIVLSGGAENLPDAEIMKSLLVELGVDKRDIITEVRSRDTEENASYVREICQQ
FT                   RNYKSVVLVTSAYHLPRAVFLFKKEGLSVIPYPTDFKRDLRYNLYSLLPKMSVLNDSVK
FT                   ALREYVALLSLRLPEWLP"
FT   sig_peptide     complement(105690..105752)
FT                   /locus_tag="Hydth_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(105752..106144)
FT                   /locus_tag="Hydth_0101"
FT   CDS_pept        complement(105752..106144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0101"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="COGs: COG0848 Biopolymer transport protein; InterPro
FT                   IPR003400; KEGG: hya:HY04AAS1_0965 biopolymer transport
FT                   protein ExbD/TolR; PFAM: Biopolymer transport protein
FT                   ExbD/TolR; SPTR: A8UXF2 Putative uncharacterized protein;
FT                   PFAM: Biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44511"
FT                   /protein_id="ADO44511.1"
FT                   /translation="MRRRRLSYDERAYIDVVPLVDTLLAVFLFLAILAFQSPMTFLAVK
FT                   LPFAQEGEKKVLSTMRVQVLKDGSYMYEGKKVSLEELDKQMQTKQPGSLVIEADEDTLH
FT                   KFVVALMDIAKKEKVQDVIIATRTRR"
FT   gene            complement(106141..106755)
FT                   /locus_tag="Hydth_0102"
FT   CDS_pept        complement(106141..106755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0102"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="COGs: COG0811 Biopolymer transport protein; InterPro
FT                   IPR002898; KEGG: aae:aq_1988 TolQ-like protein; PFAM:
FT                   MotA/TolQ/ExbB proton channel; SPTR: A8UXF4 Putative
FT                   uncharacterized protein; PFAM: MotA/TolQ/ExbB proton
FT                   channel family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44512"
FT                   /protein_id="ADO44512.1"
FT                   /translation="MDMIFDLLQKGGFAVYVLLFLSLVSWALIIERLINLRAGSILSKS
FT                   VKDVKSLLAGGDIEGALKLLSLDNSPAGGILYRMLEEYKGGKVDKRTLLNDLSFEVSLL
FT                   VPKVEKNLALLSTIASVSPLIGLFGTITGLIKVFSAFAVAQTEQGIALLAAGISEALVS
FT                   AATGLAVAIPALLAYWVFRIIGNSVLDRVEAELSEALRVLK"
FT   sig_peptide     complement(106675..106755)
FT                   /locus_tag="Hydth_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(106757..109297)
FT                   /locus_tag="Hydth_0103"
FT   CDS_pept        complement(106757..109297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0103"
FT                   /product="TPR repeat-containing protein"
FT                   /note="COGs: COG1729 conserved hypothetical protein;
FT                   InterPro IPR019734:IPR013026:IPR001440:IPR011990; KEGG:
FT                   aae:aq_1989 hypothetical protein; PFAM: TPR
FT                   repeat-containing protein; SPTR: A8UXF5 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44513"
FT                   /protein_id="ADO44513.1"
FT                   /translation="MWKLTRLFSLLACTLFLISADIKKEFDVSVELIGRSAEEKPKRLP
FT                   PETLQIPEEEPLDLSSRLLEPPSKFEQAQIKPFKEEGGISCGEPKDLVSYRLGIDYYLQ
FT                   GKYGPAKEELFKVVAMPSPFKPMAEYVLGVIYVREGKEDKATELFKHSCSFSHMYQKAS
FT                   CESYYALSFLLNGKVPQNQDPMWKAVADIKSGRITKPVCDGAIFKEYCQYVHEFYEGKE
FT                   GKNYKDSLRLRKAIVLYQRGSLLQAEETFKEYSKPSKPYRDVALYYLGLIEAKRGNERK
FT                   ALDYASILETINPKLSENLYAIISAKDILLSRLTYSITGDKRFLDRAGIIAYNSGDYRL
FT                   AVYNFLESGNVLYAVYSYVKLGEYSKAYDLLKNLSRKNREEYEWELETAYWADRSLEPI
FT                   LEEIRNRYPALYREYTGWFYFKKGDWENAVRYLEDPYYKALAYFNMKDYKGVLNILESR
FT                   NSERDRVLKAKSALFLGDPKLARSFLTDKTDEELYLLGLSYFLEGDYESSAKYFKSISS
FT                   NSPLKPKALLKLGDALYNEGKVESAKAYYYEIISKYPNSEQAKYATLSLIGMGGKNIGD
FT                   VQMQQLLEDYLRKYPNSAVSEDLKYQLAQIYIKNAQEDKAKNILLELMDSPLKYKAILK
FT                   LAQLEKDPSKKAVLLYKVYKEGSSEERREARDELIEFYTQLGDRKSLADLLAEGQDSDK
FT                   VKAVGIYISMGDDADAQKVAKQLMAEGYRDQELESYLLDLYKTSKDRGYLDYLKQSKDR
FT                   NIRSQAVYLSALDYLKSGEKKKALEDFVDITVNYKDSPFYNQAVIEGAKVLIDLNARHD
FT                   ASCLLDKANLDMASKEEVAVINSLKSRLPKCEVR"
FT   sig_peptide     complement(109238..109297)
FT                   /locus_tag="Hydth_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(109272..109907)
FT                   /locus_tag="Hydth_0104"
FT   CDS_pept        complement(109272..109907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0104"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="COGs: COG0406 Fructose-2 6-bisphosphatase; InterPro
FT                   IPR013078; KEGG: aae:aq_1990 phosphoglycerate mutase; PFAM:
FT                   Phosphoglycerate mutase; SPTR: A8UXF6 Phosphoglycerate
FT                   mutase; PFAM: Phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44514"
FT                   /db_xref="GOA:D3DFG8"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="PDB:4IJ5"
FT                   /db_xref="PDB:4IJ6"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3DFG8"
FT                   /protein_id="ADO44514.1"
FT                   /translation="MVKLILVRHAESEWNPVGRYQGLLDPDLSERGKKQAKLLAQELSR
FT                   EHLDVIYSSPLKRTYLTALEIAEAKNLEVIKEDRIIEIDHGMWSGMLVEEVMEKYPEDF
FT                   RRWVEEPHKVEFQGGESLASVYNRVKGFLEEVRKRHWNQTVVVVSHTVPMRAMYCALLG
FT                   VDLSKFWSFGCDNASYSVIHMEERRNVILKLNITCHLGEFYVEAHKAI"
FT   gene            complement(109901..111022)
FT                   /locus_tag="Hydth_0105"
FT   CDS_pept        complement(109901..111022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0105"
FT                   /product="aminotransferase class V"
FT                   /note="COGs: COG0075 Serine-pyruvate aminotransferase/
FT                   aspartate aminotransferase; InterPro
FT                   IPR000192:IPR015424:IPR020578:IPR015421; KEGG:
FT                   hya:HY04AAS1_0969 aminotransferase class V; PFAM:
FT                   aminotransferase class V; SPTR: A8UR38 Soluble hydrogenase
FT                   small subunit; PFAM: Aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44515"
FT                   /protein_id="ADO44515.1"
FT                   /translation="MYQERLFTPGPVEIPDRVREALGRQIIHHRTEEFRRAFLEVRELL
FT                   KRLLDDPSENFVFFSSSGTGAMEAAILNFFEEGQKVLVVNGGKFGERWFLLAKHWGLEV
FT                   VEYRLDWGKSADPEKVKDLLKKHPDCKGVLLQISETSTGAYHPVEDIAEVCKSADALLV
FT                   ADAITALGVYNLKPSVGIDVMVGGSQKALMLPPGLSLLWFSQKAKERLKDRAFYFSVKK
FT                   ELGKQQEGQTAWTPAISLLLALKESLSLLLQEGMERVEKRYRAMSEGTKRAISAFGLEV
FT                   FPERPAISITAVKSDDAERIRKELLRHGIRIAGGQDHLKGKIFRVSHMGVSEKDMLMLI
FT                   GVLEVVLKRLGYPVELGSGVCRYSQTLVEFGLW"
FT   gene            111042..111872
FT                   /locus_tag="Hydth_0106"
FT   CDS_pept        111042..111872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0106"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: aae:aq_246 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: A8UT53 Putative uncharacterized
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44516"
FT                   /protein_id="ADO44516.1"
FT                   /translation="MFGLVLAFLSSFFWATNDLITKKLIHKGLDEYFVLWIRFPVSSLI
FT                   LLPIGIYFWDLSSFVLFSTFLWLPVEVLGGVFFVKALKYTPLSVAMSFYSFMPFFSAVF
FT                   GFLLLGEALSLQGFLGICLMVVGTLFLTGFSPGEFFRKHIGTVYMLISTLLFGLNVVIG
FT                   KMVIISSNPFFFSWYYTFCMSFATLIFVSPKHIIERGNYTDKKLLILGILFALGGVFYN
FT                   TALVYAPASYVAAVERASLLLSMVYGRIFFGEPVKHLLPGVLLMLLGSALLSVG"
FT   sig_peptide     111042..111086
FT                   /locus_tag="Hydth_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(111849..112379)
FT                   /locus_tag="Hydth_0107"
FT   CDS_pept        complement(111849..112379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0107"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="COGs: COG0663 Carbonic anhydrase/acetyltransferase
FT                   isoleucine patch superfamily; InterPro IPR001451:IPR011004;
FT                   KEGG: aae:aq_1660 hypothetical protein; PFAM: transferase
FT                   hexapeptide repeat containing protein; SPTR: O67576
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44517"
FT                   /protein_id="ADO44517.1"
FT                   /translation="MALVKPYRGVYPQIHPSVYLSENVVIVGDVHIGEDSSIWFGTVIR
FT                   GDVNYIRIGKRTNIQDNCVVHVTHNTYPTIVGDGVTVGHRVVLHGCTLGNYVLVGMGAV
FT                   VMDGVEVEDYVLIGAGALLTPGKRIPSGVLVAGVPAKIIRDLKPEEVELIKRSAENYVA
FT                   YKNSYMSADAQKR"
FT   gene            complement(112381..113577)
FT                   /locus_tag="Hydth_0108"
FT   CDS_pept        complement(112381..113577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0108"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COGs: COG0126 3-phosphoglycerate kinase; InterPro
FT                   IPR001576:IPR015911:IPR015824:IPR015901; KEGG: aae:aq_118
FT                   phosphoglycerate kinase; PFAM: phosphoglycerate kinase;
FT                   PRIAM: Phosphoglycerate kinase; SPTR: A8UV21
FT                   Phosphoglycerate kinase; PFAM: Phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44518"
FT                   /protein_id="ADO44518.1"
FT                   /translation="MVLGKKRLKDVNITGKRVLVRVDFNVPIDEQGNIEDDTRIRASLP
FT                   TIEYLLDAKAKVILMSHLGRPKGRDSKYSLSPVAKRLSRYINKDVIMADDCIGPSVKAL
FT                   VEKMKEGDVLLLENLRFHKEEEENDEEFAKELASLGEIYVSDAFGTCHRKHASVYTVPK
FT                   ILKPAVMGFLLEKEISYFEKAMVNPQRPVVAILGGVKVSSKIGIIKNLLKRVDKIFVGG
FT                   AMAFTFIKAMGYSVGNSIVEDGYIETAKDIMEVARKLGVKFYLPVDFLLGRELSNNTPT
FT                   RLVPWQEIPQGWMGLDIGPVSIALLREIVSDAQTIIWNGPMGAFELDRFEDGTYETAKI
FT                   LANSSALTIAGGGDTDHAIHRAGVYNSIDFVSTGGGAFLELLEGNTLPCIEVLDNSEE"
FT   gene            complement(113591..113926)
FT                   /locus_tag="Hydth_0109"
FT   CDS_pept        complement(113591..113926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_1040 hypothetical protein; SPTR:
FT                   A8UR62 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44519"
FT                   /protein_id="ADO44519.1"
FT                   /translation="MKNTPLDVHLLEELSHLEYFIVKSPVNSPDFWKEWQEKFSRAYMS
FT                   RIAVKKILKTKKPPYEEHSKYKAQILLYEDVLYYLETLKNIALNLRGIFTSDQNVELDD
FT                   EDIDLDL"
FT   gene            complement(113938..114717)
FT                   /locus_tag="Hydth_0110"
FT   CDS_pept        complement(113938..114717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0110"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="COGs: COG0134 Indole-3-glycerol phosphate synthase;
FT                   InterPro IPR013798:IPR011060:IPR001468:IPR013785; KEGG:
FT                   aae:aq_1787 indole-3-glycerol-phosphate synthase; PFAM:
FT                   Indole-3-glycerol phosphate synthase; PRIAM:
FT                   Indole-3-glycerol-phosphate synthase; SPTR: A8UR63
FT                   Indole-3-glycerol phosphate synthase; PFAM:
FT                   Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44520"
FT                   /protein_id="ADO44520.1"
FT                   /translation="MGFLKEILERKRQEVKKTRELIKNLPLTPKRERSLAFEDALCGKG
FT                   TKIIAEVKKASPSEGKIREVSAWHQAKIYESAGAVAVSVLTDSTYFDGSLEDLYQVRRT
FT                   VNIPILRKDFIIDTVQIEEARAFGADAVLLIVRILEPSLLKDLIEYSYALSITPLVEVF
FT                   DLKEAEIALRAGAKVIGINNRDLDTLKVDTELSKRLTPLLKQMGAKYVIAESGISEREQ
FT                   ILELESLGADAFLVGTALMKSQDPAKKLRELLGYNDV"
FT   gene            complement(114717..115307)
FT                   /locus_tag="Hydth_0111"
FT   CDS_pept        complement(114717..115307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0111"
FT                   /product="SirA family protein"
FT                   /note="InterPro IPR001455; KEGG: aae:aq_1421 hypothetical
FT                   protein; PFAM: SirA family protein; SPTR: A8UW85 Putative
FT                   uncharacterized protein; PFAM: SirA-like protein; Protein
FT                   of unknown function (DUF3343)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44521"
FT                   /protein_id="ADO44521.1"
FT                   /translation="MNAVQEKQEFKVLDLSGLMCPLPVVMTSEQMKRLKDGEVLTVIST
FT                   DPGFELDIKNWCAQTGNELLSVKRNGNQVVVEIKKKPFSVEPSLWYWIKFHALGVKLHL
FT                   RHILMQLNPLIKKPDHFITFTAISEGTRAEKFLKGKAKLIPVPDEIDPRCGVVLAVAGY
FT                   QKAKGIYEELLKKGFGVEAIYKKEGKSYRRVYP"
FT   gene            complement(115317..116174)
FT                   /locus_tag="Hydth_0112"
FT   CDS_pept        complement(115317..116174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aae:aq_1842 hypothetical protein; SPTR: A8UW86
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44522"
FT                   /protein_id="ADO44522.1"
FT                   /translation="MLKDVNLILLTIRLLLAFLFFAIAFEKPIHQRALLVFLTTLYVSL
FT                   SLLSYLHPTKARFLKRFLDALVLPPICFIAGDEILTLSLFVPALFYANRDTAVSLTLFW
FT                   AGILLFLYTGGMSSLYYLPLLFALFLASLSPDLVESIRKERYYIRKLRASYRELSKDLS
FT                   KLEKESREKDYLSFIIDKAVEDRSPEDFLLHIKEKFSLKRIAIVPKGEITHKEAIIDKE
FT                   NTALYVPVFFEKGCAYVIFYFNTPFELYDREITTTLEKSAKLLNLYIVGFDDHVKKDSV
FT                   RLAV"
FT   sig_peptide     complement(116103..116174)
FT                   /locus_tag="Hydth_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(116184..118394)
FT                   /locus_tag="Hydth_0113"
FT   CDS_pept        complement(116184..118394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0113"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG5009 Membrane
FT                   carboxypeptidase/penicillin-binding protein; InterPro
FT                   IPR011816:IPR001264:IPR001460:IPR012338; KEGG: aae:aq_624
FT                   penicillin binding protein 1A; PFAM: glycosyl transferase
FT                   family 51; penicillin-binding protein transpeptidase;
FT                   PRIAM: Peptidoglycan glycosyltransferase; SPTR: A8UW76
FT                   Penicillin binding protein 1A; TIGRFAM: penicillin-binding
FT                   protein, 1A family; PFAM: Penicillin binding protein
FT                   transpeptidase domain; Transglycosylase; TIGRFAM:
FT                   penicillin-binding protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44523"
FT                   /protein_id="ADO44523.1"
FT                   /translation="MVRRVLVVFLGAVSLIFAFVLFALFILSTDLPSVEKLKDWRPPEA
FT                   TLIYDYKGRVFGDVAVQRRYYVPLKDIPLYVRQAFIAAEDRNFYSHFGIDPIAVLRALI
FT                   ANIREREITQGASTITQQLARNLFLTPERSFKRKVKEMLLAIKIERAFSKDKILEMYLN
FT                   YIYLGQGAYGVEAASRIYFGKHVKDLTLDEAALLAGLPKAPTKYNPFRNPEKVKERRNY
FT                   VLQRMYEDGYITQDELKRYSSVPIRVKLENRYYGMDYFLDYVKDYLVEKYGEAILAGGY
FT                   KVYTTIDRDLQMHAREAVKRGVMRVAKANGIPFLPDDPYEVQKKYEEQQVELKPWRIYI
FT                   GKVLDVGSQELKVAVKDYQFTVPRNQLPVEKGDYVLVRFVKRGKDISAEVLPDLEGALV
FT                   ALDAKTGAIRAMVGGYSYLRSPYNRAVYAKRQPGSAIKPIIYLAALMKGYTQASTIDAT
FT                   PKSFFDPSKGKEWTPKNYEGAEYGVVTLRTAIAKSINTATVNLLSEIGFDMPMQVGKSL
FT                   GIDLKPYYSMALGSIEVTPLELTSAYQAFADLGIRCEPYFIQRIVAPDGKVIEENNPKC
FT                   EQVLPPQEVRVLVDMLRAVVLEGTAASASSFGRIVAGKTGTTNDYMDAWFVGFSPYIVA
FT                   GVWVGYDIKKSMGKGMAGARVALPIWLDFMSVAAFMYPNEDFPVPDGVVVVNCPTPMYF
FT                   VDGTQGICSGEQKQDETNELKGIVDPNILKKLEEEPKVKEIP"
FT   sig_peptide     complement(118326..118394)
FT                   /locus_tag="Hydth_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            118427..119239
FT                   /locus_tag="Hydth_0114"
FT   CDS_pept        118427..119239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0114"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /note="COGs: COG1947
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate
FT                   synthase; InterPro IPR004424:IPR006204:IPR020568:IPR014721;
FT                   KEGG: aae:aq_915 hypothetical protein; PFAM: GHMP kinase;
FT                   SPTR: A8UWV3 Peptidyl-tRNA hydrolase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinases C terminal; GHMP kinases N terminal domain;
FT                   TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44524"
FT                   /protein_id="ADO44524.1"
FT                   /translation="MRVLSPAKVNLGLWLLGRRADGYHEIFTIYQAVSLFDEIFIKEGP
FT                   LKVETSSLIPQEKNLVYKALRLMEKYLGRDIDFSIYIKKNIPEGAGLGGGSSNCATVLK
FT                   VVNQLLGEPLSVEDLENIAKEVSSDAVFFLYGGTAVGRGRGDVVEPIKHLDLKITLVYP
FT                   NVVASTRRVYSAVRDASLTDKIEDDKIISCLLEGKFEVLENTLGQVAMELFPEIKEAYR
FT                   FLEYLGYRPVVSGSGSCVFYIGEASEQVKKGAALRGWRLYEVKSYNGV"
FT   gene            119230..119302
FT                   /locus_tag="Hydth_R0005"
FT   tRNA            119230..119302
FT                   /locus_tag="Hydth_R0005"
FT                   /product="tRNA-Gln"
FT   gene            119327..120256
FT                   /locus_tag="Hydth_0115"
FT   CDS_pept        119327..120256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0115"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COGs: COG0462 Phosphoribosylpyrophosphate
FT                   synthetase; InterPro IPR005946:IPR000836:IPR000842; KEGG:
FT                   hya:HY04AAS1_0016 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; PRIAM: Ribose-phosphate
FT                   diphosphokinase; SPTR: B4U638 Ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: Phosphoribosyl transferase domain;
FT                   TIGRFAM: ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44525"
FT                   /protein_id="ADO44525.1"
FT                   /translation="MIIKLLTGNSNPSLAKEVSDYLGIPISDMIVSRFSDGEIRVQINE
FT                   SMRGEDVFIIQSLCPPVNEHIMELLLILDALKRASAGRITAVIPYYAYARQDRKDRPRV
FT                   PISARLLADLITVAGAQRLVVVDLHSPQIQGFFNIPVDNLYALNVLYDYLKDKVDENTV
FT                   VVSPDAGGVERARRLANKLGCGIAIIYKRRPEPNVAEVLDIIGDVNGKKAIIVDDMIDT
FT                   AGTIVSATNLLMSKGASGVSVVATHAVLSGPAIERINTSPLTQVVVTNTIPTEGKSCDK
FT                   LKVVSVAPLIAESIKRIHEGESVSSLFV"
FT   gene            120275..120853
FT                   /locus_tag="Hydth_0116"
FT   CDS_pept        120275..120853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0116"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="COGs: COG1825 Ribosomal protein L25 (general stress
FT                   protein Ctc); InterPro
FT                   IPR001021:IPR020055:IPR011035:IPR020056:IPR 020057; KEGG:
FT                   hya:HY04AAS1_0955 ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: Ribosomal protein L25-like; SPTR: A8UWU9
FT                   General stress protein Ctc; TIGRFAM: ribosomal 5S rRNA
FT                   E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal L25p
FT                   family; TIGRFAM: ribosomal protein L25, Ctc-form"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44526"
FT                   /protein_id="ADO44526.1"
FT                   /translation="MRKVSLKLIPRELGKKSEIKRMRREGYIPVEVYGKDVENRHAYVS
FT                   LKDLMSLPHGETFLIEADVDGEKRVCLLKDIQVGYLGDDPVHVDLYDISHTKEIEIEVP
FT                   LEFVGTPAGVGLGGTFEVMMHTLTVKASVDSIPDKITVDVSAMNVGDVLHVRDITPPSG
FT                   CVIMDSPEEVIAVVLEPEVEETPTEETTT"
FT   gene            120853..121425
FT                   /locus_tag="Hydth_0117"
FT   CDS_pept        120853..121425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0117"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COGs: COG0193 Peptidyl-tRNA hydrolase; InterPro
FT                   IPR001328:IPR018171; KEGG: aae:aq_346 peptidyl-tRNA
FT                   hydrolase; PFAM: peptidyl-tRNA hydrolase; PRIAM:
FT                   Aminoacyl-tRNA hydrolase; SPTR: A8UWU8 Peptidyl-tRNA
FT                   hydrolase; TIGRFAM: peptidyl-tRNA hydrolase; PFAM:
FT                   Peptidyl-tRNA hydrolase; TIGRFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44527"
FT                   /protein_id="ADO44527.1"
FT                   /translation="MIKLLVGLGNPGKKYQHTRHNVGFMVIDELAKKLKLREYREECLS
FT                   HLYRARIGGRDVLLAKPQTYMNNSGLAVINLLEEYSILPDEMIVVYDDLDLPLGRIRLR
FT                   LEGSSGGHHGIESIIREVKTEKFPRLKVGIGRPKDKNQVVSYVLSPFSEDEQTLLYRVL
FT                   ERSRECLIRCVEFSPEDAMNFCNSPIV"
FT   gene            complement(121415..123400)
FT                   /locus_tag="Hydth_0118"
FT   CDS_pept        complement(121415..123400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0118"
FT                   /product="transketolase"
FT                   /note="COGs: COG0021 Transketolase; InterPro
FT                   IPR005478:IPR005474:IPR018970:IPR005475:IPR
FT                   005476:IPR009014:IPR015941; KEGG: aae:aq_1765
FT                   transketolase; PFAM: Transketolase domain protein; Xylulose
FT                   5-phosphate/Fructose 6-phosphate phosphoketolase-like;
FT                   Transketolase central region; SPTR: A8UR89 Transketolase;
FT                   TIGRFAM: transketolase; PFAM: Transketolase, thiamine
FT                   diphosphate binding domain; Transketolase, C-terminal
FT                   domain; Transketolase, pyrimidine binding domain; TIGRFAM:
FT                   transketolase, bacterial and yeast"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44528"
FT                   /protein_id="ADO44528.1"
FT                   /translation="MNRDDTVINTIRFLSVDQVERAKSGHPGMPLGASHIAYLIFDRFL
FT                   KFNPKDPNWINRDRFVLSAGHASAMLYSLLFVMGYDINLEDLKSFRQLNSRTPGHPERH
FT                   LTPGVEATTGPLGQGIGNAVGMAIAEKYLSNFFNREGFPIIDHYTFALVSDGDLMEGVS
FT                   CEVGQLAGHLKLGKLIVIWDNNGVSIDGPTSLAWSEDVLKRFSAFGWHVAHIEDGYNLD
FT                   ELERAIKSAMEEKERPSFISVRTHLGYGSPKQDDASVHGAPLGKELALETKRRFGWSEE
FT                   EFYVPEEVYNYRKEKIEKGLKAQEEWNRLFEEYRRAYPDLAQKLLKAFKGDWGEDYKIH
FT                   IPVFTEPMATRQASGKLLNAIAKHIPTMIGGSADLSESNNTYLHGMGDFLAENPLGRNI
FT                   HYGVREHAMGTILNGMAYHGGVLPYGGTFLIFSDYMRPSIRLAAMSGLQVIYVFTHDSV
FT                   GLGEDGPTHQPIEQLCSLRLIPNLWVLRPADANEVGIAWDMAIQRKDGPVAIVLSRQKL
FT                   PIIDRNRYAFYENARRGAYIIADTQGTPDLIIFASGSEVHPSLSAKHILEEEGIKVRVV
FT                   NVLSFEVFELQKEDYKEYVLSPQVKRRVAVEAGRGLCWYKYVGMDGLVISMEEFGKSAP
FT                   GDVLMDHFGFTGKKIAQRIKEFYFKQ"
FT   gene            complement(123420..125303)
FT                   /locus_tag="Hydth_0119"
FT   CDS_pept        complement(123420..125303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0119"
FT                   /product="ferredoxin"
FT                   /note="COGs: COG1034 NADH dehydrogenase/NADH:ubiquinone
FT                   oxidoreductase 75 kD subunit (chain G); InterPro
FT                   IPR001041:IPR017896:IPR019574:IPR001450:IPR
FT                   017900:IPR000283; KEGG: aae:aq_437 NADH dehydrogenase I
FT                   chain G; PFAM: ferredoxin; NADH:ubiquinone oxidoreductase,
FT                   subunit G, iron-sulphur binding; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: A8UV38 NADH
FT                   dehydrogenase I chain G; PFAM: 2Fe-2S iron-sulfur cluster
FT                   binding domain; NADH-ubiquinone oxidoreductase-G
FT                   iron-sulfur binding region; 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44529"
FT                   /protein_id="ADO44529.1"
FT                   /translation="MEKKVKIVIDGREIEAQEGQTLLEVALKEGISIPYFCYHPKLKII
FT                   GACRMCIVYNEKTGRLITSCNTRVEDGMIISTQHQLVKNNQRYLLQAFMTRHPLDCPIC
FT                   DKAGECDLQNYGALFGPQRQIVPVSALEKERHYIDWESDFLEYYTNRCVVCYRCTRVCD
FT                   DVNGARALYVEERGFHTNIVPTVRPIDTSSCEMCGLCVHVCPVGAIISKPFKYWTRSWL
FT                   LKREITVCSVCPVGCQVQVEYGIGDWRSKEKVYRTKPTDDLEICAKTFFGYDALNRDRL
FT                   LKPHRYGKEESIGNVINHLAYMLKSKGEETAILLSSYLSNEVLGVLKEVATRVGAYITS
FT                   PLTVDFYAFLEGYGDYTPLHLEDIKGADHYVLVGDDITSSAPVLSYYIKGKVYKYGRTY
FT                   KDAKLKPINLEGLDHLPGGGIIIVNTTGMACEEARNLGAKIKRISEEKGYRVLILHRDA
FT                   NYLGVYGIFGRDMLSDLGSIMEEVRERRIKNLLVFGEDLPDYYQEEDIQEIFRKLENLV
FT                   VFSPFADGLARWASIAVPMNLYGEAQGNFHTLKGLRSSKRFLPWSFDERSFYEELLKSL
FT                   PQEFKEVKVLRGKNPTLRRHLHIYRSNWITDRSENLTKLYEKNAKAVSFAS"
FT   gene            125405..125869
FT                   /locus_tag="Hydth_0120"
FT   CDS_pept        125405..125869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0120"
FT                   /product="NADH-quinone oxidoreductase, E subunit"
FT                   /note="COGs: COG1905 NADH:ubiquinone oxidoreductase 24 kD
FT                   subunit; InterPro IPR002023:IPR012336; KEGG: aae:aq_574
FT                   NADH dehydrogenase I chain E; PFAM: NADH dehydrogenase
FT                   (ubiquinone) 24 kDa subunit; SPTR: A8UVM2 NADH
FT                   dehydrogenase I chain E; TIGRFAM: NADH-quinone
FT                   oxidoreductase, E subunit; PFAM: Respiratory-chain NADH
FT                   dehydrogenase 24 Kd subunit; TIGRFAM: NADH-quinone
FT                   oxidoreductase, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44530"
FT                   /protein_id="ADO44530.1"
FT                   /translation="MLEESLLEKLKQHAEYFPKREQAILLCLHEVQNHYGHIPEFALEE
FT                   VAKILDLPLNHVENVVSFYDMFDRGEPARHRIRVCVSVVCHLMGKDKLIKALRELLNID
FT                   FGQVTKDGRFKLLAVQCLGACSEAPFFMVDEDAYKFENKEKLNEVLSRYA"
FT   gene            125844..127115
FT                   /locus_tag="Hydth_0121"
FT   CDS_pept        125844..127115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0121"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
FT                   NADH-binding (51 kD) subunit; InterPro
FT                   IPR011538:IPR019554:IPR019575:IPR001949; KEGG: aae:aq_573
FT                   NADH dehydrogenase I chain F; PFAM: Respiratory-chain NADH
FT                   dehydrogenase domain 51 kDa subunit; Soluble ligand binding
FT                   domain; NADH ubiquinone oxidoreductase, F subunit, iron
FT                   sulphur binding; PRIAM: NADH dehydrogenase (quinone); SPTR:
FT                   O66841 NADH-quinone oxidoreductase subunit F; PFAM:
FT                   NADH-ubiquinone oxidoreductase-F iron-sulfur binding
FT                   region; Respiratory-chain NADH dehydrogenase 51 Kd subunit;
FT                   SLBB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44531"
FT                   /protein_id="ADO44531.1"
FT                   /translation="MRSYPVTPNIYAETTLDMLLRRAKKPRVHLIEEYLKDGGYQALEK
FT                   AINMSPEEIVDWVDKSQLRGRGGAGFPTGKKWKFAIQNPAPRYLICNADESEPGTFKDR
FT                   VLLERDPHLLIEGMIISAYALGANQAFIYIRGEYPAAYYILKDAIEEAKKKGFLGKDIL
FT                   GSGFDLEIYVAKGAGAYICGEESALIESLEGKRGFPRTKPPFPVQYGLFGRPTVVNNVE
FT                   TLCNIPFIIKLGWEDYRYIGPSDYPGPKLFPVSGKVKKPGVYELPMNTTLREVVYKYAG
FT                   GTINNKKVKAVFSGALDCFSADELDTPMDYSPLGFGGTGTVIVLTEEDSIVEMCLKVAE
FT                   FYAHESCGQCTPCRVGTYEQANLLEKIMKGTATERDWEGFDFVNSYIQPTSICGLGAVA
FT                   GRLIRQTMKKFPEEWEKLRKLVSV"
FT   gene            127082..127330
FT                   /locus_tag="Hydth_0122"
FT   CDS_pept        127082..127330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A9DCC2 Protein
FT                   Y20C6A.4, partially confirmed by transcript evidence"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44532"
FT                   /protein_id="ADO44532.1"
FT                   /translation="MGKVKKVSFCVVLVLGFSYAQEKDCNTNPLRDHSWCKYAWFLCKK
FT                   ATLYRLDQVKKCIEESKSYDEGVKCFEKPWIEGFLQQ"
FT   sig_peptide     127082..127141
FT                   /locus_tag="Hydth_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            127303..127962
FT                   /locus_tag="Hydth_0123"
FT   CDS_pept        127303..127962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0123"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="COGs: COG1573 Uracil-DNA glycosylase; InterPro
FT                   IPR005273:IPR005122; KEGG: aae:aq_1693 N-terminus of phage
FT                   SPO1 DNA polymerase; PFAM: Uracil-DNA glycosylase
FT                   superfamily; SPTR: A8UU74 N-terminus of phage SPO1 DNA
FT                   polymerase; TIGRFAM: phage SPO1 DNA polymerase-related
FT                   protein; PFAM: Uracil DNA glycosylase superfamily; TIGRFAM:
FT                   uracil-DNA glycosylase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44533"
FT                   /protein_id="ADO44533.1"
FT                   /translation="MDRRILATIKSLEEIGIAEIYGFKEQKSKPDKRRMLHELYETLSK
FT                   EKKCILYEGSSGYVFGDGNPDSAVVFVGEAPGEEEDKQKKPFVGKAGKYLNAKLQEVGM
FT                   RREDVYITNVVKSRPPGNRKPTKEEMLSCLPYLRKEIEIIKPKLIVCLGSTALEGLLGK
FT                   ALPITKYRGQVFEYPYSRNIKVLLTYHPAYVLRNPSADREFMEDMKKVKALLGIIF"
FT   gene            127975..129231
FT                   /locus_tag="Hydth_0124"
FT   CDS_pept        127975..129231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0124"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="COGs: COG0499 S-adenosylhomocysteine hydrolase;
FT                   InterPro IPR000043:IPR015878:IPR016040:IPR020082; KEGG:
FT                   aae:aq_1180 S-adenosyl-L-homocysteine hydrolase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding; PRIAM:
FT                   Adenosylhomocysteinase; SPTR: A8UUD2
FT                   Adenosylhomocysteinase; TIGRFAM: adenosylhomocysteinase;
FT                   PFAM: S-adenosyl-L-homocysteine hydrolase, NAD binding
FT                   domain; S-adenosyl-L-homocysteine hydrolase; TIGRFAM:
FT                   adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44534"
FT                   /protein_id="ADO44534.1"
FT                   /translation="MEYHIKDISLKEEGKKRIEWAEKDMPVLRSIRERFSKEKPLKGVK
FT                   ISACLHVTTETANLIITLKEGGAEVYLTASNPLSTQDYVASALVAYYGVPVFAIKGEDT
FT                   QTYYQHLREVIKREPDIVIDDGADLISTLHKEYSDIAQRVLGGMEETTTGVIRLKAMAK
FT                   EGVLKFPIIAVNDAYTKHMFDNRYGTGQSTIDAIMRATNKLIAGSNFVVAGYGWCGKGI
FT                   AQRARGMGATVIVTEVDPIKALEAKMDGFIVMPMIEAAKMGDFFVTVTGNTSVIREEHF
FT                   QVMKDGAIISNAGHFNVEIDIPALERLSVGKREVRSFVEEYQLADGRRIYLLAQGRLVN
FT                   LASAEGHPASVMDMSFANQALCAEYILKNHHKLQKDVYRVPESIDRQIAHLKLKSMGVE
FT                   IDSLTSEQVKYLSSWEVGT"
FT   gene            129228..129785
FT                   /locus_tag="Hydth_0125"
FT   CDS_pept        129228..129785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0125"
FT                   /product="isochorismatase hydrolase"
FT                   /note="COGs: COG1335 Amidase related to nicotinamidase;
FT                   InterPro IPR000868; KEGG: dau:Daud_0416 isochorismatase
FT                   hydrolase; PFAM: isochorismatase hydrolase; SPTR: B1I213
FT                   Isochorismatase hydrolase; PFAM: Isochorismatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44535"
FT                   /protein_id="ADO44535.1"
FT                   /translation="MSLEKFFLNRENSLFVIIDIQEKLAKVMERRESVIENVLHLIELS
FT                   KLLSIPVVLTEQYPKGLGQTVEAIRNAIAEYKPIEKMSFNCCDEEKFLEAIESYGRKNI
FT                   VLTGMETHICVLQTALGLLKRGYNVHVVADGVCSRSYENHLTGLEFMRDAGAVITCTET
FT                   VLFQHLGVAGTPEFKVISQRIK"
FT   gene            129782..130507
FT                   /locus_tag="Hydth_0126"
FT   CDS_pept        129782..130507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0126"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2264 Ribosomal protein L11 methylase;
FT                   InterPro IPR013216; KEGG: aae:aq_2102 ribosomal protein L11
FT                   methyltransferase; PFAM: Methyltransferase type 11; SPTR:
FT                   O67870 Ribosomal protein L11 methyltransferase; PFAM:
FT                   Ribosomal protein L11 methyltransferase (PrmA); TIGRFAM:
FT                   ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44536"
FT                   /protein_id="ADO44536.1"
FT                   /translation="MIYTRYIYSLEEEEFYQFLADQPQGVEVIRRQDNRVEFATYTELK
FT                   WLKPLKVEKIKVKPPESFLRPIRIRSFLIVPPNMKTLIINPGMAFGTGLHPSTQLSLML
FT                   IEEFFKRGWSAIDVGCGSGILAFALKKLSARKVLAIDIDERAIEECEKNASLNRLKITC
FT                   LKAKPEDIKESFDFLVANLELSIFKREIDHIKPLFKKLAIFSGIYGKEELEEFLFFLAD
FT                   LRVVKIKKLKGWYAVVVKR"
FT   gene            130504..131817
FT                   /locus_tag="Hydth_0127"
FT   CDS_pept        130504..131817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0127"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047:IPR011055; KEGG:
FT                   aae:aq_1743 hypothetical protein; PFAM: Peptidase M23;
FT                   SPTR: A8URK6 Putative uncharacterized protein; PFAM:
FT                   Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44537"
FT                   /protein_id="ADO44537.1"
FT                   /translation="MKYRKYKIERKTDKKPRSRKFIKLLLLLGVFGFVLYITFQLFVQK
FT                   PQLENLEALAKIPVQKDITLKLKGSPNVKLVKVKLIQGEKEFILYEGKPSKDGKVYLSI
FT                   SPKKMGIEDGKGQVLISLRYGLFGRETYRVSTFIDTQPPKIEPLSYTEYVVQGGAGAVK
FT                   VRVKDGTQAFVYVGSDRYPMYRLEKGYFFTLFPIRVDQDPSTPIKVVAYDDAGNVSELL
FT                   LKTKIAKVNFRIDKIRLTEEFIDKVIIPLLGKHLPPKEAFKEVNEMWRNRDVEKLKKIG
FT                   SVSEGKKLWQGNFLQLPNSKVISTFGDIRYYYYQGEEVSTSRHMGYDFASFEKALIPAS
FT                   NDGIVVFTGSLGIYGNAIIIDHGFGLMSLYGHLSEIKVKKGELVKKGEIIGNTGNTGLA
FT                   LGDHLHFGVLVHGIEVNPKEWLDARWIKTRIERVLDAQ"
FT   sig_peptide     130504..130632
FT                   /locus_tag="Hydth_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            131807..132472
FT                   /locus_tag="Hydth_0128"
FT   CDS_pept        131807..132472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0128"
FT                   /product="protein of unknown function DUF374"
FT                   /note="COGs: COG2121 conserved hypothetical protein;
FT                   InterPro IPR007172; KEGG: aae:aq_2031 hypothetical protein;
FT                   PFAM: protein of unknown function DUF374; SPTR: A8USA3
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF374)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44538"
FT                   /protein_id="ADO44538.1"
FT                   /translation="MRSRIRFLFIKILLPFIALLVRILGRTIRWEKRYDFNLDRGKIYA
FT                   IWHGNALGIALFGMDRGIYTLVSRFRDGDIAAYILKKLGYHVIRGSTEEGRAEKGGRSG
FT                   VIKLIKAIKDGNNVAITVDGPKGPAFKVKEGVVFLAQKTSSVIIPAFAEFDRCIRLSSW
FT                   DGFTVPLPFARGRVHIGKPIKVSEQDSIEEKTKELEEELLRISSLGKESRLTLEQRQS"
FT   gene            complement(132390..133556)
FT                   /locus_tag="Hydth_0129"
FT   CDS_pept        complement(132390..133556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0129"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="COGs: COG0475 Kef-type K+ transport systems membrane
FT                   components; InterPro IPR006153; KEGG: aae:aq_2030
FT                   Na(+)/H(+) antiporter; PFAM: sodium/hydrogen exchanger;
FT                   SPTR: O67823 Na(+)/H(+) antiporter; PFAM: Sodium/hydrogen
FT                   exchanger family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44539"
FT                   /protein_id="ADO44539.1"
FT                   /translation="MHAGAELVYAGFILLFMFSLAYGLKTLKFPYIISFMLSGFLLKSV
FT                   VPEDVSGILLIFEYSAVALLFFFVGLEYSFEKLLGMLRILKAGFLDLLINFLPIFAISY
FT                   AFTKEFILSLVLASALYPSSTAITVKLFMDYKRLINPEVDLLIGILIFEDLICIILLSL
FT                   LTSFVRLGNINYYAISKSIFILTFLFLLFYLIRNPVKVFFEFAERKVDENLFVFLIFGT
FT                   LLLLCGLALKYDVSEALVAFIFGVLIPENSRAFKIVESSLSPLKELSVGLFFFFFTYKT
FT                   DINSLEQLSFVLLLVATALVFKLISTYISSLVYGFDKRVSMRASLSFLQRGEFSLVFSS
FT                   LYPPAQMITFFVVLITSLLGSFSFVFAPRLTDFLFPRKRSSKAPPQAP"
FT   gene            complement(133556..134041)
FT                   /locus_tag="Hydth_0130"
FT   CDS_pept        complement(133556..134041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0130"
FT                   /product="TrkA-C domain protein"
FT                   /note="COGs: COG0490 Putative regulatory ligand-binding
FT                   protein related to C-terminal domains of K+ channels;
FT                   InterPro IPR006037:IPR016040; KEGG: aae:aq_2028
FT                   hypothetical protein; PFAM: TrkA-C domain protein; SPTR:
FT                   O67822 Putative uncharacterized protein; PFAM: TrkA-C
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44540"
FT                   /protein_id="ADO44540.1"
FT                   /translation="MKVRETDLPGIGKKYAVTLAEGRDLVIIIYNTGKREIYLMEQEEP
FT                   ICSFELTDEEAKELGFLVAGVLYQPVKVEKMELILKEVLIEWIKVEQGSNLVGKTIAEL
FT                   QIRKITGASVIAIDRGGRIIPSPDPYREKIEVGDVLIVVGTRQQIKHFIEICGRCST"
FT   gene            complement(134022..134417)
FT                   /locus_tag="Hydth_0131"
FT   CDS_pept        complement(134022..134417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0131"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR000551:IPR009061; KEGG: aae:aq_702 MerR family
FT                   transcriptional regulator; PFAM: regulatory protein MerR;
FT                   SMART: regulatory protein MerR; SPTR: O66920
FT                   Transcriptional regulator (MerR family); PFAM: MerR family
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44541"
FT                   /protein_id="ADO44541.1"
FT                   /translation="MKERRRYYTIGVVAQMYSIHPQTLRLYEKEGLLKPSRTKGKTRHY
FT                   TDEDLKKLEFILTLTRDLGVNLAGVDVILRMKEQMEEMERQIEKLVEFIQREMSKIYAE
FT                   DENIKSIVLSERRGVLDIIGKNEGKRD"
FT   gene            complement(134414..135556)
FT                   /locus_tag="Hydth_0132"
FT   CDS_pept        complement(134414..135556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0132"
FT                   /product="chaperone protein DnaJ"
FT                   /note="COGs: COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain; InterPro
FT                   IPR003095:IPR012724:IPR001623:IPR001305:IPR
FT                   002939:IPR008971:IPR018253; KEGG: aae:aq_703 chaperone
FT                   DnaJ; PFAM: chaperone DnaJ domain protein; heat shock
FT                   protein DnaJ domain protein; DnaJ central domain protein;
FT                   SMART: heat shock protein DnaJ domain protein; SPTR: A8UY48
FT                   Chaperone protein dnaJ; TIGRFAM: chaperone protein DnaJ;
FT                   PFAM: DnaJ central domain (4 repeats); DnaJ C terminal
FT                   region; DnaJ domain; TIGRFAM: chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44542"
FT                   /protein_id="ADO44542.1"
FT                   /translation="MAQSAKKDYYEILGVPKNATQEEIKKAYRRLARKYHPDFNKDPSA
FT                   QEKFKEINEAYQVLSDPEKRKLYDQYGHAAFSAQGTEGFSQEVFSTNIGDILEEVFRGF
FT                   GFEDIFERATRERRRTYRRPVKGEDIYYTAQITLEEAFTGTILRIPLLREVSCHVCQGK
FT                   GYDPSKGEKVCPTCAGRGEVYQRQFFITISQTCPTCGGEGVIREVCSNCKGRGSVPIRE
FT                   ELTVRIPPGVDNGSKVLFEGKGHAGRNGGPYGDLYVVVKVLPHKLFERKGDNLYLDVNL
FT                   KFTEAVLGTEIEVPTLSGEKIKVRVPPGTKEGDIIQVPGQGMPKLRGNSRGDLFVRVHI
FT                   DVPKLSFMDKVFGNGKKIKQMLEELDKLLPEPSRIKEKEA"
FT   gene            135674..136159
FT                   /locus_tag="Hydth_0133"
FT   CDS_pept        135674..136159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0133"
FT                   /product="Protein of unknown function DUF2249"
FT                   /note="COGs: COG4309 conserved hypothetical protein;
FT                   InterPro IPR018720; KEGG: cbe:Cbei_1432 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2249; SPTR:
FT                   A6LTD0 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized conserved protein (DUF2249)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44543"
FT                   /protein_id="ADO44543.1"
FT                   /translation="MVINQVGSFNHMYVMLSQEGILPSARGYRRIYILLEGSAKYMLGQ
FT                   KFGISQSPCVFGVEEGDIFALIPVDRASILEISLGKDEECEGETIDLRFVEHGARHPLV
FT                   MKKFSELKKGEGFYIINDHDPLPLYFQMSFAFPKKVGWRYVEVKEDFWKIGIKKLKE"
FT   gene            136170..136712
FT                   /locus_tag="Hydth_0134"
FT   CDS_pept        136170..136712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0134"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1 4-benzoquinol
FT                   methylase; InterPro IPR013216; KEGG: tdn:Suden_1179
FT                   tellurite resistance protein TehB; PFAM: Methyltransferase
FT                   type 11; SPTR: A8UU14 Tellurite resistance protein TehB;
FT                   PFAM: Tellurite resistance protein TehB"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44544"
FT                   /protein_id="ADO44544.1"
FT                   /translation="MSVEDRERWDKRYAGGWKTQLHRTLLEFYHLAPVGKALELACGTG
FT                   ENAVFLAKVGFNVDAIDVSCVAIDKAKQRALEEGVQVNFICADLDEYKLSTDTYHLVIN
FT                   FYYLNRKLSEAIVKALKPGGILIFETYNEKHIILREDFNPLYLLKCGELPDLFKDLELI
FT                   YHAENFNVSTFVGRKIT"
FT   gene            complement(136705..138477)
FT                   /locus_tag="Hydth_0135"
FT   CDS_pept        complement(136705..138477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0135"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro
FT                   IPR017790:IPR005311:IPR001460:IPR012338; KEGG: aae:aq_1189
FT                   penicillin binding protein 2; PFAM: penicillin-binding
FT                   protein transpeptidase; Penicillin-binding protein
FT                   dimerisation domain; PRIAM: Peptidoglycan
FT                   glycosyltransferase; SPTR: A8UVM8 Penicillin binding
FT                   protein 2; TIGRFAM: penicillin-binding protein 2; PFAM:
FT                   Penicillin binding protein transpeptidase domain;
FT                   Penicillin-binding Protein dimerisation domain; TIGRFAM:
FT                   penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44545"
FT                   /protein_id="ADO44545.1"
FT                   /translation="MPRRRFIFLAVLGLALYLVVLLRLIHLQIFRRSYYAELSKKNYLR
FT                   LRVLYPQRGDILDRNGEKIAYDVPKYILFLDPQKLEDAVSLGDLLLELKNLFGVDLKES
FT                   DLRQRMKGFEPIPIKTLESQEEIDRFYNNSYKLPGVFINMVPQRYYSYGEITAHITGYT
FT                   GYPTQEELKKYKGRIYTQSSVGKFGIERALDHLLLGFIGGEEIMINAVGRPIRVVRNIP
FT                   SKKGDTVVLTIDVRIQRIIYQVFAESGHKAGGVLVLHAKTGEVLGMLSYPSFDPNAVSD
FT                   RWKEYASDPYKPLFNRCLFAKYPPASVIKPALAIALLEKGLSVKEGVVCTGEFQLGNRT
FT                   FYCWNRHGHGWENVKTAIRDSCDVFFYHYGYYKLGPRGIEEILRAFSYSEGIPFELPCA
FT                   KGFIPTPAWKKRRFGEAWYGGDTVNMSIGQGYITATLLEQVLMMSGIVNNGVIYKPTLL
FT                   REIRDPSGKVVWKNRKSVYKVIKASPEYFSVVREALRDVVRRGTAQLANSHIAEIAGKT
FT                   GTAQVSPFSTRRKHLPYHLRDHAWFVGFAPYRDPIFIVGVLVEHGGSGGAAAAPIAKNV
FT                   IERIYVEGINKEFM"
FT   gene            complement(138464..138919)
FT                   /locus_tag="Hydth_0136"
FT   CDS_pept        complement(138464..138919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_1621 hypothetical protein; SPTR:
FT                   A8UVM9 Putative uncharacterized protein; TIGRFAM: rod
FT                   shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44546"
FT                   /protein_id="ADO44546.1"
FT                   /translation="MRFYVLSLILAFLQASVITGAFVSNLYVPDLVLVYLFLHLSRENA
FT                   VDIKKPLLSGLYLDIMYDSFGWNTSGKLFSAFILELLKSRYIFATRLSVIISYSLIALS
FT                   EHLLRYAIFRLKYYYPFEPWLFFAGFVVELSLLFFLTFFIIKGDAKT"
FT   sig_peptide     complement(138851..138919)
FT                   /locus_tag="Hydth_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(138916..139716)
FT                   /locus_tag="Hydth_0137"
FT   CDS_pept        complement(138916..139716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0137"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="COGs: COG1792 Cell shape-determining protein; KEGG:
FT                   aae:aq_847 rod shape-determining protein MreC; SPTR: A8UVN1
FT                   Putative uncharacterized protein; PFAM: rod
FT                   shape-determining protein MreC; TIGRFAM: rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44547"
FT                   /protein_id="ADO44547.1"
FT                   /translation="MNKKRLLLYLFLFSLSLLTYFLNISSSRYTSFLFDTLYSLILPVI
FT                   ELKTDIANAVKEGVSRYLYLVEVEKKNKKLSKQVQELYFYKSQLRACQMSLKSVSELLG
FT                   VKSEEFGRGLIFASVLGYDPSGRDTFIIIDKGKDQGVEEGFVVFYKDMFVGFVEKVFGS
FT                   SSRIRTVYSRDLTVSSTTEATGKSYIYRGGWMYGQLLYVRLEDQVQKGDVVLLRDTKKA
FT                   LPAFVIGTVFSVEEKGDQFFKRVWVNPSIDIRQLEYVVIVKEKL"
FT   sig_peptide     complement(139639..139716)
FT                   /locus_tag="Hydth_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(139713..140744)
FT                   /locus_tag="Hydth_0138"
FT   CDS_pept        complement(139713..140744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0138"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="COGs: COG1077 Actin-like ATPase involved in cell
FT                   morphogenesis; InterPro IPR004753; KEGG: aae:aq_845 rod
FT                   shape-determining protein MreB; PFAM: cell shape
FT                   determining protein MreB/Mrl; SPTR: A8UVN2 Rod shape
FT                   determining protein MreB; TIGRFAM: cell shape determining
FT                   protein, MreB/Mrl family; PFAM: MreB/Mbl protein; TIGRFAM:
FT                   cell shape determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44548"
FT                   /protein_id="ADO44548.1"
FT                   /translation="MLDRLMSLLGFFSNNIGIDLGTANTVIYADGKGIVLYEPSIVAID
FT                   TRTKRVIAVGREAKEMLGKTPESIQAIRPLRDGVITDFEATQVMLTYFIDRAIGGGIFR
FT                   PKPRIIIGVPSGVTQVEKRAVIDAAKGAGAREVYLIPEPMAAAIGAGLPIEEPIGSMVV
FT                   DIGGGTTEIAVISLAGIVVSNSIRVAGDEMTEAIIQYIKKKFHMFIGEQTGERIKIELG
FT                   NAIYEEEEREMEIKGRDITGLPKTVRITSRDVVESLEDVISSIVNAIRITLERTPPELA
FT                   SDIAERGIVLAGGGSLLKNLNIRIEREIGIKTYYCDDPLTAVARGVGKILDQIDLIKRI
FT                   SME"
FT   gene            140793..142892
FT                   /locus_tag="Hydth_0139"
FT   CDS_pept        140793..142892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0139"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="COGs: COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase; InterPro
FT                   IPR004811:IPR006674:IPR007685:IPR004095:IPR
FT                   002912:IPR003607:IPR012676:IPR012675; KEGG: aae:aq_844
FT                   (p)ppGpp 3-pyrophosphohydrolase; PFAM: RelA/SpoT domain
FT                   protein; metal-dependent phosphohydrolase HD sub domain;
FT                   TGS domain protein; amino acid-binding ACT domain protein;
FT                   PRIAM: GTP diphosphokinase; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: A8UVN3 (P)ppGpp
FT                   3-pyrophosphohydrolase; TIGRFAM: RelA/SpoT family protein;
FT                   PFAM: HD domain; ACT domain; Region found in RelA / SpoT
FT                   proteins; TGS domain; TIGRFAM: (p)ppGpp synthetase,
FT                   RelA/SpoT family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44549"
FT                   /protein_id="ADO44549.1"
FT                   /translation="MHTAAEKLKVEGLLKFFEGEDREKVRKAIDFIEERHEHQVRASGE
FT                   PYIMHPIEVAITLAEMGLDADTIVAALLHDVLEDTPTTYQELKEKFGQGVADIVQGVTK
FT                   LGKFEFKDMERQKAENYRKLLLATAKDLRVILVKLADRLHNMKTLGYLRKDKQVRIAKE
FT                   TLEIYVPIANRLGVWKIKTELEDLCFMYLYPAEYERVKNFVGRSKKDLEEYLKRSFIPK
FT                   LKEALRTFNIDAHIMYRPKHLYGIWQKTVRKGIKLEDVHDVLGVRVILSTPQECYLVLG
FT                   IIHSTFKPVPGKFDDYISLPKPNLYQSLHTAVIGPKGRMVEVQIRTWEMHERAEKGIAA
FT                   HWAYKEGKTLKDNSIYAWLKSLVESIQGSKNPQELIENMKMELFSEEVFVFTPKGDLLV
FT                   LPKGATPVDFAYHIHTDIGNQCAGAKVNGRIVSLNYKLQNGDMVEIITNPSRRPNPEWL
FT                   KFVVTSKAKNKIKAYLRQLEKERYLQEGRQILDKITYKLELSKEAILEKLLQEIGFKSE
FT                   EDLLVAVGSGKVSKEKIYSLFQQKIKEKHKEERKEDLLIIDGLGSVLHSVGTCCLPIPG
FT                   EEVYGVITRGRGVVVHSKLCPNLQYIQRNLPEKVIPVVWRVSGGKHPVRIRVVVKDKVG
FT                   VLAEITSSISKVGANILEAKTKSTSTGKAFMEFLVEVSNYAEFLRLLDTIRSVEGVEIC
FT                   ERVFS"
FT   gene            142909..144207
FT                   /locus_tag="Hydth_0140"
FT   CDS_pept        142909..144207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0140"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR006680:IPR011059;
FT                   KEGG: aae:aq_587 N-ethylammeline chlorohydrolase; PFAM:
FT                   amidohydrolase; SPTR: A8URA1 N-ethylammeline
FT                   chlorohydrolase; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44550"
FT                   /protein_id="ADO44550.1"
FT                   /translation="MLDILIKQAIVPDRGIFDIAIKEGRIIRIERDIKEEARHTIRADG
FT                   KIAIPSFANMHTHISMSLLRGIGSDLTLMDWLQKVIWVLEAEFVSPEFVRDGALLGIAE
FT                   SIMSGTTLLMDMYFFEEAVAQVALSAGIRVGLGFGILDFPTKVASGPEEYLKRAEEFIK
FT                   TFKGEELVFPVLCPHAPYTCSPTTLLKVKELAEREGVLIHTHVAETKSEVEGVKEKYGK
FT                   TPVKHLESLGFVSDRVLMAHMVWLDEEEKAIVKERGAKVLHCPESNLKLASGIAPVWEY
FT                   ISMGIHVCLGTDGPASNDNLDMLEEMSLMAKLQKGYSLSAKAMDARTALKIATENGFLA
FT                   CGIKAGKIEEGYEADLILIDTQKPHLQPLYDPVAQIVYSAKSSDIDTVICRGKVIMERR
FT                   ELKTIDMEELLHIAKKWREKITGFMREKNMLYF"
FT   gene            144233..144484
FT                   /locus_tag="Hydth_0141"
FT   CDS_pept        144233..144484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_0068 hypothetical protein; SPTR:
FT                   A8USA5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44551"
FT                   /protein_id="ADO44551.1"
FT                   /translation="MEEQMYAVPFSLVGFFFTSKPIEQSIRSDLTPEEMEKLQEILARF
FT                   LFTEDIKIALYPSVVPPDQAEEALEELEDMMFGEGEEE"
FT   gene            144481..145284
FT                   /locus_tag="Hydth_0142"
FT   CDS_pept        144481..145284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0142"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="COGs: COG0289 Dihydrodipicolinate reductase;
FT                   InterPro IPR011770:IPR000846:IPR016040; KEGG: aae:aq_916
FT                   dihydrodipicolinate reductase; PFAM: dihydrodipicolinate
FT                   reductase; PRIAM: Dihydrodipicolinate reductase; SPTR:
FT                   A8USA6 Dihydrodipicolinate reductase; TIGRFAM:
FT                   dihydrodipicolinate reductase; PFAM: Dihydrodipicolinate
FT                   reductase, N-terminus; Dihydrodipicolinate reductase,
FT                   C-terminus; TIGRFAM: dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44552"
FT                   /protein_id="ADO44552.1"
FT                   /translation="MTKAVLCGALGRMGRTILRLSLEYSDFEIVAGVEHPDCVRSTDLG
FT                   EASGIPELRGKVLTSRLEEVVSLCHVVIEFSGNTSAAVSHTKIASLAGKAAVVGTTGFS
FT                   EEEMKEMEECSQNAPLLISPNMSLGVNLLFKLVQISVKALKDKNFDMEISEIHHRFKKD
FT                   APSGTALKLASIVAQELGVPLKDHAVFGRKDIQPRKDKDIGVFAIRGGDVVGDHTVYLL
FT                   GFGERIELTHRATSRDTFAKGAIEASRWIKDKPPGLYSMFDVLGL"
FT   gene            145281..145697
FT                   /locus_tag="Hydth_0143"
FT   CDS_pept        145281..145697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0143"
FT                   /product="protein of unknown function DUF101"
FT                   /note="COGs: COG1371 conserved hypothetical protein;
FT                   InterPro IPR002804; KEGG: aae:aq_2128 hypothetical protein;
FT                   PFAM: protein of unknown function DUF101; SPTR: O67888
FT                   Putative uncharacterized protein; PFAM: Archease protein
FT                   family (DUF101/UPF0211)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44553"
FT                   /protein_id="ADO44553.1"
FT                   /translation="MSFYEVIEDITADAGVRVRAKTLEELICKAILATFNEMTDIDTVE
FT                   SRESYILEVHANFPYLLVDIINEAIVLHETKKFVASKCHVLELSEKHIKVKLMGDKFDP
FT                   EKNESKLVIKAATYHRLKVEKTSEGYMAEVIFDI"
FT   gene            complement(145694..148036)
FT                   /locus_tag="Hydth_0144"
FT   CDS_pept        complement(145694..148036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpe:CPE0216 exonuclease SbcC; SPTR: A8UXN5
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44554"
FT                   /protein_id="ADO44554.1"
FT                   /translation="MVEIRGKETPSCMEYFAKGLRVSENGFLYGGVFWCGDENYAESLS
FT                   KLLYKIIKKKDKLEECKKMFKEFLEKVDFSLQGEAIYKKDRVIWLKPRELFRKEREAVF
FT                   ERFRKDKIFRLAEGVVSIASQIEKSSGLAFLRILEAQGEDITKESVWKGREDLIDIWKN
FT                   KTEDGEIKEYLSKVAQIGYIIKTYLAPEDFKKPSIFKLFSYLAPFDFKIFEDAYLVSRA
FT                   RLFERKTKAEDLIEELKQEKVIWEDLLYAFKKEGITEEELKKVLEKAFNEKFLRKLRQD
FT                   WKELLKDIIKGEEKKAIGSFVKKQMREEGWVSYGSFRVPNKEISLYIFYEKGVESKVEK
FT                   FKEGLEKSAKAFSRFTGNIGIKIERSLPIDGLIPDFDKLKNMNFSNLLHQDSFELLFNL
FT                   AYFNCRLKGFVDVMQNKNPVGILLLLDTDIREDGGGYSFWDAFNFIYEFFSLPVQTLNK
FT                   TTINLFCGFSEGKIKEKEVQGVYKNLFISLLKDLKTLEFEFEGFNLPTQLNVFAVLEKP
FT                   STGFCYRRGDPTQKAYRHFLYEIYKISVNGNRATVELEDKYLVLTGGLDFEADKFRRWI
FT                   EEKAKDGETKFCFITAGAWEDSYMNEIISKSGESSNIKSKSLFVEYSELPTAYISDKAQ
FT                   EDCFVIYTSEFEKLKESLGISKESNKVSLAIKPADIKDESRFRLDDGEFFYHSSLQVFS
FT                   TDGLGWERDDVYSERRNLFLFTLLALSQYESESFQSPYSKLDLWQKRKSLYLKIRRNQG
FT                   EYQIPLNAVLYEMIYLISKIPADKNLG"
FT   gene            complement(148017..151094)
FT                   /locus_tag="Hydth_0145"
FT   CDS_pept        complement(148017..151094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0145"
FT                   /product="helicase domain protein"
FT                   /note="InterPro IPR001650; KEGG: cyc:PCC7424_3119
FT                   helicase-like protein; PFAM: helicase domain protein; SPTR:
FT                   A8UXN6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44555"
FT                   /protein_id="ADO44555.1"
FT                   /translation="MANKFVQFLGFAFEGAFKLGFLKDRIEDYQQFKERQVFEKLKQEF
FT                   IHEHFQELEYIWELLERNIPFDPKVEQPEELRELGLQDDHKTHLLFVFLVGYYEGYFYG
FT                   LSFGDLELIKYTIGEESSQAGVYYNADLIFKSNKTLYVADFKLSGVRSQLTDIITKQIT
FT                   QQKVAIPFRNYGLPVNLALGELTFEGFLKSLTLLEDELLSLQEASPELKGFLQVVSYAV
FT                   DYLHKEKPEDIKEVCLSLLYPLAEPFIARFYLRGEDLSQYREKIISLYDRIRRLELEYK
FT                   QVESPSLARIERLREEIPKEIENLKQQIKVREKQETVLSPDSIYASREHVSKVLDRFFM
FT                   DPDPVKAVCLFHSAGSGKTTQTRKKILQMEGKHIILYMATRKILLDREQKELRKLKDQY
FT                   KIEIVYEKSAKKDNEWVRNIGDTYKDLPKDNAGILKKTVEKIRELTTKDHNFIWAFATQ
FT                   QAIVGTLYKDSTAEYLKELLSKRIINQYTFHFILDEFFGHNNGLFAIEEFFKILNYVKK
FT                   EGGRVNLYLFDANGFAPPLLEKLLEEYKEFQVMPDATILCEYSSGNVFKERDIKVYVSA
FT                   KHGYPSPRINLVKKFIFLSEEEVKLKKKPEDELINKKIAEYIEKTFKNYKEESTALVFV
FT                   QNRGHIARLRELLEGKGFSSMVATANSKRSQREINEGNQDIILSTSAISRGIDLSRPHK
FT                   PVNHIYTVIYDWGIEKNMVELIQAVSRARGDKKTESEPKTIHLIYLVYPTKNENIAYLE
FT                   EDTIHKDLIRLLNEKINLREKIYLDDVITQIITQFIKTPEEKSKVLVPLGEQYKSVYIP
FT                   NKISEIEGCLSFLNDILELEKDDEIKKNILILIEVLTEALYVSVVDISFDKEMEYYHPY
FT                   ILFNNQRVRFGFDNESRGRAKSLFYKVKEKLEEHNPEKTEDIEEIINSFLPVQESALPV
FT                   LVPIYSIVLVKHFLKINELLGFTIDKRIGRGKAETLLGSEKPRTYCFNGEQDREYACIP
FT                   LGEEYPYKEVLSGRFVKFPIEFIKYLLEERNGGDKG"
FT   gene            complement(151182..151931)
FT                   /locus_tag="Hydth_0146"
FT   CDS_pept        complement(151182..151931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0146"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="COGs: COG0007 Uroporphyrinogen-III methylase;
FT                   InterPro IPR003043:IPR014776:IPR014777:IPR000878:IPR
FT                   006366; KEGG: sul:SYO3AOP1_0051 uroporphyrin-III
FT                   C-methyltransferase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR: Q3LGA4
FT                   Uroporphyrinogen III methyltransferase; TIGRFAM:
FT                   uroporphyrin-III C-methyltransferase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44556"
FT                   /protein_id="ADO44556.1"
FT                   /translation="MGKVYIVGAGPGDPELLTLKAYRLIKSADVVLYDRLVNPEILLLA
FT                   KPECQLIYVGKEEGKHTIEQEKINELLLHYAHTKEVVVRLKGGDPFVFGRGSEEALFLA
FT                   QHGVEVEVVPGISSATGVPAYAGIPITFRRLSSSFAVITGHEDPKKGSSSVDWESLKGI
FT                   NTLVFLMAVSNRKEIARRLIEVGRDPKEPVAFIERGTTREQRVVITDLYELANDPPEVN
FT                   PPAVMVVGQVVRLSPYCGQVSATWQAI"
FT   gene            complement(151924..152979)
FT                   /locus_tag="Hydth_0147"
FT   CDS_pept        complement(151924..152979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0147"
FT                   /product="cytochrome d1 heme region"
FT                   /note="InterPro IPR015943:IPR011048:IPR003143; KEGG:
FT                   pmx:PERMA_0309 heme d1 biosynthesis protein NirF; PFAM:
FT                   cytochrome d1 heme region; SPTR: Q3LGA5 Putative
FT                   uncharacterized protein nirF; PFAM: Cytochrome D1 heme
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44557"
FT                   /protein_id="ADO44557.1"
FT                   /translation="MLLVMLFILILPFLSIAEKLYVVERERGSLAVVEEGKVVKEIEGL
FT                   GNLSHATVKVWEGYAYVISRDGYLSKIDPKEDKLLKRVKVGNSTIGLDFTDNHIVVANY
FT                   DPHTVVVLDEELNILKTLKTGSRNVGIKGFEGGFVFSLMDKDEVWVVERQEIRKFKVGN
FT                   MPFDALLSGDIYLLGFFKESGIGMIDIKNKLYRKLDFKAQGKEVVFKIPHFGTWGIVGD
FT                   EAFIPAVGEKRLYKVDLRKMEILGHVELGGLPVFASVSPNGNYLAVNFSGDREDYLALV
FT                   DVKEMKVLKELKLGQRIMHLRFSQDGTRLYVSSYFDSKLRAFQVPDLKLLYELNIPHPS
FT                   GVFLIRRNHHG"
FT   gene            complement(152967..154049)
FT                   /locus_tag="Hydth_0148"
FT   CDS_pept        complement(152967..154049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0148"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR017200:IPR006638; KEGG: pmx:PERMA_0308 heme d1
FT                   biosynthesis protein NirJ; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; SPTR: Q3LGA6
FT                   Putative uncharacterized protein nirJ; PFAM: Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44558"
FT                   /protein_id="ADO44558.1"
FT                   /translation="MLRMTEYIRNTLEGKKPKAFEGVILIWNLTNACNLHCKHCYSSAN
FT                   KDKEELSYEEAISLVHRLPEAGVKFTILSGGEPLLREDLFHIARLLKERGIRTYLSTNG
FT                   ILVKEHLKEIKECFDYVGISIDGKQEVHDLFRGKRGAFETSLEAIRMCLKEGIKVGLRF
FT                   TLTPITAESLPFVFELAEKEGIPKVYISHLVYAGRGRKLSHLEKKDYRRWVEFIVHKAF
FT                   EYVERGLPIDVVTGNNEADAVLLYREFARRHPELADKLYERLLKWGGNQAGVKLMNIDH
FT                   RGNVKPDPFFFHSVGNVKEEDIVKIWQGNGLLGFLREKPRKLKGKCSNCGFVSICNGNS
FT                   RARAYAVFGDYTEEDPACYL"
FT   gene            complement(154042..154530)
FT                   /locus_tag="Hydth_0149"
FT   CDS_pept        complement(154042..154530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0149"
FT                   /product="4-vinyl reductase 4VR"
FT                   /note="COGs: COG1719 hydrocarbon binding protein (contains
FT                   V4R domain); InterPro IPR004096; KEGG: sul:SYO3AOP1_0460
FT                   4-vinyl reductase 4VR; PFAM: 4-vinyl reductase 4VR; SPTR:
FT                   Q3LGA7 Putative uncharacterized protein; PFAM: V4R domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44559"
FT                   /protein_id="ADO44559.1"
FT                   /translation="MAGWIETLSQVRRPHLGEDVPLLVFRAFRVFTGMYLEDVLGHKGA
FT                   TALIQNAGRELGKEVGERLQDSSLDRYIGKVIDFVKDAKIGLLIPVDLKEGSLVVALDE
FT                   CITCAGMPNIGKRICHFEAGFVAGIVEAHTGNKVRAYETKCNAHGDGICEVVVEMNYA"
FT   gene            complement(154514..156136)
FT                   /locus_tag="Hydth_0150"
FT   CDS_pept        complement(154514..156136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0150"
FT                   /product="cytochrome d1 heme region"
FT                   /note="InterPro IPR003143:IPR009056:IPR011048; KEGG:
FT                   pmx:PERMA_0307 cytochrome c, class I; PFAM: cytochrome d1
FT                   heme region; SPTR: Q3LGA8 Cytochrome c; PFAM: Cytochrome c;
FT                   Cytochrome D1 heme domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44560"
FT                   /protein_id="ADO44560.1"
FT                   /translation="MKLKNLLLLPLLCSLSFGGGAELYLKYCSSCHGEDRLGGHAPPLF
FT                   PPFFNIPEERLYRIIREGAVGMPSFKELKEEEVKQIVEFIKSPVEKEKLRWDEERIKGS
FT                   VERVYTKKVEVKNLKDYTLVVERGKNLVWVMEGERLLDKFAFSSMHGGIKFSKEGVAYI
FT                   PSRDGWIGRYDPTKGELKRVRACIYLRNIAFYGGLLVASCWVPSRLVVFDSQLNYVKSF
FT                   ELHGRINAVYELYIRDGFIFTFKDKPLVGFLNYKDLKLTYENLGVALEDFIIDPLEEYL
FT                   IGSTRSGLEIYSLNDLRLVKELKALDIPHLASAYFWYSKGDFYFATPLLNKPVLSVWKA
FT                   YSWEHVKDIPLDGNGFLARSSYGTPYVWVDMSTDSMLLLDKRSLEVKKFIPAPGKRVTH
FT                   AEFTGDGRIAYVSVYEKEGALMLYDGVSLKKLGEFPANLPAGKYNFVNKSRYFEGAQLG
FT                   YQVFMEKCWGCHHTTENAFGPSLRWSIQNREKALVIAQILNPENTYRLLGYSRNAMPRI
FT                   ELKEGELKALMKFMEALKDGWMD"
FT   sig_peptide     complement(156074..156136)
FT                   /locus_tag="Hydth_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(156136..157791)
FT                   /locus_tag="Hydth_0151"
FT   CDS_pept        complement(156136..157791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0151"
FT                   /product="Hydroxylamine reductase"
FT                   /EC_number="1.7.99.1"
FT                   /note="InterPro IPR009056:IPR003088:IPR003143:IPR011048;
FT                   KEGG: pmx:PERMA_0306 nitrite reductase (cytochrome cd1)
FT                   (cytochromeoxidase) (hydroxylamine reductase); PFAM:
FT                   cytochrome d1 heme region; cytochrome c class I; PRIAM:
FT                   Hydroxylamine reductase; SPTR: Q3LGA9 Cytochrome cd1
FT                   nitrite reductase; PFAM: Cytochrome c; Cytochrome D1 heme
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44561"
FT                   /protein_id="ADO44561.1"
FT                   /translation="MRKRKKVLIGGALVFVLFAGTYAQQQQKEELPPPPPLTKQEMERA
FT                   KEIYFDRCAGCHGALRKGATGPALTPDKTRKLGTETLKTFITYGTPGGMPDWGRQGILT
FT                   PEEVDLMARYIQHDPPPPPELPLGEMKKSWKVYVPPEKRPQKPEHNRNWQNFMAVILRD
FT                   IGKVAIIDGDTKELVSTVDTGYAVHIARYSASGRYLYTIGRDGKVVLIDLWMKKPDKVA
FT                   EVKTCYDGRSLDTSKYKGPKGDFLDKLAIIGCYWPPSFVIVDGQTLEPLKIVATSAYTY
FT                   DTNEFLREARVASIVASHYDPEWVVNVKEAGQIWLVDYSNIHAPKITMIDAERFLHDGG
FT                   WDASKRYFLVAANFRDTISVVDTKEKKLVKNIKVGTRPHPGRGANIDHPKYGPLWCTGH
FT                   LGDNTIRCIGTDPVKHPQYAWKVVVKMEMPGEGGGNLFIKTHPKSPHLWADRALNNDPK
FT                   LQRSLFVFDKNTFQIKKVIEIPPEFQGRAVHLEYNKNGDEVWVAVWSKKNEPEKQAILV
FT                   YDDKTLTLKKAITGNWVATPTGHFNVYNTMKDIY"
FT   sig_peptide     complement(157723..157791)
FT                   /locus_tag="Hydth_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(157859..158599)
FT                   /locus_tag="Hydth_0152"
FT   CDS_pept        complement(157859..158599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0152"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="COGs: COG1999 Uncharacterized protein SCO1/SenC/PrrC
FT                   involved in biogenesis of respiratory and photosynthetic
FT                   systems; InterPro IPR017936:IPR003782:IPR012336:IPR012335;
FT                   KEGG: aae:aq_2189 hypothetical protein; PFAM: electron
FT                   transport protein SCO1/SenC; SPTR: A8UXC1 Putative
FT                   uncharacterized protein; PFAM: SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44562"
FT                   /protein_id="ADO44562.1"
FT                   /translation="MLKLISLLIIVCTAFGSFLPDEKKSIGTYIPDIPLEIHTGEVLRI
FT                   KEFAGGKVIIINPIYTRCSSACPLMTEGLKRAIKDLMNDVKVISLSFDPRDSIEDLKRF
FT                   ARHQSLPENWVVAKSEQVDSLLKSIDFRYRYDKSLEEFEHPNIYVVITPSGKISRYIYG
FT                   VNPKVRDIKLSVLEAKRESSKLSPVEGFFLRCFRYDPDRGDYQIDWFFVFDVMGGLLTF
FT                   LVVPALVWGKSAYKSLHDFIVKKS"
FT   gene            complement(158583..159851)
FT                   /locus_tag="Hydth_0153"
FT   CDS_pept        complement(158583..159851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0153"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="COGs: COG0843 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 1; InterPro IPR000883; KEGG: aae:aq_155
FT                   hypothetical protein; PFAM: cytochrome c oxidase subunit I;
FT                   SPTR: A8UU96 Putative uncharacterized protein; PFAM:
FT                   Cytochrome C and Quinol oxidase polypeptide I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44563"
FT                   /protein_id="ADO44563.1"
FT                   /translation="MRLFYLSLSLLSLVQAGVFGLLIALTRAPAFSLLKSPSLFYHFLV
FT                   GHVTFSITVWLMTFTLAYWHYKEGRKGRVAPPATLLGMLLLSLSCLLPYGEPYLNNYIP
FT                   VIDSPIFYAGLFVFFLAFFFEALSRVKKLKEITSFENIPQLYAMSVALGLATLLSLIPS
FT                   FFIANAEGGQKLYFERLFWIPGHLQQFLYASVMLAVWHELLKRGNGKEVSSPLLSTVNF
FT                   LLLVFPSLLMAGFFTDIFSREFRLLTVMSFGLGTGVPVLIHTYYVLKNIRLSADVPSLA
FT                   LLSSVSVYYAGVVVAYAGMQSDLRVPAHYHGVVSAVSIAFMGLGYSILKERLGYICWER
FT                   VAKLQPVVLSMGINLLVLGFYMAGRMGAPRKTYGFEYVMNTKVLIALNIAGLGSLMAVL
FT                   GGLLFILYAGQSLLSIYKHAKAY"
FT   sig_peptide     complement(159756..159851)
FT                   /locus_tag="Hydth_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(159851..161518)
FT                   /locus_tag="Hydth_0154"
FT   CDS_pept        complement(159851..161518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0154"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="COGs: COG0843 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 1; InterPro IPR000883; KEGG: mag:amb2222
FT                   heme/copper-type cytochrome/quinol oxidase, subunit 1;
FT                   PFAM: cytochrome c oxidase subunit I; SPTR: A8UXC0
FT                   Heme/copper-type cytochrome/quinol oxidase, subunit 1;
FT                   PFAM: Cytochrome C and Quinol oxidase polypeptide I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44564"
FT                   /protein_id="ADO44564.1"
FT                   /translation="MFRTCDITGLKVDLRAERLIQLNAVMAVVSLLVGVIAALLLVLTR
FT                   WQVVHLLPVEWYYRILTLHGLNALIFWIIFFEVAGLYFGSTVVLNSRMSSPKFGWLAFI
FT                   LMVLGFLLVNYTILTGSADVLMTSYAPLQASPIYYLGIILFAVGALIGVFLFFANLLIA
FT                   RKERTYGDSLPLFTFGLVAAAIIATLTLATGAIIYIPTLLWSLGIIKSIDAGVYKLVWW
FT                   GLGHSSQQINVTAMIAVWYLGAFLTVGGASINEKVSRFAFVFYVIGINVASAHHLLVDP
FT                   GPSPAWKVFNTSYIMYIAVLASMIHAFAVPSAVESAQRRRGFTKGLFDWLKNAPWGNPA
FT                   FSAVFLSIIIFGFIGGVTGVVNGMEQTNIIVHNTLSIPGHFKGTVVGGTTLAFMGATYY
FT                   LIPLIFRKKIAFFGLAKAQPWVFGLGIAVLAVSMYILGAFGVPRRHYDITFSGGPFTYT
FT                   FNPAVDFFWVLFAIGGITAVIGALMWILIVVFSVFLGQPVRGPQDMQLQIASPPPPAKE
FT                   HHGFEAPGTLTLTLLFMGVFLVFLLLNWGWLAAMWEVK"
FT   gene            complement(161531..162061)
FT                   /locus_tag="Hydth_0155"
FT   CDS_pept        complement(161531..162061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0155"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="COGs: COG1622 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 2; InterPro IPR002429:IPR008972; KEGG:
FT                   mag:amb2221 heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 2; PFAM: cytochrome c oxidase subunit II; SPTR:
FT                   A8UXB8 Heme/copper-type cytochrome/quinol oxidase, subunit
FT                   2; PFAM: Cytochrome C oxidase subunit II, periplasmic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44565"
FT                   /protein_id="ADO44565.1"
FT                   /translation="MALLPPEEGWYYKRVAKDEKMWIALALVVCLILFFWMIVWHIYGR
FT                   QNPSFTTYRTTPQEFNALANAFINKYRTGEMNGIPVVEPPPNSDVFLVAKMWRWEPVLV
FT                   LKKGQEYRFHISSLDLLHGFSLQPVNMNFMVYPGYDYVLTFKPTSTGEFAIICNEFCGI
FT                   GHHTMIGKIIVKE"
FT   gene            complement(162063..162236)
FT                   /locus_tag="Hydth_0156"
FT   CDS_pept        complement(162063..162236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb2220 hypothetical protein; SPTR: A8UXB7
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44566"
FT                   /protein_id="ADO44566.1"
FT                   /translation="MEERKTPFLQLVLDDFMLLLFLGVTIYAVSYLIWGLIELAWLSPI
FT                   PAELKQSLLGGK"
FT   gene            162404..164347
FT                   /locus_tag="Hydth_0157"
FT   CDS_pept        162404..164347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0157"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="COGs: COG1290 Cytochrome b subunit of the bc
FT                   complex; InterPro
FT                   IPR005797:IPR017896:IPR001450:IPR003813:IPR
FT                   016174:IPR017900:IPR016175; KEGG: mes:Meso_4302 cytochrome
FT                   b/b6-like; PFAM: 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; Cytochrome b/b6 domain;
FT                   methyl-viologen-reducing hydrogenase delta subunit; SPTR:
FT                   A8UXB5 Cytochrome b/b6-like protein; PFAM:
FT                   Methyl-viologen-reducing hydrogenase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44567"
FT                   /protein_id="ADO44567.1"
FT                   /translation="METLQKVSPLYMAFQRLSYAVSTFFTSRLNPLYHLGAIAVFLLVV
FT                   DALSGIYLFFFYSIDPQTSHASVEAISSSFIGNIMRGIHRYSSDALILTTLAHMIHVII
FT                   TDRFRMFRWVAWVTGVATLLIFLAIGVSGYILVWDTRAQLTGLLTAKFFSFLPVFGDAL
FT                   MSAFLGSDIKYLGGLFRILLFAHIALTILIVFTLWIHVMRNARPRLIPPRFLYITITLL
FT                   LILLSIIFPAKSDPPAYINKLPFEMSVDWFYLFGYPLLKYIPMSANWLFFLGFFAFLFL
FT                   FPWLIKGKRNPPAHIDFEKCTGCEQCYIDCPYEAITMKDFEDKKKAVLNESKCAGCGIC
FT                   VGSCSVQAIDIPTFPIEEVIKGVSQESPSYVAFRCPFSALPPKRKDLLTFTLPCAGALN
FT                   TYYAEEILRRGVKGIVIISCEYEDCYFREGNKWLEERYERKRRPILRKRVEGGRILVLE
FT                   APYVKSIEREVEEFINSSKEGREVKVVPSGRLNYAFASLVISLPIFLFYPLTTHKVSFY
FT                   PKEKSAVVLSFKYRSSPVVEVYKEEGKGLKHMQTQLAIVKERSPVRVEFYEGGKLVYSK
FT                   VFNPRGIRKDASVFVYEELLLPPGKHSLRVRLEETKGKREVKEVKLDAHLKAKDSLLIT
FT                   YDEDSGGFVVLR"
FT   gene            complement(164308..164652)
FT                   /locus_tag="Hydth_0158"
FT   CDS_pept        complement(164308..164652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0158"
FT                   /product="cytochrome c class I"
FT                   /note="InterPro IPR002324:IPR009056:IPR003088; KEGG:
FT                   abu:Abu_1734 hypothetical protein; PFAM: cytochrome c class
FT                   I; SPTR: A8UXB0 Cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44568"
FT                   /protein_id="ADO44568.1"
FT                   /translation="MWLLLVFLFVLSCEKAKVEEKPSLAINTKELIRWRGCTDCHDTKR
FT                   SLVGPSFFDISQRYEEKDILVKSILEGSCGKWKARWECMPPQKVSKEEAERMAEWILHL
FT                   RTTKPPESSS"
FT   gene            complement(164654..165421)
FT                   /locus_tag="Hydth_0159"
FT   CDS_pept        complement(164654..165421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0159"
FT                   /product="nitrous-oxide metabolic protein NosY"
FT                   /note="KEGG: sul:SYO3AOP1_0452 nitrous-oxide metabolic
FT                   protein NosY; SPTR: B2V820 Nitrous-oxide metabolic protein
FT                   NosY"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44569"
FT                   /protein_id="ADO44569.1"
FT                   /translation="MFVKLTKYIFYDLLKSRWVLATFFFYALVVYILLEFGRSVEKAVV
FT                   SYGNLSSLSLSLFSLLLSTTYLYSNRNFFEFLLSQPVKRSTLMLSINVSLSLSLSISYL
FT                   LGSLLPFYYLVGYNQGFFRCVLLNLFLVPLFVSLGILSSLLVEDRIRGFGFSLFLWLFF
FT                   CVFYDAILLYLVIALSDYPVEKMLLTLTLLNPIDLLRLTLLMEVGLYELMGFVGRWLAN
FT                   YLKDLWFLPALLSALYTLLVFLLNLSVFKRRDF"
FT   gene            complement(165406..166104)
FT                   /locus_tag="Hydth_0160"
FT   CDS_pept        complement(165406..166104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0160"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR003593; KEGG:
FT                   sul:SYO3AOP1_0451 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: B2V819 ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44570"
FT                   /protein_id="ADO44570.1"
FT                   /translation="MIRFESVYKSFKGRRLFDGLNLELKEGKTTAILGPNGSGKTTLVK
FT                   MILGLVVPDRGRILVDGRDARKDAEHKRLIGYMPQIPEFPENLSVKEIVSMVKDIRGQE
FT                   AVRFKELIELLNLEMELDKRFSSLSGGTRQKVGALVSLAFDPPMLILDEPMVGLDPISA
FT                   YRLKRFILEEKQRNKTVLFISHIMSEVEEVADYVVFLAEGRKVFDGSLEELKERTGKER
FT                   LEEAVLCLLN"
FT   gene            complement(166101..167291)
FT                   /locus_tag="Hydth_0161"
FT   CDS_pept        complement(166101..167291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0161"
FT                   /product="Carbohydrate-binding and sugar hydrolysis"
FT                   /note="COGs: COG3420 Nitrous oxidase accessory protein;
FT                   InterPro IPR006633:IPR006626:IPR011050; KEGG:
FT                   pmx:PERMA_1260 periplasmic copper-binding protein NosD;
FT                   SMART: Carbohydrate-binding and sugar hydrolysis; Parallel
FT                   beta-helix repeat; SPTR: C0QQT7 Periplasmic copper-binding
FT                   protein NosD; PFAM: Protein of unknown function (DUF1565);
FT                   Periplasmic copper-binding protein (NosD)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44571"
FT                   /protein_id="ADO44571.1"
FT                   /translation="MFSFMLSLLLVCSTCEFKDIQSALKKAREGDRIVVKSGTYKGGIV
FT                   IDKKVELVGEGKPVVDGEGKLQVITVKADSVKIEGFIIKNSGMSYSEDIAGLKVINSRD
FT                   CVIKNNKFLNNFFAIYLERVQGCLIEGNSIVGFARSEGSSGNGIHAWNSEKVIIRNNYV
FT                   KGHRDGIYFEFVKDSLIENNRSEYNLRYGLHFMFSNDDTYRKNYFYKNGAGVAVMYSKN
FT                   IRMEENTFAKNEGQANYGLLLKDIYDSVLYGNRFINNTHGVYLEGCNRTEFKGNLFENN
FT                   GWAVRIYANSEDNLFIKNSFLGNAFDVSTNTLSYFRNTFESNYYDQYEGYDINRDGYGD
FT                   IPYRPVSFVAVLFERYPLSLLLYGSFFAHIMDAVERYIPLLNPQSLLDSKPLVRRP"
FT   gene            complement(167293..167748)
FT                   /locus_tag="Hydth_0162"
FT   CDS_pept        complement(167293..167748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0162"
FT                   /product="nitrous-oxide reductase accessory protein NosL"
FT                   /note="KEGG: sul:SYO3AOP1_0449 nitrous-oxide reductase
FT                   accessory protein NosL; SPTR: B2V818 Nitrous-oxide
FT                   reductase accessory protein NosL; PFAM: NosL"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44572"
FT                   /protein_id="ADO44572.1"
FT                   /translation="MRFLLRVLWVFLPLLLFSCATDKPQPIKVGEDVCEQCKMVIADKR
FT                   FASEVITKKGKVYKFDAIECMVGYYNENEEEIKRAYVINFLNPEEFLPAQSAYYVRSPQ
FT                   IRSPMGMNLSAYRSREDAQKALQGKEGEILDWQALREFIKREYRFSH"
FT   sig_peptide     complement(167689..167748)
FT                   /locus_tag="Hydth_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(167745..168347)
FT                   /locus_tag="Hydth_0163"
FT   CDS_pept        complement(167745..168347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmx:PERMA_1258 hypothetical protein; SPTR:
FT                   C0QQT5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44573"
FT                   /protein_id="ADO44573.1"
FT                   /translation="MSIFSRGLLALASLLLVLTYFFPLWRIQLIAPQYPEGLRMFIWVN
FT                   RITGGTEFDLYNINLLNHYIGMKHIDPNAIPELKVLPFIMAFLIAFGLISALLAKRILL
FT                   YAWVGTFIALAIIGLADFYKWEYDYGHNLDPSAPIKIPGLAYQPPLIGSKQLLNMTASS
FT                   FPDIGGYIALVSLLLGIAAVALEIKLSKTAKMEVKPA"
FT   sig_peptide     complement(168270..168347)
FT                   /locus_tag="Hydth_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(168360..170336)
FT                   /locus_tag="Hydth_0164"
FT   CDS_pept        complement(168360..170336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0164"
FT                   /product="Nitrous-oxide reductase"
FT                   /EC_number="1.7.2.4"
FT                   /note="COGs: COG4263 Nitrous oxide reductase; InterPro
FT                   IPR002429:IPR011045:IPR008972:IPR015943; KEGG:
FT                   pmx:PERMA_1257 nitrous-oxide reductase; PFAM: cytochrome c
FT                   oxidase subunit II; PRIAM: Nitrous-oxide reductase; SPTR:
FT                   C0QQT4 Nitrous-oxide reductase; PFAM: Cytochrome C oxidase
FT                   subunit II, periplasmic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44574"
FT                   /protein_id="ADO44574.1"
FT                   /translation="MLGKKKLLVGGLSALVVGALLAGCPPKKELKTEVGTAEVAQKVYV
FT                   PPGKYDEFYAFLSGGFSGQVSVYGLPSGRLIKIIKVFSQDPETGYGYTPETKPMLMTSH
FT                   GFVPWDDSHHPELSQTDGVPDGRWLFINANNVPRIARIDLSTFETTEIIEIPNSAGNHA
FT                   SPFITPDSKYVTAATRFSVPIPQKDVPISSYAENFKGTLSFIKANEPGKMDVAFQILVP
FT                   GYDYDLAHCGKGPSYGWCFFTSYNTEQAYTLLEINASKNDKDYIAAVNWKRAEECIAQG
FT                   KYQEIPATYYHNYYDEKKHMAFSEVKKSVKVIIPKDCPGVMYYLPTPKSPHGVDVSPDG
FT                   EYIIGGGKLATVIPIHSFSKMLKAIEQKAFEKEVDGIPVLKYDAVLHCEVPKPCLGPLH
FT                   TEFDGKGFAYTSCFVSSEVVKYDYKQCKVVDRAPTYYSIGHLMIPGGDSAKPWGKYLLA
FT                   MNKITKDRYLPTGPELFQSAQLYDITGEKMQLLLDFATIGEPHYAQGIPVDIIMKNVKK
FT                   IYPLAENEHPYAVKAEKDARVERKGNEVHVYMTMIRSHFVPDNIEGIKVGDTVYFHLTN
FT                   LEQDWDIPHGFAVKGSEDAEILVMPGETKTLVWKPKAPGVYPFYCTDFCSALHQEMQGY
FT                   VRVSPAGSNVPLKYYTGTPTAQK"
FT   sig_peptide     complement(170271..170336)
FT                   /locus_tag="Hydth_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(170364..170810)
FT                   /locus_tag="Hydth_0165"
FT   CDS_pept        complement(170364..170810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0165"
FT                   /product="cytochrome c class I"
FT                   /note="InterPro IPR009056:IPR003088; KEGG:
FT                   sul:SYO3AOP1_0446 cytochrome c class I; PFAM: cytochrome c
FT                   class I; SPTR: B2V816 Cytochrome c class I; PFAM:
FT                   Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44575"
FT                   /protein_id="ADO44575.1"
FT                   /translation="MKKAFLLISLSGLLLFSCKEKPPEAPATPPEKPKEEAVSDKGIGP
FT                   IKEVQLGPVDQNLVKRGKEIFDSKCATCHKLEERYVGPPLKGVTKRRKPEWIMNMILNP
FT                   TEMEQKDPIAKQLLSEYLTQMTFQNVSQEDARAILEYLRSVDEK"
FT   sig_peptide     complement(170751..170810)
FT                   /locus_tag="Hydth_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            170945..171586
FT                   /locus_tag="Hydth_0166"
FT   CDS_pept        170945..171586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0166"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COGs: COG0194 Guanylate kinase; InterPro
FT                   IPR017665:IPR008144:IPR008145:IPR020590; KEGG:
FT                   hya:HY04AAS1_0765 guanylate kinase; PFAM: guanylate kinase;
FT                   PRIAM: Guanylate kinase; SMART: guanylate kinase/L-type
FT                   calcium channel region; SPTR: A8UUP9 Guanylate kinase;
FT                   TIGRFAM: guanylate kinase; PFAM: Guanylate kinase; TIGRFAM:
FT                   guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44576"
FT                   /protein_id="ADO44576.1"
FT                   /translation="MGCLFVLSAPSGAGKTTVAEKLIREVSGIKRVVTATTRSKREGER
FT                   EGVDYIFMSREEFERGIKDSIFLEYASVYGNYYGTPKEQVKKVLEEGFDALLVIDVQGA
FT                   KSIKDKLPESILIFLLPPSLEELKRRLITRGYAEENLLEREKKVEVEIACARHFDYIVV
FT                   NDFLDKAVEAIKHIVNSYRHTKERVFKDIEKLVKDDTIKDILLKGRCDIF"
FT   gene            171598..173976
FT                   /locus_tag="Hydth_0167"
FT   CDS_pept        171598..173976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0167"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="COGs: COG0466 ATP-dependent Lon protease; InterPro
FT                   IPR001984:IPR004815:IPR003111:IPR003959:IPR
FT                   008269:IPR003593:IPR020568:IPR008268; KEGG: aae:aq_242 Lon
FT                   protease; PFAM: peptidase S16 lon domain protein; AAA
FT                   ATPase central domain protein; PRIAM: Endopeptidase La;
FT                   SMART: peptidase S16 lon domain protein; AAA ATPase; SPTR:
FT                   A8UYB2 ATP-dependent protease La; TIGRFAM: ATP-dependent
FT                   protease La; PFAM: ATP-dependent protease La (LON) domain;
FT                   ATPase family associated with various cellular activities
FT                   (AAA); Lon protease (S16) C-terminal proteolytic domain;
FT                   TIGRFAM: ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44577"
FT                   /protein_id="ADO44577.1"
FT                   /translation="MIGEEFIKVPQIPAGSFELPTMPLRDLVVFPTMVMPLFVGRAFSI
FT                   RAIEEALKKDRLIFLVLQRERDLEEPSIEDLYRVGTVAHIIRTAPIEEGRLKILVQGLK
FT                   RAKLIDYKKADGYYASLVEVLEDKEIKPEELSKEDRAYISSLKELLDRAVSLGKQVIPD
FT                   LLMLIRDIEDPGKLADITASVLDIKSKEAQAVLETLDPRERLRLVHQHALNEVGLLEVQ
FT                   SRIRNIARERMEREQREYFLRQQLKAIQEELGEGDERKAEIEEYREKLSKLKLEKATKS
FT                   EIEKQINRLEKLHPESAEAGVLRTWLDWVLDLPWNKKTKDRYNLEKARQVLDRDHYDLE
FT                   KVKDRIIEYLAVRKLTKGKKSAVQILCFVGPPGVGKTSLGKSIAESLGRKFVRISLGGI
FT                   RDEAEIRGHRRTYVGAMPGRIIQAIKQAGTKNPLIVLDEVDKISISFQGDPAAALLEVL
FT                   DPEQNKNFVDLYIGMPFDLSDVFFICTANRIDTIPRPLLDRMEVISLAGYSEEEKVFIA
FT                   KNHLLPKLLPLHGFKDDEVALSDDAILEVIRGYTRESGVRNLQRYLGSVLRKLALKKLK
FT                   GENPPFMVNAQDIRTYLGVPRRYIEKEEKPMVGIAVGLAWTEVGGEIMLIEATKFKGKG
FT                   NLLLTGSLGDIMKESAQAALSYIKSKAEDYGIDPDAFSNFDVHIHVPEGAVPKDGPSAG
FT                   ITIATALISLFTERPVRMDIAMTGEVTLRGRVLPVGGLKEKILAAKRAGIYQVILPEKN
FT                   KDEVLEDLPEYVRDKMTLHFVSNLDEVFDLALLTKQSVL"
FT   gene            174002..174202
FT                   /locus_tag="Hydth_0168"
FT   CDS_pept        174002..174202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0168"
FT                   /product="ribosomal protein S21"
FT                   /note="InterPro IPR001911; KEGG: hya:HY04AAS1_0744 30S
FT                   ribosomal protein S21; PFAM: ribosomal protein S21; SPTR:
FT                   B4U8H0 30S ribosomal protein S21; TIGRFAM: ribosomal
FT                   protein S21; PFAM: Ribosomal protein S21; TIGRFAM:
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44578"
FT                   /protein_id="ADO44578.1"
FT                   /translation="MAIVEVGENESFEKVLKKFKRIVEKEGILTEVKRRQFYEKPSEKK
FT                   KRKERAARKRLLKALKKKNLL"
FT   gene            174287..174898
FT                   /locus_tag="Hydth_0169"
FT   CDS_pept        174287..174898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0169"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047:IPR011055; KEGG:
FT                   aae:aq_1753 lipoprotein NlpD fragment; PFAM: Peptidase M23;
FT                   SPTR: A8UUN8 Lipoprotein NlpD; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44579"
FT                   /protein_id="ADO44579.1"
FT                   /translation="MKKLFLAFALGGVLCKPAVDSSPLGIGGPAKDTFEFTPEKELQKE
FT                   DFDTQSVDRIISVESSVEKAMKELLDVKTVDTIKPDIWPVVGLVTSDYGWRRMGRVKEF
FT                   HPGIDISVPYGTPVSVASDGRVIYAGWLSGYGKTVIVYHGYGFVTLYGHLSDISVSYGD
FT                   KVVKGQIIGRVGMTGRTTGPHLHYEVIRYGIRQNPIAYLP"
FT   gene            174915..176393
FT                   /locus_tag="Hydth_0170"
FT   CDS_pept        174915..176393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0170"
FT                   /product="UbiD family decarboxylase"
FT                   /note="COGs: COG0043 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase and related decarboxylase; InterPro
FT                   IPR002830; KEGG: aae:aq_1612 hypothetical protein; PFAM:
FT                   Carboxylyase-related protein; SPTR: O67542 Uncharacterized
FT                   protein aq_1612; TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase; TIGRFAM: UbiD
FT                   family decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44580"
FT                   /protein_id="ADO44580.1"
FT                   /translation="MPYTDLREFLKTLEREGELARIKEPVSPILEISEVTDRVSKTPGG
FT                   GKALLFEKVEGYSVPVLTNMLGSEKRIKLALGYENLEDIGWKLYRLLRPEIPNTFLEKL
FT                   KRLPELKKLNDSLPRIVRKGPVKENIIKEKINVLDFPIPKCWPEDGGRYITFGQVITKD
FT                   PESGIRNVGLYRVQVLSPTELALHWQIHKDGNHHYWKAKRLGKKLEVAIAIGGDPVLSY
FT                   VASAPLPPEVDEYLFAGLIREEGVELVKGETVQVEYPAHAEIAIEGYVDPQEPLVDEGP
FT                   FGDHTGFYTPVDKYPRMHITAILHRDNPIYLSTLVGRPPQEDKYIGWATERIFLPLIKF
FT                   NLPEVVDYHLPAEGCFHNFCFVSIKKRYPGHAFKVAYALLGLGLMSLEKVIVVFDEWVN
FT                   VHNMEEVLWAWGNNMDPSRDVLILKGPIDVLDHSTSQVGVGGKMVIDATTKWKEEGYTR
FT                   EWPKVIEMSKEVKEKMDKLWDRIKYQIYGDNRGA"
FT   gene            176371..177270
FT                   /locus_tag="Hydth_0171"
FT   CDS_pept        176371..177270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR009050:IPR012292; KEGG:
FT                   hya:HY04AAS1_0366 hypothetical protein; SPTR: B4U7E5
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44581"
FT                   /protein_id="ADO44581.1"
FT                   /translation="METIEELKVHYGWTEEDEENLAKVSWLGEKYKEDFIEEFYRYLEN
FT                   FSDTSKYLPDEEVRKRHKEKVKGWFASLFTSKYDAQYLRKLYRIGETHVRIGLPPHYVQ
FT                   ASMNFVRNYIADKLTMEMGSTLEANSILKSINKALDINLDVMINSFREEELRLYLASGK
FT                   YQRLLIENVRRVSWFFDTFIILTLAVVGVFLIFWIVYEIGLVLKGDFPLERGGLSILGS
FT                   VLVLYAISELLAEEIKHIRGSALSLKVFVGVALAAVIRKILIISLSPEKVQELITLSVV
FT                   TLSLGVVFWLIYRVESKL"
FT   gene            complement(177242..178150)
FT                   /locus_tag="Hydth_0172"
FT   CDS_pept        complement(177242..178150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0172"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="COGs: COG0324 tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; InterPro IPR018022:IPR002627; KEGG:
FT                   aae:aq_1067 tRNA delta-2-isopentenylpyrophosphate (IPP)
FT                   transferase; PFAM: tRNA isopentenyltransferase; PRIAM: tRNA
FT                   isopentenyltransferase; SPTR: O67162 tRNA
FT                   Delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   IPP transferase; TIGRFAM: tRNA isopentenyltransferase
FT                   (miaA)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44582"
FT                   /protein_id="ADO44582.1"
FT                   /translation="MILLIGGPTASGKSFIACQVAKVLNGEIISADSMSVYRHMDIGTA
FT                   KPLDCMKVIKHHMIDIIDPGQTFDAKTFEELSCKAIEDIESRGKLPIVCGGTYLYIQAL
FT                   LYGIDESPPPDWSLRERLYRIAKEKGSHYLYEKLKAIDKRYALKISPNDSRRIVRALEV
FT                   FIQTGKPFSSFHHWGKPKVEFKAFYIKRSWETLSRRIEERVHQMIKDGLVEEVKRLVDM
FT                   GFESFLTSPQAIGYKELLPYLKGLISLEEAVESIIKNTKEYAKRQIRWFRRQGWEEVDA
FT                   ERLGIEGSADYIVRALTPLCK"
FT   gene            178179..178928
FT                   /locus_tag="Hydth_0173"
FT   CDS_pept        178179..178928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0173"
FT                   /product="protein of unknown function DUF28"
FT                   /note="COGs: COG0217 conserved hypothetical protein;
FT                   InterPro IPR002876:IPR017856; KEGG: aae:aq_1575
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF28; SPTR: O67517 UPF0082 protein aq_1575; PFAM: Domain
FT                   of unknown function DUF28; TIGRFAM: conserved hypothetical
FT                   protein TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44583"
FT                   /protein_id="ADO44583.1"
FT                   /translation="MAGHSHWAQIKHKKAKVDAQRGKLFSKIIREITVAVREGGPNPET
FT                   NSRLRTAIENARRVNMPAETIERAIKKGAGELGGESYEEVLYEGYGPGGAAIMVMATTD
FT                   NRNRTTAEIRHVFSKHGGNLGSSGCVSYMFERVGYMEVPKEGLSEDVLYEKAIEAGAED
FT                   IETGETSYIIYTKPEMFYTVKDSLLKENIPVENATITYKPLSTVQITDPETAKKLIKLL
FT                   DALDELDDVQNVISNFDIPEEVLRASA"
FT   gene            178925..179317
FT                   /locus_tag="Hydth_0174"
FT   CDS_pept        178925..179317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0174"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="COGs: COG0251 Putative translation initiation
FT                   inhibitor yjgF family; InterPro
FT                   IPR006056:IPR006175:IPR013813; KEGG: aae:aq_364
FT                   hypothetical protein; PFAM: Endoribonuclease L-PSP; SPTR:
FT                   A8UVT0 Putative uncharacterized protein; TIGRFAM:
FT                   endoribonuclease L-PSP; PFAM: Endoribonuclease L-PSP;
FT                   TIGRFAM: endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44584"
FT                   /protein_id="ADO44584.1"
FT                   /translation="MKSVYTEKAPKPVGPYSQAVICGSWLFLSGQIGIDPQTGLIKDTF
FT                   EEQVRQIFENVEGILKTAGADKNSIAKVVVYLKDLSLFATFNALYQEFLKDVEVKPART
FT                   TVGVSELPLGAMVEIDIIAAVKQERG"
FT   gene            complement(179286..180989)
FT                   /locus_tag="Hydth_0175"
FT   CDS_pept        complement(179286..180989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0175"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="COGs: COG1190 Lysyl-tRNA synthetase (class II);
FT                   InterPro IPR018149:IPR002313:IPR006195:IPR004365:IPR
FT                   004364:IPR016027:IPR012340; KEGG: aae:aq_1202 lysyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (D K and N);
FT                   nucleic acid binding OB-fold tRNA/helicase-type; SPTR:
FT                   A8UWW9 Lysyl-tRNA synthetase; TIGRFAM: lysyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class II (D, K and N);
FT                   OB-fold nucleic acid binding domain; TIGRFAM: lysyl-tRNA
FT                   synthetase, eukaryotic and non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44585"
FT                   /protein_id="ADO44585.1"
FT                   /translation="MDQERLKKLEKLKELDNPYPHKFEVDRFIEDIRQMFEKDPSGEEV
FT                   CIKGKVKRVSKIDEGFLVRVADQEGVEMLVITAHNLNQGEEYILKGKLVRYEGKLTLKD
FT                   AEPSDNQAIDIKSLKEAYDFDPNFYQVRLAGRLVSLRSMGKAIFGHLQDATGKVQIYIK
FT                   KDVVGDEKFKVFDDLFDLGDVIGVVGRLFRTSTGELTVEVQDFKMLAKSLHPLPEKWHG
FT                   LKDVEVRYRQRYLDLISNEKARRITLLRSKLLSEIRKFLEERGFIEAETPVLQHIASGA
FT                   NAKPFITYHNYLEQNLYLRIAPELYLKRLIVGGFNRVYELGKNFRNEGVDTTHNPEFTM
FT                   LEFYCAYWDYKDLMEFTQELFSHLLKKLVGSLKITYQNYTLDFTPPYKVYRYFDLLLEK
FT                   TGKDKDFFLRHEKEVRKLAAELGIPKAQELTHAKLLDKIFDVLVEDELIGPAFVIDFPK
FT                   LLSPLAKTHREDEDLVERFELFVAGKEIANAYTELNDPIEQRDRFLQQIKEKEMGDEEA
FT                   MQMDEDFITALEYGMPPTAGEGIGIDRLVMLLADVDSIREVILFPALRQR"
FT   gene            181029..181898
FT                   /locus_tag="Hydth_0176"
FT   CDS_pept        181029..181898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0176"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="COGs: COG0224 F0F1-type ATP synthase gamma subunit;
FT                   InterPro IPR000131; KEGG: aae:aq_2041 ATP synthase F1 gamma
FT                   subunit; PFAM: H+transporting two-sector ATPase gamma
FT                   subunit; SPTR: A8UXV5 ATP synthase gamma chain; TIGRFAM:
FT                   ATP synthase F1, gamma subunit; PFAM: ATP synthase;
FT                   TIGRFAM: ATP synthase, F1 gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44586"
FT                   /protein_id="ADO44586.1"
FT                   /translation="MPKLSPRDIRRKIQGIKNTRRITNAMKVVSAAKLRRAQELLYASR
FT                   PYSERLYQVLRDLSGHIDPETHPLLERREEKQADIIIITADRGLAGAFNSNLIKRAEEL
FT                   INEKRSLGVGVSLILIGRKGFQYFSKRGYQVIKGYDEVFRKEINFSVVKEVGKIVRDRY
FT                   ASRETDAVYLLNNEMVTRVSYKPMMRAFLPFEKPQDGREDYGVYEFEVEKEEFVSKLVD
FT                   LYLNYQIYRAMVESNAAEHFARMVAMDNATRNADELVRTWTLIFNKARQEAITSELIDI
FT                   VNAVEAMK"
FT   gene            181927..183348
FT                   /locus_tag="Hydth_0177"
FT   CDS_pept        181927..183348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0177"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="COGs: COG0055 F0F1-type ATP synthase beta subunit;
FT                   InterPro IPR005722:IPR004100:IPR000194:IPR000793:IPR
FT                   003593:IPR018118:IPR020003; KEGG: aae:aq_2038 F0F1 ATP
FT                   synthase subunit beta; PFAM: H+transporting two-sector
FT                   ATPase alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; SMART:
FT                   AAA ATPase; SPTR: A8UXV4 ATP synthase subunit B; TIGRFAM:
FT                   ATP synthase F1, beta subunit; PFAM: ATP synthase
FT                   alpha/beta family, beta-barrel domain; ATP synthase
FT                   alpha/beta chain, C terminal domain; ATP synthase
FT                   alpha/beta family, nucleotide-binding domain; TIGRFAM: ATP
FT                   synthase, F1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44587"
FT                   /protein_id="ADO44587.1"
FT                   /translation="MNGKIVQIIGAVIDVEFEGEDLPPVRHGLKTRRRFIDDRGNWAEE
FT                   DLYLEVAQHIGEKRVRCIAMGATDGLVRGQEVEYLGGPIKVPVGRATLGRIFNVVGQPI
FT                   DEAGEVKAEDYWPMFREPPPLEEQSTKVEILETGIKVVDLLEPYVKGGKVGLFGGAGVG
FT                   KTVLMQELIHNIAKFHKGFSVVIGVGERTREGNDLWHEMKESGVLPYTVMVYGQMNEPP
FT                   GVRFRVAQTGITMAEYFRDVEGQDVLVFIDNIFRFVQAGSEVSTLLGRLPSAVGYQPTL
FT                   NTDVGEVQERITSTKKGSLTSIQAVYVPADDITDPAPYSVFAHLDATTVLARRLAELGI
FT                   YPAVDPLESTSKYLAPEFVGEEHYTVAMEVKRILQRYKELQEIIAILGMEELSEEDKAI
FT                   VGRARRIQRFLAQPFHVAEQFTGMPGKYVRLEDNIRSFKEILTGKYDHLPEMAFYMVGT
FT                   IEEVVEKAKALGAKV"
FT   gene            183345..184106
FT                   /locus_tag="Hydth_0178"
FT   CDS_pept        183345..184106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0178"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="COGs: COG0689 RNase PH; InterPro
FT                   IPR002381:IPR001247:IPR015847:IPR020568:IPR 018336; KEGG:
FT                   aae:aq_924 RNase PH; PFAM: 3' exoribonuclease;
FT                   Exoribonuclease, phosphorolytic domain 2; PRIAM: tRNA
FT                   nucleotidyltransferase; SPTR: A8UY27 RNase PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease family, domain 1;
FT                   3' exoribonuclease family, domain 2; TIGRFAM: ribonuclease
FT                   PH"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44588"
FT                   /protein_id="ADO44588.1"
FT                   /translation="MRKDGRKPNELRPIRIVRDYLQHPEGSCLIEFGNTKVICTVSVQD
FT                   GVPPFLKGKGQGWITAEYSMLPRATITRNVRESVQGRISGRTHEIQRMIGRAMRTALDL
FT                   TKIGERTFWIDCDVIQADGGTRTASITGAFVAIADAVIKLYNEGILSSTPIKDFVASVS
FT                   VGTVNGQILLDLNYEEDSTASVDMNVVATGSGRISEIQALGEENTFSREEFDRMLSLAL
FT                   AGISQLIELQRAFYEIVGNVWKRKNVKEARL"
FT   gene            complement(184108..184722)
FT                   /locus_tag="Hydth_0179"
FT   CDS_pept        complement(184108..184722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0179"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="COGs: COG0139 Phosphoribosyl-AMP cyclohydrolase;
FT                   InterPro IPR008179:IPR002496; KEGG: aae:aq_1968
FT                   phosphoribosyl-ATP pyrophosphohydrolase; PFAM:
FT                   phosphoribosyl-AMP cyclohydrolase; phosphoribosyl-ATP
FT                   pyrophosphohydrolase; SPTR: O67780 Histidine biosynthesis
FT                   bifunctional protein hisIE; TIGRFAM: phosphoribosyl-ATP
FT                   diphosphatase; PFAM: Phosphoribosyl-ATP
FT                   pyrophosphohydrolase; Phosphoribosyl-AMP cyclohydrolase;
FT                   TIGRFAM: phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44589"
FT                   /protein_id="ADO44589.1"
FT                   /translation="MNLKFDQNGLIPVIAQDYRTGEVRMFAWANEEAVKKTLETGYAHY
FT                   YSRSRGSIWKKGETSGELQRVVEVRVDCDEDALIYMVYQEKDVACHTGERNCFFRDIWG
FT                   EKANKVLPFEVLQRLQDVIKSRIEEKKEGSYTYSLFLQGEDRVLQKFGEEAVESLIALK
FT                   NGDPESIKAELSDMLYHMLLALTIRGVDISQVLEELCSRFK"
FT   gene            complement(184730..185221)
FT                   /locus_tag="Hydth_0180"
FT   CDS_pept        complement(184730..185221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0180"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR013838; KEGG: aae:aq_1631 hypothetical
FT                   protein; SPTR: O67553 Uncharacterized protein aq_1631"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44590"
FT                   /protein_id="ADO44590.1"
FT                   /translation="MRDIPLRMLIERLEELITAQQKLASLMLLTEDKKAKLSVSTAIDM
FT                   LYTHMEMLDITLEIINALQDTSDDYTREYATMITAEALSWTGFMLPYIEASSPIFIEHI
FT                   KVESQPIISRIKSVVSLMERLGSEMDVFSSEEIIRTIDMVSRAIKYQLFMAKKSYETMA
FT                   "
FT   gene            complement(185218..186570)
FT                   /locus_tag="Hydth_0181"
FT   CDS_pept        complement(185218..186570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0181"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="COGs: COG1220 ATP-dependent protease HslVU (ClpYQ)
FT                   ATPase subunit; InterPro
FT                   IPR004491:IPR013093:IPR019489:IPR003593; KEGG: aae:aq_192
FT                   ATP-dependent protease ATP-binding subunit HslU; PFAM:
FT                   ATPase AAA-2 domain protein; Clp ATPase-like; SMART: AAA
FT                   ATPase; SPTR: A8USK6 ATP-dependent protease ATP-binding
FT                   subunit; TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: AAA domain (Cdc48 subfamily); C-terminal,
FT                   D2-small domain, of ClpB protein; TIGRFAM: heat shock
FT                   protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44591"
FT                   /protein_id="ADO44591.1"
FT                   /translation="MMMTKSLSDLLEELTPKRIVEELDKYIVGQEQAKKAVAIALRNRW
FT                   RRQKLPQHIREEVAPKNILMIGPTGVGKTEIARRLAQLIKAPFIKVEATKYTEIGYVGR
FT                   DVESMVRELVEVSYQMVKQEKIQKVKERAKRAAEERILDYLVPQQLSFGVREQQDTGKR
FT                   ELMREKLRSGELDEKVIEIDLQEKMMPMIGIAGPPGLEELEEQIKSMLGNMMPTRKRRK
FT                   VKVKEALSLLEQEEAEKLIDMEEVSRDAIQRAENFGIIFIDEIDKIAVKTPGAGPGVSR
FT                   EGVQRDLLPIVEGTTVKTKYGPVRTDHILFIAAGAFHMAKPSDLIPELQGRFPIRVELS
FT                   PLTKEDFVRILKEPKNALTKQYIELLKTEGVEIEFTDDAIEEIARIAEEANTKTENIGA
FT                   RRLHTVMEKLLEDISFNAPEMEGQHIIIDTKFVRAKLENIVRDVELSRYIL"
FT   gene            complement(186545..187012)
FT                   /locus_tag="Hydth_0182"
FT   CDS_pept        complement(186545..187012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_194 hypothetical protein; SPTR: A8USK4
FT                   Molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44592"
FT                   /protein_id="ADO44592.1"
FT                   /translation="MEFFFFTDVYADRYLIDYYIVSFKLLDESVVSTKEWEGRKYITDI
FT                   KDWEAFKESAYDIVLYEFGDEVERFNDIETALRTAYRMAYTEASRRVPKSTLPSIGIGS
FT                   PPIDVIKRVFPVSFEFEIFPEDLDLFLDRIVRETEEEITRSEFNDDDEIPF"
FT   gene            187034..187414
FT                   /locus_tag="Hydth_0183"
FT   CDS_pept        187034..187414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0183"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="COGs: COG0802 ATPase or kinase; InterPro IPR003442;
FT                   KEGG: aae:aq_843 hypothetical protein; PFAM: protein of
FT                   unknown function UPF0079; SPTR: A8URH9 Seryl-tRNA
FT                   synthetase; PFAM: Uncharacterised P-loop hydrolase UPF0079;
FT                   TIGRFAM: conserved hypothetical nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44593"
FT                   /protein_id="ADO44593.1"
FT                   /translation="MEVISSSDKETIEIGRRLGKSLKGNEVICLLGELGAGKTTLVKGI
FT                   AQGMGLLEGYQVRSPTFTIVNEYPTQKGRLIHIDLYRVNDFDIKEFIGQGVLVIEWAKN
FT                   INCCDITISIEFVPQGRLIKIR"
FT   gene            complement(187407..188018)
FT                   /locus_tag="Hydth_0184"
FT   CDS_pept        complement(187407..188018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0184"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="COGs: COG0406 Fructose-2 6-bisphosphatase; InterPro
FT                   IPR013078; KEGG: aae:aq_1744 phosphoglycerate mutase; PFAM:
FT                   Phosphoglycerate mutase; SPTR: O67630 Phosphoglycerate
FT                   mutase; PFAM: Phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44594"
FT                   /db_xref="GOA:D3DFP8"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3DFP8"
FT                   /protein_id="ADO44594.1"
FT                   /translation="MKRLYLVRHAQSEYNEKGIFQGRLDSDLTPLGFVQARLLAREFLK
FT                   KKVDIIYSSPQRRAYKTALTISDMLGTQLVVDERLREMSFGEYEGKHFWSMLEAHKDVF
FT                   LNWLSNPVKHPLPTQESMEEFEKRVRSFLEDVKSSHYQNMLIVAHGGTLHAIVCLLTGI
FT                   GLENLWNIHMDNAGITEIHMEGEKSTLVYLNKLCHTRQLT"
FT   gene            complement(188015..188611)
FT                   /locus_tag="Hydth_0185"
FT   CDS_pept        complement(188015..188611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0185"
FT                   /product="Protein of unknown function DUF429"
FT                   /note="COGs: COG2410 conserved hypothetical protein;
FT                   InterPro IPR007362; KEGG: sul:SYO3AOP1_0866 protein of
FT                   unknown function DUF429; PFAM: Protein of unknown function
FT                   DUF429; SPTR: B2V971 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF429)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44595"
FT                   /protein_id="ADO44595.1"
FT                   /translation="MDKILGLDLAGSPKRPTGYAFWKDKKLEVGCVYKDEEILSLAQSF
FT                   DLIMIDAPLSLPEGRKDLETPGPHFRECDMELRKAGIKFFPLSLGPMRMLTKRAIFLAN
FT                   LFKKQNKRVFETYPGAFYDSAGISRRDREAIVRFYRHINLNLEVREYLQDELDAVACWL
FT                   SGVCYTLGKARLFVGKDGQIVLASEECVELLKYTL"
FT   gene            complement(188604..189830)
FT                   /locus_tag="Hydth_0186"
FT   CDS_pept        complement(188604..189830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0186"
FT                   /product="osmosensitive K channel signal transduction
FT                   histidine kinase, sensor subunit KdpD"
FT                   /note="COGs: COG2205 Osmosensitive K+ channel histidine
FT                   kinase; InterPro IPR003852:IPR014729; KEGG:
FT                   hya:HY04AAS1_0720 osmosensitive K channel His kinase
FT                   sensor; PFAM: Osmosensitive K channel His kinase sensor;
FT                   SPTR: B4U8E6 Osmosensitive K channel His kinase sensor;
FT                   PFAM: Osmosensitive K+ channel His kinase sensor domain;
FT                   Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44596"
FT                   /protein_id="ADO44596.1"
FT                   /translation="MEDLEERPSPEELLELVESVENVEFDVGKGYLTVYFGYAPGVGKT
FT                   YSMLYDAHLLLEKGIDIVVGYVETHGRAETEALLKDLEIIEPVIYDYKGLKLREVNYEK
FT                   IIQRKPQIVIIDELPHTNPPGFSEEKRYQSIKRVLQAGIDVFTAMNVQHLESLKDLIYQ
FT                   ITGVEVRESVPDPFIKDAKEIKLIDLPPEELLVRLSEGKVYVKDMAEEARRRFFKIGNL
FT                   IALRTLALRVVADQLDQKLKNYLRRRGITTPLGLKEKILVGVYASPYASQLVRATYRIA
FT                   SELGGVEWIALFVETEKSKDFTEEEKKWLEKALDLARRLGGRVECIKGKNVAQEIISYA
FT                   KREGITKIVLGKPRREGALTGSIYKNLILETEGIDIYLIAPRVKAELPKSIEKKGFDRY
FT                   LDILRRYFG"
FT   gene            complement(189817..190374)
FT                   /locus_tag="Hydth_0187"
FT   CDS_pept        complement(189817..190374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0187"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="COGs: COG2156 K+-transporting ATPase c chain;
FT                   InterPro IPR003820; KEGG: tte:TTE2010 K+-transporting
FT                   ATPase, C chain; PFAM: K transporting ATPase KdpC subunit;
FT                   PRIAM: Potassium-transporting ATPase; SPTR: B7R902
FT                   K+-transporting ATPase, C subunit; TIGRFAM:
FT                   potassium-transporting ATPase, C subunit; PFAM:
FT                   K+-transporting ATPase, c chain; TIGRFAM: K+-transporting
FT                   ATPase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44597"
FT                   /protein_id="ADO44597.1"
FT                   /translation="MWKTFRVYIFLFAITGLIYPLVITGLAQLLFKEKAKGSIIYKDGK
FT                   PVGSELIAQPFVSRGLFWSRPSAVDYNPLSSGGSNLAPTNPELYRRVSQRVKLFNEMPV
FT                   PSYLVFASGSGLDPHLPPSAVYFQIKRVSKETGLTEEELKKLIEKHTEGRTLGIMGQER
FT                   VNILKLNMELLKLMEISTHGRP"
FT   gene            complement(190378..192438)
FT                   /locus_tag="Hydth_0188"
FT   CDS_pept        complement(190378..192438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0188"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="COGs: COG2216 High-affinity K+ transport system
FT                   ATPase chain B; InterPro
FT                   IPR001757:IPR006391:IPR008250:IPR005834:IPR
FT                   018247:IPR018303; KEGG: gsu:GSU2481 potassium-transporting
FT                   ATPase, B subunit; PFAM: E1-E2 ATPase-associated domain
FT                   protein; Haloacid dehalogenase domain protein hydrolase;
FT                   SPTR: Q74AA9 Potassium-transporting ATPase, B subunit;
FT                   TIGRFAM: K+-transporting ATPase, B subunit; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase; haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   K+-transporting ATPase, B subunit; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44598"
FT                   /protein_id="ADO44598.1"
FT                   /translation="MKKRDVSVFNRDIIIEALLDSFRKLNPLELWRNPVIFLVEVASLI
FT                   ITIEFFLELSGVKKGLAWFSGWTAFWLWLTVIFSNFAESLSEIRGKARAESLKSYKTTI
FT                   MAKKLESPDPNAPFVEVPSTELKKGDFVLVQEGELISGDGEIVVGAALVNEAAVTGESA
FT                   PVLREAGSDRSAVLGGTKVVAGNIVVRITANPGETFLDKMISMIEGAKRRKTLNEIALE
FT                   VLLVSLTVVFLLVAFNARAISEYLVAVSNRGEPMSLAVLASLFVSLAPTTIAALLPAIG
FT                   IAGMDRLFRRNVIALSGRAIEAAGDANVLLLDKTGTITLGNRMASEFIPVGNHSFEDCV
FT                   WTAMIASIADETPEGKSIMELAKKTLGVRSDALPRNVKVIPFTPETKMSGVEVDGHSYR
FT                   KGAFSAVRDYIQKLGGEVPHQVEVVVAKIAMSGGTPLVVVKDKEVIGVVALKDVLKQGI
FT                   KARLARLRSMGIKSIMITGDNPLTAAAIAKEAGVDDFVAEAKPEDKLKLVKELQAQGYV
FT                   VAMTGDGTNDAPALAQADVAVAMNAGTQAAREAANIIDLDSDPSKLLDIVEVGKSMLIT
FT                   RGTLTTFSIANDIAKYFVIVPASVAPIYPDLNKLNILHLENPYIAILSAVIFNALVIPA
FT                   LTPLALKGAFYKPISPGRLFLYNLLVYGLGGIIAPFVFIKLIYHLIELFVR"
FT   gene            complement(192441..194103)
FT                   /pseudo
FT                   /locus_tag="Hydth_0189"
FT   gene            194179..194538
FT                   /locus_tag="Hydth_0190"
FT   CDS_pept        194179..194538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0190"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: sat:SYN_00807 putative cytoplasmic protein;
FT                   SPTR: Q2LVQ6 Hypothetical cytosolic protein; PFAM: GYD
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44599"
FT                   /protein_id="ADO44599.1"
FT                   /translation="MMLVGHIFNVVKEEGNMGIYVMLTKISPYAVKNLEKLKEIEQHAE
FT                   KLIEENCPGVKWLMNLVVFGPYDYLDIFEASSDEEAAKVAMIIRSFGHATTETWPAIDW
FT                   KDFKSLLDKIKIDYS"
FT   gene            complement(194519..195133)
FT                   /locus_tag="Hydth_0191"
FT   CDS_pept        complement(194519..195133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0191"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI)"
FT                   /note="COGs: COG0135 Phosphoribosylanthranilate isomerase;
FT                   InterPro IPR001240:IPR011060:IPR013785; KEGG: aae:aq_2076
FT                   phosphoribosyl anthranilate isomerase; PFAM:
FT                   N-(5'phosphoribosyl)anthranilate isomerase (PRAI); SPTR:
FT                   A8USH7 N-(5'-phosphoribosyl)anthranilate isomerase; PFAM:
FT                   N-(5'phosphoribosyl)anthranilate (PRA) isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44600"
FT                   /protein_id="ADO44600.1"
FT                   /translation="MVKIKFCGLKRIQDLEKAISLKIDYVGFVLYPKSPRYVSSEELKA
FT                   LVSLSNSVKKVAVMVNPDYQDVKKVLDIGVDLIQLHGEESFDFAKKVGFERVIKAFRVK
FT                   EKIYISQEWRQVHAVLLDTYSQYLYGGTGKTFNWSIAEELVKNGFRIILSGGLTPENVQ
FT                   MAVRKVNPYGVDVSSGIEVQPGTKDHQKMEAFVRAVRSSLS"
FT   gene            complement(195126..195785)
FT                   /locus_tag="Hydth_0192"
FT   CDS_pept        complement(195126..195785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0192"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /EC_number="4.2.1.10"
FT                   /note="COGs: COG0710 3-dehydroquinate dehydratase; InterPro
FT                   IPR001381:IPR018508:IPR013785; KEGG: aae:aq_021
FT                   3-dehydroquinate dehydratase; PFAM: dehydroquinase class I;
FT                   PRIAM: 3-dehydroquinate dehydratase; SPTR: O66440
FT                   3-dehydroquinate dehydratase; TIGRFAM: 3-dehydroquinate
FT                   dehydratase, type I; PFAM: Type I 3-dehydroquinase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44601"
FT                   /protein_id="ADO44601.1"
FT                   /translation="MLIAVPLNDRNFQEGLKACQEAGADMVELRVDMFEKLDVKRIKNL
FT                   IEEVHKVGLKTILTIRSEKEGGTHIENREELFRELSPISDYTDIELSSQDIIPVVRQAV
FT                   KSSGKKLIISYHNFEMTPSDWILREIFREARRWGADIVKVATKANSYQDVARLLCVGHQ
FT                   EEGEKILICMGKMGSVSRLAGFAFGSVISYAFVDEAVAEGQIHLREMVRLRSLFYG"
FT   gene            complement(195788..196993)
FT                   /locus_tag="Hydth_0193"
FT   CDS_pept        complement(195788..196993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0193"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COGs: COG0137 Argininosuccinate synthase; InterPro
FT                   IPR001518:IPR018223:IPR014729; KEGG: aae:aq_1140
FT                   argininosuccinate synthase; PFAM: argininosuccinate
FT                   synthase; PRIAM: Argininosuccinate synthase; SPTR: A8UTT4
FT                   Argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; PFAM: Arginosuccinate synthase; TIGRFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44602"
FT                   /protein_id="ADO44602.1"
FT                   /translation="MLIMSKRVILAYSGGLDTSVMVRWLTEKGYEVITYTADVGQGEEL
FT                   SHIPEKARQAGAVEAIVEDLKEEFAREYCLPTLRALALYEGRYPLSASLSRPLISKKLV
FT                   YYAQKFKADFVAHGSTGKGNDQVRFELSVWALDPNVQVLAPVREWEFKSREEEVEYALK
FT                   HSIPVKVTKEKPYSIDKNLWGVSIECGPIEDILREPPEDAFEWTTSPEKAPDEPEYVEI
FT                   GFEEGLPTSINGKRYEFLSQLISELNTLAGRHGVGRIDMVENRLVGIKSREVYEAPGAT
FT                   LLYLAYRELLSLTTDRFTYHYFLSHVPHEYAKIVYEGLWFSPLREALDAFTSTLSKLVS
FT                   GSVRIKLYKGSAVVVGRSSPNSLYVEELATYSEKDAFDHKAGAAFTKVFGLPLKVLGRV
FT                   RR"
FT   gene            197104..199029
FT                   /locus_tag="Hydth_0194"
FT   CDS_pept        197104..199029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0194"
FT                   /product="protein of unknown function DUF839"
FT                   /note="COGs: COG3211 phosphatase; InterPro IPR008557; KEGG:
FT                   cha:CHAB381_0225 alkaline phosphatase; PFAM: protein of
FT                   unknown function DUF839; SPTR: A6DDD4 Putative
FT                   uncharacterized protein; PFAM: Bacterial protein of unknown
FT                   function (DUF839)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44603"
FT                   /protein_id="ADO44603.1"
FT                   /translation="MKRMIFFSAVLGIGAVSACGGGGGSSAQPIAIDFAPLGIPNTDQE
FT                   HVSYKVTDKLIVTYSDGSKKEFPLSYEVLLQSGDQMGSYKWGQLLDVNAQPMSNIAYTK
FT                   GEISWNPDANSLIKTSDGKYFIITHFEEPPGMLYASELDPNTLKVKSITPIDFSSVGGT
FT                   IINCAGSQTPWNTHLGGEEDYDLNSIYSVSAGGKNPAYVQCTKDSNGYFTGNDVNGKSN
FT                   YFCGYVGGVQRYLKDLNIDPSNGYLGDKFNLYNYGYIVEVAYTNGKWDVAKHYITGKYT
FT                   PEMAVVMPDRKTLYMSDDGDYKGLYKLVLNQPQNGFNKNWCGTLYAAKVKQLSDQNGGT
FT                   FDVSWIELGKACDSEVKAIIDKKPLLTDIFDVEDPSACPTDQGFKLITEDRINECLRLK
FT                   VGQYRSSKFASDDEVKKAAAFLETRKYAAYLGASIEFRKGEGLAYDPDNNVLYYAITEI
FT                   GGSMADGKGDINLPNNMCGAVYRLVLDQNYNAYKMEGIVIGKPINRDPNDPDYQKYGQK
FT                   WACHPDYVANPDNLKYIGYNTLLIGEDTSYHINNMVWAYNVKTGKLTRIAWVPTGAEVT
FT                   GVFAHGLVGNNYTMTLNIQHPFVDTFRNADGNPVNSTYNDQNKDKRKGILGIIKGIPAG
FT                   LLKLTH"
FT   sig_peptide     197104..197184
FT                   /locus_tag="Hydth_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            199031..199466
FT                   /pseudo
FT                   /locus_tag="Hydth_0195"
FT   gene            199513..201357
FT                   /locus_tag="Hydth_0196"
FT   CDS_pept        199513..201357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0196"
FT                   /product="glucose inhibited division protein A"
FT                   /note="COGs: COG0445 NAD/FAD-utilizing enzyme apparently
FT                   involved in cell division; InterPro
FT                   IPR013027:IPR004416:IPR002218:IPR020595; KEGG: aae:aq_761
FT                   tRNA uridine 5-carboxymethylaminomethyl modification enzyme
FT                   GidA; PFAM: glucose-inhibited division protein A; SPTR:
FT                   O66962 tRNA uridine 5-carboxymethylaminomethyl modification
FT                   enzyme mnmG; TIGRFAM: glucose inhibited division protein A;
FT                   PFAM: Glucose inhibited division protein A; TIGRFAM:
FT                   glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44604"
FT                   /protein_id="ADO44604.1"
FT                   /translation="MLVDEFDVVVIGGGHAGIEAALASARMGAKTVMFVLNADTIGQMS
FT                   CNPAIGGIAKGIVVREIDALGGEMGKAIDSTGIQFKMLNTRKGKAVWSPRAQADKKLYR
FT                   EYMKKVCERQENLYIKQDEVVDIIVKDNRVVAVKTKLGLEYKTKTVVVTTGTFLNGTIY
FT                   IGDKTFPAGRAWEPRSEGLAEFYKRHGFPLMRFKTGTPARLDGRTIDYSGLEIAPGDDP
FT                   PPKFSFWTEPVGTYWFPKGKEQINCYITYTTPKTHEIIRKNLHRTALYGGLIKGIGPRY
FT                   CPSIEDKVVKFPDKDRHQVFLEPEGLDTIEVYPNGLSTSLPEEIQWELYRSIPGLENVE
FT                   LIRPAYAIEYDVVPPTELYPTLETKKIRGLFHAGNFNGTTGYEEAAGQGIVAGINAALR
FT                   AFGKEPIYLRRDESYIGIMIDDLTTKGVLEPYRLFTSRSEYRLHLRQDNAILRLSKLGY
FT                   ELGLLTQDQYKIIKELQRQIEEWMSFYKSQRTALAIGSEVKSYTPSQLLTSDFTLDDLK
FT                   TFGFDVPTHPFVKEVVEIELKYEPYMERELKINERLKKLEDVKIPEDLDYDKIQGISKE
FT                   AKEKLKRFRPITVGQASRIDGITPATITSLLAYLGKLD"
FT   gene            201408..201698
FT                   /locus_tag="Hydth_0197"
FT   CDS_pept        201408..201698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0197"
FT                   /product="ferredoxin"
FT                   /note="InterPro IPR006058:IPR001041:IPR012675; KEGG:
FT                   aae:aq_919a ferredoxin; PFAM: ferredoxin; SPTR: A1IJT8
FT                   [2Fe-2S] ferredoxin; PFAM: 2Fe-2S iron-sulfur cluster
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44605"
FT                   /protein_id="ADO44605.1"
FT                   /translation="MAKVKINKKIIEIPVGVRFGELHHEIEKAGVEFGCTDGQCGVCVC
FT                   TVKKGLEYLAEPSEAEEETLWRIGEYDENRRLTCQLVIEKEPPEIIELETD"
FT   gene            complement(201701..201790)
FT                   /locus_tag="Hydth_R0006"
FT   tRNA            complement(201701..201790)
FT                   /locus_tag="Hydth_R0006"
FT                   /product="tRNA-Ser"
FT   gene            complement(201809..203176)
FT                   /locus_tag="Hydth_0198"
FT   CDS_pept        complement(201809..203176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0198"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="COGs: COG0422 Thiamine biosynthesis protein ThiC;
FT                   InterPro IPR002817; KEGG: aae:aq_1204 thiamine biosynthesis
FT                   protein ThiC; PFAM: thiamine biosynthesis protein ThiC;
FT                   SPTR: O67259 Thiamine biosynthesis protein thiC; TIGRFAM:
FT                   thiamine biosynthesis protein ThiC; PFAM: ThiC family;
FT                   TIGRFAM: thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44606"
FT                   /protein_id="ADO44606.1"
FT                   /translation="MLRAEWIERRKHLKNKSQMYLAREGIITEEMRYVAKREGLHPEFV
FT                   RQEVARGRMIIPANINHLHLEPMCIGINSRVKVNANIGNSGLASDIPTEIEKVRVAIKY
FT                   GADTIMDLSTGDAIKETREAVIKESTVPVGTVPIYEALKRAKGQVKNMTVDLILDVIEE
FT                   QAQQGVSYMTIHAGVLREFLPMVQHRVMGIVSRGGAIMAQWMVEHGKQNPLYEHFDQIC
FT                   EIFKKYDVSFSLGDGLRPGAIADASDDAQLSELKVLGELTERAWRHGVQVMVEGPGHVP
FT                   MDQIEFNIKLQQKICHEAPFYVLGPLVIDVAPGYDHIASAIGAAMAGWYGAAMLCYVTP
FT                   KEHLGLPNIEDVKQGVIAYKIAAHAADVAKNWPGAKDWDLEMSKARFAFDWNRQFELAI
FT                   DPETARAYHDETLPQEGYKTAKFCSMCGPEFCAYRISQNVSEKMEEVILQDNWPSP"
FT   gene            203286..204119
FT                   /locus_tag="Hydth_0199"
FT   CDS_pept        203286..204119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0199"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047:IPR011055; KEGG:
FT                   pmx:PERMA_0459 NlpD fragment; PFAM: Peptidase M23; SPTR:
FT                   Q75VW7 Putative lipoprotein NlpD (Fragment); PFAM:
FT                   Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44607"
FT                   /protein_id="ADO44607.1"
FT                   /translation="MREYITIIIAHHEGKPPKTLKIRKSHLKAFVASAVSFCFLSLLSY
FT                   ATSWHLLSERQKLKAEAKKLFEEKKMVLTQKERLNQEKEVMKEKLRAIETKMATVEEYL
FT                   SKRGVIGKTLAVGGASYKDVSYRDVSYLEFLEDRAEYLLSKVKATPLGYPIFGRITSHM
FT                   GWRKNPFGRGYEFHSGIDIEAPIGSKVKATADGVVEFAGRYFDYGKAVIIRHPSGYITL
FT                   YGHLSQIDVKEGQKIKAGDIVGRVGSTGRSTGPHLHYEVIKNNRPINPLDFIAWR"
FT   sig_peptide     203286..203423
FT                   /locus_tag="Hydth_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            204144..205178
FT                   /locus_tag="Hydth_0200"
FT   CDS_pept        204144..205178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0200"
FT                   /product="CoA-binding domain protein"
FT                   /note="COGs: COG0074 Succinyl-CoA synthetase alpha subunit;
FT                   InterPro IPR016040:IPR005810:IPR016102:IPR003781:IPR
FT                   005811; KEGG: aae:aq_1888 succinyl-CoA ligase alpha
FT                   subunit; PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; SMART: CoA-binding domain
FT                   protein; SPTR: Q75VW6 Citryl-CoA synthetase small subunit;
FT                   PFAM: CoA binding domain; CoA-ligase; TIGRFAM: succinyl-CoA
FT                   synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44608"
FT                   /protein_id="ADO44608.1"
FT                   /translation="MERRWKIGTPYLNDSTRIIVMGITGREASQVVAESEALYPGFVVA
FT                   GVTPGKGGSEVAGVPVYNTVREAQERHPEINTGIVYVPPASVKDAVIELIDAGIGVIFI
FT                   ITEHVPIRDTVYFYHYAKERGTIIVGPTSLGCIIPKIPARIGAIGGKDPSVAYADGGLV
FT                   ILSKSGGLTTTTAEMFKRRGWGVYMALALGGDVISCTTFADAIENLADDPNVKGVIIQG
FT                   EVGGSYEEQAAETILRLWKEGRWNKPVAAFVAGRFQESLEGVSFGHAGAIVERGKGKAT
FT                   DKIRAFNEVGKITGLVKVAEFYHDLVHCIEELGVPRDFEDSTPEGKVKPLYSTINEENC
FT                   QFKA"
FT   gene            205189..207678
FT                   /locus_tag="Hydth_0201"
FT   CDS_pept        205189..207678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0201"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG1022 Long-chain acyl-CoA synthetase
FT                   (AMP-forming); InterPro
FT                   IPR009081:IPR000873:IPR006163:IPR002123:IPR 020845; KEGG:
FT                   aae:aq_999 long-chain-fatty-acid CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase; SPTR: A8USH9 Long-chain-fatty-acid CoA
FT                   ligase; PFAM: Phosphopantetheine attachment site;
FT                   Acyltransferase; AMP-binding enzyme; TIGRFAM:
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44609"
FT                   /protein_id="ADO44609.1"
FT                   /translation="MEVDLKKGTVVPRLRERGKTALIHKAKSITYRELIENIKSFAYLL
FT                   DVAPGDKVAIISENRPEWVYALFAVWQRGAIAVPIDFMSSPQEIEYILKETEPSAIFFS
FT                   QSTRAHLLKALENSDKFPQLFEFDSIALPEKKLEHFFQLSLHDTALILYTSGTTGEPKG
FT                   VMLSFKNLLSNIKAIEKLQIATERDITLALLPFHHSYPLMVTLLVPLYIGATVVFLEKL
FT                   SSEELIKALKDYKVTILVGVPRLYQLMQKKVQERISTNPLASILFKLSAYLPKALRKWL
FT                   FWKVHQSLGGHIRFLVSGGAKLPIDTACFFDRLGFTVIEGYGLTETSPIVSFNPPHRVK
FT                   LGSVGVPIEEVYVKIAQDGEIMVRGVNVMQGYFKKPQETEKAFKDGWLLTGDLGYMDED
FT                   GYLYITGRKKEVIVLAGGKNINPEEIENLILSKSDLIKEVGVLEVDGFLHALILPDMEK
FT                   AKKMGILNVREYIKWTVLDRVNRELPEWKRITGFKLTSRELPKTRLGKIRRFLLPRLYS
FT                   EEEKVKEEKLQMPSTKEWEVLSDYLFRLSGRKVSPSDHIEIDLGLDSLAKVELISFIES
FT                   AFGVKIDEEELLSHSLIHELVSLISEKKEKIEIAQVDWGTILRSAPPYRLEHYPLVFGL
FT                   GRLLLLLFFKFYNRLEVKNSEYLPNPPFILASNHASYLDGFVLAASLPHSMAQNTYFLG
FT                   EEAYFRNPITSTFGRLAHVITVNLDKKLKESLQKTAWALRLGKAVVIFPEGARTRDGKL
FT                   LPFKKGFAVLSKELNVPVLPVALVGTYDSMSLRDRFPKPKKIKVIFGKPIHPEGRSYEQ
FT                   IVEETRRSIEELMREGR"
FT   gene            207675..208076
FT                   /locus_tag="Hydth_0202"
FT   CDS_pept        207675..208076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0202"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG0824 thioesterase; InterPro
FT                   IPR006684:IPR006683:IPR008272; KEGG: aae:aq_1494
FT                   hypothetical protein; PFAM: thioesterase superfamily
FT                   protein; SPTR: A8USI2 Putative uncharacterized protein;
FT                   PFAM: Thioesterase superfamily; TIGRFAM: conserved
FT                   hypothetical protein TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44610"
FT                   /protein_id="ADO44610.1"
FT                   /translation="MKHTYVRRVQFYETDAQGIVHHSNYFKYFEEARGDLLRSVGLAYS
FT                   QLRKEGYEVVLLEAFCKYKKPLVYDEEVHIEVSLTHMDRFTFSFDYRVVVQRELRATAY
FT                   TKHCLLKNSKLYSIPDKIKEVLTYGRKDT"
FT   gene            208057..209235
FT                   /locus_tag="Hydth_0203"
FT   CDS_pept        208057..209235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0203"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701:IPR016196; KEGG: ttr:Tter_1554
FT                   major facilitator superfamily MFS_1; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: A8UT57 GTP-binding
FT                   protein LepA; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44611"
FT                   /protein_id="ADO44611.1"
FT                   /translation="MEEKTLKKRAYRIVLLFGIVSLLADLTYEGARSIVGPYMSLLGAS
FT                   AFAVSFIAGLGEFVGYALRLVFGYLADRTRLYWGITITGYLINLFSVPLLALAPSWQWA
FT                   GFLLLLERMGKSVRAPSRDALLSFATKRMGHGLGFGVHEFFDQIGALSGPLLVSAVMFL
FT                   TGNYRLAFALLGVPAFMALLTLIYTRISYTESVKKDAEEERDQLKSTFFLYILASSLVA
FT                   MGYADFALMAYHIKTSALLPDGWVPLLYAAAMGVDAIFALLFGVLFDRIGFYALMLGVL
FT                   LASPFSLFAFSLSVPAVCIGIALWGLGMGIQESIMRSAIAKLTPPQARGKAFGIFHFFY
FT                   GLFWFIGSAILGYLYQVSLAYLMTFSVLCQIISLVPLFILSKRVSATYRSSG"
FT   sig_peptide     208057..208128
FT                   /locus_tag="Hydth_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(209163..209822)
FT                   /locus_tag="Hydth_0204"
FT   CDS_pept        complement(209163..209822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0204"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="COGs: COG1211
FT                   4-diphosphocytidyl-2-methyl-D-erithritol synthase; InterPro
FT                   IPR001228; KEGG: aae:aq_1323 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; SPTR:
FT                   A8URK9 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; TIGRFAM: 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; PFAM: Uncharacterized
FT                   protein family UPF0007; TIGRFAM: 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44612"
FT                   /protein_id="ADO44612.1"
FT                   /translation="MISVILLSAGEGRRFGRKKQFVELAGKPIYLHSLEKVIGRFEDIL
FT                   LVLPEEDIERVKVPSGVRKVKGGKERQDSVLEGLLHAKGEIVVIHDCARPLADAKLFEK
FT                   VCKLNDYHGKITAVPSRDTLKEVAGHMVIKTIDRSNVWLSQTPQAFVRKVLLECHFKAR
FT                   NEGFYATDDAALLERYGFKVGVVEGSFWNIKITYPEDLYVAETLLERMKRGTKEMI"
FT   gene            complement(209819..210169)
FT                   /locus_tag="Hydth_0205"
FT   CDS_pept        complement(209819..210169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_2063 hypothetical protein; SPTR: A8URL0
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44613"
FT                   /protein_id="ADO44613.1"
FT                   /translation="MMVMSVRHQVRGYVEKLFEGLKEKLHGGEYLVFNVYAKEGNILEM
FT                   VDVRVDFSDGEAIKKFLDRTTRETLEQEVKGLRLIAMVLEKDGDYVFSSQEEISEELKE
FT                   EIKEMIEQLKEE"
FT   gene            210257..210829
FT                   /locus_tag="Hydth_0206"
FT   CDS_pept        210257..210829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0206"
FT                   /product="Protein of unknown function DUF2168"
FT                   /note="COGs: COG4752 conserved hypothetical protein;
FT                   InterPro IPR019230; KEGG: aae:aq_054 hypothetical protein;
FT                   PFAM: Protein of unknown function DUF2168; SPTR: O66466
FT                   Uncharacterized protein aq_054; PFAM: Uncharacterized
FT                   protein conserved in bacteria (DUF2168)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44614"
FT                   /protein_id="ADO44614.1"
FT                   /translation="MINQNVFIALLHYPALDRHGKIIVTSFTTMDLHDIARPSRAYEIN
FT                   TYYIVQPVDGQRLVIKKQLDYWLSEEGKRTNPTRNEIVQLVKLMYTFEEVVEDITNIRG
FT                   KRPVIVGTDARNYPNAVSYEFLRREIENRDRDFLIVFGTGYGIPPDLMATFDYVLEPIY
FT                   GAGDWNHLSVRNAVAIILDRLLSKNRC"
FT   gene            210831..211910
FT                   /locus_tag="Hydth_0207"
FT   CDS_pept        210831..211910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0207"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferas
FT                   e"
FT                   /EC_number="2.7.8.13"
FT                   /note="COGs: COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N- acetylglucosamine-1-phosphate
FT                   transferase; InterPro IPR003524:IPR018480:IPR018481; KEGG:
FT                   aae:aq_053
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   Glycosyl transferase, family 4, conserved region;
FT                   Phospho-N-acetylmuramoyl-pentapeptide transferase,
FT                   conserved site; SPTR: O66465
FT                   Phospho-N-acetylmuramoyl-pentapeptide-transferase;
FT                   TIGRFAM:phospho-N-acetylmuramoyl-pentapeptide-trans ferase;
FT                   PFAM: Glycosyl transferase family 4; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44615"
FT                   /protein_id="ADO44615.1"
FT                   /translation="MLYHLSLWLKDHFFAFNVFKYITFRSLSAVIVAFLITLIITPIFV
FT                   KKMKALQRLFKGYIREYTPEGHLTKRYIPSMGGFVIVLSLLLSSLLLMRLDLAYFWIIT
FT                   FCTLSFAFIGFADDYVKLRNKKGISARVKLTAQVLVSFITVMLIHTFTEVNTKLYFPLF
FT                   KDLQIDLGIFYIPFAVLVIIATSNAVNLTDGLDGLAIGPVMTAAASLGTVSYVVGHYTL
FT                   SKYLNIPYVPYAGDLTVLCFAIVGAGLGFLWFNAYPAQLFMGDVGSLSLGATLGVIALI
FT                   SKSELLLPIAGGIFVFETLSVILQVAYFKLTGGKRLFRMAPFHHHLELSGMPEPKIVVR
FT                   MWIISLLLGILTVSTLKLR"
FT   gene            complement(211897..212901)
FT                   /locus_tag="Hydth_0208"
FT   CDS_pept        complement(211897..212901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0208"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="COGs: COG1522 Transcriptional regulators; InterPro
FT                   IPR019888; KEGG: pmx:PERMA_0311 transcriptional regulator,
FT                   AsnC/Lrp family; SMART: Transcription regulator, AsnC-type;
FT                   SPTR: A8UXD0 Putative transcriptional regulator, AsnC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44616"
FT                   /protein_id="ADO44616.1"
FT                   /translation="MGNEFDKILKIIQKDIPLVKEPFSVLAQEVGIEEGKLLKTIEKLV
FT                   EDGIVRHIAPIYDSRLLGYDSALIAFKVDRQKLEEVANFVNACPGVSHNYERTHDFNLW
FT                   FTLAVPPEISELEDVVRLMAERERVKDYLVLRVVRLFKIGVKLDYESPAEKESVDTKVY
FT                   TYTPLTEEEKRIVSITQGSFPLVERPFLEYAKRLRMSEEELLEKLSALKERGVLRRISA
FT                   VLYHRRAGYVANAMSVWEVPEDAIEEVGRYIAGFKGVSHCYQRTTSEKFRYNLFAMMHG
FT                   KGQEEIKLLAETISREKALSKYALLFSTREFKKVRIKYFSEEFERWFKELISA"
FT   gene            212919..213374
FT                   /locus_tag="Hydth_0209"
FT   CDS_pept        212919..213374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0209"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="COGs: COG1959 transcriptional regulator protein;
FT                   InterPro IPR000944; KEGG: aae:aq_268 hypothetical protein;
FT                   PFAM: protein of unknown function UPF0074; SPTR: A8UXB1
FT                   Putative uncharacterized protein; TIGRFAM: transcriptional
FT                   regulator, Rrf2 family; PFAM: Transcriptional regulator;
FT                   TIGRFAM: rrf2 family protein (putative transcriptional
FT                   regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44617"
FT                   /protein_id="ADO44617.1"
FT                   /translation="MIYSETVKYALLALAYLALNRDRLVKVEEIAEAQKIPKPFLSKIF
FT                   HKLARERVLRSYKGPTGGFALAVPPEQITIMDVIRYLDEDYKLDYCALRPGRCEEWQVS
FT                   PCRVHEKWTRLRDTIMDYLNNTTIAELAEVEEKHRHEKPVQLEKFSK"
FT   gene            complement(213367..215472)
FT                   /locus_tag="Hydth_0210"
FT   CDS_pept        complement(213367..215472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0210"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="COGs: COG1328 Oxygen-sensitive
FT                   ribonucleoside-triphosphate reductase; InterPro
FT                   IPR012833:IPR005144; KEGG: hya:HY04AAS1_1401 anaerobic
FT                   ribonucleoside triphosphate reductase; PFAM: ATP-cone
FT                   domain protein; PRIAM: Ribonucleoside-triphosphate
FT                   reductase; SPTR: B4U5P6 Anaerobic
FT                   ribonucleoside-triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase; PFAM: ATP cone
FT                   domain; TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44618"
FT                   /protein_id="ADO44618.1"
FT                   /translation="MLRIGGVEELKRKVERELPLVVKRDGILVPFDRSRIQRAMFKAFK
FT                   AVGEFVEQSILDELVEDVVTKVLSLGKQRVHVEEIQDLVEETLILHGFAKTAKAYILYR
FT                   KRREELRDISNAIVDAERVVQEYIHKQDWRVQENANASYSFSGLMLHTAGTVIAHYMLT
FT                   HVYPEKIAKAHREGDFHIHDLSHGIVGYCAGWSLEDLLRKGFRGGYGKVTAGPAKHLSS
FT                   LLGQIVNFLGCTQMEFAGAQALNSVDTYLAPFVRVDKLSYEEVKQLIQQLVFSLNVPSR
FT                   WGSQAPFINFSFDWTVPEDMKERPVIIGGVERPDIGYYGDFQKEMDIINRAFLEVMMEG
FT                   DYMERIFSFPIPTYNITPDFVWESPNARLLWRITAKYGIPYFQNFISSSLKPGDVRSMC
FT                   CRLQLDLRELRSRMGGLFGSADKTGSIGVVTINLPRIAYLSKDEEEFLARLSHLMELAR
FT                   ESLEIKRKVIERNLKKGLMPYTREYLDSFDTFFSTIGLIGMNEACLNLLGVSIAEKEGR
FT                   DFAIKVLKFMREKLADFQEQTGHLYNLEATPAEGTSYRLAKIDKAKFPDIITAGEKEPY
FT                   YTNSTHLPVGLTDDPFEVLEHQKDLQVLYTGGTVIHFFLQESPNELAVANFVKKVLELY
FT                   PVPYITITPTFSVCEDHGYIRGEHFTCPECGKPAEVYSRVVGYYRPVQRWNRGKQEEFK
FT                   DRLEYVI"
FT   gene            215625..216857
FT                   /locus_tag="Hydth_0211"
FT   CDS_pept        215625..216857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0211"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="COGs: COG0621 2-methylthioadenine synthetase;
FT                   InterPro IPR005839:IPR006467:IPR013848:IPR007197:IPR
FT                   006638; KEGG: aae:aq_474 hypothetical protein; PFAM:
FT                   Protein of unknown function UPF0004 ; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; SPTR: O66772
FT                   Putative methylthiotransferase aq_474; TIGRFAM: MiaB-like
FT                   tRNA modifying enzyme; RNA modification enzyme, MiaB
FT                   family; PFAM: Radical SAM superfamily; Uncharacterized
FT                   protein family UPF0004; TIGRFAM: MiaB-like tRNA modifying
FT                   enzyme; RNA modification enzyme, MiaB family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44619"
FT                   /protein_id="ADO44619.1"
FT                   /translation="MRGVAFFTLGCRSNEFDTHFIAHQFQLKGYQVVDFDKADIYVINT
FT                   CSVTAGAERSSRQAIYRAKRLNPNSLVVVTGCYAQINPQALSELKEVDLVVGNTHKRDI
FT                   LRIVEEYLSERKGKVYVDNVFRQNSVESFELITYFEKVRPFVKVQEGCNRFCSFCVIPF
FT                   ARGKSRSVLKEKVLKEAELLAERGFKEIVLTGTQLTQYGWDIATDLCDLLKDLVKIRGI
FT                   ELIRLSSLYPSEISQKLLDFVLLEEKIAPHFHLPLQSGSDRILQLMRRDYSVKDYVHLV
FT                   EKVIEKRPLSSVGTDVIVGFPSESDKDFEETYKLLSQLPIHYMHVFPYSDREGTKACKM
FT                   SRKVSQKVKKERVKTLKSLDQQKRAEFLKKNEGKELRALVIEENMLLTENYLNLEREGY
FT                   TSIGELVRVKV"
FT   gene            complement(216980..217717)
FT                   /locus_tag="Hydth_0212"
FT   CDS_pept        complement(216980..217717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0212"
FT                   /product="protein of unknown function DUF140"
FT                   /note="COGs: COG0767 ABC-type transport system involved in
FT                   resistance to organic solvents permease component; InterPro
FT                   IPR003453; KEGG: aae:aq_355 hypothetical protein; PFAM:
FT                   protein of unknown function DUF140; SPTR: O66681 Putative
FT                   uncharacterized protein; PFAM: Domain of unknown function
FT                   DUF140; TIGRFAM: conserved hypothetical integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44620"
FT                   /protein_id="ADO44620.1"
FT                   /translation="MLRVIEEVGRGVILTLMGIYFMFVNPPKLRHFISQLAYLGAETVP
FT                   VVVITSIFSGGVIALQTYSTFHRFNAEFLIGAVVAISMGRELGPVLASLMVVARVGSAM
FT                   TASIGTMRITEQIDALEVMGINPVSYLVSPRVFAGVLGVPMLVILADIAGVFGGWFVAV
FT                   KLFGVNEYLFWEKMRDIAEFYDFIGGLYKAVFFGLIISAVSCYFGFYTGGGTEGVGRAT
FT                   TNSVVVSSMLILISDYFLTAIIF"
FT   gene            complement(217701..218864)
FT                   /locus_tag="Hydth_0213"
FT   CDS_pept        complement(217701..218864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0213"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="COGs: COG0082 Chorismate synthase; InterPro
FT                   IPR000453:IPR020541; KEGG: aae:aq_081 chorismate synthase;
FT                   PFAM: chorismate synthase; PRIAM: Chorismate synthase;
FT                   SPTR: A8UVY6 Chorismate synthase; TIGRFAM: chorismate
FT                   synthase; PFAM: Chorismate synthase; TIGRFAM: chorismate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44621"
FT                   /protein_id="ADO44621.1"
FT                   /translation="MPIRFLTAGESHGKAVVCILEGIPANLDISTEYINRELERRQRGY
FT                   GRGGRMKIEKDSVEILSGVRFGKTLGSPIAMLVQNRDWENWQEKMAIEGKRPEGAVPFT
FT                   RPRPGHADLVGGIKYNQRDLRNVLERASARETVGRVAVGTVCKRFLEELGIKIGSYVVS
FT                   IGKCSPPLKEQDLLRRHELAESSSVRFPDPTKDEEFMKVIDEAREKGESLGGIFEVFAV
FT                   GVPPGLGSHIQWDKRIDGRIAQAILSIHAIKGVEFGLGFEAGRRFGSEVHDEIGWSEKD
FT                   GYFRYSNHLGGTEGGMTNGMPLLVRAVMKPIPTLTKPLRSVDIETKEEVRAGKERSDVV
FT                   AVPAASVVAEAMLAIVLADALLEKLGGDFMEEVKERYERYLRHVKSY"
FT   gene            complement(218864..219064)
FT                   /locus_tag="Hydth_0214"
FT   CDS_pept        complement(218864..219064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0214"
FT                   /product="ribosomal protein L28"
FT                   /note="InterPro IPR001383; KEGG: hya:HY04AAS1_0071
FT                   ribosomal protein L28; PFAM: ribosomal protein L28; SPTR:
FT                   A8UVY5 S-adenosylmethionine decarboxylase proenzyme;
FT                   TIGRFAM: ribosomal protein L28; PFAM: Ribosomal L28 family;
FT                   TIGRFAM: ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44622"
FT                   /protein_id="ADO44622.1"
FT                   /translation="MARCYVCGKTTKFGKSVTFSAERNSRTFKPNLHKMRVRLNNGTVK
FT                   RVYVCAKCLKAGKVVKAVRTG"
FT   gene            complement(219086..219370)
FT                   /locus_tag="Hydth_0215"
FT   CDS_pept        complement(219086..219370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR019760; KEGG: gbm:Gbem_3031 hypothetical
FT                   protein; SPTR: C1I3M4 Putative uncharacterized protein;
FT                   PFAM: Uncharacterized protein conserved in bacteria
FT                   (DUF2325)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44623"
FT                   /protein_id="ADO44623.1"
FT                   /translation="MRLVILGGHDRLKSKVEEMAKRYRLSIKFINQETQQNIDSALACA
FT                   DWVIVFTSLSGHNMVKLAKKYAKDRCIFCHSHGVCSLEKKIKELVNEVK"
FT   gene            219566..220051
FT                   /locus_tag="Hydth_0216"
FT   CDS_pept        219566..220051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0216"
FT                   /product="Sterol-binding domain protein"
FT                   /note="COGs: COG3255 Putative sterol carrier protein;
FT                   InterPro IPR003033:IPR016083; KEGG: aae:aq_026 hypothetical
FT                   protein; PFAM: Sterol-binding domain protein; SPTR: O66445
FT                   Putative uncharacterized protein; PFAM: SCP-2 sterol
FT                   transfer family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44624"
FT                   /protein_id="ADO44624.1"
FT                   /translation="MKWVMLSFLGIVGSSFAVPVFMDGEYAKAFCDAWNKTPQLVEELG
FT                   KSESWTAVPERKIFMYREDCGEAKQIQLTIKNEQGKAVCVYGGPAKDKRGPNDFLMYAQ
FT                   TQRWLEMGKGEYGPMKAMMFGRLKFEGPKFVAMKNMGPFEAFLKLIDKPPHDASRCP"
FT   sig_peptide     219566..219616
FT                   /locus_tag="Hydth_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(220052..220777)
FT                   /locus_tag="Hydth_0217"
FT   CDS_pept        complement(220052..220777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0217"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="COGs: COG0101 Pseudouridylate synthase; InterPro
FT                   IPR001406:IPR020097:IPR020103:IPR020094:IPR 020095; KEGG:
FT                   aae:aq_749 pseudouridine synthase I; PFAM: Pseudouridine
FT                   synthase I, TruA, alpha/beta domain; PRIAM:
FT                   tRNA-pseudouridine synthase I; SPTR: A8UYA7 Pseudouridylate
FT                   synthase; TIGRFAM: tRNA pseudouridine synthase A; PFAM:
FT                   tRNA pseudouridine synthase; TIGRFAM: pseudouridylate
FT                   synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44625"
FT                   /protein_id="ADO44625.1"
FT                   /translation="MPNYVLLLSYVGTNFHGWQVQPNLRTVQGVIKESLEKVFREDIKL
FT                   VGCCRTDAGVHAKEYVANFYAKKEMEPYKLLKALNSLLPEDVGIKRVWVQEGFNARYSV
FT                   RGKVYVYRVLNSFSRDAFIEPFAWRVPQKLDLSKMQKACELLAGRRDFSAFAKKEEEDK
FT                   NTVIDLEEVRLSKVEDLIEISFRARSFLRYMVRRMVGCMVQIGLGRINLSHLEEYLSNR
FT                   KTCPYTAKAKGLTLEKVLL"
FT   gene            220799..221428
FT                   /locus_tag="Hydth_0218"
FT   CDS_pept        220799..221428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0218"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="InterPro IPR001633; KEGG: dal:Dalk_3411 diguanylate
FT                   phosphodiesterase; PFAM: EAL domain protein; SPTR: B8FLF3
FT                   Diguanylate phosphodiesterase; PFAM: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44626"
FT                   /protein_id="ADO44626.1"
FT                   /translation="MLYIGDDKNLKVYAVLENVVEIETGNLYGYRLVSRIIYGNEEGSF
FT                   AEVANRELKMRIEMAVLEAVRSANKSGVIFVNLPVSVNIESLPLYGKNVVVNLPMGMGL
FT                   KNLYIYRSRIKRCGLGTALDDFTTIGYELREIMFGAFDYVFFSDSFYTNANKKDLKKAV
FT                   ELVKYYGSKVCFKKIDTTSKLEMARSVGAQLGHGFLFGYEQIKAQL"
FT   gene            221425..221853
FT                   /locus_tag="Hydth_0219"
FT   CDS_pept        221425..221853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0219"
FT                   /product="TPR repeat-containing protein"
FT                   /note="COGs: COG3063 Tfp pilus assembly protein PilF;
FT                   InterPro IPR019734:IPR013026:IPR013105:IPR001440:IPR
FT                   011990; KEGG: saf:SULAZ_0559 fog:tpr repeat protein; PFAM:
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Tetratricopeptide repeat; SPTR:
FT                   C1DTW3 Fog:tpr repeat protein; PFAM: Tetratricopeptide
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44627"
FT                   /protein_id="ADO44627.1"
FT                   /translation="MKKVLVFILSFAFSCAMPRVIVLDDPLTAEEHLNLGYIYERKGEL
FT                   KPAKEEYEKALQKDKNMWKAHFNLGNVYAKMEDYAKAEREYKRALELKPNDPDILNNLA
FT                   WVLYKQGRKEEALLLIKKAISIDDREEYRNTLREIEGS"
FT   sig_peptide     221425..221490
FT                   /locus_tag="Hydth_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(221850..223160)
FT                   /locus_tag="Hydth_0220"
FT   CDS_pept        complement(221850..223160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0220"
FT                   /product="signal recognition particle protein"
FT                   /note="COGs: COG0541 Signal recognition particle GTPase;
FT                   InterPro IPR004780:IPR013822:IPR000897:IPR004125:IPR
FT                   003593; KEGG: aae:aq_1720 signal recognition particle
FT                   receptor protein; PFAM: GTP-binding signal recognition
FT                   particle SRP54 G- domain; GTP-binding signal recognition
FT                   particle SRP54 helical bundle; Signal peptide binding
FT                   (SRP54) M- domain protein; SMART: AAA ATPase; SPTR: A8UQV4
FT                   Signal recognition particle receptor protein; TIGRFAM:
FT                   signal recognition particle protein; PFAM: SRP54-type
FT                   protein, GTPase domain; SRP54-type protein, helical bundle
FT                   domain; Signal peptide binding domain; TIGRFAM: signal
FT                   recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44628"
FT                   /protein_id="ADO44628.1"
FT                   /translation="MLDLLTERFSKSLSKLRGVRKLTEKQVNDILRDIRMALLEADVDY
FT                   DVVKSFLKKVRDRAINEDIKNKLSPADSVVLTVYEELTSILGGEKADLKRGVVIFVGLQ
FT                   GTGKTTTIGKLANFLKNQSFKVAVSSTDVRRPAAMLQLQRLAEKVGVPYYSFDEASPVE
FT                   IATKALERAKKEGVDYLLIDTAGRLHIDEELMEELKRIKEAVKPSEVIYVADAMQGQEA
FT                   LRALKAFHESITLTGVILTKMDGDARGGVALSVKEAIGVPIKFVGVGEKLEDIEIFYPD
FT                   RIAQRILGLGDLQSLIEKAQQIIPEDEAQVLATRIMMGEFDLEDMLKQIRFIKSMGPLE
FT                   KILGMIPGVSAELKNLKIDEKKFKKTEAIILSMTKEERRNPKIINMSRKVRIAKGSGTS
FT                   VGDVNKVLKEYEEMKKMIKRLKGMQGIPKLPRFPFKF"
FT   gene            complement(223200..223811)
FT                   /locus_tag="Hydth_0221"
FT   CDS_pept        complement(223200..223811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_0051 MjaVIP; SPTR: C1DXD6 MjaVIP"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44629"
FT                   /protein_id="ADO44629.1"
FT                   /translation="MDADEKEVRRKRQREVSLVGEAIEKRIMQILAQDNKIREECIIGH
FT                   GPAQAVRAETFVLRDFERDESVELPHLILSVKYTRETGEEVYMYMDADIVIYHKLSRRI
FT                   VCVISSKKSFRERGAQSAYWSLKKTGRDFKYIIVTPDSDFELYNPDNPYKQAKWRTILE
FT                   NEMAAVFVIDKGPPFKSRNFYVGNDHLKNCIRELLLSQTF"
FT   gene            223883..224839
FT                   /locus_tag="Hydth_0222"
FT   CDS_pept        223883..224839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0222"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="COGs: COG0863 DNA modification methylase; InterPro
FT                   IPR001091:IPR002941:IPR017985; KEGG: saf:SULAZ_0052
FT                   modification methylase MjaVI (N-4
FT                   cytosine-specificmethyltransferase MjaVI) (M.MjaVI); PFAM:
FT                   DNA methylase N-4/N-6 domain protein; SPTR: C1DXD7
FT                   Modification methylase MjaVI (N-4
FT                   cytosine-specificmethyltransferase MjaVI) (M.MjaVI); PFAM:
FT                   DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44630"
FT                   /protein_id="ADO44630.1"
FT                   /translation="MKYLRKKDFKETKVRILTALYERLKELSIEKGVSLNVLFNKALES
FT                   FLREQEKEDATEAIEKQNLFYDDGQIRLLLNDFLKVDLEELRGKVNLIVTSPPYNVGME
FT                   YGTIDDSMGYEEYLRFTERYLKRFYQLLADDGRVCLNIPLDKNKGGIQSVYADVVCLAK
FT                   KVGLKYQSTIVWNEQNISRRTAWGSWLSASAPYIIAPVEMVVLLYKEDWKRRDRGKTTI
FT                   SREEFIEWTNGMWTFPGENRKALGHPAPFPLELPLRCIKLFSYEGDLVLDPFVGSGTTM
FT                   VACRKLNRKGVGIDINKNYLKLAVKRIKEVSPAMFSW"
FT   gene            complement(224904..225845)
FT                   /locus_tag="Hydth_0223"
FT   CDS_pept        complement(224904..225845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0223"
FT                   /product="thioredoxin reductase"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR000103:IPR013027:IPR005982:IPR008255; KEGG:
FT                   hya:HY04AAS1_0622 thioredoxin reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: B4U848 Thioredoxin reductase;
FT                   TIGRFAM: thioredoxin reductase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; TIGRFAM:
FT                   thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44631"
FT                   /protein_id="ADO44631.1"
FT                   /translation="MLEISEDVLYDCIIIGGGPAGLTAGLYTARAKLNTLLLEKGTIGG
FT                   QIAITDLVENYPGFPEGISGKELSLRFKQQAERFGLKVAKAEATKIEKSGKEVFVHLRD
FT                   GRMLRAKTLIVASGSNPRKLGVPGEDKFLNRGVSYCATCDGALFDGLPIAVIGGGDSAT
FT                   QEALFLTRFGSIVYLIHRRDQLRAQKHLQEKVFSNPKIKFIPDTVVEEISGNEFVEKLI
FT                   LKNTKSGEVSELEVEGVFIFIGLEPNTGFLKGSVELDEKGYVITDEKMMTSLEGVFAAG
FT                   DCRSGSTGQVAVAVGEGCIAGMQAEKYIEDNF"
FT   gene            complement(225845..226171)
FT                   /locus_tag="Hydth_0224"
FT   CDS_pept        complement(225845..226171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0224"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterPro IPR006662:IPR005746:IPR017936:IPR013766:IPR
FT                   012336:IPR017937:IPR012335; KEGG: aae:aq_1916 thioredoxin;
FT                   PFAM: Thioredoxin domain; SPTR: A8USM8 Thioredoxin;
FT                   TIGRFAM: thioredoxin; PFAM: Thioredoxin; TIGRFAM:
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44632"
FT                   /protein_id="ADO44632.1"
FT                   /translation="MAGGVIVLTESNWHAEVINSDKPVVVDFWAPWCGPCRIIAPIIEE
FT                   LAMELGDKVKFGKLNTDENPNIAMQYGIRAIPTIMLFSKGEIADTRIGVQPKEALKQMI
FT                   LSHI"
FT   gene            complement(226173..226460)
FT                   /locus_tag="Hydth_0225"
FT   CDS_pept        complement(226173..226460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0225"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845:IPR011991; KEGG:
FT                   hya:HY04AAS1_0620 transcriptional regulator, ArsR family;
FT                   PFAM: regulatory protein ArsR; SMART: regulatory protein
FT                   ArsR; SPTR: A8USM9 Transcriptional regulator, ArsR family
FT                   protein; PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44633"
FT                   /protein_id="ADO44633.1"
FT                   /translation="MVEVVSEEKLEAWAEFLKALAHPIRLRIISVLIEGRQCVKNLSEL
FT                   LHTSQPNVSQHLGILRNKGIVGCKRDGSIVCYYIKDERVLEIYKILSKEV"
FT   gene            226571..228595
FT                   /locus_tag="Hydth_0226"
FT   CDS_pept        226571..228595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0226"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="COGs: COG1452 Organic solvent tolerance protein
FT                   OstA; InterPro IPR007543; KEGG: hya:HY04AAS1_0437 organic
FT                   solvent tolerance protein; PFAM: Organic solvent tolerance
FT                   protein; SPTR: A8UV29 Organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44634"
FT                   /protein_id="ADO44634.1"
FT                   /translation="MILSASYAFCLEILSDYLERLPDETVIAEGNVQAYYEKYYIEADY
FT                   VKYHPKSREVYAEGNVYVKSLDGRMEAWAKVAFLNLKEDSGYFIDSHGRFEKFYLKAQR
FT                   VDKDREVYTVQKGDITTCPPDKKEMTLCFSHAKVTDKYVFSYSNSLRLFSVPLAYLPLS
FT                   VFPVGERRSGLLPPLLGSNTYNTFIYQQPVYWAISQDKDTTLTFDIRDKQASGFSLEYR
FT                   QAISHKKDLQGAVSIYKEPTPPGKWWEGRDLTTFRENRYRLKFDLDLGDFQTGLDTISD
FT                   PYLLQDVYLHTKEKTVPYLTSYVSYKKDADKFLFTFNARKFYDTTSPNNKQTLQRLPEI
FT                   GIYYKDTPVFKDLYFNATLAYTNFYREEGPRASRIIFFPELSLPVNFLGRTFYSSFTFE
FT                   NGIYLSSNLSGTDKSFSTVHFVERLPLFFDRRWGKTDFKNVFEVVYSYRPKGYNNPRFD
FT                   TLDNIDKENQIKFVLRNYTAYDGRLLLSWYLEGGYSFLGSFSYAPFQYLLSLPFAGQQL
FT                   STTFNKTVVNKNLMPIRSIVSLSPLPFLSLSSDTLYDPNSSRFLNNTSYLSLNLKNSNI
FT                   TLGYVASKDFFGNRLTDQTLLSANTLYKHMNINLGVVHDNRINKDLLRQLRLDYTGACW
FT                   SLGVLLRDTYDGNRKKYIKEVFLAFNVFDLQRFTLPLKR"
FT   gene            complement(228573..229241)
FT                   /locus_tag="Hydth_0227"
FT   CDS_pept        complement(228573..229241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0227"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="COGs: COG0036 Pentose-5-phosphate-3-epimerase;
FT                   InterPro IPR000056:IPR011060:IPR013785; KEGG: aae:aq_968
FT                   ribulose-5-phosphate 3-epimerase; PFAM: ribulose-phosphate
FT                   3-epimerase; PRIAM: Ribulose-phosphate 3-epimerase; SPTR:
FT                   O67098 Ribulose-phosphate 3-epimerase; TIGRFAM:
FT                   ribulose-phosphate 3-epimerase; manually curated; PFAM:
FT                   Ribulose-phosphate 3 epimerase family; TIGRFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44635"
FT                   /protein_id="ADO44635.1"
FT                   /translation="MKLLAPSILSADFWHLGKQVEAVIRGGADLIHFDVMDGHFVPNIT
FT                   FGPVLLESIKNHCNLLLDAHLMIDNADMYIPEFVKAGADWISVHIENNPHIHRTLQLIK
FT                   DLGAKAGVAINPGTSLSAIEEALHYADFVLLMSVNPGFGGQRFIERSIERLRRLRQMVD
FT                   SINPSILIEIDGGIKLENLEEVALAGADVFVIGSGIFSSDNVEEQTRRIKRKLISLEEV
FT                   "
FT   gene            229373..229638
FT                   /pseudo
FT                   /locus_tag="Hydth_0228"
FT   gene            complement(229646..231520)
FT                   /locus_tag="Hydth_0229"
FT   CDS_pept        complement(229646..231520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0229"
FT                   /product="protein of unknown function DUF87"
FT                   /note="COGs: COG0433 ATPase; InterPro
FT                   IPR001736:IPR002789:IPR003593; KEGG: aae:aq_1852
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF87; phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; AAA ATPase; SPTR:
FT                   A8UV25 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function DUF87; Phospholipase D Active site motif"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44636"
FT                   /protein_id="ADO44636.1"
FT                   /translation="MTEGELIKKLEEATLSAQESIKIVSAWIKGDILENLLKGIKDGVK
FT                   VEVFVRAGERKDMEITDFRVFRAVRSVRGRIYLNPRLHAKFLIIDDRRAFVGSANLTYA
FT                   GAHQENFEAVVEITQPEKIEELLSLYENLKKESEELNPNTVAIVISSENSLSSRALLLE
FT                   EIPQQCFLKTPTERGIMLCKLTSVKTVSLDEGVFLGRNKDKDWILAFVKAYANEIGDVK
FT                   IGELRVLCEYKKVREEEKESYFGVPLVPLPVGTQLFKMEEEDPDMQRVMSMNLSGYPME
FT                   KKAYVGRLLNTNLNVYLDITKISSMHMAVIGTTGAGKTTFVRRLIEHLGSDEVKFFVID
FT                   IFGEYYEKLMVDKERIEYIKLPYTLFPIHTDDLKDLFKSYGVDIGERSLEEKTFFMTLR
FT                   RSLKPDLELISYKEKSLEELLLLSAPPSLRSEVEDFLTILKRDFGDSSIKNQVDIYHML
FT                   KKGLYSDKDIVLYDLKDVLNLDARINIVGLLMKEIFILSRLDGKRRIIVLEEAHNFVPE
FT                   RGALDIPFGRENISYTMTKRIALEGRKFGVGLIAITQRPANISKYVLSQLNTQAIFRLI
FT                   TKNDLDAVSVFFEESQLELLRVLPSLRPGTLFLNGLAVPFGMLVSIEL"
FT   gene            complement(231517..231996)
FT                   /locus_tag="Hydth_0230"
FT   CDS_pept        complement(231517..231996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0230"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: aae:aq_1482
FT                   hypothetical protein; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: A8UXW1 Putative uncharacterized
FT                   protein; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44637"
FT                   /protein_id="ADO44637.1"
FT                   /translation="MKKQALEFSIEKASEKDIHELAQVYLKGYKGLEEYSYTHIDDVIA
FT                   YLNWLFRRDVAGIFVAKYEGQIIGFVASDGNWFSKREGKVVGAIHELVVLPDYRSKGVG
FT                   KALVEKVIEYFKSRGLDTAELWVGEENYEAINFYRWLGFESKDRFNYWIRMVKKL"
FT   gene            complement(231993..232595)
FT                   /locus_tag="Hydth_0231"
FT   CDS_pept        complement(231993..232595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0231"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="COGs: COG2834 Outer membrane lipoprotein-sorting
FT                   protein; InterPro IPR018323:IPR004564; KEGG: aae:aq_1483
FT                   hypothetical protein; PFAM: outer membrane lipoprotein
FT                   carrier protein LolA; SPTR: A8UXW0 Putative uncharacterized
FT                   protein; TIGRFAM: outer membrane lipoprotein carrier
FT                   protein LolA; PFAM: Outer membrane lipoprotein carrier
FT                   protein LolA; TIGRFAM: periplasmic chaperone LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44638"
FT                   /protein_id="ADO44638.1"
FT                   /translation="MRYLLLVLIPIISWGQAFSMLEKKLSEIKTLKVAFVQKVSYSWYP
FT                   KADVSKGFFYAQKGGKFRIEYEQPERMLIVSDGREILLYYPKEKSAIIDKVENNRSAVV
FT                   EALFLLSKPISEVFDQVGEIKRDNNTTLVLKPKVIDDNFYRVYVELDEELNIRSIRVED
FT                   KDGTTTTVEFLSLSKNFSPSEELFRIRLPSGVKVQRL"
FT   sig_peptide     complement(232539..232595)
FT                   /locus_tag="Hydth_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(232592..233671)
FT                   /locus_tag="Hydth_0232"
FT   CDS_pept        complement(232592..233671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0232"
FT                   /product="peptidase M28"
FT                   /note="COGs: COG2234 aminopeptidase; InterPro IPR007484;
FT                   KEGG: aae:aq_1891 hypothetical protein; PFAM: peptidase
FT                   M28; SPTR: A8UXV8 Putative uncharacterized protein; PFAM:
FT                   Peptidase family M28"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44639"
FT                   /protein_id="ADO44639.1"
FT                   /translation="MRSETFEELQRTAEDLLKLNRLAGSEGNKLTKEKIKKFLREKGIT
FT                   YREEFFQIEKSLPIKATIQVNNTTIPCVPYVGSPKGEYEGYVKRDPLEGDIILLGISEE
FT                   RSKLPSLRERGIKAGITYLETLNVHYYGNVDEEFPLVNVKKESIQLVEDAYIKLTIETK
FT                   KESILCSNIVFDIGRGPIIYMVAHMDTKPYVFGAIDNGVGFLLLLFMADELRRNYHLPY
FT                   RVRFLLTDAEELGLEGAKFHVGKGIKHAYYCINIDAIGWQHPAVIYKDAEGYNGDRLMD
FT                   MFLRHLQDMKVSIDFRSSPRAKSDHIPFKKVGVQTLFLSSNPFTIRHTFYDNLEAVNWD
FT                   IVRMWYELILSFLRRFHKL"
FT   gene            complement(233661..234578)
FT                   /locus_tag="Hydth_0233"
FT   CDS_pept        complement(233661..234578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0233"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR005785:IPR001544:IPR018300; KEGG: aae:aq_1893
FT                   branched-chain amino acid aminotransferase; PFAM:
FT                   aminotransferase class IV; SPTR: A8UXV7 Branched-chain
FT                   amino acid aminotransferase; TIGRFAM: branched-chain amino
FT                   acid aminotransferase; PFAM: Aminotransferase class IV;
FT                   TIGRFAM: branched-chain amino acid aminotransferase, group
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44640"
FT                   /protein_id="ADO44640.1"
FT                   /translation="MEYAFFEGRIVPVEEANINIKTNSFHYGTAVFEGIRAYWNEKEQQ
FT                   LYILFAREHYLRLLKNAKAMFMEIPYTVDELVEITKEILRKSEIKWDVYIRPIAYFKDL
FT                   ALTPKLLGFTPEVAIYTYNFGRYLDTSEGIKVKVSSWRRNDDNSIPSRWKVAGAYVNSA
FT                   LAKTEALLAGYDEAIMLNQHGFVAEGSGENIFLIRGRKAITPSYSEHILEGITRSAIIK
FT                   LLQKELVVEVEERPVARSELYTADELFMTGTAAEVTPIVEVDNRKVGDGKVGPMTKELQ
FT                   ELYFNAVRGNIERYKVWLTPVYEK"
FT   gene            234627..235421
FT                   /locus_tag="Hydth_0234"
FT   CDS_pept        234627..235421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0234"
FT                   /product="protein of unknown function DUF52"
FT                   /note="COGs: COG1355 dioxygenase; InterPro IPR002737; KEGG:
FT                   saf:SULAZ_0171 hypothetical protein; PFAM: protein of
FT                   unknown function DUF52; SPTR: C1DXQ6 Putative
FT                   uncharacterized protein; PFAM: Memo-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44641"
FT                   /protein_id="ADO44641.1"
FT                   /translation="MKIKRPNVAGIFYPSDPKKLRDTVLALLKNSKLFPLKPVGLVAPH
FT                   AGYTYSGAVAGAVYKQLENLDLSKDWMVVIIAPSHYFFFEGITFGSYQAFETPLGQVEV
FT                   DRKAIERFIDTRKSLRVSFSDIPYDKEHSLEVQLPFLQVLLKSFRLVPVLYSDAKPEEI
FT                   KEVLNFFEGENTLFVVSSDLSHYHSENTARYKDSFCHAGIESLDVKLLGRCEACGITGI
FT                   TGAIFYARERNLKGKLIDYKTSGEVSEERHRVVGYGGYIFTS"
FT   gene            complement(235411..236247)
FT                   /locus_tag="Hydth_0235"
FT   CDS_pept        complement(235411..236247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0235"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="COGs: COG0616 Periplasmic serine protease (ClpP
FT                   class); InterPro IPR004635:IPR002142; KEGG: aae:aq_2080
FT                   proteinase IV; PFAM: peptidase S49; SPTR: A8UYE0 Proteinase
FT                   IV; TIGRFAM: signal peptide peptidase SppA, 36K type; PFAM:
FT                   Peptidase family S49; TIGRFAM: signal peptide peptidase
FT                   SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44642"
FT                   /protein_id="ADO44642.1"
FT                   /translation="MKRFILVLILLVSVMVIGSLLSRIPVGNRIAVLKVEGIIIDAEPV
FT                   IKKIEKAKKDDSIKALVLRVDSPGGSVGASQEIYRALERFKDSKKPLVVSMGNVAASGG
FT                   YYISVPADYIYANPGTITGSIGVIIEHIDYRELLSRLGVKATAIKTGKFKDTLSPFREL
FT                   TDEEREYLKKTIDDAYGQFLSSILKYRSKKISEDELRSIADGRIMTGLMAQKVGLVDGL
FT                   GNIEDAIDKAKELAGVKEARVFYMEERKSFLRRLLGAKLPSFDLNYYPTMIYYLMK"
FT   sig_peptide     complement(236182..236247)
FT                   /locus_tag="Hydth_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            236316..237449
FT                   /locus_tag="Hydth_0236"
FT   CDS_pept        236316..237449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_267 hypothetical protein; SPTR: O66624
FT                   Uncharacterized protein aq_267"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44643"
FT                   /protein_id="ADO44643.1"
FT                   /translation="MFYVSKVSPFFFALAVVDLFISLVYKSLNADMTAVWFLVVFGFVA
FT                   HTIMSAMYQLVPNSQSRPIRFPFLSYLVFSLSLICSLLFYARQFYYVGYIYALASLVFS
FT                   LHMVLSIKNWQPITVKFLGLAVFYFLLSSVFLMLSELDYLPLPLAVHTLTLGLMLNAVM
FT                   GVQLAWIPMLYMEPLNVKYGKYLFYSSLLALPPFLLSFYTLNYRLTAYLSILPLTVVAY
FT                   FLWIIYSVFSGRRMPKEIPLVVRYFILAMIFLPFGMLLGSLMASENLVSFIVRIHVDLL
FT                   VYGFTAITIMGGIAHLYPRIIYGWKQSEGVSIQELVDEPLLRKLLPFVPVSVAWMVFCD
FT                   AMGGFLLHISTLPYAVLWTLFFKAVLLKPFLKRKVST"
FT   gene            complement(237426..238142)
FT                   /locus_tag="Hydth_0237"
FT   CDS_pept        complement(237426..238142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0237"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1137 ABC-type (unclassified) transport
FT                   system ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: aae:aq_413 ABC
FT                   transporter; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: O66729 ABC transporter; manually curated;
FT                   PFAM: ABC transporter; Branched-chain amino acid
FT                   ATP-binding cassette transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44644"
FT                   /protein_id="ADO44644.1"
FT                   /translation="MLMAHSVKKSYKGREVLKDINISIDKGHIVGLLGPNGAGKTTLFN
FT                   CLVGFTSVDEGSIFLDGKDITHMPAHKRAREGIAFLPQEHTLFEDLTVLENLLIFLEFF
FT                   EESKSSRMARAEELLTDFGLYEVKDTKARYISGGQKRRLEIARSLIPRPKYILFDEPFA
FT                   GIDPILVADIKLMIKNLKSQNIGVLITDHNVRETIKIVDRVYIISEGSILAEGTPEEVI
FT                   AKKEVREVYLGADFSL"
FT   gene            238261..240354
FT                   /locus_tag="Hydth_0238"
FT   CDS_pept        238261..240354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0238"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR012910:IPR000531; KEGG:
FT                   pmx:PERMA_0352 TonB-dependent receptor; PFAM:
FT                   TonB-dependent receptor plug; TonB-dependent receptor;
FT                   SPTR: Q2BMJ3 TonB-dependent receptor; PFAM: TonB-dependent
FT                   Receptor Plug Domain; TonB dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44645"
FT                   /protein_id="ADO44645.1"
FT                   /translation="MRRTVGMLGLIMLSTSLAKEVQVEEVSVTATRTERKTEDVPASVS
FT                   VVGKEKLEQRPMLNLYDALQGIPGVNITTRNQGYDTRLIIRGAGLKATYGVREIMVLLN
FT                   GVPITDPDSLTRLDFVDTSLIERVEVVKGPNSTLWGVNSAGGVINVITRSPFERKGGFI
FT                   KLSLGDYNTQNHNLYYSTPLGKGFYIGFNASRRQTDNSWRSHNKFWTNQITLQPSYMFE
FT                   DGSAWENYISYTKASLELPGSLVVDPKRKIDQWSEFKRTGNVPQTADPWRHMGRYSEIL
FT                   FMSSKLDKTLENFQIIPVIYINHWQHYHPVTGRINDANTWIYGLDFQTNYRHSLGVLTG
FT                   GFTVRHDDQNTDYFKYRNIKVVGGRIVSTLSDSRGELLERQNQKTTLAGVFLQESIQRG
FT                   RWIVDIGARLDRVKFDISGYKWGDYSFSKGNYVSCPDPSIDNCFSYSREKTYTAVSPRI
FT                   GVVYKLSPVIHLYGNISTGATTPSSSELSSNPNLKLSKVINYEVGLKARHSRFSLDTAL
FT                   YLMQVKDEVVRVIQPDGYTQFTNAGKTEKKGLEISGSYRLFDGLDVGVSFAYSDYKFKD
FT                   FSEIVGSTNVSRNGNRLPYIPMHQYSLFASYTHSSGFRFRVQTDTWGEYYMDNANTEKY
FT                   GGYDFLTSISVGYAKKNFDVALMVDNLFNKKYAVEVTKDTSGVKRYTPGPPRTFLVRVS
FT                   YSF"
FT   sig_peptide     238261..238314
FT                   /locus_tag="Hydth_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            240368..241783
FT                   /locus_tag="Hydth_0239"
FT   CDS_pept        240368..241783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0239"
FT                   /product="polyferredoxin-like protein"
FT                   /note="KEGG: sul:SYO3AOP1_1371 polyferredoxin-like protein;
FT                   SPTR: B2V5N4 Polyferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44646"
FT                   /protein_id="ADO44646.1"
FT                   /translation="MQVAKVHFIAKRDKRDILGMPLLGFLFKNRYMLLFYRLLTLFLLL
FT                   YAIIYGFVNPTKENVFTTAVFWSLFWPFFMVISLPTLGNVFCMVCPHGFLGKHLTRIGL
FT                   KLRPPKWLANPYIGLIGSNILAYWFVLYTFPSFLRSPLNTALFFTFFTLLSALLFLLFR
FT                   GMAYCKYVCPIGSVNSAFSRTSFTWLSTYQEECKTCKKPDCALACPYELNPSKFDSRNS
FT                   MFNCTLCMECAHACDAVKLEAKPWGSSLYKEIKQPKMIEVMVYILLTAVITFTMRFHHG
FT                   LSRSGISDFMPWVVVGKYLQSMFNLPKWIDMTGLVAMLMALLLVLSVVYLSFKMVAVVS
FT                   KRSLKDSLLVLGYAFAPLMIVGGLSHVLEFFFTEYYHNIMNGFSQAFGLGIHVEALAKR
FT                   GEAWLHIFKVFPFIAGLWSLQILWRRSALLAEQRRVLVFAVASSLPGLYLMLSIFALWV
FT                   MVSFPSVHTHGAH"
FT   gene            241785..242543
FT                   /locus_tag="Hydth_0240"
FT   CDS_pept        241785..242543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0240"
FT                   /product="TonB family protein"
FT                   /note="COGs: COG0810 Periplasmic protein TonB links inner
FT                   and outer membranes; InterPro IPR006260:IPR003538; KEGG:
FT                   ppd:Ppro_1467 TonB family protein; PFAM: Gram-negative tonB
FT                   protein; SPTR: A1AP13 TonB family protein; TIGRFAM: TonB
FT                   family protein; PFAM: Gram-negative bacterial tonB protein;
FT                   TIGRFAM: TonB family C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44647"
FT                   /protein_id="ADO44647.1"
FT                   /translation="MQRVLKAYGLSFLLHFLFFMAYILLFGEALKYKKVVEIDLSLQSQ
FT                   ELQNYTEAPHKEDKKHRSEEKHSERSIHREVKEQAVQKNQKAKESRVQNSQMQETPKES
FT                   GQESKGLESKETHNHVGEGLSKTGGLSSEQGTTKGQESTSTNRGKDAKEEREASPEAYL
FT                   REKLSVISSIVQKHISYPLIARKMGWEGRVVVCFLLRSDGRVENVHVEKSSGYEILDKS
FT                   AVSTVQKVSGLFPKPPVDVLVRLPINYKLE"
FT   gene            complement(242550..242669)
FT                   /locus_tag="Hydth_R0007"
FT   rRNA            complement(242550..242669)
FT                   /locus_tag="Hydth_R0007"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(242707..246479)
FT                   /locus_tag="Hydth_R0008"
FT   rRNA            complement(242707..246479)
FT                   /locus_tag="Hydth_R0008"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(246523..246594)
FT                   /locus_tag="Hydth_R0009"
FT   tRNA            complement(246523..246594)
FT                   /locus_tag="Hydth_R0009"
FT                   /product="tRNA-Ala"
FT   gene            complement(246614..246687)
FT                   /locus_tag="Hydth_R0010"
FT   tRNA            complement(246614..246687)
FT                   /locus_tag="Hydth_R0010"
FT                   /product="tRNA-Ile"
FT   gene            complement(246761..248300)
FT                   /locus_tag="Hydth_R0011"
FT   rRNA            complement(246761..248300)
FT                   /locus_tag="Hydth_R0011"
FT                   /product="16S ribosomal RNA"
FT   gene            248717..249907
FT                   /locus_tag="Hydth_0241"
FT   CDS_pept        248717..249907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0241"
FT                   /product="Protein of unknown function DUF2229, CoA enzyme
FT                   activase"
FT                   /note="COGs: COG3580 conserved hypothetical protein;
FT                   InterPro IPR018709; KEGG: sus:Acid_0922 putative
FT                   CoA-substrate-specific enzyme activase; PFAM: Protein of
FT                   unknown function DUF2229, CoA enzyme activase; SPTR: A8UV47
FT                   Putative uncharacterized protein; PFAM: CoA enzyme activase
FT                   uncharacterised domain (DUF2229)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44648"
FT                   /protein_id="ADO44648.1"
FT                   /translation="MKVIHPVPKLGINYFIMLGILKRKGEKVKKDRSGIKVGIPKFLNI
FT                   WGTHQFWVGFFNHLGIKVVFSSDTSEEQYRQYGKGRITMDSCFPVKALAGHIGELLAKN
FT                   VDILFVPMIYSLPSFLRGHVLDTVSCTRVMMAPENIKAGFTREKDEFSSRGVRFISPFV
FT                   TFGEPELLPKQLYEALKEFLDLSYQEVTQAVKHGLRSLEDFDAYIRGKSLEIVKWCVKE
FT                   NKPAILVLARPYHMDTGIGHEIDVEFQTYGYPVLWYNYLPLDDWLLNWLFGQEVKAGII
FT                   KSPFDISDVWTSSYSSNTNEIIWAAKFACRFPWITGVIRLSSYECGMDQPTFTPVQKIV
FT                   ESRGTLYFKFGELDETKPAGSIKIRVETIVYYLEKYSADIINKKLSMLPPLPKELS"
FT   gene            250082..250318
FT                   /locus_tag="Hydth_0242"
FT   CDS_pept        250082..250318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0242"
FT                   /product="acyl carrier protein"
FT                   /note="COGs: COG0236 Acyl carrier protein; InterPro
FT                   IPR003231:IPR009081:IPR006163:IPR006162; KEGG: aae:aq_1717a
FT                   acyl carrier protein; PFAM: phosphopantetheine-binding;
FT                   SPTR: O67611 Acyl carrier protein; TIGRFAM: acyl carrier
FT                   protein; PFAM: Phosphopantetheine attachment site; TIGRFAM:
FT                   acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44649"
FT                   /protein_id="ADO44649.1"
FT                   /translation="MDLEQKVKEIIADQLGVEVEKLSPEAKFVEDLGADSLDVVELIMA
FT                   FEEEFGIEIPDEDAEKIRTVGDVLNYLKEKVKG"
FT   gene            250318..251556
FT                   /locus_tag="Hydth_0243"
FT   CDS_pept        250318..251556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0243"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /EC_number="2.3.1.41"
FT                   /note="COGs: COG0304 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase; InterPro
FT                   IPR017568:IPR014030:IPR014031:IPR016039:IPR
FT                   018201:IPR016038; KEGG: aae:aq_1717
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II; PFAM:
FT                   Beta-ketoacyl synthase; SPTR: O67612
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II; TIGRFAM:
FT                   3-oxoacyl-[acyl-carrier-protein] synthase 2; PFAM:
FT                   Beta-ketoacyl synthase, N-terminal domain; Beta-ketoacyl
FT                   synthase, C-terminal domain; TIGRFAM:
FT                   3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44650"
FT                   /protein_id="ADO44650.1"
FT                   /translation="MRRVVVTGLGVVSPIGTGVEKFWMNLTAGVSGVDIIKRFDPIEVG
FT                   LSVHIAAEVKDFNPENYFEKKELPRVSDFIKYAVAASEEALKDSGLLDEKFDPYRVGVI
FT                   IGTGIGGLRDIEEQQKILLEKGPKRVSPFFIPYGISNMAAGLVAIRYGFKGPNYCVVSA
FT                   CATGNHSIGDAMRLIQKGDIDVAIAGGCESAITPLGIAGFASMKALSTRNHEPQKASRP
FT                   FDLERDGFVMGEGAGILVLEEYEHAKARGAKIYAELVGYAATDDAYHITAPCADGEGAY
FT                   MCMKLALEDAKIKPEEVDYINAHGTSTPLNDKAETLAIKSLFGEHAYKLSISSNKSMIG
FT                   HLLGAAGAVEAVATVKTVQTGIIPPTINLEKPDPECDLDYTPNRAVQREVNIAISNSFG
FT                   FGGTNACLVFRRV"
FT   gene            251528..252226
FT                   /locus_tag="Hydth_0244"
FT   CDS_pept        251528..252226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0244"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="COGs: COG0571 dsRNA-specific ribonuclease; InterPro
FT                   IPR011907:IPR001159:IPR000999; KEGG: aae:aq_946 RNase III;
FT                   PFAM: ribonuclease III; double-stranded RNA binding domain
FT                   protein; PRIAM: Ribonuclease III; SMART: ribonuclease III;
FT                   double-stranded RNA binding domain protein; SPTR: A8UXZ2
FT                   RNase III; TIGRFAM: ribonuclease III; PFAM: RNase3 domain;
FT                   Double-stranded RNA binding motif; TIGRFAM: ribonuclease
FT                   III, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44651"
FT                   /protein_id="ADO44651.1"
FT                   /translation="MPVSSSEEYKELEEKLGYTFRDKKLLEQALTHKSYAVEKGVKSYE
FT                   TLEFLGDALINLFVVDILLQEFPQAKEGQLAPMKAFFVSEEFLHQLAQELELEKYLLLG
FT                   GKKGKFKVNVSILGDAFESLWGAIYIDTGRDTNFTRSLFERLYKNRIITMARSSDYKKD
FT                   YKTILQEITQKRWKERPTYRVVSVSGPQHGKVFEVECSVRNIRAVAAGSNKKEAEQLSA
FT                   KRVLELLQEL"
FT   gene            complement(252214..252699)
FT                   /locus_tag="Hydth_0245"
FT   CDS_pept        complement(252214..252699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_2085 hypothetical protein; SPTR: O67858
FT                   Uncharacterized protein aq_2085"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44652"
FT                   /protein_id="ADO44652.1"
FT                   /translation="MLTAILVQDRLIRLNLSLLEGLLSEIKADIEESKILADACLDGKE
FT                   METYEKAMLVIEGNLLLKISEMLEHVYDLYEIFNFDITFLASVPEEIEREIERLDALNS
FT                   INTKLELILSVIDELLLFEGESEKLKAILTPFRVYREVIEHSISFNKKVWDLVFQSS"
FT   gene            complement(252641..253039)
FT                   /locus_tag="Hydth_0246"
FT   CDS_pept        complement(252641..253039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0246"
FT                   /product="TOPRIM domain protein"
FT                   /note="InterPro IPR006171:IPR006154; KEGG: aae:aq_2086
FT                   hypothetical protein; PFAM: TOPRIM domain protein; SMART:
FT                   Toprim sub domain protein; SPTR: A8UUY1 Putative
FT                   uncharacterized protein; PFAM: Toprim domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44653"
FT                   /protein_id="ADO44653.1"
FT                   /translation="MEKPLSAFVRDLREASKDRAVLVEGKKDRESLIKLGIKNVFTLGG
FT                   KRFADLPDMLEDFSEVILLFDLDKHGERINRKVRDILSTQGYILIEDFRERMRGLNLLF
FT                   VEELYEKVRDADSYFGTGQAHKVKLKSP"
FT   gene            complement(253042..253716)
FT                   /locus_tag="Hydth_0247"
FT   CDS_pept        complement(253042..253716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0247"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="COGs: COG1059 Thermostable 8-oxoguanine DNA
FT                   glycosylase; InterPro IPR012092:IPR003265:IPR011257; KEGG:
FT                   aae:aq_251 N-glycosylase/DNA lyase; PFAM: HhH-GPD family
FT                   protein; PRIAM: DNA-(apurinic or apyrimidinic site) lyase;
FT                   SMART: HhH-GPD family protein; SPTR: A8USF5
FT                   N-glycosylase/DNA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44654"
FT                   /protein_id="ADO44654.1"
FT                   /translation="MFEDIIEAKASVGHFVKKRIEEFKKLGREGITFYDFRPFLDVQLE
FT                   ADIFSELCFCLLTANSSASIGIRLQKEIGIEGFKRMSFEELVHTISRYGHRFAKQRAER
FT                   IVKARETFEDVLDIINSAKSGREIRDLLSDACSKYKVEGFGLKEASHFLRNVGFDDVAI
FT                   IDRHVLRYLRENKLVPDQKTLTRRIYLMAEERLQDVCSQLNLTQAELDLYIFYIKTKKV
FT                   LK"
FT   gene            complement(253709..255274)
FT                   /locus_tag="Hydth_0248"
FT   CDS_pept        complement(253709..255274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0248"
FT                   /product="DNA repair protein RecN"
FT                   /note="COGs: COG0497 ATPase involved in DNA repair;
FT                   InterPro IPR004604:IPR003395; KEGG: aae:aq_561
FT                   recombination protein RecN; PFAM: SMC domain protein; SPTR:
FT                   O66834 DNA repair protein recN; TIGRFAM: DNA repair protein
FT                   RecN; PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: DNA
FT                   repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44655"
FT                   /protein_id="ADO44655.1"
FT                   /translation="MLVRIYLEDFFIIKHQEVEFGEGLNVLTGESGAGKSLTVSSLLFL
FT                   MGHQQEYPEGTAVEAEFLKDGEQILVRREIKKGKSRYYLNGVGSIQKVVKEIVSSMVLL
FT                   QGQNDRMKILRRDFQRDLYDRFAGVLDLRREYEKLYARLEHLKEKLRDWNERQRERKIR
FT                   LAVILEELRDIERVGLSHQEYEDIKEKLSTIEHMEKINALVGRALDHLDTHGGLIDRML
FT                   DLKRALSELCRYDKTVEPFVKGMENISDELKYLRQFLSSKLLDLDPEEINRLNEKVYQV
FT                   QKLERRYGMKYKDILAYAGKLRSQIEAYQKEEDSKEELEEEILHLEKTLTSLADKLSDG
FT                   RRSAKETFEERVMETLRDMGLERSSFKVNFSQEEGRYGRERVEFLFSSYGKDEKPLESV
FT                   VSGGEISRIALSFFLLSPTSETYVLDEIDAGIGGETSLRLAKLLRRLSESMQVIVITHS
FT                   PAIASAAHKHILVKKEFKDDSAFVKIEELSGEERLEEIARLMGVVSEKTIEGAKDLVKE
FT                   TSNV"
FT   gene            255314..256825
FT                   /locus_tag="Hydth_0249"
FT   CDS_pept        255314..256825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0249"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /note="COGs: COG0056 F0F1-type ATP synthase alpha subunit;
FT                   InterPro IPR005294:IPR004100:IPR000194:IPR000793:IPR
FT                   018118:IPR020003; KEGG: aae:aq_679 F0F1 ATP synthase
FT                   subunit alpha; PFAM: H+transporting two-sector ATPase
FT                   alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; SPTR:
FT                   A8USR0 ATP synthase subunit alpha; TIGRFAM: ATP synthase
FT                   F1, alpha subunit; PFAM: ATP synthase alpha/beta family,
FT                   beta-barrel domain; ATP synthase alpha/beta chain, C
FT                   terminal domain; ATP synthase alpha/beta family,
FT                   nucleotide-binding domain; TIGRFAM: proton translocating
FT                   ATP synthase, F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44656"
FT                   /protein_id="ADO44656.1"
FT                   /translation="MATLTYEEALQLLREHIKDFEATARMEEIGVVYYVGDGVARAYGL
FT                   DNVMANELVEFESGVMGLAFNLEEDNVGIIILGSESGIKEGSVVRRTGRILDAPVGEGL
FT                   IGRVIDPLGNPLDGKGPIKYEYRSPIEKIAPGVVKRKSVHEPLQTGIKAIDAMIPIGRG
FT                   QRELIIGDRSTGRTTICIDTILNQRDTDVYCIYVAIGQKRSTTARIIELLEKNGAMDYT
FT                   CVVVASATDPASLQYLAPFVGCTIGEYFRDNGKHALVIYDDLSKHAEAYRQLSLLMRRP
FT                   PGREAYPGDVFYLHSRLLERAAKLNDELGAGSLTALPIIETKAGDVAAYIPTNVISITD
FT                   GQIYLEPDLFNKGVRPAINVGLSVSRVGGAAQIKAMKQVAGTLRLDLAQFRELEAFVQF
FT                   AAELDKATQQTINRGLRLVELLKQEPYSPIPVEKQIVAIYAGTGGYLDDIPVESVRKFE
FT                   KELYAYMDRERPDILKEIKEKKALDDDLKRKMEEALKDFKSKFIP"
FT   gene            256822..257613
FT                   /locus_tag="Hydth_0250"
FT   CDS_pept        256822..257613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0250"
FT                   /product="protein of unknown function DUF72"
FT                   /note="COGs: COG1801 conserved hypothetical protein;
FT                   InterPro IPR002763; KEGG: aae:aq_1408 hypothetical protein;
FT                   PFAM: protein of unknown function DUF72; SPTR: A8USQ9
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44657"
FT                   /protein_id="ADO44657.1"
FT                   /translation="MKVYVGCSGFSYEDWRGVFYPHNLKREEFIVYYSKFFHVLELNFS
FT                   FYSFPSRGAIKSFLSRSKDLRFSVKAHRSFTHTRHYRSEDVKRFLYSLEPLLEEDRFIA
FT                   LLFQFPESFHLTQENLEYLKKLSQDFADMEKAVEVRSKSFKSWDFYRMVEEYGFSLVNS
FT                   DAPKNSRFLVGPWVSVGSINYVRLHGRDVQRPYDYLYSIDELKRLRDKIKKLGDKDTYV
FT                   FFNNTAKAQAVYNALQMKMLFGLKVQIPKSMEDAYREREWE"
FT   gene            257675..258154
FT                   /locus_tag="Hydth_0251"
FT   CDS_pept        257675..258154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0251"
FT                   /product="TPR repeat-containing protein"
FT                   /note="COGs: COG3063 Tfp pilus assembly protein PilF;
FT                   InterPro IPR019734:IPR013026:IPR013105:IPR001440:IPR
FT                   011990; KEGG: aae:aq_2197 hypothetical protein; PFAM: TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide repeat; SPTR: A8UQK8
FT                   Putative uncharacterized protein; PFAM: Tetratricopeptide
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44658"
FT                   /protein_id="ADO44658.1"
FT                   /translation="MEDLRKDAQELFNRAYTYHMMGDIEKAIEFYKQSIEIYPTALAYT
FT                   FLGWAYSMLGEYEKAIEMCEQAIKLDPDLGNPYNDIGSYLIALGRYEEAVPWLKRAIVA
FT                   KNYEPRHYPHMNLARAYLAMGRFKDALKEAENAIKLAPDYKPAHILKHQILGMLN"
FT   gene            258170..258571
FT                   /locus_tag="Hydth_0252"
FT   CDS_pept        258170..258571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0252"
FT                   /product="general secretion pathway protein G"
FT                   /note="COGs: COG2165 Type II secretory pathway pseudopilin
FT                   PulG; InterPro IPR000983:IPR012902:IPR010054:IPR013545:IPR
FT                   001120; KEGG: aae:aq_418 general secretion pathway protein
FT                   G; PFAM: type II secretion system protein G; SPTR: A8UYQ9
FT                   General secretion pathway protein G; TIGRFAM: general
FT                   secretion pathway protein G; PFAM: Prokaryotic N-terminal
FT                   methylation motif; Bacterial type II secretion system
FT                   protein G; TIGRFAM: general secretion pathway protein G;
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44659"
FT                   /protein_id="ADO44659.1"
FT                   /translation="MKRGFTLIELLVVIIILGLLAAIVVPRITGRVEEAKIETTKVQMK
FT                   AIKDALEQYKLDNGFYPTTEQGLKALVEKPSTPPIPPRWRQYLDKLPKDGWDRDFIYIS
FT                   PGVGHPYELRSLGPDGKDGTEDDIDVWKL"
FT   gene            258555..258842
FT                   /locus_tag="Hydth_0253"
FT   CDS_pept        258555..258842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0253"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902:IPR001120; KEGG: noc:Noc_2891
FT                   general secretion pathway protein H; SPTR: A8UYQ8 Putative
FT                   uncharacterized protein; PFAM: Prokaryotic N-terminal
FT                   methylation motif; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44660"
FT                   /protein_id="ADO44660.1"
FT                   /translation="MCGSSKGFTLLEVLVASALLALFFGVLFELISKARRDYYYSVSLY
FT                   EDIITLTNRLTLNQMEGLGVEEETLRDYPIIKEFTYTYGKAKIYIYAPKK"
FT   gene            258826..259326
FT                   /locus_tag="Hydth_0254"
FT   CDS_pept        258826..259326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR012902:IPR001120; KEGG: aae:aq_2118
FT                   hypothetical protein; SPTR: A8UYQ6 Putative uncharacterized
FT                   protein; PFAM: Prokaryotic N-terminal methylation motif;
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44661"
FT                   /protein_id="ADO44661.1"
FT                   /translation="MLLKSKKGFTLLEVLLVLVLISLLFGTLSYTYYSALNSSLDLARD
FT                   SQKLRQEAYLLWNLKRKVVSAKILHMEKDRLFMITSAGDYYEGMVKCAYIYKDGVLYYY
FT                   EFPYPYGDIKFYEEDKLIKLGKFNAFSFRAYAGGNFYDTFDGIPELLYVKLDTRQLVIK
FT                   LLS"
FT   sig_peptide     258826..258912
FT                   /locus_tag="Hydth_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            259323..260039
FT                   /locus_tag="Hydth_0255"
FT   CDS_pept        259323..260039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_1776 hypothetical protein; SPTR: A8UVS7
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44662"
FT                   /protein_id="ADO44662.1"
FT                   /translation="MTRVAWSITHQEFTITDYYYFSKLSREAQKAGILIEEVDSWDRLK
FT                   DYDTIVFNYPEIPFTEREVQDIERLVWEDGKKVILLGYYKNEDRIADTCNTLAKRFGME
FT                   LNGDEVTDEVNNHQGDAYFVVTSKLRRYTKNEKNEVTVNKILLPCTASIKPLMPDIKVV
FT                   ARAEDTARSNQDNYTLLIAEQIAPTSGGYFCLAGTCVFWDNYSIELYDNLAFSLNLLRH
FT                   KTPLKTVGGKPVVFGL"
FT   gene            260048..260989
FT                   /locus_tag="Hydth_0256"
FT   CDS_pept        260048..260989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0256"
FT                   /product="NurA domain protein"
FT                   /note="COGs: COG2380 conserved hypothetical protein;
FT                   InterPro IPR018977; KEGG: aae:aq_977 hypothetical protein;
FT                   PFAM: NurA domain; SPTR: A8UU75 Putative uncharacterized
FT                   protein; PFAM: NurA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44663"
FT                   /protein_id="ADO44663.1"
FT                   /translation="MLWGRYRVSLKPWELPDVDLLEYEESEGLVDLAEEPKPYDGEPLQ
FT                   EGITVAFVDGVRRTEYAMYLIDDSGSSYEGAFASLGAGAVLIELGKLNLVKESMLHSIV
FT                   KRYLVVRGELQGIPQKSIGFEMRTTYEDVSKEINRIMREELEVRVARKLAQQVNPTLLI
FT                   CDGTLSNRLRGTTCVGYIKTIKKLFIRRDEANLLAHLKRGQRTPIIKLHYQHKQEQKEK
FT                   VEKYTWYVKLTDAEGVGSLARLEVFENVGLSMAKRIANMTAGILPMLVSTTFQDKRSPQ
FT                   NLLPIKSLENFLRRHLGSYSIVRREIEQLIYA"
FT   gene            260982..261854
FT                   /locus_tag="Hydth_0257"
FT   CDS_pept        260982..261854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0257"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="COGs: COG0679 permease; InterPro IPR004776; KEGG:
FT                   aae:aq_1392 hypothetical protein; PFAM: Auxin Efflux
FT                   Carrier; SPTR: A8UV34 Fatty acid/phospholipid synthesis
FT                   protein; PFAM: Membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44664"
FT                   /protein_id="ADO44664.1"
FT                   /translation="MLEVLLIVASGYLLRKIGVFKKEDARVFINYVIYLALPVVSFRSA
FT                   HSLGISKSVIFVVLLAWIAIIFCLVVSFILGKVLRLKGSDLRTFLLVSSFGNTAFLGYP
FT                   YALSFFGQEGLRYAVIYDSLGSFLLVSTVGFLISRGSVNLKELFTFPPFIGLVLGFSLR
FT                   SYNFDTALKGALDTLAFSLSPVILFALGLSVSFVGIKRYLSISLFALFIKMVVSFLITY
FT                   QVAKALKMEPLAFKISLLESSMPSMMMSGVLALKYGLNHELAFASIGLGLLFSFVIVPL
FT                   LFHLFLASV"
FT   gene            complement(261811..262773)
FT                   /locus_tag="Hydth_0258"
FT   CDS_pept        complement(261811..262773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0258"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509:IPR016040; KEGG:
FT                   pmx:PERMA_1747 UDP-glucuronic acid decarboxylase 1
FT                   (UDP-glucuronatedecarboxylase 1) (UXS-1); PFAM:
FT                   NAD-dependent epimerase/dehydratase; SPTR: C0QS65
FT                   UDP-glucuronic acid decarboxylase 1
FT                   (UDP-glucuronatedecarboxylase 1) (UXS-1); PFAM: NAD
FT                   dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44665"
FT                   /protein_id="ADO44665.1"
FT                   /translation="MRVLITGAAGFIGSHLCERFLKEGFQVIGMDNFITGSPDNIAHLF
FT                   GHPKFKFIHYNVINYIYLEGPVDLVLHFACPASPIDYLSHPIHTMKVDSLGTLNTLGLA
FT                   KLKRARYVFASTSEVYGDPTIHPQPETYWGYVNPVGPRSVYDESKRFSEAMCMAYHREH
FT                   SIDVRIARIFNTYGPRMRINDGRVIPNFITQALKGEPLTVYGDGKQTRSFCYIDDLVEG
FT                   IFRLSTEDGLSGEIINLGNPQEVSIIDVAKLILELTGSSSKIVFRSLPADDPKRRCPDI
FT                   KKAKELLSWEPKVSLKDGLKITINWFKQMLRKGEREGEL"
FT   gene            262805..262879
FT                   /locus_tag="Hydth_R0012"
FT   tRNA            262805..262879
FT                   /locus_tag="Hydth_R0012"
FT                   /product="tRNA-Val"
FT   gene            262896..263846
FT                   /locus_tag="Hydth_0259"
FT   CDS_pept        262896..263846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0259"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COGs: COG0825 Acetyl-CoA carboxylase alpha subunit;
FT                   InterPro IPR001095:IPR011763:IPR020582; KEGG: aae:aq_1206
FT                   acetyl-CoA carboxylase alpha subunit; PFAM: Acetyl-CoA
FT                   carboxylase, alpha subunit, conserved region; SPTR: A8UQK6
FT                   Acetyl-CoA carboxylase alpha subunit; TIGRFAM: acetyl-CoA
FT                   carboxylase, carboxyl transferase, alpha subunit; PFAM:
FT                   Acetyl co-enzyme A carboxylase carboxyltransferase alpha
FT                   subunit; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44666"
FT                   /protein_id="ADO44666.1"
FT                   /translation="MPLEFEKEHLELYQKIDQLRRLYQLGEKDKEAELRKLQREFRKNA
FT                   KELYKKLDPWSRVLIARHPHRPHTVDYISLIFRDFTELHGDRCFGDDRSIVAGFAYLDN
FT                   MPVAIIGHEKGRSTKEKMDRNFGMPHPEGYRKAIRVAKLAEKYRMPVITFVDTPGAYPG
FT                   IGAEERGQSEAIARSLYTFGYLKVPSIAVVIGEGGSGGALALAVANRILMLENAIYSVI
FT                   SPEGCAAILWKDQSKVKEASAALKLTAHDLLKLGVIDYIVPEPLGASHIDPKRSARVLK
FT                   YFLRRCLKELINRSPEEILSERIKKFERMGDFLEK"
FT   gene            263843..265876
FT                   /locus_tag="Hydth_0260"
FT   CDS_pept        263843..265876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0260"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="COGs: COG1449 Alpha-amylase/alpha-mannosidase;
FT                   InterPro IPR004300:IPR011330; KEGG: hya:HY04AAS1_0112
FT                   glycoside hydrolase family 57; PFAM: glycoside hydrolase
FT                   family 57; SPTR: B4U6N6 Glycoside hydrolase family 57;
FT                   PFAM: Glycosyl hydrolase family 57; Domain of unknown
FT                   function (DUF3536)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44667"
FT                   /protein_id="ADO44667.1"
FT                   /translation="MNTFVIHGHFYQPYRANPYVGDVMIEDTAYPYENWNERIYRECYL
FT                   PNAYAHLRVDTKVKAIINNYTKMSFNFGWPLLDWMEKNHPELLDKIREGAENAIATSFN
FT                   HTILPLDPQEDKEIQLFWGIRAFEKFFGRRPTGFWLPELAIDKQIVHMLIKYGIKYILL
FT                   APHQTKARGSFLRYYVQDGHLDIFVYNGELSQGIAFGDLLSDAKSLLETLRSRRGLTII
FT                   AADGETFGHHKKFGEMGLAYMFANSSEFKSLEAYYKENMPKLSTDINWNTSWSCPHGVE
FT                   RWRSDCGCSTGGLPGWHQKWRKPLRDGLEAVRSRIKEIVYNKLEEYFFDVHGAILGFVD
FT                   VILGASKDEYFSKYLKRDINKEEKVKILKLLNAIKYIQLAFSSDGWFFAEISGIEPVKN
FT                   LLFAKRAIELIEDSSIERTLLRYLEEAPSNIQAYGNGLGVWKNLVLTQVYSPQTISRTA
FT                   LILHISELKDKKDRLGKWEFEVLEESKIRLIDTETEEELSFEEDLTSFDVSMLPSLYAK
FT                   HIFEKWAMDYMKEEEEFLKDYEFLLEDMVLHSKSLRFRTAQYMREKLRLLLKSKLLILI
FT                   KEKASTDKIKEILTKADTLSVDVRDEHLAQELTSYVVDKAIKAGDEELLRLLEFAREYN
FT                   LSVVRYELAIDLWQVQNIVWERRQAIKNNRIFELLNILPFSS"
FT   gene            complement(265859..268654)
FT                   /locus_tag="Hydth_0261"
FT   CDS_pept        complement(265859..268654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0261"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="COGs: COG0653 Preprotein translocase subunit SecA
FT                   (ATPase RNA helicase); InterPro
FT                   IPR000185:IPR014018:IPR011115:IPR011130:IPR 011116; KEGG:
FT                   aae:aq_1870 preprotein translocase subunit SecA; PFAM: SecA
FT                   DEAD domain protein; SecA preprotein cross-linking region;
FT                   SecA Wing and Scaffold; SPTR: O67718 Protein translocase
FT                   subunit secA; TIGRFAM: preprotein translocase, SecA
FT                   subunit; PFAM: SecA DEAD-like domain; SecA preprotein
FT                   cross-linking domain; SecA Wing and Scaffold domain;
FT                   TIGRFAM: preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44668"
FT                   /protein_id="ADO44668.1"
FT                   /translation="MIDWIIKKLIGTKNEREVKRLRGYVKKIAEKEMELDALTNRELIE
FT                   LSKELHLKVMGDESLKERIMRGDITEEVLLAFALVREAGKRTIGLRFFDVQMIGGLVLH
FT                   QGKIAEMKTGEGKTLVATSAVYVNALTNEGVHVVTVNDYLARRDAQWMGPIYKFLGLDV
FT                   GVINSDYSSYRVEWVDEEVVKEAIEEDLRVWPKGYFEEILPSHLIDTKAKKAFFTKLEL
FT                   CDRKQAYQAHITYGTNNEFGFDYLRDNMAVSLEDIVQVKGHNFAIVDEVDSILIDEART
FT                   PLIISGPSQMDTSAYYKADEVVRKLKKDEDFTVDEKNRTVLLTEQGIKKVEEFLGIENL
FT                   YDVKNIDLLHAVNQALRAHQLFKRDVHYIVKDSEVLIVDEFTGRVLPGRRWSDGLHQAI
FT                   EVKEGVPIQQENQTLASITFQNYFKLYRKLSGMTGTAETEALEFKEIYGLDVVVVPTHK
FT                   PVRRYDHPDLVYKTKQEKWQAVVDYIKREHQKGRPILVGTVSIEDSEHLSQLLKKAGIP
FT                   HNVLNAKHHEKEAEIIAQAGRLGAVTISTNMAGRGTDILLGGNPEYLAKEILTKRGKTL
FT                   ETATQEEWKQALEEAYRITQEEKEKVVQLGGLLVIGTERHESRRIDNQLRGRAGRQGDP
FT                   GETRFVLSLEDDLMRIFGGDRVKKMMEFLRIPEGEPIESRMVTKAIQNAQKRVEAQNFQ
FT                   IRKRLLEYDNVMNTQRLTVYGIRRDILEGKWLKEYVEEFIRDVIEERLHALLVEDEPEL
FT                   WDTKPLADYLKELTGRDVEVPQARDKEELVEKLTQTIKEMYAEKEESLGKDLFLEVTKV
FT                   VLLNNLDHLWREHLHILDRLREGIYLRGYASKDPLVEYKKEAFYLFENMMLNFKERAIF
FT                   DLMKVEIRSQEELEQEVQREEQQMESLLKQAVFSGVEGKSDQKGPRRKTLKERLQSRRK
FT                   R"
FT   gene            complement(268753..269199)
FT                   /pseudo
FT                   /locus_tag="Hydth_0262"
FT   gene            269401..270615
FT                   /locus_tag="Hydth_0263"
FT   CDS_pept        269401..270615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0263"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="COGs: COG0381 UDP-N-acetylglucosamine 2-epimerase;
FT                   InterPro IPR003331; KEGG: nma:NMA0199 putative
FT                   UDP-N-acetyl-D-glucosamine 2-epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase; PRIAM:
FT                   UDP-N-acetylglucosamine 2-epimerase; SPTR: A6PV73
FT                   UDP-N-acetylglucosamine 2-epimerase; TIGRFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase; TIGRFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44669"
FT                   /protein_id="ADO44669.1"
FT                   /translation="MNSKLPKVMVILGTRPEAVKLAPVVLALKKMGFNVKVVATGQHTE
FT                   MLMQVIDFFGMEACLLDCMSADLLENTACMTKALKNKLLEEKPDAVLVQGDTLSCYMGA
FT                   YSAFLNKLPVMHLEAGLRSHDKFSPFPEELYRKLTDSLSDIFFAPTPKAVDNLLSEGVR
FT                   KDRILLTGNTVVDAMHLALKRLDREKIKGEIENITGKKIDAYEGLVFITSHRRENFGKP
FT                   LENIREAILELSKRYSSLLFLWSVHKNPEVRKVVMDGLKSLPENLSLVEPLTYPQTVYA
FT                   LEKSKVLITDSGGLQEEACVVKKPVLITRNVSERPEVVEVGLGKIVGTEKENIIKSFDE
FT                   VYLSYDKFSNLEFENPYGDGRASERIAGFLLCPKVMDFILNYRERYREDLHECSERYSY
FT                   PAFAL"
FT   gene            270572..271348
FT                   /locus_tag="Hydth_0264"
FT   CDS_pept        270572..271348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0344 putative lipoprotein; SPTR:
FT                   Q2T8F5 Lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44670"
FT                   /protein_id="ADO44670.1"
FT                   /translation="MSVLSVILTLLLLFETALAYNFRLEVGAGYEYLSPHRIYGDWKSG
FT                   FLRFYHRPSNDLTYFLEADAFSRKNLGEAALGAFGLYKDWSPWLYTYSSLSAGSSSSYL
FT                   PKFRLDHEFNLKLGPQKNIVPSVGFTYIKYHDVHKDYIMYPGITYYGEGFVITYKHFFN
FT                   KSQPGSVSSSTDLISLGIGQEGKSWTYLDMYYGKQAYLATYLTSPEEVRQKSLYISLKH
FT                   ILWIRKDFALFGGVSYFKLKDGYEKYGFQAGFFKDF"
FT   sig_peptide     270572..270628
FT                   /locus_tag="Hydth_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            271314..272111
FT                   /locus_tag="Hydth_0265"
FT   CDS_pept        271314..272111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dtu:Dtur_1455 hypothetical protein; SPTR:
FT                   B8E0Z2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44671"
FT                   /protein_id="ADO44671.1"
FT                   /translation="MASRQDSLRTFEAQAVPYARFGRVLKFNRTLFLIQLLVLTAFFEA
FT                   VVLHLLDKYFEALTGITRSMFKEGHILEHSVGFLKIKYFAIFGRLPTAFESFTYLVLSG
FT                   VFLASLLSRFNRLPRNLTAWLIYVDMIYLVSSLYFVLFGERFPYTVAEFGKLYFLQQMG
FT                   VFLLIPVLLGMTLSVYTFGFVNFMLNFLTIALTLFYAFIFGAVRYLAFLSILQNWSYIH
FT                   MPAMFFVAGPLLDTVYVVSFYSLCSYLTVKLLHRKESYYQWGY"
FT   gene            272099..273361
FT                   /locus_tag="Hydth_0266"
FT   CDS_pept        272099..273361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0266"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   dtu:Dtur_1454 glycosyl transferase family 2; PFAM: glycosyl
FT                   transferase family 2; SPTR: B8E0Z1 Glycosyl transferase
FT                   family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44672"
FT                   /protein_id="ADO44672.1"
FT                   /translation="MGVLTVVLKGYLLFLVFLLLLYTTRHYIFTLNRAFGKQRFYYQDI
FT                   MDSDLPSVSVLVPMHNEEKVARFILDRLVVTDYPRDRYEVIPINDHSTDATKEILEEYA
FT                   SKYEFIKPLHRYGDLPRGKQNGLNDALKVAKGDVIIVYDADYLPSRGQIKILANAFKDP
FT                   EVGAVMGRVVSINAGKNLLTRLLDMERAGGYQVDQQARYNLNLIPQYGGTVGGYRRSLV
FT                   LRFGGFDPNILAEDTELTFKLYINGYKVAYANIAECYEEAPEDWKVRAKQLRRWSRGHN
FT                   QVMFKYLIPLWKSRHLNFFQKLDGTLLLMIYMQPFLILLGLLCSLVLFFLGDMEIYTTT
FT                   LTLLFLFSHNAFGNFAPFFQIGMALVLDGSREKILLLPLMFFSFIFNLIYASLGFVDAV
FT                   IDLLTKRSVVWQKTERFRENA"
FT   gene            273354..274289
FT                   /locus_tag="Hydth_0267"
FT   CDS_pept        273354..274289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A9YVX5 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function,
FT                   DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44673"
FT                   /protein_id="ADO44673.1"
FT                   /translation="MLDQALFVILLFILLMLLPFGASILEVILKKDAKPIHIDPERTKE
FT                   PDYFGKSFMRILKAALASLKIDHERASSYFYAKVPMPKGEEWVGFITPELLLEEEVSTV
FT                   SVFLSDTHLNVKRTFKKEVVVLGRLLITEECSMRSLYTQGDCILKAPLRIVRWLHVEGN
FT                   LGIDSPADLGQSAYVKGDAAVKGSVKFKRLYARKVSTFAYEQRKTGFKEEPINISGTLR
FT                   VKGSLNIDGTSKSVHIDGDLFSDGKIELQGNVHVKGSVFSQSDVVLKHGVRIGEEGKVK
FT                   SVVAKGRILIKGPFEAYGYLHAEGGGSIEP"
FT   sig_peptide     273354..273416
FT                   /locus_tag="Hydth_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            274286..276100
FT                   /locus_tag="Hydth_0268"
FT   CDS_pept        274286..276100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0268"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR019825; KEGG: dtu:Dtur_1451 hypothetical
FT                   protein; SPTR: B8E0Y8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44674"
FT                   /protein_id="ADO44674.1"
FT                   /translation="MRRYVLIVLTLLLLAFLFTGVKRLLSQLALERDKSLQVLLVYDKD
FT                   TYQVRAFRSVLEEEGVPHRLVHINTLISTDPKTLSKTKPALLLPDGSLQYIHPDTMSWF
FT                   KKYLSTGGSVFVSYDAGTKNYAGAYLKEALFTNLLGANYALYDKLRGEAYSKGYLKITD
FT                   RSLEITPGKVDREKRLITGYMYGSLEYPYTKVEMRNSAGKLLAVVLDSRENKEYPVMFW
FT                   ERYEKGYIFYSAVPLGHLKAYSDDLVLRATLRYFLFKLLKLPHLVNTPKGKGGLVVNWH
FT                   IDASIDWKSIPMMLKEGYLRKGIEYSSHITAGPFRDQPGDGLGFDACEKGREYVKMLIP
FT                   YGVIGSHGGWAHNWFSENVLKGKFKEKEIYEYIKKNNDCLASITGYKIREYSAPNGVHP
FT                   QPQTTEVLEKLGMVAYYYTGDSGSSPNRTFINGKMVSAKVIAFPITPFEKAASLHEMKK
FT                   QGVSEEDVAMFLTRLAEYVEKTRQVRLFYSHPYDIPLYPNAILKFLDLVEEKERSKKIE
FT                   VHSMSYFAEFLLRFLKTDYSFRKEGDVLKVKLKNPEGLKDISIAIPRYYGKVLSFPKEA
FT                   VFISQDENYYYFYLADNPKELDFSFKFH"
FT   sig_peptide     274286..274363
FT                   /locus_tag="Hydth_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            276110..276910
FT                   /locus_tag="Hydth_0269"
FT   CDS_pept        276110..276910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1896 hypothetical protein; SPTR:
FT                   Q2RH93 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44675"
FT                   /protein_id="ADO44675.1"
FT                   /translation="MKLLLITLLFIKLSFSHPVLDIINNPYAVPYFLNLASIDLISDPS
FT                   NITKVKSYMQWYLNHLNYPDRYGLTGTIYDYYITEDSEVPLYTYDSADAYSATFLFLTY
FT                   LYAERTNDYHFIREKLQKLKDMAYVIAYLQDTDGLVKALPYINLKYLVDNIEDVCGLRA
FT                   FSLLLWKLSDPDWHYYFVLSHNVEKAVMKNLIWHGQIAWAKLDNELFIAGNSAVYPDLY
FT                   AKAVFYSFVGKPVPDEWVSRFDYFQRMVIRMVKMCRRLASNPHP"
FT   gene            276935..277663
FT                   /locus_tag="Hydth_0270"
FT   CDS_pept        276935..277663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0270"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /EC_number="2.6.99.2"
FT                   /note="COGs: COG0854 Pyridoxal phosphate biosynthesis
FT                   protein; InterPro IPR004569:IPR013785; KEGG: aae:aq_1423
FT                   pyridoxine 5'-phosphate synthase; PFAM: Pyridoxal phosphate
FT                   biosynthetic protein PdxJ; PRIAM: Pyridoxine 5'-phosphate
FT                   synthase; SPTR: O67417 Pyridoxine 5'-phosphate synthase;
FT                   TIGRFAM: pyridoxal phosphate biosynthetic protein PdxJ;
FT                   PFAM: Pyridoxal phosphate biosynthesis protein PdxJ;
FT                   TIGRFAM: pyridoxine 5'-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44676"
FT                   /protein_id="ADO44676.1"
FT                   /translation="MRLGVNIDHVATLRQARKTFEPSPVFAALIAQQAGADQITLHLRE
FT                   DRRHIQDRDLELIKELVNLPVNLEMAPTQEMREIALRVKPSRITLVPERRQEITTEGGL
FT                   NVPEMMDFLRSYLKPFKEKKIEVSLFIEPNVDHVRASKDVGADAVELHTGRYANLWKEG
FT                   NKLLIKEEIERIKRAGMEAKSLGLKVYAGHGLTYQNVGEFVTELKGVVEELNVGHSIIS
FT                   NAVIFGLERAVKEFLHLIRG"
FT   gene            277685..277948
FT                   /locus_tag="Hydth_0271"
FT   CDS_pept        277685..277948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_1201 hypothetical protein; SPTR: A8UY25
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44677"
FT                   /protein_id="ADO44677.1"
FT                   /translation="MAQKEELKPESLEQEVEELRKSVFKLLELFLPPKDVRKEIMKNLY
FT                   TAELSLLKVFKTLLDYKVSQIERKIEEKEEKKRERVKKVEVE"
FT   gene            complement(277949..279379)
FT                   /locus_tag="Hydth_0272"
FT   CDS_pept        complement(277949..279379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0272"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="COGs: COG1640 4-alpha-glucanotransferase; InterPro
FT                   IPR003385:IPR017853:IPR013781; KEGG: aae:aq_723
FT                   4-alpha-glucanotransferase (amylomaltase); PFAM: glycoside
FT                   hydrolase family 77; PRIAM: 4-alpha-glucanotransferase;
FT                   SPTR: Q1Q1C3 Strongly similar to
FT                   4-alpha-glucanotransferase; TIGRFAM:
FT                   4-alpha-glucanotransferase; PFAM:
FT                   4-alpha-glucanotransferase; TIGRFAM:
FT                   4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44678"
FT                   /protein_id="ADO44678.1"
FT                   /translation="MRLAGILLHITSLPSSFGVGDLGPTAYEFVDFLEASGQKLWQILP
FT                   LNPTCMEFGNSPYFSISLFAGNPLLISLELLCKEGLLSDKDIQRAKFQSDRVDYERASR
FT                   IKMELLEKAFSNFSQTPEYLSFEEENGYWLEDYCRFKVLRDRFKKPWREWESESVKELE
FT                   LQIKKEKFFQFLFFKQWKTLKAYANSKEIRIMGDLPIYPAFDSSDVWSHRDLFKLDENN
FT                   MPYVVAGVPPDYFSPTGQLWGNPVYNWDRLKETGFHWWIERIRHNLKLFDLLRLDHFRG
FT                   FVAYYEVPASEKTAIVGRWVNAPAEEFFAKLKREFPDFPFVAEDLGLITPDVERIRDSF
FT                   GFPGMKVLAFAFEEDNHPFMPHNHQKNSFVYTGTHDNAPIRSWFLEELSSASKERLFRY
FT                   LGRAVDEEQVSDVLIRLAYMSVAKACVIPMQDILNLGKEARMNTPGKKEGNWEWKLKSI
FT                   PDEKVAQRLRELCTTYGR"
FT   gene            279395..279814
FT                   /locus_tag="Hydth_0273"
FT   CDS_pept        279395..279814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_1241 hypothetical protein; SPTR: A8UY28
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44679"
FT                   /protein_id="ADO44679.1"
FT                   /translation="MKKVLAFLTLFIFSCQPVPKNVPIEKYRNQFIKGVVDVSAELKSK
FT                   IPNGDHFLIISVRDLENPMPVAVLRVKNPKFPYNFKITGKNKIDNSRIMEGDVILTARV
FT                   SRSPMAEAQKGDLLGSLQTKVGTQNNNILINAEVK"
FT   gene            279814..280272
FT                   /locus_tag="Hydth_0274"
FT   CDS_pept        279814..280272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG2862 membrane protein; InterPro IPR005134;
FT                   KEGG: dev:DhcVS_1409 hypothetical protein; PFAM: conserved
FT                   hypothetical protein; SPTR: Q3ZVZ7 Putative uncharacterized
FT                   protein; PFAM: Uncharacterized protein family, UPF0114"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44680"
FT                   /protein_id="ADO44680.1"
FT                   /translation="MIRKMLELGQAIAFLPAISLFLGATFLALYGVYILLETIYSVVFK
FT                   PEVRDPAVLSTKFISVMDIHLLSIVLYIFSVGLYELFVGKLNVPDWLRITNIDQLKAKL
FT                   ASVIVLILAITFTKKVVEWKDPLDTFLFALAITAIVAVLIFYYKVKEE"
FT   gene            280318..281193
FT                   /pseudo
FT                   /locus_tag="Hydth_0275"
FT   gene            complement(281207..281280)
FT                   /locus_tag="Hydth_R0013"
FT   tRNA            complement(281207..281280)
FT                   /locus_tag="Hydth_R0013"
FT                   /product="tRNA-Arg"
FT   gene            complement(281291..281545)
FT                   /pseudo
FT                   /locus_tag="Hydth_0276"
FT   gene            complement(281542..282051)
FT                   /locus_tag="Hydth_0277"
FT   CDS_pept        complement(281542..282051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0277"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COGs: COG0242 N-formylmethionyl-tRNA deformylase;
FT                   InterPro IPR000181; KEGG: aae:aq_579 polypeptide
FT                   deformylase; PFAM: formylmethionine deformylase; PRIAM:
FT                   Peptide deformylase; SPTR: O66847 Peptide deformylase;
FT                   TIGRFAM: peptide deformylase; PFAM: Polypeptide
FT                   deformylase; TIGRFAM: peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44681"
FT                   /protein_id="ADO44681.1"
FT                   /translation="MVREIIKFPHPVLKMPTQKVDVIDKDVQSIVGDMFETMYHAEGVG
FT                   LAANQIGISLSIMVIDTSKKEDSPLLKAVMINPELLEAEGEVKYKEGCLSFPGLSVEVS
FT                   RYSKVKVKALDINGEEKLYLLEGFPAIVFQHEMDHLMGITFIDRVNGIKRRLALDKYAK
FT                   LQKEKV"
FT   gene            282162..282437
FT                   /locus_tag="Hydth_0278"
FT   CDS_pept        282162..282437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0278"
FT                   /product="transposase, putative"
FT                   /note="KEGG: csc:Csac_2605 transposase, putative; SPTR:
FT                   A4XMP2 Transposase, putative; TIGRFAM: transposase,
FT                   putative, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44682"
FT                   /protein_id="ADO44682.1"
FT                   /translation="MLTLQCKLILDKKDKKKLLDIMRVQSSAVRYAYNRLLESNNPKSL
FT                   HTFNTITKQLQETFKLLERNQNPRKIIFRGRELFEKLQKRRIKGSL"
FT   gene            complement(282553..282837)
FT                   /locus_tag="Hydth_0279"
FT   CDS_pept        complement(282553..282837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: min:Minf_0043 hypothetical protein; SPTR:
FT                   Q2HX23 Putative uncharacterized protein orf85"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44683"
FT                   /protein_id="ADO44683.1"
FT                   /translation="MLADTLYRLMLYGFLMVLFACFYAILYALGRASHLPSLQRLSYGF
FT                   GVLEFLSGLGMVASDYLDTFWRVLILFSIIAYLFIPPIMWRVVVAFHER"
FT   gene            complement(282827..284236)
FT                   /locus_tag="Hydth_0280"
FT   CDS_pept        complement(282827..284236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0280"
FT                   /product="Nitric-oxide reductase"
FT                   /EC_number="1.7.2.5"
FT                   /note="COGs: COG3256 Nitric oxide reductase large subunit;
FT                   InterPro IPR000883; KEGG: min:Minf_0042 nitric-oxide
FT                   reductase subunit B; PRIAM: Nitric-oxide reductase; SPTR:
FT                   Q2HX24 Nitric oxide reductase cytochrome b subunit; PFAM:
FT                   Cytochrome C and Quinol oxidase polypeptide I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44684"
FT                   /protein_id="ADO44684.1"
FT                   /translation="MERLYESQRLAIWYFWTAIALFGAQLLFGLLAAYQFINPDFLYGT
FT                   LNFMTNRMLHINAMVIWLLMGFIGGIYWFLPLETQREIVGIKLGKLAYFAFVITVAIVV
FT                   LVFLIKQFGKGDFFTLWFITEGREYVEAPRWADIGVVAVALIVAYNVVATVLASRRLTG
FT                   ILGVLIVDLAALFGLYLAGMFFTPNITVDQFWWWWVVHLWVEATWEVLVGVLMGWLLMH
FT                   LLGTPRKIIEAWLYIEVMLVFGTGILGLGHHYYWIGTPPYWLGIGGFFSSLEPLPLVAM
FT                   VIHAVYDAGVHRLQTVNRPALFWAFAQAFGNLFGAGVWGFMHTLPQINLFSHGTQLAAA
FT                   HGHLAFFGAYVAANLAIFYYILGKTRVKEGYIMNGAVWRIAYIGLIIGMFGMVASLTVA
FT                   GFAQTMIERASLGSTWEAYIQAQMHPWMEHAYRWRFFFGLIFALSYMALLYDLLTAGKR
FT                   VEQVKEAELAR"
FT   gene            complement(284255..284929)
FT                   /locus_tag="Hydth_0281"
FT   CDS_pept        complement(284255..284929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0281"
FT                   /product="nitric-oxide reductase subunit C"
FT                   /note="InterPro IPR009056; KEGG: min:Minf_0041 nitric-oxide
FT                   reductase subunit C; SPTR: Q2HX25 Nitric oxide reductase
FT                   cytochrome c subunit; PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44685"
FT                   /protein_id="ADO44685.1"
FT                   /translation="MSVGWLEVVVATLFISIVVSLILARGRHWLEPGFWKIAAVITSSV
FT                   MAITLVLLTVDTSRQISMGSKRVPSPSVINREIGYVYDAERMAMVPALGKEVGLFGRVW
FT                   SEEEAEKLVTKGKLVIQSRNCMDCHTLLGNGAYYAPDLTKAWLDPKWEKQLMPMTGAKT
FT                   REEAMRAFLMNPDKYPTWVRRMPNLKLSEDEAMAVVAYLKWMSTIDTNGFPANFPEVKV
FT                   SQ"
FT   gene            285052..286701
FT                   /locus_tag="Hydth_0282"
FT   CDS_pept        285052..286701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0282"
FT                   /product="ResB family protein"
FT                   /note="COGs: COG1333 ResB protein required for cytochrome c
FT                   biosynthesis; InterPro IPR007816; KEGG: aae:aq_2082
FT                   hypothetical protein; PFAM: ResB family protein; SPTR:
FT                   A8UT67 Putative uncharacterized protein; PFAM: ResB-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44686"
FT                   /protein_id="ADO44686.1"
FT                   /translation="MLKGFFPIVVSSLFFLATIIAGLFYLDERGVLYYALLFLSASFFI
FT                   LSLVGPTIRVVKAFVEDYRRHKSFLDFLYDFFSSLKLAIFLMVSIGVLSMLGSTYIQQN
FT                   QPLGFYLDKFGVDVGLWFWKLWLTDVFHSWYYMLLIVLLAVNLIVCSVKRLPRVWIQTF
FT                   TKERFQRLDQHTQKHLKPISIKTNSSKDKVIAFLKKMGFKVYTEEEDGKVYFYGEKGRY
FT                   SRLGVYVVHIGLLVIMAGALIDAIWGVRGSVIVPEGSRSDTLVIPSKEVGLKLPFQIEL
FT                   ENFRIVTYGEEAQERGKKISTPFKDDVASFESDIRIIKDGKVVAEGMTAVNSPFDFGTY
FT                   RIFQATYGLTGEAGTVRLVIFDKEKAVKDPRSALVGEVVLKAGKVAEFKDMLLSIDRST
FT                   LNIENEQAGMNGDLKPALVVKVLLNHKAYDVPVVYSPELTLIAYNQMKELKDFPYVFFM
FT                   SDFRPRFFSGFQVSRQPGTPIVWLGSIMVVGGMIVAFYTIHRKVWMRLEGDTLWVAFWS
FT                   HKLKEDFKRSFIKALEELKHEGTSDGKESYAA"
FT   gene            286661..286963
FT                   /locus_tag="Hydth_0283"
FT   CDS_pept        286661..286963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_2140 hypothetical protein; SPTR: O67897
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44687"
FT                   /protein_id="ADO44687.1"
FT                   /translation="MKVLLMEKNLMLLSRIKSSLSEYEVRVGDKHTDEDVVFINVEAFP
FT                   VDTIKELKSKGAKVVAYCGHKNIDLQSKARKAGADAVVPNSQVIDAKAIIEKLGG"
FT   gene            286981..290205
FT                   /locus_tag="Hydth_0284"
FT   CDS_pept        286981..290205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0284"
FT                   /product="helicase domain protein"
FT                   /note="COGs: COG0513 Superfamily II DNA and RNA helicase;
FT                   InterPro IPR014021:IPR001650:IPR006935:IPR014001; KEGG:
FT                   pmo:Pmob_1535 helicase domain-containing protein; PFAM:
FT                   helicase domain protein; type III restriction protein res
FT                   subunit; SMART: helicase domain protein; DEAD-like
FT                   helicase; SPTR: A9BGJ6 Helicase domain protein; PFAM:
FT                   Helicase conserved C-terminal domain; SNF2 family
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44688"
FT                   /protein_id="ADO44688.1"
FT                   /translation="MGAPSTDLSFITNEGGISLKDRLLALIKDCETFDCIVGYFYLSGF
FT                   HLIYKALENTKKIRILTGMGIDPKSAHIIHSAKEIKEKAQKKMEEELEDCEDSYEVESA
FT                   IRRFVEWIESGKLEIKAYPDGRLHAKVYIMTFREGDRDLGRVITGSSNLTQSGLEGNLE
FT                   FNVELKNRADYEYAKKKFEELWSQAVDITEDYVKTITEKTWLNDKITPYELYLKFLYEY
FT                   FRDELKAGDFELKLPSGIKRLKYQEQAVINAKRILEAYGGVFISDVVGLGKTYITAMLL
FT                   KQLDGRTVVIAPPNLIDEKNPGSWVNVLDSFKINARFFSTGKLDDAISYIQSKDSEDPI
FT                   KNVVIDESHRFRTEDTKSYEKLAQICRGKRVILVSATPYNNHPIDILSQLKLFQSPRKS
FT                   LIPGVPNLESFFKKLDKKLKEAKKEGEEEYVRVSREVSKEIREKVLKHVMIRRTRRDIL
FT                   NYFREDIDKEGIKFPEVEPPKPIYYQLEKEEDDIFMETLRILTKDIKYSRYKVLTYHKN
FT                   EDIRNKLLTSQKNLATIMKILLVKRLESSFHAFKNSINRFVKYYENFIKEYEKGHVYVS
FT                   KEHINKLFELLEEEDYEAIEKLIEEDKVQRYPREEFFEKLEKDLYEDLSSLRRIKQMWD
FT                   NIKRDPKLEKLIKELEENPILKNNKVIIFTESKETAEYLYQELTKKFGNTVLLFHGSAS
FT                   ENHKELLIKNFDANLPQKQQDNTYRMLVTTDTLAEGINLHRSNIIINYDIPWNPTKIIQ
FT                   RVGRVNRIGTKFDTIYVFNFFPTEKADSEIELTKIARSKVEAFLNMLGEDSAILTQDEP
FT                   VASHELFDKLVSKEVLEEDKEEESEIKYLRIIEEIRDKDPKLFEKIKHLPKKARSSKRF
FT                   SESLRDIASSNSLLTFFRKGKLMKFFLSDKEKTVELDFLTAAKILESQQNEKRAEFPPS
FT                   KDFYELFNKNKEAFMNATEDEIVETHRQAGRSSYNDLLKILKAVLRNGKELTEEQQEYY
FT                   KTLINRLEEGAIPKKTVQKTLKELNALKEDIQDPIKVLSVCQRTIPSALLKSHYAQAPA
FT                   LEESKREVILSLYLQGDEHHKYFGVD"
FT   gene            290206..294432
FT                   /locus_tag="Hydth_0285"
FT   CDS_pept        290206..294432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0285"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="COGs: COG1002 Type II restriction enzyme methylase
FT                   subunits; InterPro IPR011462:IPR002052; KEGG:
FT                   hya:HY04AAS1_1423 hypothetical protein; PFAM: protein of
FT                   unknown function DUF1568; SPTR: B4U5R8 Putative
FT                   uncharacterized protein; PFAM: Transposase IS200 like;
FT                   Eco57I restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44689"
FT                   /protein_id="ADO44689.1"
FT                   /translation="MNREQAKRLVIETFENPFDEKKFIEFIANLLKTYDRSKALEPRSG
FT                   IQGITERYLDFISSWKRIGRYEDEDGRKIDILIVYLKKETSLYRARTAQRNFVAEYLQG
FT                   KLGTDSKKYAALVAFVSSPEDWRFSLVKMDYKFVGGRVKEEFTPAKRFSFLVGKNEKSH
FT                   TAQSRFLPLLESDKYPTLEDLEEAFNVEVVTEEFFRKYRDLFIRTKLELDKIVQTNPKV
FT                   RQEFENKNINTVDFAKKLLGQIVFLYFLQKKGWFGVKRGASWGSGPKDFIRRLFNGEYG
FT                   KYDNFYNDILEPLFYEALRTDRSADDHYYSRFNCKIPFLNGGLFDPINNFDWVNVDILL
FT                   PNELFSNKNKTKEGDIGDGILDVFDRYNFTVNEEEPLEKEVALDPELLGKIYEKLNAIR
FT                   PDNFDEYVKVLKSGKKGDETKFNKEYGVYYTPREIVHYMCQESLINYLETELAGKVKRE
FT                   DLEKFVRYADLFLEHERTAFEKRERIERGEQKETKYEHRIPESIIQNAELIDKLLADIK
FT                   VCDPAVGSGAFLVGMMHEIVKLRQLLSVYKSSTGIPESSTGTGISACDTYGEGELKITR
FT                   RNLPHWTKPGSIYWVTFRLADSLPQEKLRQWKEEYEMWLKRNPKPWNEKQWKEYNEKFG
FT                   ERIEKWLDSGYGSCILAKPEVREILKECLFKFDKERYLIHAVVIMPNHVHLLIEPFSGY
FT                   SLSELLKGIKGASAYYINKLLNSTGNKVWMEESYDHIVRSEKEYLRFVQYIIDNPKKAN
FT                   LPDDKYWLYVSQTAMSVVHGVKQAILPVSEKETQKGTLQTGMSSQTGMSQQTGMSVLHY
FT                   DLKRHCIENSLYGVDIDPGAVEVCRLRFWLSLVVDEEDFYSIKPLPNLDYKVVQGDSLL
FT                   GVEKNLFNQEDFRKLEELKKKYFNEANPRQKQNYKRQIDELIYKITNGHKEFDFRVYFS
FT                   EVFHEKGGFDIVIGNPPYVRQERIKHLKPKLEKAYKDFFVSTADLYTYFYKKSYDILRK
FT                   NGVLCFISSNKWMRAKYGEKLRKFLKENTKVIEVVDFSGYRVFEQTVDTNIITLLKSKP
FT                   EKGHLVSFVNVGSDVDDDVIKYIRNNKKTILQEKLSDSAWTLAEDKVLAIKEKIEKIGT
FT                   PLKDWDVKIYRGVLTGYNEAFIIDTETRNKILANCKTEEERKRTEEIIKPVLRGRDIEK
FT                   WRYKWAGLWLIYIPWHFPLHNNPNISGASKEAEERLKQLYPSLYEHLLKYKEKLLNRNK
FT                   EETGIRYEWYALQRWASDYYPEFEKEKIVWQRVTQQFSFCIVPKGIYVLDSMAFMVGNN
FT                   LRFLIGVLNSRLIDYYIRTYVHQYADKGFLLSNQYVERIPIPKVPSSQQKPIIDLVDKI
FT                   LECTTGTFACDYKNTDKNVHATSDYETNQQKQARVKELEKQLDQLVYKLYNLTEEEINI
FT                   IEGNKI"
FT   gene            294429..294524
FT                   /locus_tag="Hydth_0286"
FT   CDS_pept        294429..294524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44690"
FT                   /protein_id="ADO44690.1"
FT                   /translation="MMNNVLDDIVFDALGLTEEERKRSTGQLLSL"
FT   gene            294559..295884
FT                   /locus_tag="Hydth_0287"
FT   CDS_pept        294559..295884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0287"
FT                   /product="Gp37Gp68 family protein"
FT                   /note="COGs: COG4422 Bacteriophage protein gp37; InterPro
FT                   IPR011101; KEGG: rca:Rcas_0327 Gp37Gp68 family protein;
FT                   PFAM: Gp37Gp68 family protein; SPTR: B6AS61 Putative phage
FT                   protein Gp37/Gp68; PFAM: Phage protein Gp37/Gp68"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44691"
FT                   /protein_id="ADO44691.1"
FT                   /translation="MKEYRLKEVSKAKHIILEKYFPAWARILKSKHQTLIYVDCFAGSG
FT                   RYSSGEEGSPLIVARKANELIEKDKSMKFYLIFVEKNKKSAQELEKQLKSYERENVKIF
FT                   VFNEDSHDFVPELLEKIPKNIPAFFFIDPYGHPLSIPVINKILSMQRKEILLNLMWYAI
FT                   NMHLNNPKAEQTINRMFGNTDWKNQNFIRKERENNFVEYFIRQVNAKYNFKFRIRFSPE
FT                   DKVHGGENRTKYYLIHFANHERAILLMKEVMWTIGDEEGTFDYSASHQEILFSRTPTVE
FT                   QLEDVPAHFIKSVFEVMNRAKHLTFQVLTKRSERLLEISKELEWTENIWMGVSVENSNY
FT                   IYRINYLLQTPAKIKFISFEPLLGPIYEFPTKGIDWVIVGGESGPNARPMLKEWVMEIY
FT                   RICRENNIPFFFKQWGGVSKRKNGRELNGKIYEEYPYAKKQG"
FT   gene            295908..296228
FT                   /locus_tag="Hydth_0288"
FT   CDS_pept        295908..296228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0288"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="COGs: COG1669 nucleotidyltransferase; InterPro
FT                   IPR002934; KEGG: dth:DICTH_1832 nucleotidyltransferase;
FT                   PFAM: DNA polymerase beta domain protein region; SPTR:
FT                   B5YBB5 Nucleotidyltransferase; PFAM: Nucleotidyltransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44692"
FT                   /protein_id="ADO44692.1"
FT                   /translation="MNREKITRKDEVIEKLRENMGKLREFGVKRIGIFGSVVKEALRTD
FT                   SDIDLIVEFERGKATFKNVSGLIDFLEDLFGRKVDILTPDGIASIRISHIRHQIEREIE
FT                   YV"
FT   gene            296221..296574
FT                   /locus_tag="Hydth_0289"
FT   CDS_pept        296221..296574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0289"
FT                   /product="protein of unknown function DUF86"
FT                   /note="COGs: COG2361 conserved hypothetical protein;
FT                   InterPro IPR008201; KEGG: tle:Tlet_1463 hypothetical
FT                   protein; PFAM: protein of unknown function DUF86; SPTR:
FT                   A8F785 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44693"
FT                   /protein_id="ADO44693.1"
FT                   /translation="MYKRGDREFVLDMLFACNKIMNYTKGLTYEDFKKNEMVIDAVTRN
FT                   IEILGEASKSISDGLKNKYPEVGWKEIARTRDKIIHFYFGINLEIIWDIVIEDIPKLKT
FT                   ELEKIIKLEGWSL"
FT   gene            296577..297308
FT                   /locus_tag="Hydth_0290"
FT   CDS_pept        296577..297308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aas:Aasi_0589 hypothetical protein; SPTR:
FT                   Q1Q2B6 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2851)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44694"
FT                   /protein_id="ADO44694.1"
FT                   /translation="MKTIDLNHLGEKWLELKKQRMQNLLKIALTDEALYREIMISLGYS
FT                   KNKVNFLELAIITPYSEIRKLKEKSIIEKALLYRAGFIDDKNGLPDDFDFSLRMDKSVW
FT                   IYKGIRPANFPEKRIEGISVLLSKTTECGLVNFFLERIKSEIGSKNLKKSLKSIMNFEG
FT                   IGLSRKEEMFFNTIMPFMMVYSQDDEVQNFLRFMFENYPPLSENSLIKSFRLSYPEVKI
FT                   ENLKTYMGAILFQKTNPGQSS"
FT   gene            297365..300391
FT                   /locus_tag="Hydth_0291"
FT   CDS_pept        297365..300391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0291"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="COGs: COG0525 Valyl-tRNA synthetase; InterPro
FT                   IPR019754:IPR002303:IPR002300:IPR013155:IPR
FT                   019499:IPR009080:IPR009008:IPR010978:IPR001412:IPR014729;
FT                   KEGG: hya:HY04AAS1_1214 valyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ia; tRNA synthetase
FT                   valyl/leucyl anticodon-binding; Valyl-tRNA synthetase,
FT                   class Ia, tRNA binding arm; SPTR: B4U9T8 Valyl-tRNA
FT                   synthetase; TIGRFAM: valyl-tRNA synthetase; PFAM: tRNA
FT                   synthetases class I (I, L, M and V); Anticodon-binding
FT                   domain; TIGRFAM: valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44695"
FT                   /protein_id="ADO44695.1"
FT                   /translation="MKDIGKYDHKAVESKHSRRWIESAIYSSGSDQREEKFSVVIPPPN
FT                   VTGSLHMGHALNATLQDMVCRWQRMMGKKVVWVPGFDHAGIATQYVVDKKLQQEGKDRL
FT                   EVGREEFLKEVWKWVPISRGAIREQLEKLGVSVDWKRERFTLDEGFSRAVRYAFRKLYE
FT                   DGLIYRGEYIVNWCPNDLTALSDLEVEHEEEDGKLYYIKYPLEDASGYITVATTRPETM
FT                   LGDTAVAVHPQDERYKHLVGKRVRLPLVSWKRKAMSGEEVSEYIPIVADESVLSDFGTG
FT                   AVKITPAHDPTDFQIGKRHNLPFVQVMDQHARMNENAGEFAGLDRYEARQQIVKRLEEL
FT                   GLLEKVEDHRHAVGKCYRCKTTLEPMVSVQWFVRVSDERIKKAAIKVVEEGKIRFIPEG
FT                   WKKIYLQWMENLKDWCISRQIWWGHRIPVWYCQDCGKESVYTDDDFDRVYDKLIFNLIA
FT                   DGKIDYEFTPEEVEKVLHSPSFVHPNMTVLDFYKKFAFHKYHSTEVSAHSLRLFFTQDI
FT                   NPMAILTEKKNRYRYDPKTKKYRFVLRCKHCGSERLRQEEDVLDTWFSSALWPFGVFGW
FT                   PEEAQDLKNLYPTDLLVTGFDIIFFWVARMIMMGTYFTGDVPFVDVYIHALVRDEKGQK
FT                   MSKTKGNVIDPLDIVERYGADALRFTLAILTQQGRDIKLSEKRFEGYKHFANKLWNAGR
FT                   FILMNLDQDLLANLPYAAPPRSEDLWITTKLNQTVRKVNEALSQYEFSEAAQALYEFVW
FT                   SEFCDWYLEMSKLRLYAKPTENLPEEERQKEEQRIKAERITAQATLLKIFDSVLKLLHP
FT                   FMCYITEELYSHLPTSHLESVSLCQYPQYNPQDVFEQAHEKVEKLKGVISSVRALRSDL
FT                   RIEPSRKIRLYCRGEGWKEMLTEFEEHIKSLVKVEELIHTQERPPRAVAGFYKDLEFFL
FT                   SVEEGINIEELINSYTKRHKEVVKSLESVERRLQNPSFLEKASREEVEKVQKIREELLA
FT                   EKAKLEELLKSLEEARVSS"
FT   gene            300388..301308
FT                   /locus_tag="Hydth_0292"
FT   CDS_pept        300388..301308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0292"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR011912:IPR001509:IPR016040; KEGG:
FT                   aae:aq_344 ADP-L-glycero-D-manno-heptose-6-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; SPTR: A8US79
FT                   ADP-L-glycero-D-manno-heptose-6-epimerase; TIGRFAM:
FT                   ADP-L-glycero-D-manno-heptose-6-epimerase; PFAM: NAD
FT                   dependent epimerase/dehydratase family; TIGRFAM:
FT                   ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44696"
FT                   /protein_id="ADO44696.1"
FT                   /translation="MRVLITGGAGFIGSNIAKQLERSYPNAKVYVLDDFSSGHFKNLIG
FT                   FRGEVITGNISDPSLWEWLAQNYQFDVVFHKAAITDTTIMDQALMMKTNADSFRHLLKC
FT                   AVKWKAKVIYASSAGVYGNVEPPMREEGPQEPENVYGFSKLIMDRIALNFLEEHKDIKL
FT                   IGFRYFNVYGEGESYKGKTASMVYQLYKKIASGEKARLFKWGEQRRDFVYIKDVIKANM
FT                   LALEKDVSGIFNIATGESRSFNEIVDILSIELNTKPEVEYFDCPYDFYQQHTQADISKA
FT                   REVLGYTPDFSLEDGIRDYIKVLRA"
FT   gene            301305..302216
FT                   /locus_tag="Hydth_0293"
FT   CDS_pept        301305..302216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0293"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COGs: COG0548 Acetylglutamate kinase; InterPro
FT                   IPR011148:IPR001057:IPR004662:IPR001048; KEGG: aae:aq_2068
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PRIAM: Acetylglutamate kinase; SPTR: O67848
FT                   Acetylglutamate kinase; TIGRFAM: acetylglutamate kinase;
FT                   PFAM: Amino acid kinase family; TIGRFAM: acetylglutamate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44697"
FT                   /protein_id="ADO44697.1"
FT                   /translation="MIEELIQKAKILQSALPYIRKFYGKTFVVKYGGSAMLEESLRESF
FT                   AKDVLLLRYTGIKVVVVHGGGPQISAALEKFGIKSTFVGGLRKTDQETMHVVEMVLSGD
FT                   INKDIVALINKHSGEQIYAVGLSGRDGNLIRAKKLNKEEYFREIGLEVPREDIGFVGEV
FT                   LSVNTHLLQALMDNGYIPVIAPVGVGEDGQAYNINADIVASEVARYTKAEKLLFLTDTE
FT                   GIKDKDGKTISSLSREEAYRLISEGTIKGGMIPKVKSALRALQEGVGKVHIVDGRIPHS
FT                   ILLEIFTEEGVGTEIVNQRSMD"
FT   gene            302393..303013
FT                   /locus_tag="Hydth_0294"
FT   CDS_pept        302393..303013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_0416 hypothetical protein; SPTR:
FT                   B4U7J5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44698"
FT                   /protein_id="ADO44698.1"
FT                   /translation="MDDVKVKASEYAELTGVSLNTVKNRIRAGVVRGGKEEDGIWYVYL
FT                   SQDEYHHLMRSQEKRGERQREINNSLEKLKASFEGQLIATYIEIQMLKDLQKEELLHEM
FT                   SSLYTLLAVREKEIQIMRNQLEEAEKALKEREESLKELQKKLAELEKSLRALENQLRDK
FT                   ELSLAEKDIQMQKMLLEKEKELLSKTAQIEQLKRELEIKGGKE"
FT   gene            303024..303890
FT                   /locus_tag="Hydth_0295"
FT   CDS_pept        303024..303890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0295"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR004107:IPR002104:IPR011010:IPR010998:IPR
FT                   013762; KEGG: aae:aq_1137 hypothetical protein; PFAM:
FT                   integrase family protein; integrase domain protein SAM
FT                   domain protein; SPTR: A8USU5 Putative uncharacterized
FT                   protein; PFAM: Phage integrase, N-terminal SAM-like domain;
FT                   Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44699"
FT                   /protein_id="ADO44699.1"
FT                   /translation="MDKDHLLDTWKRSLERTKSARTVITYIKSLESFIKHIGEKDLIHI
FT                   DPRRIYEYVDTSSLNTSSILTHLSAIKHFYKFAFRRGYVDKEKYSDIESVIDEVREDLG
FT                   RNIAKRYPKALTEEEINKILSAVKGAKYEKIYVLFLYSGIRLSEYLSLRKSDFYQDKSG
FT                   LLWIRLSADITKRRKERLVPVLGSSKEETYAVIDRLLVWIESYEENFRVKRGSLQVFTN
FT                   RLSRKLCIPFSLHSFRHTYITNLVNSGFPAEVVKEFAGHSNVRTTIDIYYKFSQERARQ
FT                   LVENFLK"
FT   gene            303887..304633
FT                   /locus_tag="Hydth_0296"
FT   CDS_pept        303887..304633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0296"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="COGs: COG0336 tRNA-(guanine-N1)-methyltransferase;
FT                   InterPro IPR002649:IPR016009; KEGG: aae:aq_1489 tRNA
FT                   guanine-N1 methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase; PRIAM: tRNA
FT                   (guanine-N(1)-)-methyltransferase; SPTR: A8USU7 tRNA
FT                   (guanine-N(1)-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (Guanine-1)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44700"
FT                   /protein_id="ADO44700.1"
FT                   /translation="MKFFVLTIFPEMIHVYAQYGIVKQAIKKGSLTIEVIDLRQYADKG
FT                   RVDDEAYGGLPGMVIKPEPVFRAYKSITERYGRPYTILPEPWGKRLVQQDLDRLSQKES
FT                   LAVICGRYEGIDERVKVLADEELSLGDFVLSGGEIFALALLEGVARLLPDVLSEPESLL
FT                   SDSFRRWLGYPVYTRPPEYEGLRVPDVLLSGNHKLIELWKLWHSIERTLTYRPDLIPED
FT                   ITSLERDMMESIKKGIKFEEWIKTRR"
FT   gene            304638..305552
FT                   /locus_tag="Hydth_0297"
FT   CDS_pept        304638..305552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0297"
FT                   /product="beta lactamase precursor"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: aae:aq_974 beta lactamase precursor;
FT                   SPTR: O67103 Beta lactamase; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44701"
FT                   /protein_id="ADO44701.1"
FT                   /translation="MVRALFTLLMAVFLAFSYEIKLRKVDKDIYMVRGEDALPSLKNGG
FT                   FISNAFAVYTEEGWVVIDTLSTPELSEKFLKELLKVKKAPVKYTIITHYHPDHWYGAKT
FT                   FKDAKAKMVAHKKLKELYDSGEAKAILEEANRSFNGLYDSVVLVPPDIVVEDKVRLKAG
FT                   SRTFDIISMTPAHTNSDIVVYMPDRKVLFAGDLVYYKRIPFMGDRNASSKGWEEVLRRI
FT                   KSMDIKLILGGHNEPMDKKAIDYTLGYITYLRENIRMMKQEGKFIDEIKQALSDSPYKK
FT                   DAMYQEFHNANIFRVDMELDLEP"
FT   sig_peptide     304638..304688
FT                   /locus_tag="Hydth_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            305549..306808
FT                   /locus_tag="Hydth_0298"
FT   CDS_pept        305549..306808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0298"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /note="COGs: COG0621 2-methylthioadenine synthetase;
FT                   InterPro IPR005839:IPR005840:IPR002792:IPR013848:IPR
FT                   007197:IPR006638:IPR013785; KEGG: aae:aq_849 hypothetical
FT                   protein; PFAM: Protein of unknown function UPF0004 ;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: O67016 Ribosomal protein S12
FT                   methylthiotransferase rimO; TIGRFAM: MiaB-like tRNA
FT                   modifying enzyme YliG; RNA modification enzyme, MiaB
FT                   family; PFAM: Radical SAM superfamily; Uncharacterized
FT                   protein family UPF0004; TIGRFAM: MiaB-like tRNA modifying
FT                   enzyme YliG, TIGR01125; RNA modification enzyme, MiaB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44702"
FT                   /protein_id="ADO44702.1"
FT                   /translation="MKVGVISLGCAKNLVDTEVLLGKLKAGGATIVSDPRRADVIVINT
FT                   CGFIEPAKMEAIETILEFAGSKKVIVMGCLVQRYKEELKKEIPEVSAYFGTESWDSIVE
FT                   FLNLRSNESKRIITTPSSYAYLKVSEGCNRLCSFCAIPLIRGRHRSRPIEEVVEEAKYL
FT                   ADQGIKELCIVSQDTTYYGKDLYAKPYLVELLKALEKVEGIKWIRLLYLYPTEIDENLL
FT                   SYMAQSEKVLPYFDVPLQHVSTEVLKSMRRGYDEAFVREFVEKVRKNIANAVLRTTFIV
FT                   GYPLERERDYQKLLDFVREGHFHWVGAFTYYQEEGTHAYALGDPIPQREKEERKEELLR
FT                   VQRDITYQKNLSLVGKSFELLVDGFDEEFGFVPVGRIYAQAPEVDGITYVESDKELKAG
FT                   DVVKVMITQVGDYDVGAKVL"
FT   gene            complement(306805..307362)
FT                   /locus_tag="Hydth_0299"
FT   CDS_pept        complement(306805..307362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0299"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /note="COGs: COG1838 Tartrate dehydratase beta
FT                   subunit/Fumarate hydratase class I C-terminal domain;
FT                   InterPro IPR004647; KEGG: aae:aq_1679 C-terminal fumarate
FT                   hydratase, class I; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate beta region; SPTR: O67590 C-terminal
FT                   fumarate hydratase, class I; TIGRFAM: hydro-lyase, Fe-S
FT                   type, tartrate/fumarate subfamily, beta subunit; PFAM:
FT                   Fumarase C-terminus; TIGRFAM: hydro-lyases, Fe-S type,
FT                   tartrate/fumarate subfamily, beta region"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44703"
FT                   /protein_id="ADO44703.1"
FT                   /translation="MEKRIFTPLTDETIESLKAGDRVLLTGYIYTARDAAHKRMVEALN
FT                   RGEAPPFDMKGQVIYYVGPTPPKPGQVIGSAGPTTAIRMDKYVEPLLKLGLKGMIGKGY
FT                   RSQLVKDLLIKYKAVYFAAVGGVAVLLSKSIKSSEVIAYEDLGTEAIRRLYVEDFPVIV
FT                   ANDIYGGDVFEEGRKKFAQIDP"
FT   gene            307405..308496
FT                   /locus_tag="Hydth_0300"
FT   CDS_pept        307405..308496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0300"
FT                   /product="twitching motility protein"
FT                   /note="COGs: COG2805 Tfp pilus assembly protein pilus
FT                   retraction ATPase PilT; InterPro
FT                   IPR006321:IPR001482:IPR003593; KEGG: aae:aq_745 twitching
FT                   motility protein PilT; PFAM: type II secretion system
FT                   protein E; SMART: AAA ATPase; SPTR: A8URR1 Twitching
FT                   motility protein PilT; TIGRFAM: twitching motility protein;
FT                   PFAM: Type II/IV secretion system protein; TIGRFAM: pilus
FT                   retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44704"
FT                   /protein_id="ADO44704.1"
FT                   /translation="MTPTAQSQEVKLIDLLVKTVQLGASDLHITPGAKPSVRIDGRITP
FT                   LAEYPVLTPEITQRLAYSVMSERHRKELEEKGQVDFSFGVKDIGRFRSNVFFQRNSIAG
FT                   AFRRLPYKIMSVKELGLTEKVLELCHKSMGLILVTGPTGSGKTTTLASLINYINENFPY
FT                   HIITIEDPIEYVFQHKKSIVNQREIGEDVDSFASALRAALREDPDVILVGEMRDLETIE
FT                   IALRAAETGHLVFGTLHTNTAISTITRIIDVFPPSQQEQIRIQLSFVLQGVISQRLLPK
FT                   VGGGRVLAYELMIPNTAIRNLIRENKLQQVYAMMQSGQAETGMQTMNQSLASHYRAGLI
FT                   TLDDAFKYSPDVKELERMIGRSI"
FT   gene            308499..309722
FT                   /locus_tag="Hydth_0301"
FT   CDS_pept        308499..309722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0301"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR003004:IPR018076; KEGG: aae:aq_747
FT                   fimbrial assembly protein PilC; PFAM: Type II secretion
FT                   system F domain; SPTR: A8URR2 Fimbrial assembly protein
FT                   PilC; PFAM: Bacterial type II secretion system protein F
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44705"
FT                   /protein_id="ADO44705.1"
FT                   /translation="MPRFRYRAFGEDGSFIQQEVTYPSHELLVADLQQKGFTIVEVEEL
FT                   EEKKKRELNIQLPFLGGVSDRDISIFCRQLGTMINAGVNIIDAINILAEQLPNKMLSDA
FT                   SKQVAKMVSEGMNLSAAMNRFPKVFPELVVNLAKVGEETGNLDVALIRAAEYYEKMAMI
FT                   KSKIKSASFYPIFVVVIATIIVTGILYYLVPTFAQMYESLGGELPLPTQMLVNASNALR
FT                   NNLLTIIGVILLFSAVFRLLYQRSYAFRKSVHTFMLKVPKMGELVLKSSMAKFARTMAT
FT                   LFASGVALERAFDIAGQVTGNLVIKESVERAKKRVIEGKPMHASLEETGIFPKLVIAMV
FT                   RVGEDTGRLDEMLDTIARFYEDEFDRAVEGMIKLIEPALMVFIGGVVGMILVALYLPIF
FT                   KMGELIKG"
FT   gene            309757..310854
FT                   /locus_tag="Hydth_0302"
FT   CDS_pept        309757..310854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0302"
FT                   /product="GTP-binding protein YchF"
FT                   /note="COGs: COG0012 GTPase probable translation factor;
FT                   InterPro IPR004396:IPR006073:IPR002917:IPR013029:IPR
FT                   012676:IPR012675; KEGG: aae:aq_609 GTP-dependent nucleic
FT                   acid-binding protein EngD; PFAM: Protein of unknown
FT                   function DUF933; GTP-binding protein HSR1-related; SPTR:
FT                   A8UU40 Putative uncharacterized protein; TIGRFAM:
FT                   GTP-binding protein YchF; PFAM: GTPase of unknown function;
FT                   Protein of unknown function (DUF933); TIGRFAM: GTP-binding
FT                   protein YchF"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44706"
FT                   /protein_id="ADO44706.1"
FT                   /translation="MSLSVGIVGLPNVGKSTLFNAITESAKAQAANYPFCTIEPNVGVV
FT                   EVPDRRLYEIARLERSKKITPTFIEFVDIAGLVRNASQGEGLGNQFLAHIREVDAIAMV
FT                   LRCFEDPDIVHIEGSVDPVRDAQIIDLELIAKDLETVSKRLEKVEKMARIGDKKAKEEL
FT                   EKLSMLREILEGMEPVRRRELAQDVREYAERVLFLLTIKPVLYVANVDEEGLKGNEHLE
FT                   KVMGYARNEKAPVVAICAKLEAELVSLPAQDRKELLLAYGLEEPGLNRLVREAYKLLGL
FT                   ITFFTAGEKEARAWTIKRGTKAPQAAGKIHSDFERGFIAAEVINYEDYIKVGSISKAKE
FT                   MGLVRLEGRDYQIKDGDIVYFRFNV"
FT   gene            complement(310844..311887)
FT                   /locus_tag="Hydth_0303"
FT   CDS_pept        complement(310844..311887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0303"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: sul:SYO3AOP1_1197 glycosyl transferase
FT                   group 1; PFAM: glycosyl transferase group 1; SPTR: C4FJT7
FT                   Glycosyl transferase, group 1 family; PFAM: Glycosyl
FT                   transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44707"
FT                   /protein_id="ADO44707.1"
FT                   /translation="MKILWLNGNPNPNFGGTEIHTLQMVKELKKEGIDVLLVCARDSYV
FT                   DKHTEGVEKYHISFPNSLALISTIRLTSLAKRRKVDFLIANNGKEYLNVLLAGRLSGCR
FT                   VVFFRHMEKMKQWAVRKLVFPHVDLFLAVSKHVKENLIKEGVNQDRIRVIYNVVDEGRF
FT                   YYQEKQKDPVELVFVGKLDEGKGIMDFLQAFYRLSQTDKRVRAWIVGDGRLRQKVRAFI
FT                   TERGLQDRVFTVGYTPKVEDYYRMAHICVIPSKETEAFPRVALEALACGCALVVSDIGG
FT                   IKEAVEDGQNGFVFKAGSIEDLTEKMALAVRRWIELSQNALSLYRRKFSRDKVVKDFIE
FT                   ALESLKH"
FT   gene            complement(311884..312564)
FT                   /locus_tag="Hydth_0304"
FT   CDS_pept        complement(311884..312564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0304"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COGs: COG0726 xylanase/chitin deacetylase; InterPro
FT                   IPR002509:IPR011330; KEGG: sul:SYO3AOP1_1196 polysaccharide
FT                   deacetylase; PFAM: polysaccharide deacetylase; SPTR: B2VA34
FT                   Polysaccharide deacetylase; PFAM: Polysaccharide
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44708"
FT                   /protein_id="ADO44708.1"
FT                   /translation="MKVLTYHSIGMPPPEAKLKTLYVKPSVFKRQINTLRFLGYRFLSV
FT                   DHLLKGNAPRKSVLLTFDDAYLDFWENAFPLLKEYKIPAVVFVPAMLVGKFNQWDHQRV
FT                   NVKKLIMDWQQLRELTKAGIEIGSHSLTHPYLSKIPREKAKREIEDSKKLLEDKLGVQI
FT                   RAFCYPYGDYNHEVRDLVMQAGYLMAFTTKAGSFEQSENLFEIRRITVFGNDFILKLLL
FT                   KILL"
FT   gene            complement(312561..313376)
FT                   /locus_tag="Hydth_0305"
FT   CDS_pept        complement(312561..313376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0305"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterPro IPR000719:IPR017442:IPR020635:IPR002290:IPR
FT                   011009:IPR017441; KEGG: aae:aq_576 Ser/thr protein kinase;
FT                   PFAM: Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   subgroup, catalytic domain; SPTR: A8UT78 Ser/thr protein
FT                   kinase; PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44709"
FT                   /protein_id="ADO44709.1"
FT                   /translation="MDSTEEKNIILGTYQILSLLGRGTFGEVYKVRVLRGRYRGKMMAL
FT                   KVARNAEVLPYLWREVQTLLLFNHPHIISLQSYLYKKDRGELYVLYELMDVGDLKDYVV
FT                   SNGKLSEENALKVLLHVAKGLEFLHSRGYIHGDVKPENIFGKRVLRDVVWKLGDFGLVR
FT                   IRGSESIIDVKGTAGYIAPEVFRGEIHRSSDIFSLGCVLHFMLTGRDPFECEDRKEKLK
FT                   RNKEGACTIEDGLSERIKTLLHIMLSKDPTKRFRTAKELIEYMIRERLA"
FT   gene            complement(313378..314541)
FT                   /locus_tag="Hydth_0306"
FT   CDS_pept        complement(313378..314541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0306"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670; KEGG: aae:aq_1145 1,3 propanediol
FT                   dehydrogenase; PFAM: iron-containing alcohol dehydrogenase;
FT                   SPTR: A8UXW7 1,3 propanediol dehydrogenase; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44710"
FT                   /protein_id="ADO44710.1"
FT                   /translation="MSEFEFYLPVEVVFGAGCVSKVGQIARRFGFKALIITGKKSTKEN
FT                   GALDRVLDSLRKAGVGEVLVFDGIETNPTDKLVNEASQMAVREKVDFIIGLGGGSALDT
FT                   AKAVSIVSSNEGYAWDYVNYPEGPRLIPFLNRPVICIPTTAGTGSEVNRYSVISNPIRR
FT                   EKLVISHSLNYPRVAIVDPELTVSMNPRLTAITGIDAFMHALESFTNRAYNPLADELAI
FT                   RSAKIIKDWLPVAIEEPQNLKAREMMSYAAMLAGIAIDKKRVALIHAMEHPVSAHYPHV
FT                   IHGEGLAALAPAVTEFNHRGNPEKYGLFAEALGYPRKAFKAVDVVIDLLQKVNLRVSLK
FT                   SLGVRRESIEKLAEDVCLLSWNSFHLNPVEPSQEDIYRLYNRAYEGF"
FT   gene            complement(314538..314981)
FT                   /locus_tag="Hydth_0307"
FT   CDS_pept        complement(314538..314981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0307"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="COGs: COG1734 DnaK suppressor protein; InterPro
FT                   IPR000962; KEGG: aae:aq_250 hypothetical protein; PFAM:
FT                   zinc finger DksA/TraR C4-type; SPTR: O66611 Uncharacterized
FT                   protein aq_250; PFAM: Prokaryotic dksA/traR C4-type zinc
FT                   finger; TIGRFAM: RNA polymerase-binding protein DksA"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44711"
FT                   /protein_id="ADO44711.1"
FT                   /translation="MFTKEMLDNLRTKLLEEKAKILERYRKKEDTQARIGEEVKEPGDL
FT                   EDLSQMTYTQELLDTLSAREVFILREIDYALQKMQAGSYGICEYCGEEIPYERLQAIPW
FT                   TRYHAHCAEKVEEEGIVPTYPTPTFEGTIPEEMEIQREDITEA"
FT   gene            315039..316373
FT                   /locus_tag="Hydth_0308"
FT   CDS_pept        315039..316373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0308"
FT                   /product="Formiminotransferase domain protein"
FT                   /note="InterPro IPR013802; KEGG: aae:aq_592 hypothetical
FT                   protein; PFAM: Formiminotransferase domain protein; SPTR:
FT                   O66854 Putative uncharacterized protein; PFAM:
FT                   Formiminotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44712"
FT                   /protein_id="ADO44712.1"
FT                   /translation="MYTLIQKHKTLLVFIVTVASGAFFLWLFFTGSVRDITSVGKKCVA
FT                   EVNGSCITLRDYRRELLRFSNIQSRDLEEVIKKQVIENLITQELLYQKARSLGFYASDE
FT                   EVVSVIKSDPTFQEGGVFSASKYKEMLARLGLEPGEYEDYIRRMLTVQKLLALVSNSVY
FT                   LSEAEKNINLAVQSTLLSGKLYIITPSDVEVSYTPTQEEMMSFYEKNKELFRRPEKKLV
FT                   RVWAEKDKAKVEEIYRAIKEGKQVQGYTEYLLPDDANRLPKGVSSEVSKLDQKDGILVT
FT                   KEGDEYLIVYLYRVEPAGIRSFEEVKEQIRSALIDKRKASLLRDKAQEIYKRLTEGKDV
FT                   SVKYLTFEDTPVDQIMSIAKVKEGQVVSFILSKQKVFGPYELSQGYGVFVITDRKKKPA
FT                   DEEEIKKLTQDILNMKSDATVNYLIEHLIRSAKIKINEEVIKGGA"
FT   gene            316373..317152
FT                   /locus_tag="Hydth_0309"
FT   CDS_pept        316373..317152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0309"
FT                   /product="Citrate synthase"
FT                   /note="COGs: COG0372 Citrate synthase; InterPro
FT                   IPR016141:IPR002020:IPR016142; KEGG: hya:HY04AAS1_1379
FT                   citrate synthase; PFAM: Citrate synthase; SPTR: Q75VX1
FT                   Citryl-CoA lyase; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44713"
FT                   /protein_id="ADO44713.1"
FT                   /translation="MERIWKTGITQHIGHETYIRGYRLLDLVGNLSFAQAIYLILKGEL
FT                   PTERESRMMEAMLVSVIDHGIAPPSAIAARSVASGGNSLNVGVAAGVLAFGSAHGGALE
FT                   DAMRFIQEGVSSKRSVEDIVKEYLETKKPIPGYGHRYYKDFDPRTKRLMDIARVLEFYG
FT                   EHCKFAEDVAEEIGRQKGKKLVLNVDGAIAAIASEMGFDWRLGKGFFIIGRVPGLVAHV
FT                   YEELTTEKPFSKRLDEERDVEYTGSPPRELPQELKKI"
FT   gene            317152..317565
FT                   /locus_tag="Hydth_0310"
FT   CDS_pept        317152..317565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0310"
FT                   /product="Protein of unknown function DUF2495"
FT                   /note="InterPro IPR019628; KEGG: tth:TTC1114 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2495; SPTR:
FT                   Q72IL8 Putative uncharacterized protein; PFAM:
FT                   Phosphate-starvation-inducible E"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44714"
FT                   /protein_id="ADO44714.1"
FT                   /translation="MQEFISKIYKNFLKLAFNITIIVLTVSLFIGIFRTVSEIGLTLSE
FT                   ATVRLGFKELVTNVLSLVVVLELIRAFIDFFEHERVRVDILLEVLIAFVIREFMLHLFE
FT                   GKMAGQDVFFWSFGIIFLIGARAISLFYRVPKA"
FT   gene            complement(317562..318866)
FT                   /locus_tag="Hydth_0311"
FT   CDS_pept        complement(317562..318866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0311"
FT                   /product="homoserine dehydrogenase"
FT                   /note="COGs: COG0460 Homoserine dehydrogenase; InterPro
FT                   IPR016204:IPR005106:IPR001342:IPR002912:IPR
FT                   019811:IPR016040; KEGG: aae:aq_1812 homoserine
FT                   dehydrogenase; PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; amino acid-binding ACT domain
FT                   protein; SPTR: O67677 Homoserine dehydrogenase; PFAM:
FT                   Homoserine dehydrogenase; Homoserine dehydrogenase, NAD
FT                   binding domain; ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44715"
FT                   /protein_id="ADO44715.1"
FT                   /translation="MKVRIGIVGCGVVGTGTVKLLLENAHIIKKKTGIDILLTKVADKD
FT                   WERPREIEVPLNLRTYDYMDVINESDIVVELVGGKTFAKSLILEALERGKHVVTANKRL
FT                   LAEDGFEIFKKAKEKGLYIGFEASVGGGIPIVKALREGLVANRINTIYGILNGTTNYIL
FT                   TRMLEDHMDFSHALELAQKLGYAEADPSLDIDGWDSAHKICILSMIAFGRYVPFEDVYV
FT                   EGIRDLDLLDVELGKELGYTLKLLAISKRTDGEIEVRVHPTFIRSEDALAKVSDVYNAI
FT                   MIEGDFVGKTMFYGKGAGSYPTASSVVSDIVDIAKKVLFCSKDHDEFQWENQPIGIGKN
FT                   FYSRYYIRFDVPDKPGVLAGVSRVLADYNISIASVLQKEKVCKLARREGEATVPLVILT
FT                   HKAYEKNMQRAIEDIKKLPIIVGQPVIIRVEEEAY"
FT   gene            complement(318879..319745)
FT                   /locus_tag="Hydth_0312"
FT   CDS_pept        complement(318879..319745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0312"
FT                   /product="protein of unknown function DUF114"
FT                   /note="COGs: COG0616 Periplasmic serine protease (ClpP
FT                   class); InterPro IPR002825; KEGG: aae:aq_814 hypothetical
FT                   protein; PFAM: protein of unknown function DUF114; SPTR:
FT                   O66996 Putative uncharacterized protein; PFAM: Serine
FT                   dehydrogenase proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44716"
FT                   /protein_id="ADO44716.1"
FT                   /translation="MDQAQPYLNPIAYMFNFLWFFLLIFLFIIPVWRRFLLSRAREAII
FT                   EQLERKRGSRVITLIHRQESLALLGVPIFRYINIEDSEQVLRAIRMTPEDMPIDLIIHT
FT                   PGGLALAATQIANALSRHKAPVRVIVPHYAMSGGTLIALAADEIVMDHNAVLGPVDPQL
FT                   GQMPAASILKVLELKNVNEIDDQTLILADVAKKAIDQMIDYLVNLLKNNGMEEEKARRI
FT                   AQELATGKYTHDYPLSVEKLREIGLNVSTEVPEEVYALMDLFPQPMGSQVPSVQYIPVP
FT                   YKTHGMK"
FT   gene            319779..321107
FT                   /locus_tag="Hydth_0313"
FT   CDS_pept        319779..321107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0313"
FT                   /product="DNA repair protein RadA"
FT                   /note="COGs: COG1066 ATP-dependent serine protease;
FT                   InterPro IPR004504:IPR003593:IPR020568; KEGG: aae:aq_552
FT                   DNA repair protein RadA; SMART: AAA ATPase; SPTR: A8UXH3
FT                   DNA repair protein radA; TIGRFAM: DNA repair protein RadA;
FT                   PFAM: KaiC; TIGRFAM: DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44717"
FT                   /protein_id="ADO44717.1"
FT                   /translation="MKRERTQFVCQECGYSSAKWLGKCPSCGNWNSFVEESEHVLIKSY
FT                   REKPSVRSICEWEHEGLERKSVGFENFDRAIGGGMVPGQVMLLAGEPGIGKSTLLLQVS
FT                   DRYAQNYGSVLYVSGEESGSQIAVRGRRTGVKSKDVLVLPETRLEAVLDVAQELNPQLL
FT                   VVDSIQTLYTESLSSSPGSVSQVRECAFRITEFCKSRDIPVFLVGQITKEGDIAGPKVL
FT                   EHLVDTVLYFEGERFNFYRIVKVVKNRFGSSGEVAVFRMLDRGLEEVPEPSAFFLQERT
FT                   QSCGSVVFPYTEGSKPVLVEVQALTIQALYTTPQRRSQGYDVNRLSIILAVLEKECKIF
FT                   TRDRDVFVNVVGGMQIREPAADLAVALAIISSIKNKPIPDIVAFGEIGLSGELRAVHFA
FT                   DVRLKEAARFGFSRAFLPKSISIPVEGMEVVGIAHLRDALEIL"
FT   gene            complement(321118..322620)
FT                   /pseudo
FT                   /locus_tag="Hydth_0314"
FT   gene            322789..323001
FT                   /locus_tag="Hydth_0315"
FT   CDS_pept        322789..323001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0315"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167:IPR008988; KEGG: gem:GM21_3767
FT                   FeoA family protein; PFAM: FeoA family protein; SPTR:
FT                   A8UTN9 Putative uncharacterized protein; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44718"
FT                   /protein_id="ADO44718.1"
FT                   /translation="MNLEEVKVGAEVMIQDLIGKEEVLRRVEAMGLRRGRKVEVLQKVG
FT                   RVILLKLNNSRLAISRDIAKNIFVK"
FT   gene            322998..325058
FT                   /locus_tag="Hydth_0316"
FT   CDS_pept        322998..325058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0316"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterPro IPR006073:IPR002917:IPR011619:IPR011642:IPR
FT                   011640:IPR005225:IPR003373; KEGG: aae:aq_1255 ferrous iron
FT                   transport protein B; PFAM: GTP-binding protein
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; nucleoside recognition domain protein; Ferrous
FT                   iron transport B domain protein; SPTR: A8UTN7 Ferrous iron
FT                   transport protein B; TIGRFAM: ferrous iron transport
FT                   protein B; small GTP-binding protein; PFAM: Ferrous iron
FT                   transport protein B; Ferrous iron transport protein B C
FT                   terminus; Nucleoside recognition; TIGRFAM: ferrous iron
FT                   transporter FeoB; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44719"
FT                   /protein_id="ADO44719.1"
FT                   /translation="MKVLKKILRVALAGNPNVGKTSILNHLAGTTLKVGNWPGVTVEKR
FT                   EGKATYKDYTLILIDLPGIYTLEPVSEDELIAYRFLTEESPDVIVNVIETPNMERDLLL
FT                   TAQFLELGMPMVIVLNMMDEAQKLGIEIDTQRLEGLLGIKVVKTNGRTGLGVKEILSAV
FT                   IETYEKGIKPKEVRYSEEMEKILDALREEASESKHQLIKKLLSYREHAQKLERLYGKPA
FT                   YHIIRDNRFAFVHGLYNEVVKRKAITSMDITSLLDKFLLHPYLGMTIFLLVMFALFKVS
FT                   FDFSKPFMDWLDGFLNGFVSPFVRIELEKLGVENWVVRFISEALIGGVGFVLTFTPLIA
FT                   TIYLLLSFLEFTGYLPRIAFLMDRFMHRLGLHGKSLIPLLLGFGCNVPAIVATRTMESR
FT                   RDKLLVITMIPFMSCPARLVVFSFFAITFFSHPVLVIFSLYLLGILVAFFTAILLKKVA
FT                   FKGGLDHFVMELPPYRLPTLKLLLRIVWVYLKDFLYRAGTLIFAVSVLIWLSLNLPPGV
FT                   KTTQDSLAGRFGKLITPIFEPIGITDWRISTSLVPAFLAREIVLSSMATIYSVEKEETK
FT                   EFLPLQEAKKQVYALKDAAEEAFSSLINPLPKTFEVSEEHNTLRAAITKSMSGASALSF
FT                   MIFILIYTSCLGTVAVMWREAGRGFALGFLIYSFVMAWIVSFLVYRIGSLV"
FT   gene            complement(325152..326336)
FT                   /locus_tag="Hydth_0317"
FT   CDS_pept        complement(325152..326336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0317"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR003004:IPR018076; KEGG: aae:aq_1285
FT                   fimbrial assembly protein PilC2; PFAM: Type II secretion
FT                   system F domain; SPTR: A8UVK2 Fimbrial assembly protein
FT                   PilC2; PFAM: Bacterial type II secretion system protein F
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44720"
FT                   /protein_id="ADO44720.1"
FT                   /translation="MALLYTGIDRQGNIRKGKIEAPDQSTAYRLLVSQGIKPIKIEKEK
FT                   SIWSRELIKRKPSDEDLSFALLQLSLLLSSGLNLTKALEMLAHQVEDKKISSAIASIKE
FT                   AIERGEPLHLAFKRVEIFPEFLVEMLKTAERGENLEEIFAIAGNFLQRISDIRSRIFSS
FT                   LTYPAFVIVLSILSVLVVVKFVVPKIATVLASFGKDLPLITKVLLFISKIIGYLFYLLP
FT                   AFVVLMVFGKRFVRKEKLHEISLKIPVFGKVFYYFNLSRFAGSLRMSIASGIPLTKALS
FT                   LSRGSITNSYMRNSLNNIEEELAKGKSLSEVLTRTDLFPPLFVNLISTGEKSGELERML
FT                   SLIEELYDREAMRTISFWIRFAEPLSMLIIGIIVAFVVFSVILPITELSAGIKR"
FT   gene            complement(326337..327803)
FT                   /locus_tag="Hydth_0318"
FT   CDS_pept        complement(326337..327803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0318"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="COGs: COG0516 IMP dehydrogenase/GMP reductase;
FT                   InterPro IPR018529:IPR013785:IPR000644:IPR001093:IPR
FT                   015875:IPR005990; KEGG: aae:aq_2023 inosine monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; PRIAM: IMP dehydrogenase; SMART:
FT                   CBS domain containing protein; SPTR: O67820
FT                   Inosine-5'-monophosphate dehydrogenase; TIGRFAM:
FT                   inosine-5'-monophosphate dehydrogenase; PFAM: CBS domain;
FT                   IMP dehydrogenase / GMP reductase domain; TIGRFAM:
FT                   inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44721"
FT                   /protein_id="ADO44721.1"
FT                   /translation="MEDAQFFEGYTFDDILLIPQYSEVLPNEVDVSTQLTKRIKLNIPI
FT                   VSAAMDTVTESRLAIALAREGGIGIIHRNMSIEKQAQEVEKVKKSESGMILQPITVHPH
FT                   NTVREAMQIMERYKISGVPVVDADGMLVGILTNRDLRFLKTTDYDKPVSLFMTKEGLIT
FT                   AQERVTLEEAEEILHRHKVEKLPIVDKEGRLRGLITIKDIVKRKKYPNACKDEIGRLRV
FT                   GAAVGTGPDTKRRVEELVSVHVDVIAVDTAHGHSKRVLDTVEMIKSNFPQVDVIAGNVA
FT                   TREGVRDLIKAGADAVKVGVGPGSICTTRVVAGVGVPQITAIMWAYEEAKEYGIPIIAD
FT                   GGIRYSGDIVKALAAGASAVMLGNLLAGTEDAPGETIYYQGRAYKVYRGMGSLGAMMSR
FT                   YSSDRYGQENMEKFVPEGIEGRVPYKGKLSDVIFQLVGGLRSGMGYVGASNIRELREKA
FT                   KFVKITYAGYRESHVHDVIITKEAPNYWVE"
FT   gene            complement(327825..328310)
FT                   /locus_tag="Hydth_0319"
FT   CDS_pept        complement(327825..328310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0319"
FT                   /product="protein of unknown function DUF177"
FT                   /note="COGs: COG1399 metal-binding possibly nucleic
FT                   acid-binding protein; InterPro IPR003772; KEGG: aae:aq_1103
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF177; SPTR: O67188 Putative uncharacterized protein;
FT                   PFAM: Uncharacterized ACR, COG1399"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44722"
FT                   /protein_id="ADO44722.1"
FT                   /translation="MVTLNLREIFKRRSKFTGFYRISPKELLLPADMGELMEPVNVYVE
FT                   ITKEKGGYRVHLEIEGSLTLECSRCLSLFARDMSLSEDIRIEPYPTKDIVHIKPKDLDV
FT                   SFFEDEESFDLVNLVREQIILSIPIKPLCDPQCKGIPLEEGQSIDIRFSALKKFIKE"
FT   gene            328357..329334
FT                   /locus_tag="Hydth_0320"
FT   CDS_pept        328357..329334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0320"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="COGs: COG0391 conserved hypothetical protein;
FT                   InterPro IPR002882:IPR020845:IPR010119; KEGG: aae:aq_778
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   UPF0052 and CofD; SPTR: A8URT0 Putative uncharacterized
FT                   protein; PFAM: Uncharacterised protein family UPF0052;
FT                   TIGRFAM: conserved hypothetical protein, cofD-related"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44723"
FT                   /protein_id="ADO44723.1"
FT                   /translation="MNIVAIGGGTGLSSLLRGLKKEVGERVKSLSAIVTVADSGGSTGR
FT                   LRKAYNLPAPGDIRNCIVALSESEQIMQQLFQYRFKGGELEGHAFGNLFLIALTDITGS
FT                   FMMSIKIASQILRTKGDIIPATVGDVHLCAEFSDGKVVMGEEEITNYGKENKVRIKRIW
FT                   IQPEDTLTPIDAVGRIESADMITFGPGSLYTSIIPNLLIKDIREAVERSNALKVFIVNA
FT                   MTQPGETDGFTAYDHLMTFLKHSGIKKVDAVIVNTKMPSSSILKRYLDEGQEPVVPDIA
FT                   RIAREGFNVYAEDLIGDKEDFVRHDPDRLADLLMRVYYNYAVLP"
FT   gene            329318..330847
FT                   /locus_tag="Hydth_0321"
FT   CDS_pept        329318..330847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0321"
FT                   /product="L-aspartate oxidase"
FT                   /note="COGs: COG0029 Aspartate oxidase; InterPro
FT                   IPR013027:IPR003953:IPR005288:IPR015939; KEGG: aae:aq_777
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; SPTR: A8URS9
FT                   L-aspartate oxidase; TIGRFAM: L-aspartate oxidase; PFAM:
FT                   domain; FAD binding domain; TIGRFAM: L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44724"
FT                   /protein_id="ADO44724.1"
FT                   /translation="MRFFLNFDTSKLSEEKVDVLVCGSGIAGLTTAITLRELGLKPVIL
FT                   TRGMGNTYYSQGGIACAVHPQDSPLLHFIDTYKAGRGLCHEMALRVLVDEGIQCISHLE
FT                   RWGVKFDTKDGLYETTLEGGHSFPRVLKVKDYTGRAIYQALLKKAQSLEIPIITGELQE
FT                   ILAYDGVKGVLYYDGSLKFLRVKALVLATGGAASIFLHTSNPVKVRGDAIGIALRCAVD
FT                   IKNPEFVQFHPTVVEGTNLLISEAVRGEGALLVDDKGERFVNELEPRDTVARAIYNKLK
FT                   EGKRVFLDMRPIKGGEKYLQERFPTIVEFLEKMGLDPRRDLIPVVPAAHYFIGGMEVDL
FT                   YGRTQIFGLYAVGECACSGVHGANRLASNSLLEGVVFGHRVAHRIYHDIKYFSFSASHF
FT                   KSEREAFLKPPYSFDHLRKLMWDACGLEREEGELLQAIEILKSWLKDMEKWEDTIQNRE
FT                   LLDITLVALSTLKASLSRRESRGVHYRRDYPYEREELRRDSLVKLEELLGL"
FT   gene            complement(330833..331126)
FT                   /locus_tag="Hydth_0322"
FT   CDS_pept        complement(330833..331126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpa:VPA0727 putative nonspecific tight
FT                   adherence protein TadD"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44725"
FT                   /protein_id="ADO44725.1"
FT                   /translation="MKYLMLFVMIFTLGCATVNKKLDPKAKLFYERGYEGQMDFKVLVK
FT                   DEPCKERIRSSYRVKVEGGDFLVLTLTHSELKKLLQDDCITFVSATQRLEPK"
FT   sig_peptide     complement(331067..331126)
FT                   /locus_tag="Hydth_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            331168..331599
FT                   /locus_tag="Hydth_0323"
FT   CDS_pept        331168..331599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0323"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="COGs: COG1267 Phosphatidylglycerophosphatase A and
FT                   related protein; InterPro IPR007686; KEGG: aae:aq_314
FT                   hypothetical protein; PFAM: phosphatidylglycerophosphatase
FT                   A; SPTR: A8UVM6 Putative uncharacterized protein; PFAM:
FT                   Phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44726"
FT                   /protein_id="ADO44726.1"
FT                   /translation="MLQELIATGFFVGRFRYAPGTVGTLLGIPLVYLFAFKWWLVAILG
FT                   IFLYLVGFWACSYVVDMRKESDPEDVIIDEVLGYFLSYMLIEPTLESILVGFFTFRLLD
FT                   IFKPYPINLFEKLPKGHGVMADDAIAGLINSVILFFLFH"
FT   gene            complement(331579..332349)
FT                   /locus_tag="Hydth_0324"
FT   CDS_pept        complement(331579..332349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0324"
FT                   /product="ribonuclease BN"
FT                   /note="InterPro IPR004664; KEGG: aae:aq_453 hypothetical
FT                   protein; PFAM: ribonuclease BN; SPTR: O66760
FT                   Uncharacterized protein aq_453; PFAM: Ribonuclease BN-like
FT                   family; TIGRFAM: YihY family protein (not ribonuclease BN)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44727"
FT                   /protein_id="ADO44727.1"
FT                   /translation="MFKSIKYILYTIYISITEGYTYHASSLTYSFIMVLGSLILFSSFL
FT                   ASFLPFFDFNKIINYAVLLFPEQAERVILEILKVYQHRTSGSILSFTVAYFFSVSFSKS
FT                   LYRAFLYVLSEARSEKEWVFWVKTPALVLLYTLCLSLLFFLNSFLKVYLGNYNAYLFYF
FT                   INLLTFWVLIFLTYTLFLPRKYSFKDVYVGAMLSSCALLLFNKLFSAFVVKLVALNPLY
FT                   SFMGSILIFFIWVNLSFSVLLAGAKYIQLMKEKE"
FT   gene            complement(332342..333445)
FT                   /locus_tag="Hydth_0325"
FT   CDS_pept        complement(332342..333445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0325"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="COGs: COG1509 Lysine 2 3-aminomutase; InterPro
FT                   IPR003739:IPR007197:IPR006638; KEGG: aae:aq_454
FT                   hypothetical protein; PFAM: Radical SAM domain protein;
FT                   PRIAM: Lysine 2,3-aminomutase; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: O66761 Uncharacterized kamA family
FT                   protein aq_454; TIGRFAM: lysine 2,3-aminomutase YodO family
FT                   protein; PFAM: Lysine-2,3-aminomutase; Radical SAM
FT                   superfamily; TIGRFAM: KamA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44728"
FT                   /protein_id="ADO44728.1"
FT                   /translation="MRRFFENIPKDLWRDYGWQIKNRLKTREDIQKYIKLLPEEVEGIE
FT                   RTKGIYPLAITPHYFSLIEPEDPNDPIRLQCIPRREEVDENAQRLGEPDPFREEGQVPG
FT                   LTHRYRDRVLLSVTTFCAVYCRHCMRKRIFAQGERSRSTEELRKMIEYIKEHEEIRDVL
FT                   ISGGEPLSLSYEKLEYLLSQLRKIKHVEIIRFGTRLLVLAPQRFFDNKLLDILEKYSPI
FT                   WINTHFNHPKEITEEAEEAVERLLRRGIPINNQTVLLKGVNDNPQTMLELFRGLLRIKV
FT                   KPQYLFHCDPVKGAVHFRTSIDKGLEIMEYLRGRISGMGIPTYAVDLPGGKGKVPLMPN
FT                   YIINREGDKFTFRSPFGDVVEYEITDV"
FT   gene            333469..334695
FT                   /locus_tag="Hydth_0326"
FT   CDS_pept        333469..334695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0326"
FT                   /product="glutamyl-tRNA reductase"
FT                   /note="COGs: COG0373 Glutamyl-tRNA reductase; InterPro
FT                   IPR000343:IPR016040:IPR015895:IPR006151:IPR 018214; KEGG:
FT                   aae:aq_1279 glutamyl-tRNA reductase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Tetrapyrrole
FT                   biosynthesis, glutamyl-tRNA reductase-like; SPTR: A8UYI6
FT                   Glutamyl-tRNA reductase; TIGRFAM: glutamyl-tRNA reductase;
FT                   PFAM: Shikimate / quinate 5-dehydrogenase; Glutamyl-tRNAGlu
FT                   reductase, N-terminal domain; TIGRFAM: glutamyl-tRNA
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44729"
FT                   /protein_id="ADO44729.1"
FT                   /translation="MDRIFVWGINFKTAPVEYREGLACSREETAYLLSILKTIKGVEEL
FT                   ILLSTCNRVELYAVAQEYACMENLVNTLLELKGASWDLKRYSFLLQGKEAIHHIFKVAS
FT                   SLDSMVVGETQITSQFKDAFSIARNVGTVGKVLHRLYEKALRTAKRVRTETGISKNAVS
FT                   VSYVAVDLARKIFGNLKKAKVLLVGAGEMGELAARYLKKLQASLSITNRTYEKSVDLAR
FT                   ELEGHALRFESLEDYLYEFDIVILSTASKEPILKKDMVKKAIKLRNYKPMFIIDISVPR
FT                   NADPSINDLDEVFLYNIDDLRSIAEKNLSERLKEKEKGEIIVWDEVEKLVKWLELLKVE
FT                   SYIIKIKNRWKDVEAREPAVRKLIHSVIEEIRKQPSSAERLFKIFVQEVDDGDTFRGLS
FT                   YVHNRADGA"
FT   gene            334667..334939
FT                   /locus_tag="Hydth_0327"
FT   CDS_pept        334667..334939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0327"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="InterPro IPR019887:IPR011008; KEGG:
FT                   hya:HY04AAS1_0684 transcriptional regulator, AsnC family;
FT                   PFAM: Transcription regulator, AsnC-type-like; SPTR: A8UYI5
FT                   Putative uncharacterized protein; manually curated; PFAM:
FT                   AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44730"
FT                   /protein_id="ADO44730.1"
FT                   /translation="MSITELMELESEYSIKAYILIKADPREIPSIMLALSTFDGVKTAD
FT                   VVTGPYDIIVFAELRNQDELGRLVINKIHSLEGVREALTCVVVKI"
FT   gene            334936..335109
FT                   /locus_tag="Hydth_0328"
FT   CDS_pept        334936..335109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0328"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: A8UYI3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44731"
FT                   /protein_id="ADO44731.1"
FT                   /translation="MKYPQILEYEDRIVVIYSADEPNYTEEDDGVILFYSKKGDVVKII
FT                   IKKDEKHHIIYF"
FT   gene            335081..336370
FT                   /locus_tag="Hydth_0329"
FT   CDS_pept        335081..336370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0329"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COGs: COG0766 UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase; InterPro IPR001986:IPR005750:IPR013792; KEGG:
FT                   aae:aq_1281 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); SPTR:
FT                   A8UYI2 UDP-N-acetylglucosamine 1-carboxyvinyltransferase;
FT                   TIGRFAM: UDP-N-acetylglucosamine 1-carboxyvinyltransferase;
FT                   PFAM: EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44732"
FT                   /protein_id="ADO44732.1"
FT                   /translation="MKSITSYTSDYLVIEGGHRLVGKVRISGSKNASLPIMMSSLLTDD
FT                   VCYIEDVPDLLDVRSTIELLQVFNAEVSYHQGKLRLDASKIKSFIAPDYIVRRMRASVL
FT                   AMGPLLGRFGKAVVAMPGGCSIGVRAIDQHLKVFERGGARINVQHGYVHLEVDKIKPVE
FT                   YTFEVVTVTGTENALMFLSRCEKRSILRNIAIEPEVMDLVEVLRSMGVSIEIDGRTAIV
FT                   RGSRELKGFAHRVIPDRIEAGTFLVAGFITGGDIELENVRVDHLGSVIEKLREAGACVE
FT                   VSSDRIRVYSNGGGIKPLSISTSEYPGFPTDMQAQFTSMCCLAEGLSEITENIFENRFQ
FT                   HVAELQRMGADIHIRGRTAFIKGVKKLTGAEVFSTDLRASASLVLAGLVAEGKTVVRDI
FT                   YHLDRGYERLDEKLKSLGAPVERHSITDVI"
FT   gene            complement(336363..336794)
FT                   /locus_tag="Hydth_0330"
FT   CDS_pept        complement(336363..336794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0330"
FT                   /product="heat shock protein Hsp20"
FT                   /note="COGs: COG0071 Molecular chaperone (small heat shock
FT                   protein); InterPro IPR002068:IPR008978; KEGG:
FT                   hya:HY04AAS1_0735 heat shock protein HSP20; PFAM: heat
FT                   shock protein Hsp20; SPTR: A8UYI0 Small heat shock protein
FT                   (Class I) (Fragment); PFAM: Hsp20/alpha crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44733"
FT                   /protein_id="ADO44733.1"
FT                   /translation="MRRSIALWNPFAELERIRREFDRLIEEMWPREEVERAFAPAVEMY
FT                   ETDNEIVVKAELPGVKKENIEVSIKDNTLHIRGEKKEEREEKTETIHRLERVYGKFERV
FT                   LTLPVDVKAEEVKAEYKDGILEIRLPKSEVSKEKKIEIK"
FT   gene            complement(336925..337512)
FT                   /locus_tag="Hydth_0331"
FT   CDS_pept        complement(336925..337512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0331"
FT                   /product="Nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="COGs: COG1335 Amidase related to nicotinamidase;
FT                   InterPro IPR000868; KEGG: pmx:PERMA_0323
FT                   pyrazinamidase/nicotinamidase; PFAM: isochorismatase
FT                   hydrolase; PRIAM: Nicotinamidase; SPTR: A8UXU4
FT                   Pyrazinamidase/nicotinamidase; PFAM: Isochorismatase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44734"
FT                   /protein_id="ADO44734.1"
FT                   /translation="MRVKLTDKDALIVVDMQNDFMPWGALPVPDGDKIVPKLNAYIDIF
FT                   SSRGLPVYFTRDWHPPDHISFLENGGVWPPHCVQNTEGAKFHKDLRIPKDNKFIISKGT
FT                   SRDFDAYSGFQGTMLDSLLQERGIRRVFVGGVATDYCVKNTVMGALNLEYQAFLLIDAT
FT                   KGVDVKPGDTERAIDEMLSSGAVAIEFENLTA"
FT   gene            complement(337518..338162)
FT                   /locus_tag="Hydth_0332"
FT   CDS_pept        complement(337518..338162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0332"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="COGs: COG1489 DNA-binding protein stimulates sugar
FT                   fermentation; InterPro IPR005224; KEGG: aae:aq_057 sugar
FT                   fermentation stimulation protein; PFAM: sugar fermentation
FT                   stimulation protein; SPTR: A8UXU6 Sugar fermentation
FT                   stimulation protein; TIGRFAM: sugar fermentation
FT                   stimulation protein; PFAM: Sugar fermentation stimulation
FT                   protein; TIGRFAM: sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44735"
FT                   /protein_id="ADO44735.1"
FT                   /translation="MRFPSLVSGEFVKRINRFVCVVRIKDKEHFAYLRNTGRLSELLKE
FT                   GTCVYLKEKDKGKYSYELLLAEGEKGILVCLDSQIAPKLYAEGLPAGELVYEPKVVGGK
FT                   LDLLVGKELIEVKSVNLVRDGIALFPDAPTQRGSRHIDLLIKAYPKYTPKMVFVIQRED
FT                   AYAFSPNREMDPIFANKLKVFKSLGHRVVAYNCKVSLEEIKLKEEVEVLWR"
FT   gene            338278..338943
FT                   /locus_tag="Hydth_0333"
FT   CDS_pept        338278..338943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_1272 gliding motility protein; SPTR:
FT                   C1DVV4 Gliding motility protein; PFAM: Ras family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44736"
FT                   /protein_id="ADO44736.1"
FT                   /translation="MSRGNEPVKKILKYQILSVGKNSTALKSKRRNKRSVVKSGTFGKS
FT                   SFSLSSRSLREGFFSSFSFLEKLKEIYSSCVYDRLHQQTREGRTVYLDVLSLKLKTRLE
FT                   GVELMVSLFTTPGQKRYSILRPWLFGHTFAVVFVFDSSRGVEENLESFREIKDSDKVVV
FT                   QANKRDAEGAVPLEEIKRIFENYTVIPAVAKDGVGVIETFKEALRIALHGAGKAFRPS"
FT   gene            338912..339382
FT                   /locus_tag="Hydth_0334"
FT   CDS_pept        338912..339382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_1273 hypothetical protein; SPTR:
FT                   C1DVV5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44737"
FT                   /protein_id="ADO44737.1"
FT                   /translation="MVREKLLDLLKRAKPTLGPISRDAVNLSWILEMHSWSLQTGVYTF
FT                   QSLERSSLLPMVDGHLLGSLEDSFDMLSFYRTTKNALVHTFKLSIPLELPLRKANPIWI
FT                   NLESLSFNLKEFFRKIEDFGTTGFVEVEDRIKKERGYIFLYNGLVVSAKVGE"
FT   gene            339390..340178
FT                   /locus_tag="Hydth_0335"
FT   CDS_pept        339390..340178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR016024; KEGG: saf:SULAZ_1273
FT                   hypothetical protein; SPTR: C1DVV5 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44738"
FT                   /protein_id="ADO44738.1"
FT                   /translation="MKRILRSLSENACLLNIYELNHITLEFLLSKPKLLSYFWDFEEAE
FT                   RFLKEISKRHASLTALLVSVSLYEYGYRMYMDGEVIYEEGFDTEALFFEIYVIKSFMEL
FT                   NFLKPEDYISEHEKIKVLKSDEKSTIIYFCPACWSIVSQKDITCPNCGYDLTEFHNMPY
FT                   EYKLLMGLEHPVVEMRMNVIHTVGVKDLKEAMPQLEYMINRESNPMLLMAVVDALAKMS
FT                   HPEALELLRKLAHHTYPIIRSRAKYALEKRLTGGRRSPAV"
FT   gene            complement(340147..341082)
FT                   /locus_tag="Hydth_0336"
FT   CDS_pept        complement(340147..341082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0336"
FT                   /product="ferrochelatase"
FT                   /note="COGs: COG0276 Protoheme ferro-lyase
FT                   (ferrochelatase); InterPro IPR001015:IPR019772; KEGG:
FT                   sul:SYO3AOP1_0845 ferrochelatase; PFAM: ferrochelatase;
FT                   SPTR: A8UVP5 Ferrochelatase; TIGRFAM: ferrochelatase; PFAM:
FT                   Ferrochelatase; TIGRFAM: ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44739"
FT                   /protein_id="ADO44739.1"
FT                   /translation="MSKIGVVLLNMGGPDSLSAVEPFLYNLFSDHDIIEIPRLIQKPVA
FT                   RLIAKLRAEKTKHYYEVMGGKSPQREQTEQQAKALQNVLGENYKVVVAMRYWHPFTEEA
FT                   LRELFTEDISKIVLLPMYPQYSKTTTGSSFNEFERVFKRFPQVPVIRIISYHNHPAYIR
FT                   AMVENIKEHLQSWESYFFLFTAHSLPVQVIKRGDPYKDQTEETVKLIMEHFPEVSYALG
FT                   YQSKIGPVKWLEPFTDKLIEELIKSGVKRLALIPVSFVCEHSETLYELDVQYKSLAESL
FT                   GVESFVRIPTLKDHPSFIEALRQLVISSLQ"
FT   gene            complement(341075..344539)
FT                   /locus_tag="Hydth_0337"
FT   CDS_pept        complement(341075..344539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0337"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="COGs: COG1196 Chromosome segregation ATPase;
FT                   InterPro IPR003395:IPR010935:IPR017871:IPR011891; KEGG:
FT                   aae:aq_629 chromosome assembly protein; PFAM: SMC domain
FT                   protein; SMCs flexible hinge domain protein; SPTR: A8UUA2
FT                   Citrate synthase; TIGRFAM: chromosome segregation protein
FT                   SMC; PFAM: RecF/RecN/SMC N terminal domain; SMC proteins
FT                   Flexible Hinge Domain; TIGRFAM: chromosome segregation
FT                   protein SMC, primarily archaeal type"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44740"
FT                   /protein_id="ADO44740.1"
FT                   /translation="MGAWIEKIVVEGFKSYGKGRVEIPLGPGFVGIVGPNGAGKSNIGD
FT                   AISFALSLATAKTLRAKNLSYLIYTKDSDSSHHAYVEVHFKNEGTFPLEDSIIVISRKV
FT                   DKDGRSIFRINGSVIRERDLKDLLAKAGLYENAYNIVLQGDVIRFLRMTPVERRKLIEE
FT                   VAGIGEYEEKKQKALADLGEVELKLREFRLLIDEMEVQMERLSEDVRKLRRYRELENTL
FT                   RDLHIKLLMKEAKATSQSIENLQALIEERKKELLEIREKLKVLELEYQQREEELRSVND
FT                   QLLPFREKLGKISSDIEYLEKSIKEAIKKREETQEEILRSESHLRSLRANLETLLEEEK
FT                   HINSLITQKERQISAKEEEAKALYSALKSKEERLKVSLEEAQATQEKISIIRKDLDSKK
FT                   RLLSSIDIKLREMDLKRERIMEEMQRLREEKEKLKSQMGENILKMENYRKMQKEEEVSL
FT                   RKKKQELESLEERLRRIRKEREELIKEKAMLEAKLMSSEGDTLPFEGIEGVYGRGSELI
FT                   RVKDHEYIKAVESAGGARLSYVVVEDENVAKACIERLKEVKGGRMNFIPLSRIKVPSLP
FT                   PYPRRKGFIDFVVNLVEYDRKFEKAVRFIFGDTLLVENFQSAKDLGIGTYRMVTLEGEV
FT                   FEKSGVISGGDAQSKGELGREFYAKEVDRLSLMEKRLKDEEEQVERLLKTVRQELIEKE
FT                   GVLKILERRLKDTEESDKMSFERIKEMEDKLRKSQEYLEVLAKEREGLLKEREALGQEV
FT                   FYLEEKLNNLLIKKQSILEHYRESGIESLRESYERELKNLDKLKEHLFSLNMKLKDVQK
FT                   DLQNLQMEIKRKMAFLESAAGAVKEAEERIKKLKEEKAKLEESVKDLERTAYELYSKRD
FT                   KLEDVCRDLQASIGGLRMQEETKREELAKYEMEKAKLEEKLNETTKKLRDLEFFGDVQD
FT                   VKEGYTKIKEVMEKVRKQMEELGTINFKAEEDYKEYEARHRDYTERYQRLNQEKKAIRD
FT                   MIEEIEAKKLNAFTEAFESINESLKKVFAELSPGGKAYMQVEKPEDPFSGGINLVVKPK
FT                   GKEVQYLEAISGGEKTLVALSLIFAIQDYKPSPFYYFDEVDAHLDEANAKRVGQLIRKR
FT                   SQKAQFIVVTLREVLASYADKLIGVSMRGGVSKVFPVKNMLVEVSNE"
FT   gene            complement(344546..345691)
FT                   /locus_tag="Hydth_0338"
FT   CDS_pept        complement(344546..345691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0338"
FT                   /product="protein of unknown function DUF100"
FT                   /note="COGs: COG1980 fructose 1 6-bisphosphatase; InterPro
FT                   IPR002803; KEGG: aae:aq_1790 hypothetical protein; PFAM:
FT                   protein of unknown function DUF100; SPTR: A8UU24 Putative
FT                   uncharacterized protein; PFAM: Fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44741"
FT                   /protein_id="ADO44741.1"
FT                   /translation="MRITLSVIKADVGGYVGHSGVHPQLVETIKEFVQEEVKKGILIDA
FT                   SVLVCGDDTAIVMTHTHGVDSEIVHGIAWRAFEKATEVAKKLKLYGAGQDLLSTAFSGN
FT                   VKGMGPGVAEMEFEERPSEPVIVFFADKTAPSAWNLPLYEMFADPMVCAGLVIDPKMHD
FT                   GFTFEVLDTYTGKAVKLSTPSELYELLALIGTVERYAIRSVWRNNDGEIAAVASTQRLS
FT                   LIAGKYVGKDDPVMVVRAQAGFPAVGEILEPFARPWIVEGWMRGSHNGPLMPVSFKNAT
FT                   PTRFDGPPRVIAAGYQIAEGKLIGPRDLFDDPAFDKAREQAQLMADMLRRQGIFEPHRL
FT                   PSEEMEYTTLPKILKKLEERFYELEAPRKAVEDPVEKHDID"
FT   gene            345733..346941
FT                   /locus_tag="Hydth_0339"
FT   CDS_pept        345733..346941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_197 hypothetical protein; SPTR: A8UUD9
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44742"
FT                   /protein_id="ADO44742.1"
FT                   /translation="MREALKVLFLIVSYNFLLEYVSSKLPLPVRLFPEDIHSFVMLLSF
FT                   DSALYLAWLFGYRSTTLLWLAYLFFFQILGISFIDGTYTPIAEYTPSFLITLLFLRFSE
FT                   SPTERRTREIKEEIKKLERELEINRGELETLRQQVKLSEDLILHLNKEKAMIEEKLNEL
FT                   RDSQMAEGQALLKERDQLAEKIRQAEISLSEYKNKLERITEANRKLFELLEILQRREEG
FT                   SQKGEIAQLRKERKKLVKEVLELRSLWESSEREKAQLKLEVLELKSSLEKLQRERDLLE
FT                   LELQELKSKMLSKEEVYREVLGFVLDNIEMEERALREFISLPVDKKREFMKELLLLNMK
FT                   GRDESLEAMKGLKNVFKLKPRGGRIYFTFGQKLRWKVLGLIASEDDKDKDRYAKEILVK
FT                   YMQ"
FT   gene            346963..348183
FT                   /locus_tag="Hydth_0340"
FT   CDS_pept        346963..348183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1503 Peptide chain release factor 1 (eRF1);
FT                   KEGG: aae:aq_199 hypothetical protein; SPTR: A8UUE0
FT                   Putative uncharacterized protein; PFAM: eRF1 domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44743"
FT                   /protein_id="ADO44743.1"
FT                   /translation="MKSLKASLDTLTSFKPDKYMVISLYLKLSPEERADRKYLLTFKSM
FT                   VKKQKEYLTKRDLDAQVLQSLMEDFSRIEAYLSEIDNLKGCRGIAVFSSSRRGLFEVIK
FT                   LPYVYRDRLMIAPNPQIREIAAIDEELGKIGILLIDRKHVKFYLMDLEGAYEVMDFLEP
FT                   LVTRSHKFHSGGGLLKGAQGAMKYAMPSRTSAPNMVQHSYGEYRFHMRIREEKHRLFKL
FT                   ANDALMEAWKEHKFDKLVIGSDREDVKEIENHLHPYLHKIFMGYVQVNPTEVTDTKLKS
FT                   TVIDFLLQKDREQEKELIKQLEELQGRGLATNGTSHVIEQLAVGNVRMLLVPDGFEKPG
FT                   YLCSQSHLPSLKPECPIEGELVYEVPDIVDEVIELALEERALVKVIVDPQLQKKIDGLA
FT                   AFLRFPL"
FT   gene            348180..348779
FT                   /locus_tag="Hydth_0341"
FT   CDS_pept        348180..348779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0341"
FT                   /product="protein of unknown function DUF88"
FT                   /note="COGs: COG1432 conserved hypothetical protein;
FT                   InterPro IPR002790; KEGG: aae:aq_200 hypothetical protein;
FT                   PFAM: protein of unknown function DUF88; SPTR: A8UUE1
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44744"
FT                   /protein_id="ADO44744.1"
FT                   /translation="MIDERVIIFIDGSNLFHAIRYLNIRIDYQKLVDFLTEGRRLIRAY
FT                   FYGAMPHEKDVKKNTPEWESLLRQKRFLEELSLMGIKVKTAHLKKLPSGEYVEKEVDIM
FT                   LATDMLSMAYMNTYDTAVLISGDSDYSYTVEEVQRIGKKVENASFKRTSSYQLRKACDR
FT                   FILLDDYLDRFLVEEKPAITQETSFWERIVRIWKRS"
FT   gene            348776..349717
FT                   /locus_tag="Hydth_0342"
FT   CDS_pept        348776..349717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0342"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="COGs: COG0196 FAD synthase; InterPro
FT                   IPR002606:IPR014729:IPR015865:IPR015864:IPR 004821; KEGG:
FT                   aae:aq_139 riboflavin kinase; PFAM: FAD synthetase;
FT                   Riboflavin kinase; SPTR: O66535 Riboflavin kinase; TIGRFAM:
FT                   riboflavin biosynthesis protein RibF;
FT                   cytidyltransferase-related domain protein; PFAM: Riboflavin
FT                   kinase; FAD synthetase; TIGRFAM: riboflavin kinase/FMN
FT                   adenylyltransferase; cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44745"
FT                   /protein_id="ADO44745.1"
FT                   /translation="MRALSLKWDSQCVKSLECVENIQESTAVTVGNFDGIHLGHRFLIE
FT                   KLKEEAKKRNLKTLVLSFHPHPLKVLSPKQSPCELTNLEEKLNLLEALSIDYAVFIRFD
FT                   EKFSLMKADDFIREILYKRLSAKFLLVGYDWRFGYRREGEIELAKELGEKLGFEVMSVE
FT                   PFKINGHIVSSTLIRRLLHSGRLEEAQVYLGRHYWVKRKVVKGDGRGSSIGVPTANLEG
FT                   TENLCLKEGVYAVLVEESLLGVANYGYRPTFGGRRKVLEVHILDFNENLRSKKIKVEFV
FT                   KFLREEKKFNSLEELKKQIKQDIELTRSLLLG"
FT   gene            complement(349691..349996)
FT                   /locus_tag="Hydth_0343"
FT   CDS_pept        complement(349691..349996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_1561 hypothetical protein; SPTR:
FT                   A8UW41 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44746"
FT                   /protein_id="ADO44746.1"
FT                   /translation="MDMLKEEDIVARSVSIEVVGEIHRCKEGPSSRFYCLPVVIHFDNG
FT                   EKRAYMLKAHSEPKTLQDFLENKKGLKDRMEKSFALLKNGEIRYASYLLTQQETSG"
FT   gene            complement(350002..351558)
FT                   /locus_tag="Hydth_0344"
FT   CDS_pept        complement(350002..351558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0344"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="COGs: COG3829 Transcriptional regulator containing
FT                   PAS AAA-type ATPase and DNA-binding domains; InterPro
FT                   IPR020441:IPR002078:IPR000014:IPR013656:IPR
FT                   002197:IPR003593:IPR009057; KEGG: hya:HY04AAS1_0103 PAS
FT                   modulated sigma54 specific transcriptional regulator, Fis
FT                   family; PFAM: sigma-54 factor interaction domain-containing
FT                   protein; PAS fold-4 domain protein; helix-turn-helix
FT                   Fis-type; SMART: AAA ATPase; PAS domain containing protein;
FT                   SPTR: B4U6M7 PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family; PFAM: Bacterial regulatory protein,
FT                   Fis family; Sigma-54 interaction domain; PAS fold"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44747"
FT                   /protein_id="ADO44747.1"
FT                   /translation="MDFNILEHLFDAVLVIDKDRRVIYANSSAKGLIGDAKEGESCKGL
FT                   FSICSHCPMSYVEEEREGLQVYDARIRNGKHVCWSMTPLFEKGDFVGVIEVFRDVSNVV
FT                   SCILEAERQKAYKEAIFNSIVEAILVLDTQGYVVEHNQIAKRMLCREEEENLTGKYIKE
FT                   LVNLDLEELPPEGERADVYINTPCGKQKASVLLSPMQSGFGYIVSLYVVNEVAVCGFGE
FT                   EMIITKSSAFQKVIDLARACAEHDVNVLIEGETGTGKSLLAKYIHNLSPRRAGPFVKIN
FT                   CAAIPDHLLEAELFGYMRGAFTGAVRDKPGKVELAEGGTLFLDEIGDMPLHLQAKILHL
FT                   VQEKEFERLGDTKVRRANVRIISSTNKNLRELIKKGLFREDLYYRLGVVKLQVPPLRER
FT                   KEDIPLLINHFLEKYSKAYSRKIKGVSSEAMKLLLSYHFPGNVRELENVIERAIITCKG
FT                   SVINVEDLQLEFQEQVPQKEEDREKIRQVLEQTGWNKSLAAKVLGMHRTTLWRKMKELG
FT                   L"
FT   gene            complement(351567..351953)
FT                   /locus_tag="Hydth_0345"
FT   CDS_pept        complement(351567..351953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0345"
FT                   /product="Sterol-binding domain protein"
FT                   /note="COGs: COG3255 Putative sterol carrier protein;
FT                   InterPro IPR003033:IPR016083; KEGG: aae:aq_090 hypothetical
FT                   protein; PFAM: Sterol-binding domain protein; SPTR: O66500
FT                   Putative uncharacterized protein; PFAM: SCP-2 sterol
FT                   transfer family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44748"
FT                   /protein_id="ADO44748.1"
FT                   /translation="MYAFLSEEWIKAYADEWNRNEKLRSDLKDFSARIKYYIEGSEDRA
FT                   VELVVENGVAKSVGLANSHSYDFELWASLENWKKMASGDMGPKAAMLTKRLKFKGSMIT
FT                   AMKYMGAFEESLRMMGRIPTNWNL"
FT   gene            complement(352002..352337)
FT                   /locus_tag="Hydth_0346"
FT   CDS_pept        complement(352002..352337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0346"
FT                   /product="Protein of unknown function DUF2173"
FT                   /note="COGs: COG4831 conserved hypothetical protein;
FT                   InterPro IPR018685; KEGG: aae:aq_088 hypothetical protein;
FT                   PFAM: Protein of unknown function DUF2173; SPTR: O66499
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   conserved protein (DUF2173)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44749"
FT                   /protein_id="ADO44749.1"
FT                   /translation="MANLDRLMQVKGVWAAGEFSPDGKLIAYKGNISEEHAAMAAKMCA
FT                   ANTLMAEMQAEGYTAFSGQEWVPLIGWALSGPKYSVCVVGNVGVFVKNDEVSFNEVFKA
FT                   LREVAGK"
FT   gene            complement(352353..352694)
FT                   /locus_tag="Hydth_0347"
FT   CDS_pept        complement(352353..352694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0347"
FT                   /product="Protein of unknown function DUF2173"
FT                   /note="COGs: COG4831 conserved hypothetical protein;
FT                   InterPro IPR018685; KEGG: aae:aq_087 hypothetical protein;
FT                   PFAM: Protein of unknown function DUF2173; SPTR: O66498
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   conserved protein (DUF2173)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44750"
FT                   /protein_id="ADO44750.1"
FT                   /translation="MATISKLKELMSLPGAVAAGEFADDGRLIAYYGDIDEKSAEIAAM
FT                   MCAANKLMGNMQAKGWSAYTGEGGFYPVLGFAVAGGKYAACIMGNVGVFVKLDQADFDK
FT                   VFETLSKYI"
FT   sig_peptide     complement(352638..352694)
FT                   /locus_tag="Hydth_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            353288..353713
FT                   /locus_tag="Hydth_0348"
FT   CDS_pept        353288..353713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0348"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: aae:aq_918 hypothetical
FT                   protein; PFAM: Hemerythrin HHE cation binding domain
FT                   protein; SPTR: O67063 Putative uncharacterized protein;
FT                   PFAM: Hemerythrin HHE cation binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44751"
FT                   /protein_id="ADO44751.1"
FT                   /translation="MSIKEYLTDEHRECDKLYAKVESLVQEGNWGQAEEAFRAFKDANL
FT                   LHFKREEDVLFPAFEETTGVVMGPTQVMRMEHAQARDLMDRMEKAIKEKDKKSFLSLGD
FT                   TFVVLLQQHNMKEEQILYPMCDQHLVADEVIEKMKQL"
FT   gene            353710..354888
FT                   /locus_tag="Hydth_0349"
FT   CDS_pept        353710..354888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_917 hypothetical protein; SPTR: O67062
FT                   Uncharacterized protein aq_917"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44752"
FT                   /protein_id="ADO44752.1"
FT                   /translation="MTGLSIVQAPPFIIVFSYFLTATLFGFLLSTFEIYMAFKHTLFPP
FT                   PIVHLYTLGFALFTMFGALFQMLPVVAGVVIKNPKPKAAVSYVLLITGIPTLLYGFYTG
FT                   KFLLFGSLMTYVGILYTSLLMLYHLLGIKSFTPTSRGMKFSLVFLLLGATAGFYRVLSY
FT                   YGYLPAFEENLIIHYSILLFGWIGLLIASVSFQVVEMFFITESYGKRFSMNYPIMVLLF
FT                   LPLSFLGGFFSLPLSLLFIIYSLMTLKRLIRRGRKMEDYTLYFWYLGQISLIFSAILLV
FT                   FKERFLIQFLFFYAVFFTSIIMGMMYRIIPFLVWFHMSNEGGANIPLMSEVIPPERIKL
FT                   SFYLHLAWVVLTSIAYVLGDFYVVASFIHFISSLLLLYNIYTGGIVYFKTQP"
FT   gene            complement(354872..356686)
FT                   /locus_tag="Hydth_0350"
FT   CDS_pept        complement(354872..356686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0350"
FT                   /product="potassium transporter"
FT                   /note="COGs: COG3158 K+ transporter; InterPro IPR003855;
FT                   KEGG: sul:SYO3AOP1_1248 K potassium transporter; PFAM: K
FT                   potassium transporter; SPTR: B2VA86 K potassium
FT                   transporter; PFAM: K+ potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44753"
FT                   /protein_id="ADO44753.1"
FT                   /translation="MFYGVKSVIRAMGAVFGDIGTSPLYTFSVIVLLTKPTQQEILGIA
FT                   SLIIWTLIILVTVQYAWFAMNLSIKGEGGTVVLGEIAKSLTNNRKLRNFYRVLVFIGLG
FT                   FLLGDGVITPAITILSSAEGVRLIPGFENIHQSEVILIAIAITVGLFLLQPKGTGKIGD
FT                   YFGPVMLLWFATIGIIGFYHALSYPYVFYAVSPHHAIEFLINHPIKGFIALSEVLLAAT
FT                   GGEALYADMGHLGRISIRRAWAFVFPMLVLNYLGQASYILTHQDKEHQAIFFESARSLL
FT                   GDTLYLPFLVLVMCAGVIASQALISGAFSIVFQAINTRIAPLLNIKHTSTEISTQIYIP
FT                   VVNWMLLAGVIFMYFNFKTSENMASAYGFAVSAVMVITGFFLTFIHFMKRQVFFFIGSV
FT                   LLLLIDITFFISNFYKIPHGGYWSVIFALIPLSVMVLYTAGQSKLYKSMKFTPFREFIL
FT                   SFENLYLQNPKIKGTAIFLVRDLKNIPPYVTQTFFDHGILYEDNVFLSLVKKDEPFGVE
FT                   TFLKGSIAQGLRLVEIRYGYMEVLDIDRELREAGIWERAIFYGVEDIYTNKLLWKLFSF
FT                   LKRVTPSFVEFYRFPHGKLHGVAVRVEF"
FT   gene            complement(356688..358478)
FT                   /locus_tag="Hydth_0351"
FT   CDS_pept        complement(356688..358478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0351"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="COGs: COG0173 Aspartyl-tRNA synthetase; InterPro
FT                   IPR002312:IPR012340:IPR006195:IPR004365:IPR
FT                   004364:IPR004115:IPR004524:IPR016027; KEGG: aae:aq_1677
FT                   aspartyl-tRNA synthetase; PFAM: tRNA synthetase class II (D
FT                   K and N); nucleic acid binding OB-fold tRNA/helicase-type;
FT                   GAD domain protein; SPTR: O67589 Aspartyl-tRNA synthetase;
FT                   TIGRFAM: aspartyl-tRNA synthetase; PFAM: GAD domain; tRNA
FT                   synthetases class II (D, K and N); OB-fold nucleic acid
FT                   binding domain; TIGRFAM: aspartyl-tRNA synthetase,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44754"
FT                   /protein_id="ADO44754.1"
FT                   /translation="MLKRTKYCGQVSEEDIGKELILCGWVHRIRNHGGVIFIDLRDREG
FT                   IMQVVVEERTSPKAYEIADSLSSEYVIAVKGSVRRRPPGTENPKLKTGYYELLAQEIEV
FT                   LNTSEPLPFPVDEETPVSEELKLRYRYIDLRRESMKESILFRHKAYQIIREVFIKHGFV
FT                   EIETPFLTKSTPEGARDFLVPSRLHPGKFYALPQSPQLFKQILMVAGFDRYFQIVKCLR
FT                   DEDLRADRQPEFTQIDFEMSFVEEEDVISFSEELICKLFRELLGIELKRPFDRMSYKDV
FT                   LERYGTDKPDRRFGIELVDLSNIFKNTEFKVFKDALQSGGSVKAINFKNSHLSRKEIDE
FT                   LTKFVQTLGARGLAWIKVEDGKLNSPITKFLSDEEIKNLLEKTSANEGDTIFFSADKQD
FT                   MAYKILGSLRLHIAKKYQLLRDNTFDLLWVVDFPLMEWDEEEGRFVSLHHPFTSPKEED
FT                   LPLLEEALKSQDLEEKKQLLKRVRARAYDLVINGYEVGGGSIRIHRREVQELVFKLLGI
FT                   SEVEAEEKFGFLLRALRYGAPPHGGLAFGLDRLIALMRGLDSIRDVIAFPKTQKGICPL
FT                   TGAPDYVSPKQLKDVHIKLE"
FT   gene            358503..359042
FT                   /locus_tag="Hydth_0352"
FT   CDS_pept        358503..359042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0352"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="COGs: COG0634 Hypoxanthine-guanine
FT                   phosphoribosyltransferase; InterPro IPR000836:IPR005904;
FT                   KEGG: aae:aq_544 hypoxanthine-guanine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   PRIAM: Hypoxanthine phosphoribosyltransferase; SPTR: A8UTD9
FT                   Hypoxanthine-guanine phosphoribosyltransferase; TIGRFAM:
FT                   hypoxanthine phosphoribosyltransferase; PFAM:
FT                   Phosphoribosyl transferase domain; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44755"
FT                   /protein_id="ADO44755.1"
FT                   /translation="MPYVSIKGKKLKLLIDEERIKSRVKELATSIETDMGESFIAVGLL
FT                   KGSFIFLADLIRHINLPVKVDFMWVSSYGSKTISEGHIRILRDLSMDIENQKVLLVDDI
FT                   LDTGYTLKEIKQILMLRKPKVLKTCVLLDKYERRKVDVEVDYTGFRVPDAFLVGYGLDW
FT                   DEEGRNLRGIYAVEGL"
FT   gene            359052..360332
FT                   /locus_tag="Hydth_0353"
FT   CDS_pept        359052..360332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0353"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="COGs: COG0141 Histidinol dehydrogenase; InterPro
FT                   IPR012131:IPR001692:IPR016161; KEGG: aae:aq_782 histidinol
FT                   dehydrogenase; PFAM: Histidinol dehydrogenase; PRIAM:
FT                   Histidinol dehydrogenase; SPTR: O66976 Histidinol
FT                   dehydrogenase; TIGRFAM: histidinol dehydrogenase; PFAM:
FT                   Histidinol dehydrogenase; TIGRFAM: histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44756"
FT                   /protein_id="ADO44756.1"
FT                   /translation="MKVEDLRNTAWRFNERLRYIAKRGEVLEEEYEPIVREIIKRVKEE
FT                   GDKAITYYTEKFDGVKLTPDTMEVPYEELENAYNEIEEDVRSALEIAYERIRRFHELQR
FT                   EKAFFMEESGTLLGMKVVPLERVGVYVPGGKAAYPSTVLMNVVPALVAGVEEIIMVSPK
FT                   PNKYTLAAAFISGVSRVYQIGGAQAIAGLAYGTEMIPKVDKIVGPGNIYVAIAKKLLFG
FT                   VVDIDMIAGPSEILIISDGSCEPSWIATDLLSQAEHDEMAGAFMITTDEKHALRVKEEL
FT                   ERLMEDFPRKEIAKKSIERFGTIFLVEDMFKACEVANYIAPEHLEVLTEDPFSLLPYIK
FT                   HAGAIFLGRYSTEALGDYILGPNHTLPTGGTARFFSPLGVYDFIKRSSVLFVSKEGFER
FT                   LAEPTESIAKAEGLFAHFTSVRIRRET"
FT   gene            360329..360886
FT                   /locus_tag="Hydth_0354"
FT   CDS_pept        360329..360886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_0892 hypothetical protein; SPTR:
FT                   A8UWW3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44757"
FT                   /protein_id="ADO44757.1"
FT                   /translation="MKRVFLVCLLMLSYACAPVVCPGEKEVRSRYSEDTAPKNYEAFTS
FT                   LRYGILRVPIYIEKSEGKYTIRSPQTGTVFLKDSNLCVNATCLDLPVNPDGLIFGALLR
FT                   GDEKPSCSFGTITFERDDQMYKRKYIFSNGELKRVELTDKNRDRILILEYGDRSKEGYY
FT                   KRVKASLGDMTFLFSVDELKRR"
FT   sig_peptide     360329..360388
FT                   /locus_tag="Hydth_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            360891..362057
FT                   /locus_tag="Hydth_0355"
FT   CDS_pept        360891..362057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0355"
FT                   /product="LL-diaminopimelate aminotransferase"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro
FT                   IPR015421:IPR015422:IPR004839:IPR004838:IPR
FT                   019881:IPR015424; KEGG: aae:aq_273 LL-diaminopimelate
FT                   aminotransferase; PFAM: aminotransferase class I and II;
FT                   SPTR: O66630 LL-diaminopimelate aminotransferase; TIGRFAM:
FT                   LL-diaminopimelate aminotransferase; PFAM: Aminotransferase
FT                   class I and II; TIGRFAM: LL-diaminopimelate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44758"
FT                   /protein_id="ADO44758.1"
FT                   /translation="MSFEYSERIKSLPPYLFAQIDKKKKEKIAQGVDVIDLGVGDPDMP
FT                   TPEPIVKAMQRAVEKPEHHRYPSYEGMLSFREAVAEFYRRRFGVFLDPEKEVITLIGSK
FT                   EGIAHFPLAFINPDDVVLCPDPAYPVYKIGTLFAGGVPYIMPLKEENNFLPDFKSIPKD
FT                   VLKRAKIIWVNYPNNPTSAVADESFYRELIDWARENNIIVASDLAYSEIYFGNQKPMSI
FT                   LQIDGAKEVAIEFHSLSKTYNMTGWRIGMAVGNEKLISGLGKVKTNVDSGQFQAIQEAG
FT                   ITALKMPESELQKIREVYRQRREAMVKALQDAGLEVYSSTATFYLWVKVPKGYTSAQFV
FT                   SLLLDECGIVCTPGNGFGEHGEGYFRISLTLPTERLLEAAERIRKLKI"
FT   gene            362054..363337
FT                   /locus_tag="Hydth_0356"
FT   CDS_pept        362054..363337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0356"
FT                   /product="CBS domain containing protein"
FT                   /note="InterPro IPR000644; KEGG: aae:aq_040 hypothetical
FT                   protein; PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; SPTR: A8UWT6 Glycine
FT                   dehydrogenase subunit 2; PFAM: CBS domain; EAL-domain
FT                   associated signalling protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44759"
FT                   /protein_id="ADO44759.1"
FT                   /translation="MMKEVELLQLCTLVPTVDYRMTPQEALKLFNEHELHEFLVVVKDG
FT                   KPVGWVKKKDVRLALYRQELCVGDLTRPLTNIRNLKTTVDNMSGLFDFFNLRKDPLIVV
FT                   NRNGSYMGVLFYHVLLNYVCMHREAEASLFQKLRNFFGQAYYLYVFFLKGKKTFREAYG
FT                   TVKEEGLYKILYEDIKDSISGDVSLVKDEGEVYALSKEKLQRDKIKEIIENFHKEFSLL
FT                   YADAKPVYVQGYLIPLDTVKNYEELFRIASDTKDKLRGVDASFFVIHGLQPSVIMCEYK
FT                   AKELILKIKEQITEDFKRILERINREDRELWEYVLYDFFKEYPYFELFYIMNERGVQIS
FT                   NNVINPKISYSIKAGKKGADRSEKSYFKQAMKDGTYISDIYISQATDDFCITLSARFQH
FT                   KDKTYVLAGDINYREIHQLVKSYTKASL"
FT   gene            363334..364461
FT                   /locus_tag="Hydth_0357"
FT   CDS_pept        363334..364461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0357"
FT                   /product="Histone deacetylase"
FT                   /note="COGs: COG0123 Deacetylase including yeast histone
FT                   deacetylase and acetoin utilization protein; InterPro
FT                   IPR000286; KEGG: aae:aq_1023 acetoin utilization protein;
FT                   PFAM: histone deacetylase superfamily; PRIAM: Histone
FT                   deacetylase; SPTR: O67135 Acetoin utilization protein;
FT                   PFAM: Histone deacetylase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44760"
FT                   /protein_id="ADO44760.1"
FT                   /translation="MKKLVGSLKYRNLRYTQNHPLRIPRVSLLIEFLKAMGLIEEQEII
FT                   QSREATEEELLLYHTEDYLRALEESDRCMCVKDRYREKYNIGTYENPVSPAMWRGSLLA
FT                   TGSSVQAVEVFLEGGVAFNPAGGMHHAYPSRANGFCFINDPAVSIEFLKKKGFKKILYI
FT                   DLDAHHCDAIQESYYQDDSVFVLSLHQSPEYAFPFKSGFAHEIGRGRGKGYNMNVPLPK
FT                   GIKDGEYLYALEESLKIVKEIFSPDVYILQLGTDSLKEDYLSKFELSNAGFLKAFDMVR
FT                   DMLGEGIYLGGGGYHPIALARAWALIWCRISGREIPSKINSEARQVLLSVNFEEFDEDI
FT                   DRTYMYDYLLDRSDGEPPRGEVKRLIERLKALFLL"
FT   gene            364470..365735
FT                   /locus_tag="Hydth_0358"
FT   CDS_pept        364470..365735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0358"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="COGs: COG0151 Phosphoribosylamine-glycine ligase;
FT                   InterPro IPR013817:IPR013815:IPR013816:IPR011761:IPR
FT                   020562:IPR020561:IPR020560:IPR020559:IPR000115:IPR016185:I
FT                   PR011054; KEGG: aae:aq_742 phosphoribosylamine--glycine
FT                   ligase; PFAM: Phosphoribosylglycinamide synthetase,
FT                   ATP-grasp (A) domain; Phosphoribosylglycinamide synthetase,
FT                   N-domain; Phosphoribosylglycinamide synthetase, C-domain;
FT                   PRIAM: Phosphoribosylamine--glycine ligase; SPTR: A8UU63
FT                   Phosphoribosylamine-glycine ligase; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, N domain;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, C domain; TIGRFAM:
FT                   phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44761"
FT                   /protein_id="ADO44761.1"
FT                   /translation="MKLLVVGNGGREHALVWKLKQSPLVKQIYIARGNAGSWQIAKGVD
FT                   IDYLDIKGLAEFALREGIDFTVVGPEAPLVGGIVDEFESRGLKILGPNRRASMLEGSKV
FT                   FAKDFMQRYQIPTAEYQVFDDAVKAKRFVMDFGTPLVIKADGLAGGKGAVVCYDQKTAM
FT                   EAIDRIMVRGELGSAGRRVVIEQFLEGEEASYIVLLDGDRYIPLPTSQDHKRLLDGDMG
FT                   PNTGGMGAYSPNPFVGEETEKAIKHQIIERLIRGLKEEGIYYRGFLYAGLMLTKDGPKV
FT                   LEFNVRLGDPEAQPILMRIKGDFMKNLLDFYEGKAINLEIDKRCALCVVLASRGYPEKP
FT                   QVGGVIYGLDAIKEEDVIVFHAGTDIKDGKVIAKGGRVLNVCAWGKSIKDARDKAYRVI
FT                   ESIKFEGMQYRRDIGAKALNLL"
FT   gene            complement(365722..366792)
FT                   /locus_tag="Hydth_0359"
FT   CDS_pept        complement(365722..366792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0359"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="COGs: COG0628 permease; InterPro IPR002549; KEGG:
FT                   aae:aq_740 hypothetical protein; PFAM: protein of unknown
FT                   function UPF0118; SPTR: A8UU65 Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44762"
FT                   /protein_id="ADO44762.1"
FT                   /translation="MSREKVFSYFLLGITVFFTFLVLVILTPFLKPILWAVIFSLVAYP
FT                   LHLSLSRLLRNNTLSALMVTLLVLTFIVIPFLIIGLVAAKQSVEITKAIIQYLQNHTLT
FT                   DVLHSLYSLPVVNKLITEEILQRVYEYMQSEEFKNTITSYLSKLTQKAGEIFTSMLFAT
FT                   GSVIFKSFVFLISFFFILRDGRRFVEFFARFLPMHKEDLYEVLLTIYKTILAVVYGSIG
FT                   VALVQAVLSFIAYTVVGINYSLLWALITFIASFVPPFGTGFVWVPIAIYTFLNKGLFYG
FT                   IFMLLWGSLVISTVDNILRPLIMKKGIKMPYIVLFFSTVGGLLTFGFLGLFLGPIVFTT
FT                   LFSLAIIYERRILKEG"
FT   gene            366806..367357
FT                   /locus_tag="Hydth_0360"
FT   CDS_pept        366806..367357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0360"
FT                   /product="TPR repeat-containing protein"
FT                   /note="InterPro IPR011990:IPR019734:IPR013026:IPR001440;
FT                   KEGG: mbn:Mboo_1172 TPR repeat-containing protein; PFAM:
FT                   TPR repeat-containing protein; SPTR: A7I7H9 TPR
FT                   repeat-containing protein; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44763"
FT                   /protein_id="ADO44763.1"
FT                   /translation="MIIDMGKSLLFIFVFFALSCAEKTVVVKEEPKSRAPGMAVASGKA
FT                   VENGKKQLSKGHCKQAIHEFYKALEKDPQNFEALYWLGVAEGVCGYYPQAYDRLTFVVR
FT                   YAPDDIWRARVYATMGITLLYMGKEDDAVAYFEKARAIDPRNELVVAYYENDHKKNKKH
FT                   KIKKRPKDREGYEITFRWMY"
FT   gene            complement(367341..368366)
FT                   /locus_tag="Hydth_0361"
FT   CDS_pept        complement(367341..368366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0361"
FT                   /product="Chorismate binding protein"
FT                   /note="COGs: COG0147 Anthranilate/para-aminobenzoate
FT                   synthase component I; InterPro
FT                   IPR019999:IPR005801:IPR015890; KEGG: aae:aq_1144
FT                   p-aminobenzoate synthetase; PFAM: Chorismate binding-like;
FT                   SPTR: O67217 p-aminobenzoate synthetase; PFAM: chorismate
FT                   binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44764"
FT                   /protein_id="ADO44764.1"
FT                   /translation="MRLVFSGGWIGKGGLYQARIKRVSFLKSLHELSPESFPCFLVLSY
FT                   HLASEVFGLPIKTSSLPLVVLVEIESFKAIDPREKRVSLTLLESSISDEGFKEKVNEVK
FT                   KLIEEGIVYQINLTNRFTFSLKGDPFDLFLKFYARQPVDYAFFLDLDDFYIISGSMELF
FT                   LRREGKKLRSEPIKGTASKREELKKSEKDRAENLMITDVVRNDLGIVGKCVEVKDLFGI
FT                   RKYKTLYHMYSAVECETTASLKAILFATFPPASVTGAPKRKAVEVIDSLEPHCRDLYCG
FT                   CAGFLKSEEDFTLSVLIRTALGDGKTLSYYAGCGIVWDSDPQKELREVYLKMKAFFSTS
FT                   T"
FT   gene            complement(368366..369103)
FT                   /locus_tag="Hydth_0362"
FT   CDS_pept        complement(368366..369103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0362"
FT                   /product="aminotransferase class IV"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR001544; KEGG: tye:THEYE_A1969 aminodeoxychorismate
FT                   lyase; PFAM: aminotransferase class IV; SPTR: B5YIC8
FT                   Aminodeoxychorismate lyase; PFAM: Aminotransferase class
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44765"
FT                   /protein_id="ADO44765.1"
FT                   /translation="MANRSFFYGEGLFETILYRGRTKKLLRHYERLSKSAEYFGIPYPD
FT                   LETFCDRIEKKVKGKKDIYVKVCLVSYGKPKYYQMPYRSELKVFVYKYTPLQNPVSVCI
FT                   SSIKRHSSDPLIKHKTLNYLTNVLVKREAIQRGFYDGLMLNEKGHITESSSANLLLVRK
FT                   DSIYTPHIASGLLLGTTLKSIMEKVEIKEKEVKPEDVFGADHLFLVNSLIGVLPVMRLE
FT                   DKIFSVDESLTQYLKSIVEEENR"
FT   gene            369137..371236
FT                   /locus_tag="Hydth_0363"
FT   CDS_pept        369137..371236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0363"
FT                   /product="ribonuclease R"
FT                   /note="COGs: COG0557 Exoribonuclease R; InterPro
FT                   IPR012340:IPR003029:IPR013223:IPR001900:IPR
FT                   011805:IPR004476:IPR011129:IPR016027; KEGG: aae:aq_2046
FT                   VacB/RNase II family 3'-5' exoribonuclease; PFAM:
FT                   ribonuclease II; Ribonuclease B OB region domain; RNA
FT                   binding S1 domain protein; SMART: Cold shock protein; SPTR:
FT                   O67834 Ribonuclease R; TIGRFAM: ribonuclease R; VacB and
FT                   RNase II family 3'-5' exoribonuclease; PFAM: RNB domain;
FT                   Ribonuclease B OB domain; S1 RNA binding domain; TIGRFAM:
FT                   ribonuclease R; VacB and RNase II family 3'-5'
FT                   exoribonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44766"
FT                   /protein_id="ADO44766.1"
FT                   /translation="MAQEHITEEDVLELLKKSKKPLHFEQIVKELELDKEGKKKLKKVL
FT                   KTLKRSNKLTVERGRYKLAEEEIVVGTVIPYPAGFGFLQIGEGKKDIYIPPFEMVKVFG
FT                   GDVVKARVVEFKGKKEVRILQVIKRGKREIICKIVKGKTCYAIPLYDNPHQKIQLSQES
FT                   CKDLKKDTVVVVGIKEYPRAKAPARGYIKEVIGHPKERVLTIELLIRKYDLPLSYPEEV
FT                   IKEAQKFRLHIKKELKNRKDLRDQICFTIDPERARDFDDAVAIQMTPEGHYRLWVHIAD
FT                   VSYFVKEGSHIDEEAFKRGFTFYLPDRALHMLPEKLSSDLCSLKPNEDRLTFTCEMVFD
FT                   QKGNLLNYDIYESVIRSKARLTYDEALRLIVGDPALEEKYPHLVEPLRLMENLYRILSK
FT                   KRWEKGSIDFDLPESEVIVDEFGQPVAVVPYERHIAHRIIEHFMISANETVAMHLEHLG
FT                   YPCLYRVHEKPDPEKVENLIEILAGLGYKVKRVSLEPKFFQKIIEDFEGRPEENLVRFL
FT                   TLRSMKRAYYSPHNVGHFGLASEHYAHFTSPIRRYTDIIVHRILKKAIKGEDVPYEQMV
FT                   SYLEMAGQYLSERERLADNVEREAIELLKARLMKGHIGEAFAGIITGVVPFGFFVEIQD
FT                   YLVEGLVSINTLVDDQYIYDEPAHRLVGVRTGKVFRLGDVVKVKVVGVDEERGRIELEL
FT                   VKEEG"
FT   gene            371233..372534
FT                   /locus_tag="Hydth_0364"
FT   CDS_pept        371233..372534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0364"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COGs: COG1004 UDP-glucose 6-dehydrogenase; InterPro
FT                   IPR016040:IPR014027:IPR001732:IPR014026:IPR
FT                   017476:IPR008927; KEGG: aae:aq_024 nucleotide sugar
FT                   dehydrogenase; PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; PRIAM: UDP-glucose
FT                   6-dehydrogenase; SPTR: O66443 Nucleotide sugar
FT                   dehydrogenase; TIGRFAM: nucleotide sugar dehydrogenase;
FT                   PFAM: UDP-glucose/GDP-mannose dehydrogenase family, NAD
FT                   binding domain; UDP-glucose/GDP-mannose dehydrogenase
FT                   family, central domain; UDP-glucose/GDP-mannose
FT                   dehydrogenase family, UDP binding domain; TIGRFAM:
FT                   nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44767"
FT                   /protein_id="ADO44767.1"
FT                   /translation="MRITVVGGGYVGLTTGICFSHLGYEVKVVEKVPQKVSMLNEGVVP
FT                   IYEPGLEDMLKDSLRLKRISFTTDLVEGLEFSEVIFICVGTPQQEDGSADLSQVEEVAR
FT                   LTAEHMESYKLLVEKSTVPVNTHKLIKKTLQRYMKRHVEFDVASNPEFLREGSAVKDFL
FT                   EPDRIVVGIESERAKNLLQKLYEPIKAPILFTDPATAELIKHASNSFLAMKISFINMIS
FT                   DLCEKTGADVKLVADGMGYDKRIGRAFLDAGIGWGGSCFPKDVRAFIKMAEDYGVDFSL
FT                   LREVDKINARRIENFLEKVKNALWSLKNKKLAVWGLSFKPNTDDIREAPSIKIVSALLR
FT                   EGAKLQLYDPKAMGNFRRIFPEGEDLIYAQGMYEAIKGCDALLILTEWEEFKKADLERV
FT                   KHLLKLPVVIDGRNIYEPAHMRELGFEYYCMGRR"
FT   gene            372531..373511
FT                   /locus_tag="Hydth_0365"
FT   CDS_pept        372531..373511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0365"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: aae:aq_1509 oligopeptide transport system permease;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; SPTR: A8UY59 Oligopeptide transport
FT                   system permease; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44768"
FT                   /protein_id="ADO44768.1"
FT                   /translation="MRNLPTFPIAIIMLFVIFALFADFIAPYPYDLQSRKTPYHPPTRI
FT                   HIVKDGRITFPYVNPYVMEDPIFKSYRENKKVSCKIEFFTKTPYGFKLFGVKAPCKIHL
FT                   LGADKLGRDVFSRLVYGARVSMFIGLVGITVTFLVGSLVGGFSGYMGGKVDSFIMRIVE
FT                   VLLAIPTFYLMLSLRSVFPLTMGSFEVFLMVVFIISFIGWAGLARVIRGMVLSIREKEF
FT                   VQSAKTYGAGTFRILTKHILPNTYYYLIVSATLSFPGYILGESALSFLGLGVQEPQPSW
FT                   GNMLSDARNVNLISSYPWILSPGVAIFLLVMAFNLLGDELLRRQK"
FT   sig_peptide     372531..372596
FT                   /locus_tag="Hydth_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            373508..374257
FT                   /locus_tag="Hydth_0366"
FT   CDS_pept        373508..374257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0366"
FT                   /product="Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulfur cluster binding domain protein"
FT                   /note="COGs: COG0543 2-polyprenylphenol hydroxylase and
FT                   related flavodoxin oxidoreductase; InterPro
FT                   IPR012165:IPR017927:IPR008333:IPR001433:IPR
FT                   019480:IPR017938; KEGG: aae:aq_1305 dihydroorotate
FT                   dehydrogenase electron transfer subunit; PFAM:
FT                   Dihydroorotate dehydrogenase, electron transfer subunit,
FT                   iron-sulphur cluster binding domain; oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; Oxidoreductase
FT                   FAD-binding domain protein; SPTR: A8UV91 ATP-dependent DNA
FT                   ligase; PFAM: Oxidoreductase FAD-binding domain;
FT                   Iron-sulfur cluster binding domain of dihydroorotate
FT                   dehydrogenase B; Oxidoreductase NAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44769"
FT                   /protein_id="ADO44769.1"
FT                   /translation="MKALKVKVLKNAPLSLRTYVMELSAPDIAHSVKPGQFVMLKVSHT
FT                   NDPIGRRAFAVGDVRGDNLYIFYDVVGRGTYLLSSLPEGSHIELFGPLGKRTFELSGDK
FT                   HLLIGGGIGIAGLTLLGKELRKEGKKVFFVYGAKGKEHLGLKSWLEEENFEHLIFTEDG
FT                   SEGRKGLVTEAVKEFDRSWTVSACGPKGMLKSLKNLVEPSRLYLSLESRMACGWGVCLG
FT                   CVVKGTQGNYLRVCYEGPVFRADEVCL"
FT   gene            374257..374880
FT                   /locus_tag="Hydth_0367"
FT   CDS_pept        374257..374880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0367"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="COGs: COG0307 Riboflavin synthase alpha chain;
FT                   InterPro IPR001783:IPR017938; KEGG: aae:aq_1707 riboflavin
FT                   synthase subunit alpha; PFAM: Lumazine-binding protein;
FT                   PRIAM: Riboflavin synthase; SPTR: O67604 Riboflavin
FT                   synthase alpha chain; TIGRFAM: riboflavin synthase, alpha
FT                   subunit; PFAM: Lumazine binding domain; TIGRFAM: riboflavin
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44770"
FT                   /protein_id="ADO44770.1"
FT                   /translation="MFTGLVEDVGKVKNIKISSKGGTLEVITSLKEIKVGDSIAVNGVC
FT                   LTVTKVEDSIISFDLSPETLRRSNLSKAFVGDLVNLERAIKVGDRLGGHILLGHVDFTS
FT                   RIESFRSVGDHYELKIYIPDEWILYFVEKGSVGIDGISLTVNTVEGNLISLNIIPHTYQ
FT                   NTNLKGRKEGDHVNIEVDILGKYVINYLSKRRERRLDQLLERLF"
FT   gene            374898..376121
FT                   /locus_tag="Hydth_0368"
FT   CDS_pept        374898..376121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0368"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="COGs: COG3434 signal transduction protein containing
FT                   EAL and modified HD-GYP domains; InterPro
FT                   IPR014408:IPR001633:IPR013976; KEGG: aae:aq_2044
FT                   hypothetical protein; PFAM: EAL domain protein;
FT                   Metal-dependent hydrolase HDOD; SMART: EAL domain protein;
FT                   SPTR: A8UWG8 Putative uncharacterized protein; PFAM: EAL
FT                   domain; HDOD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44771"
FT                   /protein_id="ADO44771.1"
FT                   /translation="MNVLCKQAIYDRSGRVAFYEVFIQDSITGEYPEGLDPLKATTLAI
FT                   DTITELNPIRVGNGKIVFVNVPAIFLEASMFDLLSPDYVGIELVENRRLSKELFEAINA
FT                   LLKKGFKFCIDDFGFEKIDYLPLLSKCHYVKINLKKNPYDKEELKEVIGILKSLKKGII
FT                   AKHIETKEDYELAYQLGFNFFQGFYLSKPVRFRDTRTISYLKATILRLYRAIKDKDMKG
FT                   IVDILEKDIGATYKFLKFLNSAYSTRTKDISRIDEAVAHLGLENIAKFTIVLALSEMFV
FT                   EEHEMDLWKRSLFRASLAERLAQMYAPHVREKAYIAGLFSLAGEALGQKPEDVVRDLML
FT                   DKEIVEAFERRLNEIGFILSLVELLEDNKSERIISRVSRIMNVDPEAVKNSIKEAEKES
FT                   SELLSSIT"
FT   gene            complement(376118..377038)
FT                   /locus_tag="Hydth_0369"
FT   CDS_pept        complement(376118..377038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0369"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="COGs: COG0755 ABC-type transport system involved in
FT                   cytochrome c biogenesis permease component; InterPro
FT                   IPR002541:IPR017562; KEGG: aae:aq_2043 cytochrome c
FT                   biogenesis protein; PFAM: cytochrome c assembly protein;
FT                   SPTR: A8UWG7 Cytochrome c biogenesis protein; TIGRFAM:
FT                   cytochrome c-type biogenesis protein CcsB; PFAM: Cytochrome
FT                   C assembly protein; TIGRFAM: cytochrome c-type biogenesis
FT                   protein CcsB"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44772"
FT                   /protein_id="ADO44772.1"
FT                   /translation="MRHVIHQRNVWMLSDYLIAFIGIFIAMLLSLLQVDNVFWYKSATL
FT                   LYALSSVMYLSYPLFRNSLFGKVSTLTLFLGLLLNLAGMIRRGVQSYQLGVFHPPWSNL
FT                   FEALTFWSFIAGSIYLLIERKYALRILGTFVVPLIFGLSAFAMLKASKDITPLMPALRS
FT                   YWLYLHVVTAFVGYAGFTVAFAGAVLYLVKGRFPQTKLLPSQDTLEEITYKAIIVVFPV
FT                   WTASIILGSAWANEAWGGYWSWDPKEVWSLIVWLFFGAYLHARQMLGWRGRRVAWMVVL
FT                   GFITVLICFFAINLYFPGLHSYATD"
FT   gene            complement(377091..377534)
FT                   /locus_tag="Hydth_0370"
FT   CDS_pept        complement(377091..377534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0370"
FT                   /product="ribosomal protein L9"
FT                   /note="COGs: COG0359 Ribosomal protein L9; InterPro
FT                   IPR020070:IPR020069:IPR020594:IPR009027; KEGG: aae:aq_2042
FT                   ribosomal protein L09; PFAM: Ribosomal protein L9-like;
FT                   SPTR: A8UWG6 Ribosomal protein L09; TIGRFAM: ribosomal
FT                   protein L9; PFAM: Ribosomal protein L9, N-terminal domain;
FT                   Ribosomal protein L9, C-terminal domain; TIGRFAM: ribosomal
FT                   protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44773"
FT                   /protein_id="ADO44773.1"
FT                   /translation="MKVVLLQDLEGYGVFGDVINVKDGFANNYLIPRGIALPATEGNLR
FT                   HVKSIIQQRMRKLQREKEKAISLAKALEGLMLEIPRPVGEKGKLFGSVTAADISNALKE
FT                   KGFDVDRKRILLKTLIKDVGIHTVQIRLHPQVNVEIKVEVKPA"
FT   gene            complement(377546..377764)
FT                   /locus_tag="Hydth_0371"
FT   CDS_pept        complement(377546..377764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0371"
FT                   /product="ribosomal protein S18"
FT                   /note="COGs: COG0238 Ribosomal protein S18; InterPro
FT                   IPR001648; KEGG: hya:HY04AAS1_0449 ribosomal protein S18;
FT                   PFAM: ribosomal protein S18; SPTR: B4U7M8 Ribosomal protein
FT                   S18; TIGRFAM: ribosomal protein S18; PFAM: Ribosomal
FT                   protein S18; TIGRFAM: ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44774"
FT                   /protein_id="ADO44774.1"
FT                   /translation="MEIKKTAKKACRFCEEKKDPSYKNYEELRQFMTERGKIIGRRQTG
FT                   VCAKHQRMLSREIKRARQLALLPYLVA"
FT   gene            complement(377777..378199)
FT                   /locus_tag="Hydth_0372"
FT   CDS_pept        complement(377777..378199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0372"
FT                   /product="single-strand binding protein"
FT                   /note="COGs: COG0629 Single-stranded DNA-binding protein;
FT                   InterPro IPR012340:IPR000424:IPR011344:IPR016027; KEGG:
FT                   aae:aq_064 single stranded DNA-binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; SPTR: A8UWG2 Single-stranded DNA-binding
FT                   protein; TIGRFAM: single-strand binding protein; PFAM:
FT                   Single-strand binding protein family; TIGRFAM: single
FT                   stranded DNA-binding protein (ssb)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44775"
FT                   /protein_id="ADO44775.1"
FT                   /translation="MLNKVLIIGRLTKDPSVRYLPSGNQITEFSIAYNRRYKVGDDWKE
FT                   ESHFFDVKAYGKLAESLSTRISKGYTVVVEGRLTQDRWTDKEGKAQSKVRIVADAVRII
FT                   NKPKLDEAPEEEVIPDTYEQEAEEKLWNSQDDEIPF"
FT   gene            complement(378192..378524)
FT                   /locus_tag="Hydth_0373"
FT   CDS_pept        complement(378192..378524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0373"
FT                   /product="ribosomal protein S6"
FT                   /note="COGs: COG0360 Ribosomal protein S6; InterPro
FT                   IPR014717:IPR020814:IPR000529; KEGG: aae:aq_063 ribosomal
FT                   protein S06; PFAM: Ribosomal protein S6, bacterial-like;
FT                   SPTR: A8UWG1 Ribosomal protein S06; TIGRFAM: ribosomal
FT                   protein S6; PFAM: Ribosomal protein S6; TIGRFAM: ribosomal
FT                   protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44776"
FT                   /protein_id="ADO44776.1"
FT                   /translation="MAKRYYETTRHYESVFVLKPTLTEEEVQRRLQEIRETIQKKGGQI
FT                   LQEEDWGIKKLAYPIKNFQHGRYFIFRITSSNPELPNHLDFYYKISDDIIRWLNFQVKV
FT                   KEGKNA"
FT   gene            378644..379102
FT                   /locus_tag="Hydth_0374"
FT   CDS_pept        378644..379102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0374"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1246 N-acetylglutamate synthase and related
FT                   acetyltransferase; InterPro IPR016181:IPR000182; KEGG:
FT                   aae:aq_1359 acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: A8UWB1 Putative uncharacterized
FT                   protein; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44777"
FT                   /protein_id="ADO44777.1"
FT                   /translation="MEVRKAVLKDVQDIYTLINEYAKEGILLPRSLNSIYENIRDFWVC
FT                   EREGEILGCCALHVVWEDLAEIKSLAVKKDARNSGVGSMLIERCLQEAKELGIKKVFVL
FT                   TYATDFFGKFNFREIKKEALPHKVWGECINCVKFPHCDEVAMILEVKA"
FT   gene            379099..380829
FT                   /locus_tag="Hydth_0375"
FT   CDS_pept        379099..380829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0375"
FT                   /product="DNA-directed DNA polymerase"
FT                   /note="COGs: COG0749 DNA polymerase I - 3'-5' exonuclease
FT                   and polymerase domains; InterPro
FT                   IPR002298:IPR002562:IPR001098:IPR019760:IPR 012337; KEGG:
FT                   aae:aq_1967 DNA polymerase I (PolI); PFAM: DNA-directed DNA
FT                   polymerase; 3'-5' exonuclease; SMART: DNA-directed DNA
FT                   polymerase; 3'-5' exonuclease; SPTR: A8UVF5 DNA polymerase
FT                   I; PFAM: 3'-5' exonuclease; DNA polymerase family A"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44778"
FT                   /protein_id="ADO44778.1"
FT                   /translation="MRYSYITSRDGLRSLKERLKDESYLFLDTETVSEKIRLVQLGNNE
FT                   DVFIVDLFETGSYGVDFLKDLLVDKGIVGHNLKYDLKFLYRYGIEPYAVFDTMIASQLL
FT                   GELDRHSLQKVAMHYLGEVLDKSLQMSNWGRAVLSKEQLEYAALDVKMVRDLYSILLDK
FT                   LNSTAHQEETLLKTRTSRVFGLKNPVAIIEMAFVQEVAKLELNGIGVDIKELEDLIREY
FT                   KKNLNKKVMEFMMHYRIDPLSPKQLGELLSKRLGLDLPKTEKGNISTDDKILSQFIHHK
FT                   PVQMILEIRMTKKLLDKLDEIRSFVKDGSVYPEFKQIGAITGRMSSLNPNVQNIPRDLR
FT                   GVFKAREGKVLVISDFSQIELRIASEYVGDERMIKAFREGKDLHRYTASVLLGKKEEDI
FT                   SKEERQLAKAVNFGLIYGISARGLSDYAKSYGIDLSVDDAQKIRDRFFEYFRSFKEWHE
FT                   RVKRELKQLGGSRGYTLLGRSYVAHTFPDAVNYPIQGTGADLLKLSVLMFDAEIKREKI
FT                   EAHVVNLVHDEIVVECQMEKAQLVRDLLERAMKHAGRVVLKQVPVEVESTINERWLKEG
FT                   "
FT   gene            complement(380826..381464)
FT                   /locus_tag="Hydth_0376"
FT   CDS_pept        complement(380826..381464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0376"
FT                   /product="putative 6-phosphogluconolactonase (DevB, Pgl)"
FT                   /note="COGs: COG0363
FT                   6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase; KEGG: pmm:PMM0771 putative
FT                   6-phosphogluconolactonase (DevB, Pgl); SPTR: A8UQU5 50S
FT                   ribosomal protein L13; TIGRFAM: 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44779"
FT                   /protein_id="ADO44779.1"
FT                   /translation="MARRGSYKLFSSKDIDVKVALFIKRVAHLFIKKKGRFNCALAGGE
FT                   TPLKAYSILANLPLDWTKTSFFLTDERFVPPEDERSNCKKIRQILSDRVKCFDLSLDIY
FT                   ESAKLYSENFKEIKCLDLVLLGIGEDGHTASLFPNTACQKVTPYVCISRSPDGIKRISL
FT                   TEEFINLSEKIAFFAKGDRKREVIKRLLRGEDMPATRIKNCRSIIIFTD"
FT   gene            complement(381442..382797)
FT                   /locus_tag="Hydth_0377"
FT   CDS_pept        complement(381442..382797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0377"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="COGs: COG0364 Glucose-6-phosphate 1-dehydrogenase;
FT                   InterPro IPR001282:IPR016040:IPR019796; KEGG: dtu:Dtur_0054
FT                   glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase; PRIAM:
FT                   Glucose-6-phosphate dehydrogenase; SPTR: A8UQU6
FT                   Glucose-6-phosphate 1-dehydrogenase; TIGRFAM:
FT                   glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   Glucose-6-phosphate dehydrogenase, C-terminal domain;
FT                   Glucose-6-phosphate dehydrogenase, NAD binding domain;
FT                   TIGRFAM: glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44780"
FT                   /protein_id="ADO44780.1"
FT                   /translation="MNRKFSIFILGGTGDLAKRKLLPALERLYKEGHLKNLHKVYSLAR
FT                   KEDPSWKVLVSSLEPSEKFDNFLQFDVNLDSSYHHLGRILRELKGQELIFYLALSPFLF
FT                   ETALRKLGRLLRDFTNPRKIVIEKPFGFDTASARKLNQLLYTYFLEEEIYRIDHFLGKE
FT                   TIQNIFSVRFSNTIFESLWHRNFVDHVQIVAIEDIGIEGRGEYYDKAGAIRDMLQNHML
FT                   QMLSFLAMEPPCCMYPEFIRDEKVKLLRSVRKISPEETVKGQYEGYLLEKAVREGSKTE
FT                   TFVAVKLHIDNPRWQDVPFYLMTGKRLSKKLSQMAVVFKEVPRSFANLFDCMPNQNKII
FT                   FQTSPKNKIAIHFELRPPAGKFIACPVETVMEYDMESYVGKKLPEAYETLILDIIEGDR
FT                   SLFIRGDEVELMWEIVQPILESDAPLHIYKPGTLGPEQAHLLLQKDGKAWII"
FT   gene            complement(382790..383692)
FT                   /locus_tag="Hydth_0378"
FT   CDS_pept        complement(382790..383692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0378"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="COGs: COG1023 6-phosphogluconate dehydrogenase;
FT                   InterPro IPR006183:IPR016040:IPR013328:IPR006115:IPR
FT                   006114:IPR004849:IPR008927; KEGG: aae:aq_498
FT                   6-phosphogluconate dehydrogenase-like protein; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding;
FT                   6-phosphogluconate dehydrogenase domain protein; SPTR:
FT                   A8UQU7 6-phosphogluconate dehydrogenase; TIGRFAM:
FT                   6-phosphogluconate dehydrogenase, decarboxylating; PFAM:
FT                   6-phosphogluconate dehydrogenase, C-terminal domain; NAD
FT                   binding domain of 6-phosphogluconate dehydrogenase;
FT                   TIGRFAM: 6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44781"
FT                   /protein_id="ADO44781.1"
FT                   /translation="MKVLVVGLGRMGGGIVRRLKSKGYQVAGYDSHPDVRNAFKDTAFV
FT                   MDSLSQMTEFFGDQRKIIWLMVPHHAVDDVIESFVPFLSGGDIVIDGGNSYYKDSQRRY
FT                   QKLAKIGVSFLDVGVSGGVYGEQMGYCLMIGGDEKTYDLIKDLFKDLSYREEGYAYLGG
FT                   PGAGHFAKMVHNGIEYAFMQAIGEGFELLKESGFNYHLGEVARIYNAGSVIRSWLMELT
FT                   QKVFEEFKDLETLEAYVEDTGEGRWTLIEAIERAVPVPTIADALFMRFRSRQENSFRDR
FT                   LLAGLRYQFGRHSLKRKDE"
FT   gene            384137..384592
FT                   /locus_tag="Hydth_0379"
FT   CDS_pept        384137..384592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0379"
FT                   /product="cytochrome c class I"
FT                   /note="InterPro IPR009056:IPR003088; KEGG: msl:Msil_3147
FT                   cytochrome c class I; PFAM: cytochrome c class I; SPTR:
FT                   B8EMC8 Cytochrome c class I; PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44782"
FT                   /protein_id="ADO44782.1"
FT                   /translation="MAKRGLKALLLSSCLFLTYLVSLPVSSAEGENPYKANESKLPPMK
FT                   NPYEGDQKAAQDGRKLWFANGCNGCHGGTGGGGMCPPVINKVWVYGKSDAILFNLIKLG
FT                   SVGLREKYGLVRIGRENVVGDMPPFSSLSDEEIWKLITYMRSIYKGD"
FT   sig_peptide     384137..384217
FT                   /locus_tag="Hydth_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            384594..385166
FT                   /locus_tag="Hydth_0380"
FT   CDS_pept        384594..385166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdl:CDR20291_2344 putative ATP-dependent
FT                   helicase; SPTR: Q182D7 Probable ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44783"
FT                   /protein_id="ADO44783.1"
FT                   /translation="MRLKALLMSLCLFALAQEKSLVKTEIKFQKAECIKVDKGGACLIY
FT                   SPSSSDNLRYNLLIKSVNPIKQGKYTLLVLASHVGFMDPLQISLIRSIEYKNLNDGLKL
FT                   EGTIDKERLPLKDCADFRNRILLTPFIFNKELTQKEIEDMLNASRYCPDPKNKYACSYS
FT                   AFFAYVQKTGMVLNAVNHEFVTLCKGK"
FT   sig_peptide     384594..384641
FT                   /locus_tag="Hydth_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            385168..385755
FT                   /pseudo
FT                   /locus_tag="Hydth_0381"
FT   gene            complement(385717..386292)
FT                   /locus_tag="Hydth_0382"
FT   CDS_pept        complement(385717..386292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0382"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="COGs: COG3427 conserved hypothetical protein;
FT                   InterPro IPR010419; KEGG: hoh:Hoch_4562 carbon monoxide
FT                   dehydrogenase subunit G; PFAM: carbon monoxide
FT                   dehydrogenase subunit G; SPTR: D0LQ16 Carbon monoxide
FT                   dehydrogenase subunit G; PFAM: Carbon monoxide
FT                   dehydrogenase subunit G (CoxG)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44784"
FT                   /protein_id="ADO44784.1"
FT                   /translation="MELVVKESFETKADFKEAWKFFSNPEFIVPCIPGAEIREIKEDGS
FT                   FEASVKLKLGAVSLNFVGNMKYEKLDEAQGLMVLSGEGKEKGGAGRAKANIEATLKEEG
FT                   DVLKVSVIATVDISGKILQYGRGMFEQVAKQYFAQFSQCAKSYLEAEQSEEKKMPPEPV
FT                   KVNALNLILKAFLAWLLSPFRRIFGGKA"
FT   gene            complement(386264..387241)
FT                   /locus_tag="Hydth_0383"
FT   CDS_pept        complement(386264..387241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0383"
FT                   /product="protein of unknown function DUF182"
FT                   /note="COGs: COG1975 Xanthine and CO dehydrogenase
FT                   maturation factor XdhC/CoxF family; InterPro IPR003777;
FT                   KEGG: dge:Dgeo_0385 hypothetical protein; PFAM: protein of
FT                   unknown function DUF182; SPTR: C1XU58 Xanthine and CO
FT                   dehydrogenases maturation factor, XdhC/CoxF family; PFAM:
FT                   XdhC and CoxI family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44785"
FT                   /protein_id="ADO44785.1"
FT                   /translation="MQTWKEAKLLAEGILDCKKRGVRCALLTIVSVRGSSYRKEGAKFL
FT                   VTEEGEEICSISGGCLEKGLLDTALEVINSNYSVLERINMEEESSWGMWLGCPGEVDIY
FT                   IEPLHFDEVMDAWVDALITGEKFVLAKKLFSSEKLLVTERSIVGSLLVAEEEAKAMIKE
FT                   YGVRPYLKGDIFFDTLLRYPPVHIFGGGEEAHHFREIAQILGFEVFLHEPSEKVKMAKG
FT                   SFVIVANHNLKADRLSLKQALMSEASYIGVVSSRKRFLKLSEGLDLDDRVYCPAGLDLG
FT                   SFTPEEVAFSIMAEILKVYWGKTGESLRKVKQEVTHGIGSQGIL"
FT   gene            complement(387244..388101)
FT                   /locus_tag="Hydth_0384"
FT   CDS_pept        complement(387244..388101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0384"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="COGs: COG1319 Aerobic-type carbon monoxide
FT                   dehydrogenase middle subunit CoxM/CutM homologs; InterPro
FT                   IPR016167:IPR016169:IPR005107:IPR016166:IPR 002346; KEGG:
FT                   ape:APE_2219 aldehyde dehydrogenase, middle subunit; PFAM:
FT                   molybdopterin dehydrogenase FAD-binding; CO dehydrogenase
FT                   flavoprotein domain protein; SPTR: Q9Y9R9 Aldehyde
FT                   dehydrogenase, middle subunit; PFAM: FAD binding domain in
FT                   molybdopterin dehydrogenase; CO dehydrogenase flavoprotein
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44786"
FT                   /protein_id="ADO44786.1"
FT                   /translation="MIPVSFEYYRANTLDEALELVKKFGDEAKVLAGGQSLIPMLKLRF
FT                   ARYSKIIDIGRLQELRYIKEEGGQIWIGGLTTHREVEKSSLIKEKVPVLSACASEIADV
FT                   QVRNMGTIAGSLSHADPSADYPPTMLALGATMVARGSKGSREIPADNFFVGTFTTALEP
FT                   DELLVEVRVPVIKNNERAAYMKIGHPATGFAIVNCAVKFSLRDGKIEGARVAFGGFVTV
FT                   PYRDTRVENLLAGKDVSLDTLKRASELVGEGQDIIGDYYADADYRRSLAKALFVRVARS
FT                   ALGV"
FT   gene            complement(388105..390450)
FT                   /locus_tag="Hydth_0385"
FT   CDS_pept        complement(388105..390450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0385"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR000674:IPR008274; KEGG: ape:APE_2216.1 aldehyde
FT                   dehydrogenase, large subunit; PFAM: aldehyde oxidase and
FT                   xanthine dehydrogenase molybdopterin binding; aldehyde
FT                   oxidase and xanthine dehydrogenase a/b hammerhead; SPTR:
FT                   D1C3L7 Aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein; PFAM: Molybdopterin-binding
FT                   domain of aldehyde dehydrogenase; Aldehyde oxidase and
FT                   xanthine dehydrogenase, a/b hammerhead domain; TIGRFAM:
FT                   carbon-monoxide dehydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44787"
FT                   /protein_id="ADO44787.1"
FT                   /translation="MVIGQPLRRFEDDRLIRGLGQYVEDIKLPRMAYAVFVRSQVAHGR
FT                   IKSINTEEAKKAEGVIAVITGQDIKDKVGKNFTAWIVPNSNQVSAEVSSRPLLAVDKVR
FT                   YVGEPVALVIADSRERAFDAAELVEVEYEELPAVASVEKAIQEGAPLVHEEAPGNIALR
FT                   WHVKSGDVERVFSEADRIVKQRIYINRAAPVPMEPRACIADYNPATGRLTLWVTSQNPH
FT                   IHRFYLAVVLGIPEHKIRVIAPDVGGGFGAKIDIYNEELVVSYASILLKRPVKWVETRS
FT                   EHFVASLHGRDFLAELEFAVKNDGRVLGIRGKSYANMGAYLGTVAPGVATVLHGLILPG
FT                   PYRIEAFDYVMHGVFTNTMLLDADRGAGRPEAIFLLERMMDLVADELGMDPLELRKKNY
FT                   LPAGENVQTVTGLSYDSIDFGKVLKKFEEVVDYKALRDMQKKAREEGRYIGIGIVSSID
FT                   ICGFAPSPVVGAVGLQAGQWESAVVRVHPTGKVTVLSGAHSHGQGGDTTYAQIVADVLG
FT                   VPVDAIEVLHGDTDMIPMGWGTYGSRGTSTGGSAVYKAAEKVREKGRLIAAHMLGTRPE
FT                   DVEFSEGIYYLKTDPSKKVSIQDVALQANVAWNLPPGVEPGLEAEAFFDPPNFTFPFGI
FT                   HCCVVEVMPDTGEVKFLKYVAVDDAGRIINPLLAEAQIQGGIVHGIGHAMYENIVYTED
FT                   GQLLTGSFNEYALPKAHLIPKMETYFTETPSPANPLGAKGIGEEGAIAGQIAVANAIID
FT                   AIKPFGVKHLDGPYTPSRIWRAINKLEV"
FT   gene            complement(390464..390940)
FT                   /locus_tag="Hydth_0386"
FT   CDS_pept        complement(390464..390940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0386"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="COGs: COG2080 Aerobic-type carbon monoxide
FT                   dehydrogenase small subunit CoxS/CutS homologs; InterPro
FT                   IPR012675:IPR001041:IPR002888; KEGG: sti:Sthe_1398
FT                   (2Fe-2S)-binding domain protein; PFAM: [2Fe-2S]-binding
FT                   domain protein; ferredoxin; SPTR: D1C3L6 (2Fe-2S)-binding
FT                   domain protein; PFAM: 2Fe-2S iron-sulfur cluster binding
FT                   domain; [2Fe-2S] binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44788"
FT                   /protein_id="ADO44788.1"
FT                   /translation="MKERVSLTVNGVSHTLEVEPRTLLVYAIREILNLTGTHIGCDTSS
FT                   CGACTVLMNGKAVKSCTVLALQADGAEIITVEGLASDSELHPIQEGFKEEHGLQCGFCT
FT                   PGMMMVSCDILETEEELDEDKVRKLLKGNLCRCTGYQNIVKAILYAKEKSAVTK"
FT   gene            complement(391140..393182)
FT                   /locus_tag="Hydth_0387"
FT   CDS_pept        complement(391140..393182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0387"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR012910:IPR000531:IPR010917; KEGG:
FT                   ent:Ent638_2099 TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   SPTR: C0Q4P2 Probable TonB-dependent receptor; PFAM:
FT                   TonB-dependent Receptor Plug Domain; TonB dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44789"
FT                   /protein_id="ADO44789.1"
FT                   /translation="MKRVWVWYTILLSLTVSSGSSLAQDMEVPPIVITATRTEKPLFEL
FT                   STSAGTVEKENIQTALPNLQPADVLSRISGVYAQDRGRNFAQDAKIIIRGFGARTQFGV
FT                   REMKLFWDGVPLTMADGQGDIDKLDMSFIKHVEVLKGPLAVLYGNSAGSVIYFESEDGG
FT                   LKPISAQLKISGGSYGFHKENLRLGGQVERLNYMFGLTTLYTTGFRDHSSARRNYANLK
FT                   TMVEVTDRSSLTLFLHLFDEPFAKDPGALTKAEFEKDPKQASPIYKANDAREIIQNREI
FT                   GFLYQHELVQNHSFKVTGYLGHRDFTGYTPVIVNDFGRDYYGVGFNWLSKFKVADRRIE
FT                   TTLGIDTDFMKEDRNNFQNASGNKGNLQYTQNSDVKNLGLYALVSLDITKSLQLNGGAR
FT                   YSKVNFSADYNRLSPSALFVSSERNFQFTSWALTLSYKPIQRVNLYTGVGRGFITPTLI
FT                   ELINSPSGPGGLNQNLKASKFYNYEAGIKTLLGQGTYLDTAIFLVKTSDELIPKQLFPG
FT                   TNYYVNAGKTERKGVELYLTHELPFNLYTTLSYTYMEATFKDFIDTDGLNKSGRRVPGI
FT                   PRHTFFYELGWKPTKNLVASIDVKYADKIWADNSNTASADSYTIVNLKSSYKFNIFGHN
FT                   LDAFFRIENLFDKKYVTSVVPNATGGRYYEPGPGRNYYVGMALSF"
FT   sig_peptide     complement(393114..393182)
FT                   /locus_tag="Hydth_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(393205..394035)
FT                   /locus_tag="Hydth_0388"
FT   CDS_pept        complement(393205..394035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0388"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="InterPro IPR001638; KEGG: min:Minf_0995 periplasmic
FT                   binding protein, involved in methanol oxidation; SMART:
FT                   extracellular solute-binding protein family 3; SPTR: B3DUP7
FT                   Periplasmic binding protein, involved in methanol
FT                   oxidation; PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44790"
FT                   /protein_id="ADO44790.1"
FT                   /translation="MRKNYRLPWRVLGKFIILLPLLIPLIARPAPKELTACSDPGLIPL
FT                   FDMQGRGIYNKIEELIASYYGQKIGRYFFPMQMGFIRHTLVEKACHFVVGVPAGYELTL
FT                   NTKPLFRSTYVLVYRSDSGFDIKGIDDPILSRLKIGGIVNNPAFFYLKDEGITNYVGYN
FT                   SFYDSFNRPDDNPNLQIIKDLLDKKIDVAVLWGPIAGYFVKEYNGKLKMILPNPKSQSD
FT                   VRLDYKVAIGVRKGDTLMKEYVEKAILEQKEAIKSLLVSNNVPLLPCDNCVINP"
FT   sig_peptide     complement(393949..394035)
FT                   /locus_tag="Hydth_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(394067..395050)
FT                   /locus_tag="Hydth_0389"
FT   CDS_pept        complement(394067..395050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0389"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="COGs: COG3391 conserved hypothetical protein;
FT                   InterPro IPR015943:IPR011044; KEGG: mei:Msip34_0162
FT                   40-residue YVTN family beta-propeller repeat protein; SPTR:
FT                   C6X8E1 40-residue YVTN family beta-propeller repeat
FT                   protein; PFAM: 3-carboxy-cis,cis-muconate lactonizing
FT                   enzyme; TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44791"
FT                   /protein_id="ADO44791.1"
FT                   /translation="MRYFFALFLSFFIYLEAMASYVFVSDEEQGIYAIDTDKLELIKHI
FT                   ELKGMGIRGVGVTKDGKYLAVASKKLGKLLVVSTESWKVVREVPLGENPEFVKVHPKRD
FT                   LLFVTYEETGKVEKAYIVAIDTKNWKEAFRFEGGKESEGMAFSKEGRYLLVTNEGENSI
FT                   SVYDLDTKKKLRDVDLKSYGDRPRGIVSSPDGKYYAVTFENSNGLLLLDNNFKVIRSVK
FT                   TDAGPYGVTFSPDGSEIIVASFRAGKLDIFDSKTLTKKSSVETGKRCWHFTYSSDYTKL
FT                   VVPCGNSQNVLIFDVNGFHVIKTFSGLGKPWGAVAFPRAWGSIDTP"
FT   sig_peptide     complement(394994..395050)
FT                   /locus_tag="Hydth_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(395137..397008)
FT                   /locus_tag="Hydth_0390"
FT   CDS_pept        complement(395137..397008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0390"
FT                   /product="PQQ-dependent dehydrogenase, methanol/ethanol
FT                   family"
FT                   /note="COGs: COG4993 Glucose dehydrogenase; InterPro
FT                   IPR011047:IPR019551:IPR002372:IPR019556:IPR
FT                   017512:IPR018391; KEGG: min:Minf_0992 methanol
FT                   dehydrogenase large subunit protein; PFAM: PQQ-dependent
FT                   enzyme-like; Pyrrolo-quinoline quinone; SPTR: B3DUP4
FT                   Methanol dehydrogenase large subunit protein; TIGRFAM:
FT                   PQQ-dependent dehydrogenase, methanol/ethanol family; PFAM:
FT                   Pyrrolo-quinoline quinone coenzyme N-terminus;
FT                   Pyrrolo-quinoline quinone coenzyme C-terminus; PQQ enzyme
FT                   repeat; TIGRFAM: PQQ-dependent dehydrogenase,
FT                   methanol/ethanol family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44792"
FT                   /protein_id="ADO44792.1"
FT                   /translation="MKRRAYHRLLFLLILSAVSWVGLSIANPQVEELSKKAGLWPAPGR
FT                   DYHLTRYSPLSQINTHNVKNLDLAWSFSTGVLRGHEGQPLVIGNTMYVQTAYPNIVYAL
FT                   DISKGNDYKILWKYVPQQDDRAVAVACCDTVMRGISYADGKIVMNTLDGHVIALDAKTG
FT                   KELWKVKHADPYKGETITMAPIVAKDKVIVGISGGEFGVRGRVAAYDLNSGRRVWLCYN
FT                   QGPDQDMCYGSRTPASYKGLGVNTWQGDQWKIGGATVWGWFSYDPKLNLVYYGTSNPGT
FT                   WNPYIRCSASWEECQSGRYDNKWSTSIIARDADTGELVWAFQMTPFDQWDYDGVNESIL
FT                   LDVNVGSKKVPALIHFDRNGFAFLLNRATGELIYAKPFVYVNWAKSWDERHARDGHTFK
FT                   VTKDPTKSPWKPGDNKKDVCPSAMGGKDQQPAAYSPETGLVYVPTNQWCMDYEPAETKY
FT                   TEGAPYVGANVLMKFYEHKSSVHGLSKTPGHYGRIIAWDPAKGEIKCYIDEKYPTWSGV
FT                   LVTKGGVGFYGTMDGWFRAFDLKTCKVLWSKKLGSGIIGNPISFEVNGKQYIAVYSGIG
FT                   GWAGLPVTANLDPNDPYGGLGATNLSLELDLYRQATMSGVLYVFSLE"
FT   sig_peptide     complement(396931..397008)
FT                   /locus_tag="Hydth_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(397144..397548)
FT                   /locus_tag="Hydth_0391"
FT   CDS_pept        complement(397144..397548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: B3RJ70 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44793"
FT                   /protein_id="ADO44793.1"
FT                   /translation="MKVDDVEMLIRSIAGEGVSKMFRKFAQQVEGKDTEKIAFALEVLE
FT                   RFFGISTLVPIMIFVGKNLNLQHSTEADGSKLKVVCLFEKLSINKKPLEHPLCYPCWGS
FT                   LHTFGNPQFDGQEESKCIFIIEPKERFLTL"
FT   gene            complement(397718..397861)
FT                   /locus_tag="Hydth_0392"
FT   CDS_pept        complement(397718..397861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sul:SYO3AOP1_1346 hypothetical protein; SPTR:
FT                   C4FLD7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44794"
FT                   /protein_id="ADO44794.1"
FT                   /translation="MNFIRTRSGRYLNTLHVISLSVEEAKIEVDGRKRAVYKVVAYMSQ
FT                   PS"
FT   gene            complement(397858..398118)
FT                   /locus_tag="Hydth_0393"
FT   CDS_pept        complement(397858..398118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0393"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="KEGG: sul:SYO3AOP1_1345 conserved hypothetical
FT                   lipoprotein; SPTR: B2V5K9 Conserved hypothetical
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44795"
FT                   /protein_id="ADO44795.1"
FT                   /translation="MEKKELAQELEKIKQELEELKKKMTVAEEERSIKDLPAEAFQKVM
FT                   EVSKDIVKSTTEIAEKALKLIKYSAEGAKRALKSEEEKKEE"
FT   gene            complement(398173..400116)
FT                   /pseudo
FT                   /locus_tag="Hydth_0394"
FT   gene            complement(400211..400525)
FT                   /locus_tag="Hydth_0395"
FT   CDS_pept        complement(400211..400525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sul:SYO3AOP1_1342 hypothetical protein; SPTR:
FT                   B2V5K6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44796"
FT                   /protein_id="ADO44796.1"
FT                   /translation="MLNINIPNTLGGCISTNAMLYGFGALAGLVILSKLLRDSRPILVS
FT                   ATKEVIAFQQWLTGNLEEGKEFWEDVFSEARHLYRLEVEKKLEVLQKQQEILQRIKDRL
FT                   "
FT   sig_peptide     complement(400445..400525)
FT                   /locus_tag="Hydth_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(400536..400733)
FT                   /locus_tag="Hydth_0396"
FT   CDS_pept        complement(400536..400733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sul:SYO3AOP1_1341 hypothetical protein; SPTR:
FT                   D0GLJ9 Transposase, IS4 family (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44797"
FT                   /protein_id="ADO44797.1"
FT                   /translation="MEGKENTKTLLVIYNKRSFAEYFINQIKIRREAKRLNMAMLGSVA
FT                   GLITFGVCSMFLVPYVKTKL"
FT   gene            complement(400737..400844)
FT                   /locus_tag="Hydth_0397"
FT   CDS_pept        complement(400737..400844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44798"
FT                   /protein_id="ADO44798.1"
FT                   /translation="MIEYISVSEGRARLYFSTREERDLFMRGIREMEGV"
FT   gene            400914..402089
FT                   /locus_tag="Hydth_0398"
FT   CDS_pept        400914..402089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0398"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="COGs: COG0683 ABC-type branched-chain amino acid
FT                   transport systems periplasmic component; InterPro
FT                   IPR001828; KEGG: tye:THEYE_A0768 leu/ile/val-binding
FT                   protein; PFAM: Extracellular ligand-binding receptor; SPTR:
FT                   A8UVG6 Putative branched-chain amino acid transporter
FT                   substrate-binding protein; PFAM: Receptor family ligand
FT                   binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44799"
FT                   /protein_id="ADO44799.1"
FT                   /translation="MKVLLAILLVLVSLSFPQDVIKFGAAISLTGKLAKEGQLLKQGYE
FT                   LWKERVNALGGIKVGGKHYKVDVVYYDDQSDPVTSARLVERLIVEDGIKFILGPYGSAQ
FT                   VFSSAPIVEKYGAIMVQAGGASSDIYQKGYRNVFGLYTVAPNYGRDLVELATNLDRGAK
FT                   RIAIIYEKDIFSQDAAEGALEHARRKGLNVVLYEGYPKQVQDLSSLMQKLRLLKPDIVI
FT                   GSGHFQDAVLMVKQLKQFRINPRFLGLTVGPALPAFAEALGEDAEGIFGPVQWSTALNY
FT                   RDPLFGNNREFVKLYRERFGSDPEYHVAGAVAAGIVFQKAIEKAGSVEVDKVRNALRKL
FT                   KVETLFGVIGFDDTGKVVTKPMAVIQIQRGRQVTVYPFEEAKPIYPKPQWR"
FT   gene            402080..402943
FT                   /locus_tag="Hydth_0399"
FT   CDS_pept        402080..402943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0399"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG0559 Branched-chain amino acid ABC-type
FT                   transport system permease components; InterPro IPR001851;
FT                   KEGG: tye:THEYE_A0767 branched-chain amino acid ABC
FT                   transporter, permease protein; PFAM: inner-membrane
FT                   translocator; SPTR: A8UVG7 Putative high-affinity
FT                   branched-chain amino acid transporter membrane protein;
FT                   PFAM: Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44800"
FT                   /protein_id="ADO44800.1"
FT                   /translation="MEIVFQLLLDALLLAGFYSMLSSGFSLMWGVTGIINLAYGSFVLL
FT                   GAYLLYTLYLSGVGLLTAFFIVLAVGLLSGAVLEMFFFNKLMNYEPFTLLVLTFGLDIL
FT                   LTNFLNLLFKADIRSLSVKGLEGSLLLGDFIVPYNKLSVFLLSSLVISALQFYLKFSWT
FT                   GKAIRAISADPIGAQLCGINPKRVYTVSTSLATALAMISGGFYAFLQGFTPFDSESITL
FT                   RAFFVCVVGGLGSTHGLLAGSFILASSEVFSGFYLGEGWKTAVSLLILVFFLIFRPRGL
FT                   IGIKYA"
FT   gene            402936..403811
FT                   /locus_tag="Hydth_0400"
FT   CDS_pept        402936..403811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0400"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4177 ABC-type branched-chain amino acid
FT                   transport system permease component; InterPro IPR001851;
FT                   KEGG: tye:THEYE_A0766 high-affinity branched-chain amino
FT                   acid transport system permease protein LivM; PFAM:
FT                   inner-membrane translocator; SPTR: A8UVG8 Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44801"
FT                   /protein_id="ADO44801.1"
FT                   /translation="MLKLFILVIAGAVFPLLADPYWLRVASSALLLSSLAYSHNLFFHF
FT                   LGYPTFGGVAFFGIGAYTFSLLFSHNLPIYASLPFAGILSSLFAIPLLPVVLRLKSHYF
FT                   AIGTLALQITLMEVAENLSITGGTKGYALKVSESSNLIAFYLFLLLTVILLIYCAFLER
FT                   SILGKTLKAIKEDEEAAQILGINPTPYKMLMLISMTFSLGLLGGTFSIWSAYIDAPTVF
FT                   SPVLSVKTFFILILSMRAPILGPLLWSILFELIFELMWSSFPQVHGLLLGIAIILLILI
FT                   FPKGVLWKGS"
FT   sig_peptide     402936..402989
FT                   /locus_tag="Hydth_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            403796..404515
FT                   /locus_tag="Hydth_0401"
FT   CDS_pept        403796..404515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0401"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0411 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro
FT                   IPR003439:IPR003593; KEGG: tne:Tneu_0546 ABC transporter
FT                   related; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: A8UVG9 Branched-chain amino acid transport
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44802"
FT                   /protein_id="ADO44802.1"
FT                   /translation="MERLLEVIDVRKSFGGNRVLEGVSFSVKGGEILGIIGPNGSGKTT
FT                   LLNVISGLIRQDSGKILLMGKDISDAKPHVRARLGMGRTFQNPRAFPSLIVLECLKIAQ
FT                   LHSGRDVQIDELLKKTGLYELQGRASDKLSLAQRKRLELAKALAIKPKVLLLDEIFAGL
FT                   NPASIGEVSHLIKQLKDEGLGIVIVEHVLSALVPLADRLLVLAGGRVIYDGDKYEAFRD
FT                   EKVRRAYLGERYSSLGV"
FT   gene            404484..405203
FT                   /locus_tag="Hydth_0402"
FT   CDS_pept        404484..405203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0402"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0410 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro
FT                   IPR003439:IPR003593; KEGG: tye:THEYE_A0764 high-affinity
FT                   branched-chain amino acid transport, ATP-binding protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   A8UVH1 Branched-chain amino acid transport ATP-binding
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44803"
FT                   /protein_id="ADO44803.1"
FT                   /translation="MERDTLLLECDGINCGYKDAQVLYHVRITVKEGEAVVVFGSNGSG
FT                   KTTLLKVLSGIIKPWSGIVRFRGRDITKLSPHDRVKLGIAFASDTRNLFLSMSVEENLI
FT                   LGAYTRKKNVKEGLEMVYHYFPDLASQRKKLAGELSGGFQRMLSIGRAIMSKPLLLMID
FT                   ELSLGLSPKMVDKLGQALMSINRERGIAMLVVEQEVYLAGSMCRRGYVFDLGRVVAQGD
FT                   VQKLLKEDTVRRIYMGV"
FT   gene            405377..405850
FT                   /locus_tag="Hydth_0403"
FT   CDS_pept        405377..405850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0403"
FT                   /product="rare lipoprotein A"
FT                   /note="COGs: COG0797 Lipoprotein; InterPro
FT                   IPR005132:IPR012997:IPR009009; KEGG: aae:aq_1370 rare
FT                   lipoprotein A; PFAM: Rare lipoprotein A; SPTR: O67382 Rare
FT                   lipoprotein A; TIGRFAM: rare lipoprotein A; manually
FT                   curated; PFAM: Rare lipoprotein A (RlpA)-like double-psi
FT                   beta-barrel; TIGRFAM: rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44804"
FT                   /protein_id="ADO44804.1"
FT                   /translation="MTWLHFVCYYATKFLNGRLKMWILLLVFMLFGVVLAKGECEEIEG
FT                   YASWYGKGFHGRRTASGESFDRYKYTAASKVFPLNTYVLVRNLENDQEVIVRITDRGPF
FT                   VKGRILDLSKASAEKLGILKKGIVKVKAMPLYCVADVDRGDEDEYIMDIIRTF"
FT   sig_peptide     405377..405484
FT                   /locus_tag="Hydth_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(405847..406641)
FT                   /locus_tag="Hydth_0404"
FT   CDS_pept        complement(405847..406641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0404"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0820 Fe-S-cluster redox enzyme; InterPro
FT                   IPR007197; KEGG: aae:aq_1528 hypothetical protein; PFAM:
FT                   Radical SAM domain protein; SPTR: O67488 Putative
FT                   uncharacterized protein; manually curated; PFAM: Radical
FT                   SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44805"
FT                   /protein_id="ADO44805.1"
FT                   /translation="MKLLSTFKSELNRLFVFELEDSNKIEAVFYRGDTLCISTQVGCAI
FT                   RCPFCLSGSAGFVRNLTYEEILAQYYLLRDTLPIKRIAVAGIGEPLMNYSHVIRAFWKF
FT                   KEEGLKVSFYTTGFPHIHLRELIHIPHNGLTISIHSTKSEKRRKLIPHGGDLNALIDML
FT                   REELPRMSKRKRKKVSLAYLLLKGVNDSYEDLEEFAKLVRDLGVSATLLYYNSTGFFET
FT                   MSKSEYEERFLYLRGYGIRVSLSTRFRKDSLGGCGTLVINRC"
FT   gene            complement(406613..407482)
FT                   /locus_tag="Hydth_0405"
FT   CDS_pept        complement(406613..407482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0405"
FT                   /product="PSP1 domain protein"
FT                   /note="COGs: COG1774 Uncharacterized homolog of PSP1;
FT                   InterPro IPR007557; KEGG: aae:aq_1527 hypothetical protein;
FT                   PFAM: PSP1 domain protein; SPTR: A8URT2 Putative
FT                   uncharacterized protein; PFAM: PSP1 C-terminal conserved
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44806"
FT                   /protein_id="ADO44806.1"
FT                   /translation="MLYIKARFQDTGKIFQVEGVWDDGIKRDDLIVVSSEKGEEVVKVL
FT                   GLSKQPSQIKATFLRKAKDEDILKMEENEKKAQNLYSLCKEKIAQHGLGMKLIKAYIPL
FT                   DAGKVFFYYTSEQRVDFRNLVKDLAKVVKKRIEMRQIGVRDAVQMTGWVGACGDIPCCV
FT                   RFSENFESISLKDIEDQNLPLSPTKFTGPCGRLLCCLAYERDNYMIRNLLPEVGTELCF
FT                   KGKIYKLLYIDPPMDKVLIESEGKKEELSISSLLPYGYEKALRHCKSCGLCCRRAYKED
FT                   EAFINLQE"
FT   gene            407631..408254
FT                   /locus_tag="Hydth_0406"
FT   CDS_pept        407631..408254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0406"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="COGs: COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I);
FT                   InterPro IPR012285:IPR017896:IPR001450:IPR017900; KEGG:
FT                   aae:aq_1375 NADH dehydrogenase I chain I; PFAM: 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; SPTR: A8UR10
FT                   NADH dehydrogenase I chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44807"
FT                   /protein_id="ADO44807.1"
FT                   /translation="MIKKVFERQLSWLERIFFVDFIKGLSVTIRHAFSKTITTHYPYEK
FT                   LTPPKRFRGFLGHKVVDGNEPQPAFDEWVERFKIEVRPGRSRCVVCMLCKRACPVPQLF
FT                   EIEGEKLPNGKRVVSIFNMNLMLCTFCGFCVDACPVDCLFNSDIHETASYTRKDAILNL
FT                   EALEQIGRDWQARREKEPDRIWIDNHQRQKLWRENDLKLPEVKG"
FT   gene            408251..408784
FT                   /locus_tag="Hydth_0407"
FT   CDS_pept        408251..408784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0407"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="COGs: COG0839 NADH:ubiquinone oxidoreductase subunit
FT                   6 (chain J); InterPro IPR001457; KEGG: aae:aq_1377 NADH
FT                   dehydrogenase I chain J; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6; SPTR:
FT                   A8UR09 NADH dehydrogenase I chain J; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44808"
FT                   /protein_id="ADO44808.1"
FT                   /translation="MIQWITFLLFSLLAVVSSLGVVLLPNPVYVILSLLSSLIAIAGVF
FT                   FVAGAELVGALQLLIYAVAVTVFYVFVLTAVPWEKALKKDSHYRVEGVLSFPILLLLYF
FT                   EILIVFSLGVSASPKGQIKELSKKFGNTEVIGSILFSKYFFAFELVSLVLLIGMIGAVI
FT                   IGRKEAQTYDSNTP"
FT   sig_peptide     408251..408310
FT                   /locus_tag="Hydth_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            408765..409073
FT                   /locus_tag="Hydth_0408"
FT   CDS_pept        408765..409073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0408"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="COGs: COG0713 NADH:ubiquinone oxidoreductase subunit
FT                   11 or 4L (chain K); InterPro IPR001133; KEGG: aae:aq_1378
FT                   NADH dehydrogenase I chain K; PFAM: NADH-ubiquinone
FT                   oxidoreductase chain 4L; SPTR: A8UR08 NADH dehydrogenase I
FT                   chain K; PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44809"
FT                   /protein_id="ADO44809.1"
FT                   /translation="MTAIPLEAYMLLSIVIFGLGLFGIVVRRNLVTVLMSTELALNAVN
FT                   IAFVGIDAHLSLANGQIFALFIIALAAAEAAVGLGIIISIFRLRRVESTDEITDMRG"
FT   gene            409075..410961
FT                   /locus_tag="Hydth_0409"
FT   CDS_pept        409075..410961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0409"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /note="COGs: COG1009 NADH:ubiquinone oxidoreductase subunit
FT                   5 (chain L)/Multisubunit Na+/H+ antiporter MnhA subunit;
FT                   InterPro IPR003916:IPR018393:IPR001516:IPR001750:IPR
FT                   003945; KEGG: aae:aq_1379 NADH dehydrogenase I chain L;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein; SPTR: A8UR20 NADH dehydrogenase I chain L;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH-Ubiquinone/plastoquinone (complex I),
FT                   various chains; NADH-Ubiquinone oxidoreductase (complex I),
FT                   chain 5 N-terminus; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain L"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44810"
FT                   /protein_id="ADO44810.1"
FT                   /translation="MEALVLFLPLFAFLVVGLLGRYMGDLLSALITIGAGLLSFVLSLT
FT                   ILSKAISSPFSVKLYDFLPFLSFGLYFDALSSITSAVVTLVACLIFVYSIGYMHNLFGH
FT                   WTFKFYAYLSLFLFAMLLIVLSDNLLGIFFGWEGVGLASYLLIGYFHTQKKAADASLEA
FT                   FVMNRVGDWLFIFGIISSFYIFGSLSLLDIFGKVSSVPSALLSVCALLLFGGAVGKSGQ
FT                   LPLHTWLPNAMAGPTPVSALLHAATMVAAGVYMVARLYPLFEATPESLKVVALIGGITA
FT                   LFAALAATSHTDIKKIIAFSTMSQLGLMYLALGLGDKAGAMFHLTTHAFFKALLFLAAG
FT                   SVIHAFHHQVYDIYQVGGLKKYMPATYWSFIVGALALSGIFPLSGFFSKDRIISSAYEA
FT                   GTGWGLLASFVSLLTAYYIFREGFVMFVSKREYEEKPHESEKVMVLPMVALSVLSVVSG
FT                   LIEGWYMRVMGSKSELHLSIAISSVLIGLTGIGIAYAVYVKGAIDHRRAYRALKPIADT
FT                   FREQFYTEKLYHKLIAYGYLVVSKALYRIGDRITIDGFINLLAFLYFKVVRFLWMKLDI
FT                   MVVDLFVNGVAKLSFKTGRYVRNLQTGLLNNYVLFLLMGIVFILGVITYSLR"
FT   gene            410966..412477
FT                   /locus_tag="Hydth_0410"
FT   CDS_pept        410966..412477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0410"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /note="COGs: COG1008 NADH:ubiquinone oxidoreductase subunit
FT                   4 (chain M); InterPro IPR003918:IPR001750:IPR010227; KEGG:
FT                   aae:aq_1382 NADH dehydrogenase I chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR: A8UR18
FT                   NADH dehydrogenase I chain M; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; PFAM:
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44811"
FT                   /protein_id="ADO44811.1"
FT                   /translation="MERLEATFPLLPLSMMVPVFGSLLILLLPERFSKGISLFSAGISF
FT                   LIALSSLLFFDFSKAQAVQFYQYYPLIPELKVGLALGLDGLSMLMYLLTTLVSFVAILW
FT                   SVRDRQINHRLREYYLWFLLSEAFLIGVFSSWDLMVFYVFYELTLVPMLFVIGIWGYKL
FT                   RLYSAYKFFIYIFVSSLFLLLGIVSLAVEHYKLFGKFSFSYFDLLNNHYSLEYGLFLFL
FT                   LFFIAFAVKTPIVPFHTWLPDAHGEAPTAGSVVLAAILLKMGTYALLRFNIGLFPEVAV
FT                   FLMPVLVLWGIFSIAVASWYTISQSNVKRFVAYSSVSHMGFVVTGMFLLNMEGLRASIM
FT                   EMFAHGLTSASLFMIAGFIYNRLHSFNMDSLKGSAKYMPLFAIITVLTAFSSMGLPGGS
FT                   SFWGKFLTILSAREYTTLLAFLVLVGAFFSAVYILYLMKVLFLDSKEESKLVHFTDVRG
FT                   FKLSAFLLLVFPMFMVGLAPYLFFNIFDKSAKELLLLVMRKLVGG"
FT   gene            412484..413944
FT                   /locus_tag="Hydth_0411"
FT   CDS_pept        412484..413944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0411"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /note="COGs: COG1007 NADH:ubiquinone oxidoreductase subunit
FT                   2 (chain N); InterPro IPR003916:IPR001750:IPR010096; KEGG:
FT                   aae:aq_1383 NADH dehydrogenase I chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR: A8UR17
FT                   NADH dehydrogenase I chain N; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain N; PFAM:
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44812"
FT                   /protein_id="ADO44812.1"
FT                   /translation="MELRDLVGVIEFPHLQLLMPEIIVLLTGFILFSLDLLYKKAHHRL
FT                   FTVVSAVGYTLALLYITLNPFLSGSTFYHLYVRDTFSSFLQFFMILITLFVLAFAYRYY
FT                   QQKLSLYREFYYILSFSLVSAMFLASSYHLITLYVALEGVSISFYILTALLRGDFNSKE
FT                   GAFKYLILGGISIALASYGAAFMYLYAGSLDLKEILTHVGENRYFLVLGLVFFLIGFAI
FT                   KIGAVPFHFWLPDAYQGAPTPVTAYMASVGKLAFFAPVVRIMPLIEEHFAYAWVITVSI
FT                   ISAMTMLYGNLVALVQKDVKRLLAYSSIAHSGYILAGISVAKVIGLKAVLYFLVAYALM
FT                   GAGAFLVLALLERHPEWQNRMEEFSGLRFSMPWVATSFMIFMFSLLGVPPTVGFVSKAL
FT                   IFTTLSFDRLWWLAFIMILATGISTGYYVRLVVLTFMKENSKPFQVKSSLAERIVLIVL
FT                   TLSVVFLGAVPIIIWSFVSPSAEMLFKR"
FT   gene            413948..414325
FT                   /locus_tag="Hydth_0412"
FT   CDS_pept        413948..414325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0412"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="COGs: COG0838 NADH:ubiquinone oxidoreductase subunit
FT                   3 (chain A); InterPro IPR000440; KEGG: aae:aq_1385 NADH
FT                   dehydrogenase I chain A; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 3; SPTR:
FT                   A8UR16 NADH-quinone oxidoreductase subunit; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase, chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44813"
FT                   /protein_id="ADO44813.1"
FT                   /translation="MDYMGLLAFFGVMLALALILISLNALLGPKTPESMEDYPYECGVP
FT                   LYDQSAQSTFHQGYYLLGLLLLLFDIEAAFLFPWTVVYKYLGVFGFIEMFLFILILTYG
FT                   LLYAWRKGALDWQFEEEVLER"
FT   sig_peptide     413948..414028
FT                   /locus_tag="Hydth_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            414330..416048
FT                   /locus_tag="Hydth_0413"
FT   CDS_pept        414330..416048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0413"
FT                   /product="NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /note="COGs: COG0649 NADH:ubiquinone oxidoreductase 49 kD
FT                   subunit 7; InterPro IPR001268:IPR001135:IPR014029; KEGG:
FT                   aae:aq_551 NADH dehydrogenase I chain D; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa; NADH
FT                   dehydrogenase (ubiquinone) 30 kDa subunit; SPTR: A8UR14
FT                   NADH dehydrogenase I chain D; PFAM: Respiratory-chain NADH
FT                   dehydrogenase, 30 Kd subunit; Respiratory-chain NADH
FT                   dehydrogenase, 49 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44814"
FT                   /protein_id="ADO44814.1"
FT                   /translation="MPWAKEEDFIELKKRFPDLEVEVKPTITNLHITKEKLIDLLKVLK
FT                   DQLGFKLFVDHSVIDFPDKKPRFQAFYILYHVDERKRVVVKTWTDGTLPSIEKLWFAGK
FT                   WAERECYDMFGIRYEGHENLVRAFMWETYPYHPLRKDFPLEGYANTYLPSLNEVLRGDE
FT                   LTGTMNYDRMHTAVPTLEDLEITEKRRLKKKAQIVLNWGPLHPGTHGTMWFLFDLEGER
FT                   VVQCDVILGQLHRGVEKLAESQMYNQFLVYTDRMDYISALCSNQAWVVAVERLLGIEDI
FT                   VPEKAKYIRTMMSELQRINSHLLWLGTYALDLGALTIFLYAFKEREKIMDIIEGITGAR
FT                   LTISYPRVGGVRMDLPEGALEVIKAFIKRFPKELRDWENILTRNRIWLRRNVGVGVINK
FT                   EDVYFYGLTGPVARGSGVAYDLRKLEPYDAYPFVEFDIPVGENGDVYDRYLVRLEEMRQ
FT                   SVRIIEQCVAFLEKLPPSAPYFAESPDPKKIKLSLDGIGLKVPEGEIYSSGENPRGELG
FT                   FYIYSTGGVKPYRVKIKPGSMYNLCVYPKLMQDRVIADAVAILASLDPVVGEIDR"
FT   gene            416059..417108
FT                   /locus_tag="Hydth_0414"
FT   CDS_pept        416059..417108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0414"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="COGs: COG1005 NADH:ubiquinone oxidoreductase subunit
FT                   1 (chain H); InterPro IPR001694:IPR018086; KEGG:
FT                   hya:HY04AAS1_0758 NADH dehydrogenase (quinone); PFAM:
FT                   respiratory-chain NADH dehydrogenase subunit 1; PRIAM: NADH
FT                   dehydrogenase (quinone); SPTR: A8UR12 NADH dehydrogenase I
FT                   chain H; PFAM: NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44815"
FT                   /protein_id="ADO44815.1"
FT                   /translation="MENIVASLIIVGIKILVLLAIVLGLGAYLTLVERKVAAHIQRRPG
FT                   PMVVGWHGLLQPLADGLKLLTKEDLFPRYGNKFLYNLAIVMALVPASLVFAVIPFGPEF
FT                   EVFGIRVKPILTDVNVGLLLFFALGSLAVYAIALAGWASNSKYALIGSMRKAGIVISYE
FT                   VVITFAAMGPIILAQSLSTYSIVQNQIDQKLWYIWLQPVAFVVYMFAMLAETGRVPFDV
FT                   QEAEAELVTGFTVEYGGMKFGLFPLVEWYVETLSLSAIGVILFLGGWSSINIPFVGFFD
FT                   PLFFLGPLSPFVWFLLKVGLVFLFVLWLHWTLPRYRIDQITSTAWKVMLPLTFVNLVFT
FT                   ALIAPLVWK"
FT   gene            complement(417083..417862)
FT                   /locus_tag="Hydth_0415"
FT   CDS_pept        complement(417083..417862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0415"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="COGs: COG0107 Imidazoleglycerol-phosphate synthase;
FT                   InterPro IPR013785:IPR006062:IPR018313:IPR004651:IPR
FT                   011060; KEGG: aae:aq_181 imidazole glycerol phosphate
FT                   synthase subunit HisF; PFAM: histidine biosynthesis
FT                   protein; SPTR: O66567 Imidazole glycerol phosphate synthase
FT                   subunit hisF; TIGRFAM: imidazoleglycerol phosphate
FT                   synthase, cyclase subunit; PFAM: Histidine biosynthesis
FT                   protein; TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44816"
FT                   /protein_id="ADO44816.1"
FT                   /translation="MLAKRIIPCLDVAKGRVVKGVRFENLVDAGDPVEVAKAYEEQGAD
FT                   ELVFLDISASYEGRSIMIDVVRRVAEQVFMPFTVGGGIRDIEDIRKLLLAGADKVSINT
FT                   AAVKNPGLIRESAIRFGSQCIVVAIDAKRKYGGWEVYINGGRTPTGLDAVEWAKKVASL
FT                   GAGEILLTSIDADGTKSGYDVELTRAVAESVNIPVIASGGAGTFEHFYSVFTDGKADAA
FT                   LAASLFHFKEISIHELKEYLHSKGIPVRRITSTQEVL"
FT   gene            complement(417862..419139)
FT                   /locus_tag="Hydth_0416"
FT   CDS_pept        complement(417862..419139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0416"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="COGs: COG0323 DNA mismatch repair enzyme (predicted
FT                   ATPase); InterPro
FT                   IPR003594:IPR013507:IPR014762:IPR014763:IPR 020568; KEGG:
FT                   aae:aq_1578 DNA mismatch repair protein MutL; PFAM: DNA
FT                   mismatch repair protein domain protein; ATP-binding region
FT                   ATPase domain protein; SPTR: O67518 DNA mismatch repair
FT                   protein mutL; TIGRFAM: DNA mismatch repair protein MutL;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; DNA mismatch repair protein, C-terminal domain;
FT                   TIGRFAM: DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44817"
FT                   /protein_id="ADO44817.1"
FT                   /translation="MFVYTLPEEVISKISAGEVIESPADCVKELVENALDASSSRIDVE
FT                   MLKGGKRYICVRDNGTGIHREDVHKVVQRWTTSKIKDMSDLMSISSYGFRGEALYAIST
FT                   VSKMIIKSRFFQDEIGIKMEVEGGKVINKQEIGMPVGTCVEVYDLFYNLPVRLKFLKKE
FT                   DTERNKIIKLIKEYALSNWNVHFTLHSNGRKVLDLYPCEDKKERIEALFGCKFEEKSIE
FT                   KNSINISLYTSLESSRGEIYLFVNSRPVHNKNLLEYIRKVVGYKKICVCYIDLPPYMVD
FT                   VNVHPKKREVRIYKENIIKEMIKELFRRQEWYPFELAQERAYYLPTPVVIDIIDNTLIL
FT                   VRIGDYLYFFDQHLLSERILYEKTREVERSCAFAIKAGKAISKEEAKELVKAWMSLENR
FT                   EVCPHGRPMYYRLYLGDIYKSLDRRR"
FT   gene            419161..420138
FT                   /locus_tag="Hydth_0417"
FT   CDS_pept        419161..420138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0417"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="COGs: COG0167 Dihydroorotate dehydrogenase; InterPro
FT                   IPR012135:IPR013785:IPR001295:IPR005720; KEGG: aae:aq_046
FT                   dihydroorotate dehydrogenase 1B; PFAM: dihydroorotate
FT                   oxidase; SPTR: O66461 Dihydroorotate dehydrogenase;
FT                   TIGRFAM: dihydroorotate dehydrogenase family protein; PFAM:
FT                   Dihydroorotate dehydrogenase; TIGRFAM: dihydroorotate
FT                   dehydrogenase (subfamily 1) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44818"
FT                   /protein_id="ADO44818.1"
FT                   /translation="MFGEVKTDSCDLSITLFGITFKNPVWVASGTFGYGLEAREIYDVS
FT                   LLGAVVTKGISLKPREGNPPERIAETPCGMLNSIGLQNPGVEGFLKKIYPHIEKIDTHF
FT                   IANIFGETEEEYVEVCMALEDARKIVAYELNVSCPNVKKGGMLFGHDAVVLGRLVESVK
FT                   AKVKKPVLVKLSPNAGNVVEFAKVCADAGADGLVLINTLLGMKIDVKAQKPDLSTFTGG
FT                   LSGPAILPIAVRMVWEVFSELGDKLPIIGVGGIHDTDSALEHILAGASAVQIGTANFSD
FT                   PLCPLKVIKGIQDYMQNMKEKNFKSLVGKAHGIKLQPYLFQQGP"
FT   gene            complement(420106..421404)
FT                   /locus_tag="Hydth_0418"
FT   CDS_pept        complement(420106..421404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0418"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COGs: COG0104 Adenylosuccinate synthase; InterPro
FT                   IPR001114:IPR018220; KEGG: aae:aq_1290 adenylosuccinate
FT                   synthetase; PFAM: adenylosuccinate synthetase; PRIAM:
FT                   Adenylosuccinate synthase; SMART: adenylosuccinate
FT                   synthetase; SPTR: A8URI9 Adenylosuccinate synthetase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   Adenylosuccinate synthetase; TIGRFAM: adenylosuccinate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44819"
FT                   /protein_id="ADO44819.1"
FT                   /translation="MKKDLLILGAQWGDEGKGKIVDLLSANYQVVVRYQGGSNAGHTVV
FT                   VGNEKFILHLLPTGILHNHTKGVIAQGMVVDLELLKAEIEELEKKGISVRERLIISDRA
FT                   HLVMPYHKLLDALFERKSKIGTTLRGIGPSYMFKYGRKGIRMCDLEDKDRLYHLIKEDW
FT                   EFVKDICEKVYCENHSIDIDRVYEETLMYYSYVKECISDVSKFLMENKDLSLLFEGAQG
FT                   TMLDVDMGTYPYVTSSNASALGLPNGTGLSPKFFENTFFWAVSKAYTTRVGEGPFPTEL
FT                   FDEDGNMLRNRGKEYGSTTGRPRRCGWLDLVALKYAVDVNGLDGLILTKLDVLDTFEEV
FT                   KVCVAYEYEGKEITRFPASLSLLEKVKPVYKVFKGWLKHTKGIKDPKDLPERAREYISF
FT                   IEEYTGVPVVMLSTGPEREEYLWLRPLLEEVRL"
FT   gene            complement(421404..422516)
FT                   /locus_tag="Hydth_0419"
FT   CDS_pept        complement(421404..422516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0419"
FT                   /product="GTP-binding proten HflX"
FT                   /note="COGs: COG2262 GTPase; InterPro
FT                   IPR016496:IPR006073:IPR002917:IPR005225; KEGG: aae:aq_1908
FT                   GTP-binding protein HflX; PFAM: GTP-binding protein
FT                   HSR1-related; SPTR: A8USN5 GTP-binding protein HflX;
FT                   TIGRFAM: GTP-binding proten HflX; small GTP-binding
FT                   protein; PFAM: GTPase of unknown function; TIGRFAM:
FT                   GTP-binding protein HflX; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44820"
FT                   /protein_id="ADO44820.1"
FT                   /translation="MKALLVSLSYPDQNKEEVREYIEELKELVKAVGGKVLGYVVQRRS
FT                   APDARYYIGAGKLEEIKQVIEGVSADTIIFNTFLSPSQIHNLENALGVKVLDRADLVLE
FT                   IFSRRVRSKTAKLQVELAKLELELPRLYGRGKELSRLGGGVGTRGPGEQEAEVRRRWIK
FT                   KRIQQIREELEEVKKQRKEQRKRRDRWHSDIRIVKVALVGYTNVGKSSLMRLLTGRETF
FT                   VADMPFATLDTKTSDVYLSKDIKVLITDTVGFIRDLPHELIESFKATLEELQEADILLH
FT                   VVDISDKKWLEKIKVVRKVLAELKVDEKPTLYVFNKADKLVESEQDIELLTEPAFLGEK
FT                   SVVISAQKGWGIKKLLSTIKEMVEEFIEVS"
FT   gene            complement(422516..422728)
FT                   /locus_tag="Hydth_0420"
FT   CDS_pept        complement(422516..422728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0420"
FT                   /product="RNA chaperone Hfq"
FT                   /note="COGs: COG1923 Uncharacterized host factor I protein;
FT                   InterPro IPR005001:IPR010920; KEGG: hya:HY04AAS1_1230 RNA
FT                   chaperone Hfq; SPTR: A8USN4 RNA-binding protein Hfq;
FT                   TIGRFAM: RNA chaperone Hfq; PFAM: LSM domain; TIGRFAM: RNA
FT                   chaperone Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44821"
FT                   /protein_id="ADO44821.1"
FT                   /translation="MYPIEKNNNIQDELIEEFKRKGATVTVFLTRGNRITGKVLEHDKY
FT                   TILLEVDGQPNLIYKHAISTIVQGA"
FT   gene            complement(422790..423329)
FT                   /locus_tag="Hydth_0421"
FT   CDS_pept        complement(422790..423329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_0995 hypothetical protein; SPTR:
FT                   C1DV31 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44822"
FT                   /protein_id="ADO44822.1"
FT                   /translation="MERVIDLLRQFVVETGKPLDIILVGAMALPFYHVKLRFTQDLDAE
FT                   IKQGDIEELYSYLKAKGLESDLSENISGWSIISMPSGYRERSRVVYKDQLLTIRVLSPE
FT                   DYIIMKLRRGTAQDIEDAIEVAIAQKVKKEDLEVLFEKVLKESIKDTALFNFRRIYQVF
FT                   TEELGRKVYNQNRPMP"
FT   gene            complement(423313..423627)
FT                   /locus_tag="Hydth_0422"
FT   CDS_pept        complement(423313..423627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_0994 hypothetical protein; SPTR:
FT                   C1DV30 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44823"
FT                   /protein_id="ADO44823.1"
FT                   /translation="MREKKIKLKLKRLYGKERATLKELLSDRAGQKLLPYEIALNGLVD
FT                   WKELGVPEDIYRKACVIYSNYHHLIKRETPLPALNEKLPDEEVRRVFEVLRSLESGESD
FT                   "
FT   gene            complement(423671..424807)
FT                   /locus_tag="Hydth_0423"
FT   CDS_pept        complement(423671..424807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0423"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="COGs: COG4992 Ornithine/acetylornithine
FT                   aminotransferase; InterPro
FT                   IPR015421:IPR005814:IPR004636:IPR015424; KEGG: aae:aq_023
FT                   N-acetylornithine aminotransferase; PFAM: aminotransferase
FT                   class-III; PRIAM: Acetylornithine transaminase; SPTR:
FT                   A8UWB8 N-acetylornithine aminotransferase; TIGRFAM:
FT                   acetylornithine and succinylornithine aminotransferase;
FT                   PFAM: Aminotransferase class-III; TIGRFAM: acetylornithine
FT                   and succinylornithine aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44824"
FT                   /protein_id="ADO44824.1"
FT                   /translation="MYVMETYTRLPVSFVRGEGVYLFDQEGRKYLDLVAGIAVNALGYN
FT                   HKDLIDAICEQSQRLMHVSNLFENPWQEEVAKMLIEKFWTKGRVFFCNSGTEANEAAIK
FT                   LVRKYFKEKGENRYRIITFYNSFHGRTFGSMSATAQEKVQKGFEPLLEGFDYAIYNSFD
FT                   SVLKALRKDTAGIMLEVIQGEGGIRVANYEFIQKVQELCHNEGLLLIVDEVQTGVGRTG
FT                   KFFAYEHFDLKPDIITLAKGLGGGFPVGAVIAREKVSEVFSPGSHGSTFGGNPLACACA
FT                   KVVINKVSELLHHVSDVGEYFKRGLERLKVGKVRGMGLMLGLDLERDCSTIVRKALEHR
FT                   LVINCTAGTVLRFVPPLIIQKDHINTGLAVLDRILKAR"
FT   gene            complement(424810..426507)
FT                   /locus_tag="Hydth_0424"
FT   CDS_pept        complement(424810..426507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0424"
FT                   /product="NAD+ synthetase"
FT                   /note="COGs: COG0171 NAD synthase; InterPro
FT                   IPR014445:IPR003010:IPR014729:IPR003694; KEGG: aae:aq_959
FT                   NAD synthetase; PFAM: NAD synthase; Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase; SPTR:
FT                   O67091 Probable glutamine-dependent NAD(+) synthetase;
FT                   TIGRFAM: NAD+ synthetase; manually curated; PFAM: NAD
FT                   synthase; Carbon-nitrogen hydrolase; TIGRFAM: NAD+
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44825"
FT                   /protein_id="ADO44825.1"
FT                   /translation="MKSKLNITIAQMDITVGDVEGNAIKILKIWEEYHRVSHLIVFPEL
FT                   ALSGYPPEDLLLRMDFIKECQRWLDIIRDASAKFEAMALIGTPFYEGDLYNSALLVGGG
FT                   KLLAYYHKHFLPNYSVFDEKRYFRKGTYGTMVELGEVKIGISVCEDLWHPDGLERTYAI
FT                   MGAHALININASPYYFGKYEFKEAFLKARAEDNLCYVVYVNAVGGQDELVFDGRSLVID
FT                   PDGHICARAKAFEEDVLTVSLDVEKVKRRRLLDTRLREGKEKYHVISCGADTYRELEVF
FT                   PPRVERNPKDEEEIYTALKTGLEAYVKKNNFSKVVLGLSGGIDSSLVACLAVDALGSDR
FT                   VVGIFMPSEFTSKESKEDAVSLAKNLGIELYQFPIDVIFKSFRDTLGFTDFGVADENLQ
FT                   ARIRANILFYLSNRYGWLVLSTSNKSEASVGYTTIYGDMAGGFAPLKDVYKTLVYRLAR
FT                   YRNSLRPDIPERVFQKPPSAELRPGQKDQDTLPPYQMLDQILTLYIEEGLSQEEIVQKG
FT                   IDRETVEKVIRMIRLAEYKRRQAPVGIKITPRAFGKDWRMPITNMWGY"
FT   gene            426548..427204
FT                   /locus_tag="Hydth_0425"
FT   CDS_pept        426548..427204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q0G6Z5 Putative
FT                   aminotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44826"
FT                   /protein_id="ADO44826.1"
FT                   /translation="MKKLALLGMLSFAVFSCGGGSGSGIYGSYDTVLVGITSLVPAKVN
FT                   SDTVVFVGDAGQRCQLTFQDDAINIKIKSETIKNVAGQPVTPNPSPVYFDSYRVIWSSA
FT                   VSNNACEGAPECRQIFATPFAQLTSITVPPDSEVEVQGLVVTLASWKSSVLSQYCVSSL
FT                   DNCIYNAILELHGREVLTGKEKIVRGSFNIQFANYDQGNACGASACAQDSTVCIR"
FT   sig_peptide     426548..426613
FT                   /locus_tag="Hydth_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            427219..428877
FT                   /locus_tag="Hydth_0426"
FT   CDS_pept        427219..428877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0343 hypothetical protein; SPTR:
FT                   B8KVM5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44827"
FT                   /protein_id="ADO44827.1"
FT                   /translation="MKRVFLSTLSLLVVFGFSFSLQPVIRIFPSSPYDYGPTTIDTTKT
FT                   TDFAITNIGDATAGPLRICGTSVPSGFENFKIVADNCTGKSLNYGESCTISVRFEPRQK
FT                   LAYTGTLSVIYDDDGDATACNTQKNAIVNLTGKATAIKISGTGCDPSRFICDFSDVDIG
FT                   TNAYKTVRICNASGDPLLLLNPAFTLIENPVGDLPAYGIVTTNCNGANLSFFAGNTDDC
FT                   VNNYCELQLAFSPHDLKTYFGTAQINDANGGPLGQNSGVGIFLRGNGRYPNADIDFGTV
FT                   PIGSFIDRFVNVSFTCPGSGSVTLPDSLVSVSGTYFSLGGSSCPTSCTGGQPVSCNVAV
FT                   RFQPFTAGVFTGRVIVAVPNGTSVERTLVGRGGPATQNFLSLSISSIDFGTVPRFSSVG
FT                   RTIVVRNITSSTLEFNVDVAGSGFFAVMVGCTCNDNYVSNGSFCVPGTPPPTSLRPYKL
FT                   RPGEVCTVAVGFSPPLTARGTLGGVLIFDTQAQAISVPMTAQVAVSNPPTTPPSLPSVG
FT                   SGGGGGCSVSYGNFSTLMAWLSLPIALLMRRFMRR"
FT   sig_peptide     427219..427278
FT                   /locus_tag="Hydth_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(428901..430340)
FT                   /locus_tag="Hydth_0427"
FT   CDS_pept        complement(428901..430340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0427"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG2804 Type II secretory pathway ATPase
FT                   PulE/Tfp pilus assembly pathway ATPase PilB; InterPro
FT                   IPR001482:IPR003593; KEGG: pmx:PERMA_0824 general secretion
FT                   pathway protein E (type II traffic warden ATPase)(cholera
FT                   toxin secretion protein EpsE); PFAM: type II secretion
FT                   system protein E; SMART: AAA ATPase; SPTR: C0QPL5 General
FT                   secretion pathway protein E (Type II traffic warden
FT                   ATPase)(Cholera toxin secretion protein EpsE); PFAM: Type
FT                   II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44828"
FT                   /protein_id="ADO44828.1"
FT                   /translation="MDAEVGRHINHEFLSANGIAPLEEGENFVKFACLKEDAYLKELLE
FT                   RALGKKVIFELVDQEKLKNLLEDPISIGLELEALSEDALDEKKLENIAEEAPIVKFVND
FT                   TIKDAIMRSATDIHIEQFENHVVVRYRIDGILYTVREYPKYIAPPVISRIKILSRLNIA
FT                   EKRLPQDGKLSYSLNGQDYDIRVSTVPSVHGEGVVLRILKRGEINLSLHTLGFREQDVD
FT                   ALLSFIRKPYGMILVTGPTGSGKTTTLYACMKEINTGQKKIITVEDPVEYNLRGVVQIQ
FT                   VMPKIGLTFANALRNILRQDPDVIMIGEIRDLETASIAVQASLTGHLVLATLHTNDAAS
FT                   AFTRLIDMGVEEFLLASAVVGVISQRLVRKVCPNCIYEYKPTTFEEEVLKMNGIERPQK
FT                   LYRGKGCERCNNTGYSGRTVIGEVLKVTEDIRSLVVKKSDAGKIKEQAIKDGMVPLLKD
FT                   GLLKAVEGITTVEEILRVYRD"
FT   gene            complement(430325..430903)
FT                   /locus_tag="Hydth_0428"
FT   CDS_pept        complement(430325..430903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A2DUG2 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44829"
FT                   /protein_id="ADO44829.1"
FT                   /translation="MKRHIHNIRLLSERRVFRAALSFIIAGLFFIGFYYGVYKPFQKKK
FT                   QEMKSLYEERKKLRDELRHKAQELKSLMKEEEKINDQLSKLKDKVATGGDENTIVEQVK
FT                   ALISDKARAYKLTETSFSKEEVQDINGVKKIVLKAGYTSNSVESILRFLKDIEASGIMI
FT                   ESLSLGIDNPSNPSAYYVELRVYKLWMQR"
FT   gene            complement(430900..433002)
FT                   /locus_tag="Hydth_0429"
FT   CDS_pept        complement(430900..433002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0429"
FT                   /product="type II and III secretion system protein"
FT                   /note="COGs: COG1450 Type II secretory pathway component
FT                   PulD; InterPro IPR001775:IPR001814:IPR005644:IPR004846;
FT                   KEGG: dat:HRM2_30110 GspD2; PFAM: type II and III secretion
FT                   system protein; NolW domain protein; SPTR: A6PP67 Type II
FT                   and III secretion system protein; PFAM: Bacterial type
FT                   II/III secretion system short domain; Bacterial type II and
FT                   III secretion system protein; TIGRFAM: general secretion
FT                   pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44830"
FT                   /protein_id="ADO44830.1"
FT                   /translation="MFFVVGGKVKKAVALISLSLMSFSCAQMVSGYQEPYTIKQGETEK
FT                   TIKVEKEEKKGKAFEERKEEKVLYEKDYEEKAKEKEVKKAGNISIHFDDITISELLNEV
FT                   FYKILGVSYLAPADLNQRVSVHINHLTKDEVITYMQEILSLYGLGLSVDKGRLVVLPSG
FT                   RSPVGDNLSALVYSPENVSASSLSQAISTFISPSGKIIAQQRLLVIIDYREKLSKLKKL
FT                   LTEIDTPFYGDKKIAFIKTKVDASQIRDNVRKILKLLGKADADSVIDSLEKEGIVIVVS
FT                   KDPVLFNDIKRWIEVLEETSSGTKREIYIYRLNFLDAESTAELLNTLGIFEEGIGISSQ
FT                   QQAQTEAPRSTQEITKIQALPPTDQKPKQTTPETQKKEEMPPAVIEEKAKSEAKEEKKI
FT                   VKVGNIVADKSTNTLIIKATPIEFEVIRSLLRELDVVPKQVLIEMVIAEVSLGKGLQYG
FT                   VEGLLKGFLDSSSFTIGTSFGLAPQADTLQGFKTIIFNKNNDIRGILNFLASKTSLKVL
FT                   SAPHILVKDNEEAKIEVGAEVPILTQQIVPVTGGTLNVQNMVQYRTTGVILKVRPTVSA
FT                   DNSVTLKITQEVSDAVKNTVQPELTSPLITKRSASTTLILRNDQVGLLGGIIQNRLQRQ
FT                   KSGVPLLSDIPGLGILFSNESVSSSNTELILLIKASVITTPEEGQGVKTSFENKLKHLK
FT                   DLLKEE"
FT   sig_peptide     complement(432925..433002)
FT                   /locus_tag="Hydth_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            433043..434494
FT                   /locus_tag="Hydth_0430"
FT   CDS_pept        433043..434494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0430"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR003959:IPR012763:IPR003593:IPR008921; KEGG:
FT                   aae:aq_1855 DNA polymerase III gamma subunit; PFAM: AAA
FT                   ATPase central domain protein; PRIAM: DNA-directed DNA
FT                   polymerase; SMART: AAA ATPase; SPTR: O67707 DNA polymerase
FT                   III gamma subunit; TIGRFAM: DNA polymerase III, subunits
FT                   gamma and tau; PFAM: ATPase family associated with various
FT                   cellular activities (AAA); DNA polymerase III subunits
FT                   gamma and tau domain III; TIGRFAM: DNA polymerase III,
FT                   delta' subunit; DNA polymerase III, subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44831"
FT                   /protein_id="ADO44831.1"
FT                   /translation="MYIPFARKYRPKFFKDVVGQEPVKRILLNAVRLQKVSSAYIFAGS
FT                   RGTGKTTVARLLTKSLNCINLQESGEPCGQCENCLSIDRGSFPDLIEIDAASSRGIDDI
FT                   RAIRDAVSYTPIKGRYKVYILDEAHMLTKEAFNALLKTLEEPPPRTVFILCTTEYEKII
FT                   PTILSRCQRLIFTKLSQEEIVQRLKHICQEENISYDEKSLITIAKLSDGGMRDAVSLLD
FT                   QVSTYAEGNIKEGVLEEFLGIVSQERVREFLRMLLESRVDEAIDFLRQITTRGFNLVRF
FT                   WDALEDEIRMILLYRSLKDPSKVIKVEDFHRSMSQVPINALLYLEKVINTARADAKTRD
FT                   FLRACELAIIKTLVVKDIIPVGELFKRTDLHLTKEDAPQEVSLKDKVINEVEKAFGVLE
FT                   AQRLKNLEAKEEKGRITFLVPESEAKTIDINRIKTRFPEIDFEILSSSKENKEELPEFS
FT                   KKVKDLFGAKVIKHGKGDKGKDTSG"
FT   gene            434457..434714
FT                   /locus_tag="Hydth_0431"
FT   CDS_pept        434457..434714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_0522 hypothetical protein; SPTR:
FT                   A8UUZ9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44832"
FT                   /protein_id="ADO44832.1"
FT                   /translation="MERAIKARILLVKVPPELIGIFTSLIDGSGRRAIVRTKESKGDLV
FT                   YLIATPDTYEELIFTVEQIKKHLPQVEMLGETEPSELEIN"
FT   gene            434804..435850
FT                   /locus_tag="Hydth_0432"
FT   CDS_pept        434804..435850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0432"
FT                   /product="transglutaminase domain protein"
FT                   /note="COGs: COG1305 Transglutaminase-like protein;
FT                   InterPro IPR002931; KEGG: sdl:Sdel_2128 transglutaminase
FT                   domain protein; PFAM: transglutaminase domain protein;
FT                   SMART: transglutaminase domain protein; SPTR: A8UV37
FT                   Putative uncharacterized protein; PFAM:
FT                   Transglutaminase-like superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44833"
FT                   /protein_id="ADO44833.1"
FT                   /translation="MDRREFLSYTFWGACGLISLPSIIYGRNTYRTKFSYAVNLPYEDA
FT                   VRLWVPVPENTSYQKLLHMEVKTNASYYELTADRVYNAPILYAEFKGGNENKSLEVIFD
FT                   VEYTDRSVDMSKLPKNNGNIPDEVAFYLKPTDHVPTDGIVKEYADRITSGKKSQLEKVK
FT                   AIYDWVVENTFRDPQVQGCGTGDVKSMLETGYFGGKCTDINSLFVALCRASGIPAREVF
FT                   GIRVRASSLSKGISSVTKDATKAQHCRAEFYLGQWVPADPADVRKLILEERLSIDHPKV
FT                   RQVREFLFGNWDAHWVAFNSARDFSLEPPLTSGEKVNEFMYPLAEVKGKLIDKYKLTFE
FT                   LSKYTILA"
FT   gene            complement(435847..436527)
FT                   /locus_tag="Hydth_0433"
FT   CDS_pept        complement(435847..436527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0433"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="COGs: COG0047 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase glutamine amidotransferase domain; InterPro
FT                   IPR010075:IPR017926:IPR011698; KEGG: aae:aq_1105
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase; PRIAM:
FT                   Phosphoribosylformylglycinamidine synthase; SPTR: O67190
FT                   Phosphoribosylformylglycinamidine synthase 1; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44834"
FT                   /protein_id="ADO44834.1"
FT                   /translation="MKFAICVFPGSNCDYDVYYVIKDILGQEAQFVEYTQKKLEGFDCV
FT                   ILPGGFSFGDYLRAGALASKTPIAKAVQDFAQKGGLVLGICNGFQILTELHLLPGALLK
FT                   NENLRFVCKDVYLRVENNRIAFTRKIEEGEVLNIPIAHGEGRYYVPEDILQQMERNQQI
FT                   VLRYCDKEGNVIPSSNPNGSVGNIAGVCNKEGNVFGLMPHPERASEDLLGSHDGLLFWY
FT                   SLIS"
FT   gene            complement(436524..436736)
FT                   /locus_tag="Hydth_0434"
FT   CDS_pept        complement(436524..436736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0434"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="COGs: COG1828 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase PurS component; InterPro IPR003850; KEGG:
FT                   aae:aq_932a phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, PurS component; PFAM:
FT                   phosphoribosylformylglycinamidine synthetase PurS; SPTR:
FT                   A8UVW1 Phosphoribosylformylglycinamidine (FGAM) synthase,
FT                   PurS component; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase, purS; PFAM: Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase, purS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44835"
FT                   /protein_id="ADO44835.1"
FT                   /translation="MKVRVLILPKKGLLDPEGRAIKEMLLENGYQVNDVKVGKVVDLDV
FT                   EEGTDIKMLVESFLVNTLIEEYTIE"
FT   gene            complement(436999..437262)
FT                   /locus_tag="Hydth_0435"
FT   CDS_pept        complement(436999..437262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q5CQT3 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44836"
FT                   /protein_id="ADO44836.1"
FT                   /translation="MGLYDRDYMRKDRKREKREENRILDSLSELFEKLQHREERIEKPK
FT                   QEGVKTEKERQVRKPDLALYFWILSGVIAVGLLIFMLIKAHA"
FT   gene            complement(437313..437642)
FT                   /locus_tag="Hydth_0436"
FT   CDS_pept        complement(437313..437642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0436"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="COGs: COG0792 endonuclease distantly related to
FT                   Holliday junction resolvase; InterPro IPR003509:IPR011335;
FT                   KEGG: hya:HY04AAS1_1639 protein of unknown function
FT                   UPF0102; PFAM: protein of unknown function UPF0102; SPTR:
FT                   A8UQV9 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised protein family UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44837"
FT                   /protein_id="ADO44837.1"
FT                   /translation="MSRKGKEFEDIACKYLESLGYQILARNFYCKGGEIDIIAKDGDTL
FT                   VFVEVKGTKAKSFGDPAERIDRIKMERLLRCIEEYLSLCHTESLRLDALIIRGKDIEHI
FT                   RGIEL"
FT   gene            complement(437617..438567)
FT                   /locus_tag="Hydth_0437"
FT   CDS_pept        complement(437617..438567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0437"
FT                   /product="rfaE bifunctional protein"
FT                   /note="COGs: COG2870 ADP-heptose synthase bifunctional
FT                   sugar kinase/adenylyltransferase; InterPro
FT                   IPR011611:IPR002173:IPR011913; KEGG: aae:aq_565 ADP-heptose
FT                   synthase; PFAM: PfkB domain protein; SPTR: A8UQW0
FT                   ADP-heptose synthase; TIGRFAM: rfaE bifunctional protein;
FT                   PFAM: pfkB family carbohydrate kinase; TIGRFAM: rfaE
FT                   bifunctional protein, domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44838"
FT                   /protein_id="ADO44838.1"
FT                   /translation="MKLDKDTVLRVFERLRSLKILVVGDVILDRYVFGKVERISPEAPV
FT                   PVVEVEREEFRLGGAGNVASNLSALGVKTYLVGITGEDYGMHMIKGLLRERDIQDLTVR
FT                   DSSRPTTEKVRVISMSQQLIRIDRENTRTVQGENLRKILDRLEVYVDGIIISDYAKGVV
FT                   CKEVIEKVKSTGKFYSVDPRPQNVHLYQGAHLMTPNEKEARQMFKAQTLEDLGWGLKRE
FT                   LSLQALAITLGPKGIALFENRLSLYPARARQVYDVTGAGDTVIAVLTACRVAGFDWDIS
FT                   CELANVCAGIVVGKLGTASPSIEEVIEYVEEGERV"
FT   gene            complement(438557..439792)
FT                   /locus_tag="Hydth_0438"
FT   CDS_pept        complement(438557..439792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0438"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="COGs: COG0527 Aspartokinase; InterPro
FT                   IPR001048:IPR002912:IPR018042:IPR005260:IPR 001341; KEGG:
FT                   aae:aq_1152 aspartokinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; amino acid-binding
FT                   ACT domain protein; SPTR: A8UQW2 Aspartokinase; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: ACT domain; Amino acid kinase family; TIGRFAM:
FT                   aspartate kinase, monofunctional class; aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44839"
FT                   /protein_id="ADO44839.1"
FT                   /translation="MHLVIKFGGTSVGSLERIENAARKVIEKVKEGYKVVVVSSAMAGE
FT                   TDRLINLARQLDNFPPEREVDMLISTGEQQAIALFAITLNKLGYPAVSLCGWQVPIITD
FT                   HVHTKARVRKVGIQRIKNLLKEGYIPVVAGFQGVTEDWEITTLGRGGSDLSAVVLAHAL
FT                   GADCEIYTDVEGVFTADPRIVPQARKIPRISYEEMLEMASLGAKVMQARSIEFAMKYNV
FT                   RIHVRSSFSDVEGTWILPEEEVMEKVAVRAITLDTKESRITVVRVPDRPGIAYSIFKAL
FT                   GDAHIVVDMIVQNVSHQGYTDMSFTVNKTDADLAESIVRKVAGDIGAQEVVRDDHVAKI
FT                   SVVGIGMKSSYGTAAKMFEVLYRNNINIMAISTSEIKISCLIESKYGELAVRELHSAFI
FT                   EEGEEVKVINET"
FT   gene            439817..440599
FT                   /locus_tag="Hydth_0439"
FT   CDS_pept        439817..440599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0439"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR016040:IPR000683; KEGG: aae:aq_440 hypothetical
FT                   protein; PFAM: oxidoreductase domain protein; SPTR: A8UXG7
FT                   Putative uncharacterized protein; PFAM: Oxidoreductase
FT                   family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44840"
FT                   /protein_id="ADO44840.1"
FT                   /translation="MRILLVGVGNMGRKYLTKITELGHTPILCDTDPGKRVNGFSFYCH
FT                   VEEVKEQVDAAIVAIEPSQHVKVSKPLLEMGLPVLLEKPPALSYREFQEIEPYTHLYIS
FT                   EIETFSSCLKYFPEKVQSLSIERLGRSKGYVSPLWDLAWHDLYLLQLFFENIRITQVKT
FT                   GEVWEINGEVDRIPFSLKVAWEHPAPSRKWIINEGELILDLAKEEVWVKGELLHSEPRD
FT                   KLKLMIQAFLKDEFNQRSRERAKRNLSLLEEAESLLRT"
FT   gene            complement(440561..441922)
FT                   /locus_tag="Hydth_0440"
FT   CDS_pept        complement(440561..441922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0440"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR002078:IPR003593:IPR009057; KEGG:
FT                   pmx:PERMA_0513 nitrogen assimilation regulatory protein;
FT                   PFAM: sigma-54 factor interaction domain-containing
FT                   protein; SMART: AAA ATPase; SPTR: A8V246 Two component,
FT                   sigma54 specific, transcriptional regulator, Fis family
FT                   protein; PFAM: Sigma-54 interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44841"
FT                   /protein_id="ADO44841.1"
FT                   /translation="MERLLYTKDQHFRLEGFERVEELPEDISKSLVIVDIDSVGLSCLP
FT                   DLLEGENIAVAVTGKRIPGYTIKLVSLGFYHVLFKPVSSNKLKELLRSLESLERERDVI
FT                   LLPEEENLSGELCKELCSIVGDPEGKMRDVLLKIGKAAPLDVPVLLLGETGVGKEVFAK
FT                   ALWKTSKRWNGPFVAVNCAAIPPELLEAELFGYEKGAFTGAFSSKEGLIESAKGGVLFL
FT                   DEIGDLPLHIQPKLLRVLQEKKLRRLGSTKEVHCDFRLVCATNRDIKKLVKEGLFREDL
FT                   YYRISAVEIHIPPLRSRREDIPLLINCMLRNLSKEIGKRIRGYTEGFLKKALTYSWPGN
FT                   VRELENALRRAITLCKGEVLRAEDLEVEHQDYSQENLEDALKEEVKRLLTEGEGNLYYR
FT                   LMDRVSKIIVGEAFSFLGRNYSRTAKVLGINRITLKRILQKTSSPEKALSFLQE"
FT   gene            442053..444707
FT                   /locus_tag="Hydth_0441"
FT   CDS_pept        442053..444707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0441"
FT                   /product="adenylylsulfate reductase, thioredoxin dependent"
FT                   /note="COGs: COG0155 Sulfite reductase beta subunit
FT                   (hemoprotein); InterPro
FT                   IPR014729:IPR005117:IPR006067:IPR003749:IPR
FT                   002500:IPR004511:IPR011798:IPR016155; KEGG: rmr:Rmar_2355
FT                   ferredoxin--nitrite reductase; PFAM: phosphoadenosine
FT                   phosphosulfate reductase; nitrite and sulphite reductase
FT                   4Fe-4S region; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; thiamineS
FT                   protein; SPTR: D0MEK5 Ferredoxin--nitrite reductase;
FT                   TIGRFAM: adenylylsulfate reductase, thioredoxin dependent;
FT                   phosphoadenosine phosphosulfate reductase; PFAM: ThiS
FT                   family; Nitrite and sulphite reductase 4Fe-4S domain;
FT                   Phosphoadenosine phosphosulfate reductase family;
FT                   Nitrite/Sulfite reductase ferredoxin-like half domain;
FT                   TIGRFAM: thioredoxin-dependent adenylylsulfate APS
FT                   reductase; phosophoadenylyl-sulfate reductase
FT                   (thioredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44842"
FT                   /protein_id="ADO44842.1"
FT                   /translation="MREEVIEKNPRERLKAEKHPLDILEELPTIIDRGYEDTPEEDMVR
FT                   LQWYGLYHDKPRVGYFLLRVKVPGGILNPEQLRVVGELSSRFGDYAEITLRQDIQLHYI
FT                   RLEHLPDVFESLKSVNLFPVGACGDTVRNITTCPLCGLEKDELFDVRECVQKLEGFFHH
FT                   PENRDYFNLPRKFKITVSACPYHCNMPEMHDLAFVGTVFEGKEGFAVWIGGGLSSTPRI
FT                   ARKLGIFVEKERVLSLAKAVVDLWSEDPENRKSFVKARFKYMVDRLGVEKIKSMILERL
FT                   DFTPQPLDEEPLPVKRYFHTGVGRQKQEGFYYLGIPLPAGRVRGSQLLALAELAQEFNL
FT                   SIRLSQRQNIILVNISQEDLREVRDRVKELGFHLDVGETRAISVACTSDPFCNYSVGSA
FT                   KEALLELLDYLEEKLGKLEGVSIGVDGCPHACAHHWLNDIGLQATHLRHPDGSVETTYN
FT                   LVLRGGYGRRASIGKIVAKKVPLERVKVYVERLILAFRSSKLEEFYEFVNSKSDEELLS
FT                   IMEGKATQAKEEVKRSVKIRIFGPLTRFSGGLSELEVSANTVRTALEHLEKEFEGFKGR
FT                   LFDERGELKPFVKVFLNEEDVSFLKGLETPLKDGDELMLYPALAGGSHTFDELELHELA
FT                   LEFEEKPAQELLVWAIENFHPRLYIAWSGQVEDMVLLDMAWRINPDVRVFAVDTGRLHE
FT                   ETYRLMQEVEDRYGVRVEVYFPDAKDVEELTRKYGINCFYKSVELRHLCCHVRKVKPLL
FT                   KALSQVDAWITGLRREQWASRHNIMKIEVDHDHGQIVKINPLADWSEREVWEYIKKNAV
FT                   PYNKLYEAGYRSIGCEPCTRPVAPFEDPRAGRWWWEKDAPKECGMHCSIETGGFEKIAD
FT                   KVIKEEKDGSEDT"
FT   gene            444688..444975
FT                   /locus_tag="Hydth_0442"
FT   CDS_pept        444688..444975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: svi:Svir_33730 uncharacterized enzyme involved
FT                   in biosynthesis of extracellular polysaccharides; SPTR:
FT                   C3XG35 Flagellar assembly protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44843"
FT                   /protein_id="ADO44843.1"
FT                   /translation="MALRILERVNIEKLKEELFKRGWNEGKFNSRQAMLKEFNDYLWVA
FT                   VLEKEPYFLSLPKEESSRVHSEGMKALREEVESLALTLGFSLPTKGGSYA"
FT   gene            444968..445717
FT                   /locus_tag="Hydth_0443"
FT   CDS_pept        444968..445717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0443"
FT                   /product="protein of unknown function DUF81"
FT                   /note="COGs: COG0730 permease; InterPro IPR002781; KEGG:
FT                   min:Minf_0617 predicted permease; PFAM: protein of unknown
FT                   function DUF81; SPTR: B3E014 Predicted permease; PFAM:
FT                   Sulfite exporter TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44844"
FT                   /protein_id="ADO44844.1"
FT                   /translation="MLEYLLLGFFIAFAIGLTGVGAGTLTAPVLILLGLNPAQAVGSAL
FT                   SFSTLVKFPGFLFHALYKNVEYRLLMFMCFGGVPGVLLGSSLLSRLSQADKLKNLIMFI
FT                   IGITVILLVILNLLGTLMKRRIDLTRYFYLIPLVCFFIGLEVGFTSAGAGALGMVLLLY
FT                   FTRLPPSKAVGVDIGFGLACSLTGSLAHLLQGHTQPHVFLPMSLGGLLGIWLGTHLTRR
FT                   INPKPLRVGISMLLILVAFNLIKRGLS"
FT   sig_peptide     444968..445033
FT                   /locus_tag="Hydth_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            445717..446484
FT                   /locus_tag="Hydth_0444"
FT   CDS_pept        445717..446484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0444"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="COGs: COG0007 Uroporphyrinogen-III methylase;
FT                   InterPro IPR014777:IPR014776:IPR000878:IPR003043:IPR
FT                   006366; KEGG: sul:SYO3AOP1_0051 uroporphyrin-III
FT                   C-methyltransferase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR: Q3LGA4
FT                   Uroporphyrinogen III methyltransferase; TIGRFAM:
FT                   uroporphyrin-III C-methyltransferase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44845"
FT                   /protein_id="ADO44845.1"
FT                   /translation="MGKVYIVGAGPGDPELLTLKAYRLIKSADVVLYDRLVNPEILLLA
FT                   KPECQLIYVGKEEGKHTLEQEKINELLLHYAHTKEVVVRLKGGDPFVFGRGGEEALFLA
FT                   EHGVEVEVVPGISSATGVPAYAGIPITFRGLSSSFAVITGHEDPKKERTSVDWESLKGI
FT                   NTLVFLMAVSNRKEIARRLIEVGRDPKEPVAFIERGTTREQRVVITDLYELANYPPEVN
FT                   PPALMVVGQVIKLRKLISFKEVVACFYPTVENL"
FT   gene            446454..447605
FT                   /locus_tag="Hydth_0445"
FT   CDS_pept        446454..447605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0445"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="COGs: COG2046 ATP sulfurylase (sulfate
FT                   adenylyltransferase); InterPro
FT                   IPR014729:IPR002650:IPR015947; KEGG: tth:TTC0307 sulfate
FT                   adenylyltransferase; PFAM: ATP-sulfurylase; PRIAM: Sulfate
FT                   adenylyltransferase; SPTR: B7AB26 Sulfate
FT                   adenylyltransferase; TIGRFAM: sulfate adenylyltransferase;
FT                   PFAM: ATP-sulfurylase; TIGRFAM: ATP sulphurylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44846"
FT                   /protein_id="ADO44846.1"
FT                   /translation="MLLPHGGELVNRVVPERERAKVLEEAKSYPSLVVDTDALLDIENI
FT                   AVGVFSPLKGFMTHEELLSVAYHMSLPGGVVWSLPVLLQLREKPEVDGRVALKDTSGRI
FT                   KAIVDVKEVYRIDLPLIAKLVWGTESEEHPGVKLFYSKGEWAVGGDVWLLEKVEFPFRD
FT                   WILTPEETRKIFEYRGWKTVVGFQTRNAPHRAHEYLQRIGLEVADGLFVNPVLGWRKSD
FT                   DFDPLTVLEAYEYLINSYYPKNRVLLSGLATAMRYAGPREAVFHAIVRKNFGCTHFIVG
FT                   RDHAGVGDFYDPYEAHRIFDRLPEDIGIEIIKVSAVFYCRSCDCIASEKSCGHEENQRV
FT                   YVSMTKIRNMLREGKFPPEEMIRRDVAELLIKRRTKSLTNVHS"
FT   gene            447620..448816
FT                   /locus_tag="Hydth_0446"
FT   CDS_pept        447620..448816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0446"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3); InterPro
FT                   IPR013027:IPR012999:IPR016156; KEGG: sto:ST1879
FT                   dihydrolipoamide dehydrogenase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; SPTR: Q96ZF4
FT                   Dihydrolipoyl dehydrogenase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44847"
FT                   /protein_id="ADO44847.1"
FT                   /translation="MEHFDVVIVGSGPGGYMSAKLLLERGKSVALVEKSVFGGVCLNAG
FT                   CIPKEGLYKLALEKSKPRWKVAVQMVQGKVIEIRDTSLKALLSKGLTYVEGDGELIDER
FT                   VIKVGNRRLTASHIILACGSKQREPGISPEDVLRGWAIPKNNVCIVGGGAAGCELAFIL
FT                   SSFGFKVYLVREDTVLKGYRNIPEEFALKLEDALERCGVKLVENTKNVDADLVIRATGR
FT                   IPNFCQERFPFVAVDERGFVRTDSFLETDTKGIFAVGDIVPPMGAGYAFEKARVAVRSI
FT                   LYDKERVFDPRKVPVIISSAYQIGFVGDVKDAKIFVTKPLGTNPKAYVTENDGIISVGF
FT                   DDSGRLVYCCLIGREVGEILNLCATLLGKNLEEHLSFAHPSYGEIINEILSIKQEVCR"
FT   gene            448813..449301
FT                   /locus_tag="Hydth_0447"
FT   CDS_pept        448813..449301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0447"
FT                   /product="4-vinyl reductase 4VR"
FT                   /note="COGs: COG1719 hydrocarbon binding protein (contains
FT                   V4R domain); InterPro IPR004096; KEGG: aae:aq_1655
FT                   hypothetical protein; PFAM: 4-vinyl reductase 4VR; SPTR:
FT                   A8UVQ3 Putative uncharacterized protein; PFAM: V4R domain;
FT                   TIGRFAM: bacteriochlorophyll 4-vinyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44848"
FT                   /protein_id="ADO44848.1"
FT                   /translation="MKDQEVLSRVRIFLREEGVIVPKGPIKEFYSQLMKLSGFGIGGLL
FT                   VFSGKKAGKMAGTYIKSIVGDENPSVEKVADYVSAFLEETGICKVENYELSDSQIIFKV
FT                   KDSIFAQDVDNKKPVCMPLSGALAGVFEEVTKKEWDCREIECQAQGKERCIFEIKLKH"
FT   gene            complement(449291..450274)
FT                   /locus_tag="Hydth_0448"
FT   CDS_pept        complement(449291..450274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0448"
FT                   /product="NHL repeat containing protein"
FT                   /note="InterPro IPR011042:IPR001258; KEGG: rca:Rcas_3798
FT                   NHL repeat-containing protein; PFAM: NHL repeat containing
FT                   protein; SPTR: A7NQJ1 NHL repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44849"
FT                   /protein_id="ADO44849.1"
FT                   /translation="MKIEVLGIVGAPSNFSLQVPDAKASPYTLYGPRGVFLKGDVFIVA
FT                   DTGNHRVLVWKAIPLHGEPALVVLGQRDFYSDSPNAGGDTERGLFMPTGVFLSDDGKLF
FT                   LADAWNHRVLMWEKLPEENFSKPDHVIGQPSLKSVDRNMLFWCFGVYYDGYLYVCDTGN
FT                   RRILRWKGVPDSMQKPDDVYEGFSWPHTLCKNEDRFFVADAGTGVSKVYVFENSLSDAY
FT                   NCNSYIGQREGCDEMSLNLPYGVSANGDFLFIGDTSNNRVLVFRGDSVKPVAVVGQRNF
FT                   FECGENRWEKVDEQSLCWPYAVFSTENILLVADTGNNRVIIYRFSV"
FT   gene            complement(450271..451098)
FT                   /locus_tag="Hydth_0449"
FT   CDS_pept        complement(450271..451098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0449"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="COGs: COG2146 Ferredoxin subunits of nitrite
FT                   reductase and ring-hydroxylating dioxygenase; InterPro
FT                   IPR017941:IPR001075; KEGG: chl:Chy400_2990 Rieske (2Fe-2S)
FT                   domain protein; PFAM: Rieske [2Fe-2S] iron-sulphur domain;
FT                   nitrogen-fixing NifU domain protein; SPTR: C6QQT8
FT                   Nitrogen-fixing NifU domain protein; PFAM: NifU-like
FT                   domain; Rieske [2Fe-2S] domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44850"
FT                   /protein_id="ADO44850.1"
FT                   /translation="MTEELSFEKLAERIDELLAKVKNFEDEKRETVGELIKSIEEFTRM
FT                   ALVKLVKLMKEDSAGKDILLKAVREPEIYSLFLKHGIIREDDRTKAIKALELIRPYIRS
FT                   HGGDVEFVDLKEKTLYVRLRGTCTGCSQVSFTLQQTILEAVQAYIPHIEKVELAKDTPV
FT                   EAFLELSGKEEGYIKAFDISELKEGHVYRFLHEGVDVILMLWKGRVYAYRNSCAHQGHP
FT                   LHEGELTEKGVLVCPWHRFEYSITSGECLTVPYVQLVSVPTKIQNGWVLLKVR"
FT   gene            complement(451082..452257)
FT                   /locus_tag="Hydth_0450"
FT   CDS_pept        complement(451082..452257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0450"
FT                   /product="TPR repeat-containing protein"
FT                   /note="InterPro IPR011990:IPR019734:IPR013026:IPR001440;
FT                   KEGG: fra:Francci3_1074 hypothetical protein; PFAM: TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide repeat;
FT                   SPTR: Q2JE36 Putative uncharacterized protein; PFAM:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44851"
FT                   /protein_id="ADO44851.1"
FT                   /translation="MSWREVFPQPVGILPFPFDFLILPHSNLWQEHIPTVLLLKLEGLP
FT                   SEWKFILSLKEKDWKQALQNILSISEEDVKNYNLSLITGSKQTVKDKTLAYLLDIVFSD
FT                   RFDIRDMGRDDLNALVLYRKAQLLEGEGKIEDAIAMIENALRLVRDLSPLFYANLLLKK
FT                   AKLFMEHKGVNYAVLALLEELEEKLSEADFLRAEVQFNLGNAYSSLGNLSKAISYYWKA
FT                   LDFFTVDKDPYMYALINNNMGLAYLSSDVSDLEDQVRLAYGVQSLRNALKVFTKERYPK
FT                   EWASTTMNYANALQYLPTANPAKNLLKAVELYREVLDYRKEVGDELGYARTLANMGNAL
FT                   AHLGRLFEARRHLIEAFEIFKKYGMEEEMNGIREVLEEIHMLMEARHDGGA"
FT   gene            complement(452257..452475)
FT                   /locus_tag="Hydth_0451"
FT   CDS_pept        complement(452257..452475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_2266 hypothetical protein; SPTR:
FT                   A0QUM9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44852"
FT                   /protein_id="ADO44852.1"
FT                   /translation="MFKDRALIAETFVEEKDGQWSVFIEVLFKDETVRYEVGRYFTKKK
FT                   AELAAGYIKRCANRDIPHPNDGLGGCC"
FT   gene            complement(452491..453249)
FT                   /locus_tag="Hydth_0452"
FT   CDS_pept        complement(452491..453249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0452"
FT                   /product="hydrogenase maturation protease"
FT                   /note="COGs: COG0680 Ni Fe-hydrogenase maturation factor;
FT                   InterPro IPR000671; KEGG: msm:MSMEG_2264 peptidase M52,
FT                   hydrogen uptake protein; PFAM: peptidase M52 hydrogen
FT                   uptake protein; SPTR: A7BI66 Ni,Fe-hydrogenase maturation
FT                   protease; TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   Hydrogenase maturation protease; TIGRFAM: hydrogenase
FT                   maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44853"
FT                   /protein_id="ADO44853.1"
FT                   /translation="MRKVVIVGCGNPIRGDDGVGPRLIRYLWERGLPPHIKLVDGGTSG
FT                   IDVVFHMEGADEVVFVDACCTGEKPGTVFCVPHEEVEELPSSEEANLHSIKWYHAVAIA
FT                   RHLLNGNYPKSIKVYLIEGKSFGIGEVLSEEVESAMKRLAERIIKEYSIEGGKVVELEL
FT                   KEDGYLIIPADVAERYLGGCMSVLVIPRGMHFTLLPLPTSAQGGLLLKRINKEGDRAVL
FT                   LWELLPPGTPFGKKKAVWSDEEGGLVVSLI"
FT   gene            complement(453246..454880)
FT                   /locus_tag="Hydth_0453"
FT   CDS_pept        complement(453246..454880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0453"
FT                   /product="Cytochrome-c3 hydrogenase"
FT                   /EC_number="1.12.2.1"
FT                   /note="COGs: COG0374 Ni Fe-hydrogenase I large subunit;
FT                   InterPro IPR018194:IPR001501; KEGG: chl:Chy400_2995
FT                   nickel-dependent hydrogenase large subunit; PFAM:
FT                   nickel-dependent hydrogenase large subunit; PRIAM:
FT                   Cytochrome-c3 hydrogenase; SPTR: A7BI65 Ni,Fe-hydrogenase
FT                   large subunit; PFAM: Nickel-dependent hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44854"
FT                   /protein_id="ADO44854.1"
FT                   /translation="MATKQHLVIDPLARLEGDVRADVFVEDGHVADVQVEAVMFRGFEI
FT                   ILRGKDPLAGLIVTPRVCGICGGSHLYKACQALDTAWRTEVPPNAWHIRNIAQACETLQ
FT                   SVPRWYYAIFAIDFVNKNYAKSKLYDEVVRRWAPFVGTSYKIGLEVSALPVKVYAMFGG
FT                   QWPHSSFMVPGGVMCAPQLDHITRAYALLERYRTEWLEKVWLGCSVDRWLENKTWDDVL
FT                   KWLDENESHRNSDCGLFIRFCLENGLDKYGAGVNAFLACGTYIDPEFYPVSTIEGRNQA
FT                   LQSPSGVVYNGKYYIFDQMNVREDITHSYFEGSSMLHPWEGETVPLDPEVAKKQGKYSW
FT                   AKSPRYLIDGKPVPLEAGPLARQVVAGYEEAKSACSASGCIEHAIDPLFKNIVSKIGPS
FT                   VMVRVLARMHEAVKYYKWVKTWLAKVNFDDDRFYKKPKELPEGKGYGGTEAARGALQDW
FT                   IVIENGKIKNYQIVTPTAWNIGPRDSKGQMGPIEKAIVGAPIKNPEDPIEVAHVARSFD
FT                   SCLVCTVHVYDRKRGKELARYKLGTFK"
FT   gene            complement(454906..455877)
FT                   /locus_tag="Hydth_0454"
FT   CDS_pept        complement(454906..455877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0454"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="COGs: COG1740 Ni Fe-hydrogenase I small subunit;
FT                   InterPro IPR001821:IPR006137; KEGG: chl:Chy400_2996 NADH
FT                   ubiquinone oxidoreductase 20 kDa subunit; PFAM: NADH
FT                   ubiquinone oxidoreductase 20 kDa subunit; SPTR: A7BI64
FT                   Ni,Fe-hydrogenase small subunit; PFAM: NADH ubiquinone
FT                   oxidoreductase, 20 Kd subunit; TIGRFAM: hydrogenase (NiFe)
FT                   small subunit (hydA)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44855"
FT                   /protein_id="ADO44855.1"
FT                   /translation="MATVLWLHGGACNGNTMSFLNAEYPSVCDLVTDFGIEILWHPSAG
FT                   LEMGNQVQALLRDILAEKIPLDIFVFEGTVVLGPNGTGRYNMFAGRPMKDWVYELAHVA
FT                   KFVVAVGNCACQGNIPAVPPNPTESTGLQFHKTKKGGFLGEHFVSRGGLPVINIPGCPA
FT                   HYDWITQILVALAVGRASDIQLDEYNRPLTFFKTFSQTGCTRVQFHEWKISAEEFGQGT
FT                   RKGCLFYELGCRGPLTHAPCNRILWNGVSSKQRSGHPCIGCTEFAFPWFDLAPGTIFKT
FT                   QKVAGVIPKESVYEADKFTYMLHAVTARIAAPKWATEDIFVV"
FT   gene            456028..456459
FT                   /locus_tag="Hydth_0455"
FT   CDS_pept        456028..456459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0455"
FT                   /product="protein of unknown function DUF1641"
FT                   /note="InterPro IPR012440; KEGG: gwc:GWCH70_0463 protein of
FT                   unknown function DUF1641; PFAM: protein of unknown function
FT                   DUF1641; SPTR: C6QQU8 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF1641)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44856"
FT                   /protein_id="ADO44856.1"
FT                   /translation="MSYHEQTLLEGLTVGEAKEQLSQLIDKLETINFLLSSLEELMQRT
FT                   PFILESISSEVIRFREKFRESEDGIKNILELAYNAVDFLGKENLASLLNGLLEAYTEVK
FT                   QHDYRTSITGIVRAMTDPDVQRALAFVLLTLKKMGMSMR"
FT   gene            456464..456913
FT                   /locus_tag="Hydth_0456"
FT   CDS_pept        456464..456913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0456"
FT                   /product="protein of unknown function DUF1641"
FT                   /note="InterPro IPR012440; KEGG: gtn:GTNG_0463 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1641; SPTR:
FT                   Q5L2T7 Hypothetical conserved protein; PFAM: Protein of
FT                   unknown function (DUF1641)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44857"
FT                   /protein_id="ADO44857.1"
FT                   /translation="MENHYIFLRRPEDELVEAYFKKDENIRHLTTFLNSLDALAYFAEI
FT                   LHEYVESREDLSRYVHEREDRREAVKAGAEKLDFLIRELVGTLELGNLAHFARANYEAY
FT                   EDTKKNPRRVGLLGIYRELRDPDVQLALGFVFTLLKRIAYLFKEK"
FT   gene            457029..457712
FT                   /locus_tag="Hydth_0457"
FT   CDS_pept        457029..457712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0457"
FT                   /product="Nickel transport complex, NikM subunit,
FT                   transmembrane"
FT                   /note="InterPro IPR019613; KEGG: saf:SULAZ_0739
FT                   hypothetical protein; PFAM: Nickel transport complex, NikM
FT                   subunit, transmembrane; SPTR: C1DUD7 Putative
FT                   uncharacterized protein; PFAM: Nickel uptake
FT                   substrate-specific transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44858"
FT                   /protein_id="ADO44858.1"
FT                   /translation="MKRFFLPLILSSLSMSHDLWVEREGSQYALYYGHLHPVQGEEKFI
FT                   KYKPEDVLKFECVSSGGKPLQYKFEKSYPARLKGSCGAVLAVFSSGYWTKSVEGLKNLP
FT                   KDRVQGAIEGWLSYESVKRIDSWSQELKKPLTDDLEIVPLENPLEAKVGDKLTFAVYYR
FT                   GKPLKDAVVAYDEKPVGSTDDDGRINIRIKRKGLQLISTSVKEKADGVKADYVVKTANL
FT                   SFEVK"
FT   sig_peptide     457029..457076
FT                   /locus_tag="Hydth_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            457712..458134
FT                   /locus_tag="Hydth_0458"
FT   CDS_pept        457712..458134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_0740 hypothetical protein; SPTR:
FT                   C1DUD8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44859"
FT                   /protein_id="ADO44859.1"
FT                   /translation="MWLLLLLLSLSFAHDLQHSLLREGNCIVLSFYFPDNTKFSYEKYE
FT                   VYKEDEKLPFQVGRTDALGRVVFCPDKRGEWTVRTTSEDGHGAIVKVRVDKASVKTESS
FT                   LFERYQKVFVGMGIVLGIFGALELYIRRVSWVRKFL"
FT   sig_peptide     457712..457750
FT                   /locus_tag="Hydth_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            458113..459162
FT                   /locus_tag="Hydth_0459"
FT   CDS_pept        458113..459162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_0741 hypothetical protein; SPTR:
FT                   C1DUD9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44860"
FT                   /protein_id="ADO44860.1"
FT                   /translation="MGKKVLMTALLCCGLSFAHHGVAALGAASLEGPGAPLETSSSATL
FT                   PEGSWLFYLKLDHVKWKKYSFQDFPDQKSTYDFWMYGLGYGVKPWLSLYLFVPYYVKKE
FT                   LKSINGDPTQGQYSYTNSDFADISLMAVLGFKYDRGFRLVPKKESLDDLMDWHFTLYGG
FT                   LSLPTGNPNKYDRARDPKGEFEPDMSTGFGKPAITLGFTATKQLVSLPRLTFVFDTNYI
FT                   KFFENTYNFRESPDAPRKKYKFGDEFRLNTALAYRLYTNAERKFRADALLEANFQYNQR
FT                   DKEDGVKLEGSGGKILYGVLGTRLYYKNISAGLGVKVPVWKKLNEESQQQGAEGKEKYR
FT                   LILTLSALF"
FT   sig_peptide     458113..458181
FT                   /locus_tag="Hydth_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            459174..459821
FT                   /locus_tag="Hydth_0460"
FT   CDS_pept        459174..459821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0460"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="COGs: COG0310 ABC-type Co2+ transport system
FT                   permease component; InterPro IPR002751; KEGG:
FT                   saf:SULAZ_0742 CbiM; PFAM: cobalamin (vitamin B12)
FT                   biosynthesis CbiM protein; SPTR: C1DUE0 CbiM; PFAM: Cobalt
FT                   uptake substrate-specific transmembrane region; TIGRFAM:
FT                   cobalamin biosynthesis protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44861"
FT                   /protein_id="ADO44861.1"
FT                   /translation="MHIPDGFVAPQVYVPAYLIDGLFLVYSFGKFRKALKEKTIPYIAS
FT                   LSLLSFVLMSVAVPLPGGTSVHSLGVASLSLLFGPWVAFLCVSLLLFLQAVVFGEGGIT
FT                   TFPINSIGMGLLGSFCAFYTYRVMRAFFSDKISLFLAGFLSTLFSALLIAVILGLHPHL
FT                   FKDASGKPLYFPFGFSVVIPALLLPHIIVGVGEGILTYLVVEFLKGRVGYEG"
FT   gene            459811..460383
FT                   /locus_tag="Hydth_0461"
FT   CDS_pept        459811..460383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0461"
FT                   /product="ABC type permease"
FT                   /note="KEGG: pmx:PERMA_0828 ABC type permease; SPTR: C0QPM0
FT                   ABC type permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44862"
FT                   /protein_id="ADO44862.1"
FT                   /translation="MKDKALFLLYITFLIWASSMHSVESLLAILLLLLVLLALLPVKAR
FT                   EKLRVLKRTFLSVFLFSLFVPLPYFVVGLFTGENRLDYLLMINARTFAMTMSTFMFLET
FT                   ANLFKALDFSKNLSLLLVLVSSHALSYARILKEFTDAFRSRSPSRRMKKEDTKHYLIRV
FT                   LSYFFDKSKETSEDIYTAMKSRGFYYD"
FT   sig_peptide     459811..459942
FT                   /locus_tag="Hydth_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            460376..461149
FT                   /locus_tag="Hydth_0462"
FT   CDS_pept        460376..461149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0462"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1122 ABC-type cobalt transport system
FT                   ATPase component; InterPro IPR003439:IPR017871:IPR003593;
FT                   KEGG: saf:SULAZ_0744 cobalt import ATP-binding protein CbiO
FT                   2; PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   A8V3F4 ABC transporter-related protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44863"
FT                   /protein_id="ADO44863.1"
FT                   /translation="MIELRGVYHSYDGEEVLRDINLTVKEGERVVLLGINGSGKTTLLK
FT                   ILNALILPQRGAYTYCGVRVDKSKLKDRDFVRSFRKEMVMLFQNPDVMLFNPTVYDELA
FT                   FSLRQLGFEEKQVEERVLHWADRFDLIEHLDKPPFKLSGGQKQKLCLACLLVLEPKILL
FT                   LDEPTANLDPRTTGWLIDLLYDLNITTIVSTHNLSLVPELGDRLVVLGEEHSIVYDGKI
FT                   ETFLRDEEKMLKAGLLHKHRHKHGDREHAHYHFHL"
FT   gene            complement(461140..461646)
FT                   /locus_tag="Hydth_0463"
FT   CDS_pept        complement(461140..461646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0463"
FT                   /product="peptide deformylase"
FT                   /note="COGs: COG0242 N-formylmethionyl-tRNA deformylase;
FT                   InterPro IPR000181; KEGG: sul:SYO3AOP1_0895 peptide
FT                   deformylase; PFAM: formylmethionine deformylase; SPTR:
FT                   B2V9A0 Peptide deformylase; TIGRFAM: peptide deformylase;
FT                   PFAM: Polypeptide deformylase; TIGRFAM: peptide
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44864"
FT                   /protein_id="ADO44864.1"
FT                   /translation="MRRLEILKYPDERLKIPSKEVSDFGKFFSEFLESLVFTMRSSPGC
FT                   VGIAAPQVNVHKRVIVVDTSISKHKENKLSHGLLVLVNPIILQREGEIVIREGCLSVPD
FT                   YTGNVKRHYWIKVSALDVKGNPVEFETEGFEAVVIQHEIDHLDGKVFLERLVSPKELFK
FT                   RKVYR"
FT   gene            complement(461643..462167)
FT                   /locus_tag="Hydth_0464"
FT   CDS_pept        complement(461643..462167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0464"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="COGs: COG2716 Glycine cleavage system regulatory
FT                   protein; InterPro IPR002912; KEGG: pmx:PERMA_0109 glycine
FT                   cleavage system regulatory protein; PFAM: amino
FT                   acid-binding ACT domain protein; SPTR: C0QT92 Glycine
FT                   cleavage system regulatory protein; PFAM: ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44865"
FT                   /protein_id="ADO44865.1"
FT                   /translation="MKFFILSIFGKDRPGIVAGVSEALYRLGLNIEDSSMTRLNGEFTI
FT                   MLIVSSERNITSENILESLKDVKEKFHLFTLCKEVQKLDQKEHKPTELYRLVVFGSDKP
FT                   GIVYSVSKLLAQMGINIYDLKTEKRGDLYVMIIQAESQEDVFEELSKKLDDIRESLRVD
FT                   ISLEREEEELL"
FT   gene            462182..462502
FT                   /locus_tag="Hydth_0465"
FT   CDS_pept        462182..462502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_0986 hypothetical protein; SPTR:
FT                   B4U961 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44866"
FT                   /protein_id="ADO44866.1"
FT                   /translation="MEEKDQLKFYISEIAKLMGLAQPVGFMLSYEVGDIWIDVYVERGE
FT                   DEWQNRTYTISVPKNKGDKLRNFVEAVGGNTSDMMADAERVYASLTQEDWEQVSTSIMN
FT                   LL"
FT   gene            462511..463365
FT                   /locus_tag="Hydth_0466"
FT   CDS_pept        462511..463365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0466"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="COGs: COG2084 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenase; InterPro
FT                   IPR016040:IPR013328:IPR006115:IPR008927; KEGG: aae:aq_038
FT                   3-hydroxyisobutyrate dehydrogenase; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding; SPTR: O66454
FT                   3-hydroxyisobutyrate dehydrogenase; PFAM: NAD binding
FT                   domain of 6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44867"
FT                   /protein_id="ADO44867.1"
FT                   /translation="MRIGFAGLGHLGKEIARRLISEGIELVVWNRTKEKALDLGVAIAD
FT                   TPADLIKQVDRVFLIVFDSQASEEVIFGKGGFVEGDVKGKTIIDMTTNHYAYAERAYQE
FT                   LKKYGAYYLDAPVLGSVVPAQKGQLVMLVGGDKEKYEENLPLFEKFCRKIYYVGKAGNG
FT                   TKLKLINNIVLGGFMELLAEAIAIGELAGFDRELLISILSEGAGKSYILDVKKQKLLDE
FT                   DFSTHFSVDLIYKDLHYAQDLLRDVKAFSFALQNVKEAYGKARSMGLGELDFSAVYKIF
FT                   KKT"
FT   gene            463413..464081
FT                   /locus_tag="Hydth_0467"
FT   CDS_pept        463413..464081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0467"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="COGs: COG0704 Phosphate uptake regulator; InterPro
FT                   IPR008170:IPR018054; KEGG: aae:aq_906 transcriptional
FT                   regulator (PhoU-like); PFAM: PhoU family protein; SPTR:
FT                   A8USU0 Transcriptional regulator (PhoU-like) protein;
FT                   TIGRFAM: phosphate transport system regulatory protein
FT                   PhoU; PFAM: PhoU domain; TIGRFAM: phosphate transport
FT                   system regulatory protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44868"
FT                   /protein_id="ADO44868.1"
FT                   /translation="MKLFEELEETKQLVLKMAGLIKNAVEKAIESLNKQDIELAESIIK
FT                   GDDEIDQLEVEIERRCIRMIALYQPEAIDLRLIMGIYKVVSDLERIGDEAENIAERAIL
FT                   LAQEPPLKPYVNLTLMAGHVKDMIEDAVMSFFQRDTELAKKVIARDDTVDELYHQLERE
FT                   LITYVMEDPRNIKKVINLSFVGRHFERMADHAENIAEMAVYWSEGEVIKHQHIKEKGMV
FT                   "
FT   gene            464078..465838
FT                   /locus_tag="Hydth_0468"
FT   CDS_pept        464078..465838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0468"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG5000 Signal transduction histidine kinase
FT                   involved in nitrogen fixation and metabolism regulation;
FT                   InterPro IPR003594:IPR005467:IPR003660:IPR003661:IPR
FT                   009082; KEGG: aae:aq_905 histidine kinase sensor protein;
FT                   PFAM: histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SPTR: A8USU1
FT                   Sensor protein; PFAM: HAMP domain; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44869"
FT                   /protein_id="ADO44869.1"
FT                   /translation="MRLYLTFLLIFLIFLGINIALLDNLRKVWQIGFPIILLVINIDLL
FT                   VLVIVFAIFFRKFIKVYLEGSKKRLRKKLSQALLLYIFVPILFLNFATSFILIQSTKTL
FT                   VSSQLKDVAQKAQILYESLKKREQERIKLYREFFAFLVSRGEDPRAYLRGLKEVESIEP
FT                   AKNCLENLMEDKAVMCIGGYRIVLKRDKETLGNINSLYYVSRQIRNLVKSRDVISSVYV
FT                   YFLVLITLITLLATVWFGNLVARYISLPLERLSSKVKEIAKGNFSIKVGVPYTGDEIQE
FT                   LSEAFERMRSELQRTYTKLENDKRMLEGLINALPVGVVYIHKDGSLMVNESFKKMFGEK
FT                   VKAEEDLAKIQNKAYIRQVAVESEEGKVFIYEDLQPVILSERFKTWQYAVKRIAHEIKN
FT                   PLTPISLNLERVLRLLEKEPLSKEKITESIRVVLEEIARIRDTINKFRDLSVEREPKLE
FT                   ELSLKDIIRDISKLYTGISVEVQGDKKVYADREMLRDMFLNLFNNSLEWHAKKVSINIR
FT                   EDALEYVDDGRGIEKGKEELIFIPYHSESPQGMGLGLAVVKHIAQVHGWSVKALHNPAG
FT                   FHLVVSFRPM"
FT   sig_peptide     464078..464143
FT                   /locus_tag="Hydth_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(465808..466257)
FT                   /locus_tag="Hydth_0469"
FT   CDS_pept        complement(465808..466257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_904 hypothetical protein; SPTR: A8USU2
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44870"
FT                   /protein_id="ADO44870.1"
FT                   /translation="MKNPFQEFTRYSEWKERFLKDRDRIKEINPKSSRLSEAIAAMYVG
FT                   GLEHRTQDEEIKKWTDWAGEKTYRTFNGFPQLSDEELSFLFYCLGKLFVPLLLHEKGVK
FT                   SESFKALTQEEQESAVSDVLDTIWENHIIRILQVLPYMGLKETTK"
FT   gene            complement(466254..466823)
FT                   /locus_tag="Hydth_0470"
FT   CDS_pept        complement(466254..466823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_1324 hypothetical protein; SPTR: A8USU3
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44871"
FT                   /protein_id="ADO44871.1"
FT                   /translation="MICLTHLELCPYCKRVALQVCEYDEPYPRVTAECQCCGYKAHDVP
FT                   MKLTREDFKSILDKLGRKLIGEVCIDDRCGSDKVLKLLQEGAYAEYRCLDCGAEWNSEE
FT                   IQRAINRVKRVQNALKNGNRLLEVLKAGEGECPLCGWDVGHIHVGYAVAIECFVCGYYS
FT                   KVEEIIPDVDLTTLECPEYERSEETG"
FT   gene            complement(466859..467950)
FT                   /locus_tag="Hydth_0471"
FT   CDS_pept        complement(466859..467950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0471"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095; KEGG: sul:SYO3AOP1_1123
FT                   transposase, IS605 OrfB family; PFAM: transposase IS605
FT                   OrfB; SPTR: A7BLI4 Transposase ISC1316; TIGRFAM:
FT                   transposase, IS605 OrfB family; PFAM: Putative transposase
FT                   DNA-binding domain; TIGRFAM: transposase, IS605 OrfB
FT                   family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44872"
FT                   /protein_id="ADO44872.1"
FT                   /translation="MQAKEIKRSLLFSLEFANAGKKKFLDQLWEEYKNALQYFVDKGFD
FT                   ERSLPSYEHVKTYSHKTWLSKRYLGCALLQAVDILKSVFQRKKKVNKPEVKKVSLKLDK
FT                   RFYRLERGNNSFNFWFLLRNPKDKNWVHFPVKNYRYAQKYFDEWKLSSGMELLKRDGKW
FT                   FLKLTFKKEVVLEERGPKGIDIGYRKLITLSDGQVFGREIKEIIEKKILPKKQGSKRFK
FT                   RVLDYLKTEVNRVLKQVIDGSFSPVLEKLKNLKRGKRGKWRRDINRRFNYWMYGYVLRR
FT                   IKELCEVAGVQWHIVPASYTSRTCPQCGYEDRANRDGEWFHCLNCGYENDADVVGAVNI
FT                   LWRFGREPIVPYPAKPPSVSLNL"
FT   gene            complement(468011..468943)
FT                   /locus_tag="Hydth_0472"
FT   CDS_pept        complement(468011..468943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0472"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="COGs: COG0331 (acyl-carrier-protein)
FT                   S-malonyltransferase; InterPro
FT                   IPR001227:IPR014043:IPR004410:IPR016035:IPR 016036; KEGG:
FT                   aae:aq_892 malonyl-CoA:acyl carrier protein transacylase;
FT                   PFAM: Acyl transferase; SPTR: O67041 Malonyl-CoA:Acyl
FT                   carrier protein transacylase; TIGRFAM: malonyl CoA-acyl
FT                   carrier protein transacylase; PFAM: Acyl transferase
FT                   domain; TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44873"
FT                   /protein_id="ADO44873.1"
FT                   /translation="MGKIAYIFPGQGSQYVGMGYDFYREFSEASDVFHSAEVALRYNLT
FT                   DIIFKGPEDELNKTINTQPALLTVSLAIYAVLKANGLPKADFVAGHSLGEYTALAVVGG
FT                   VELFEAVRLAYLRGKYMQEAVPEGVGAMVAVLKLSPEKVEEACRLASDVGVVEPANYNS
FT                   PEQVVISGERQAVEKASQIVKEMGGKVISLKVSVPSHCSLMKPAADAFRLKLAQTPIKN
FT                   IDLPLVQNYTAKAHTMAHEIRENLYRQIFSSVRWYQSLQYMAEQGVDTFVEIGPKNVLS
FT                   KLVVQTLPHARVMNVEKVEDVEKVIKALR"
FT   gene            complement(468947..469132)
FT                   /locus_tag="Hydth_0473"
FT   CDS_pept        complement(468947..469132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0473"
FT                   /product="putative transposase DNA-binding domain family"
FT                   /note="KEGG: saf:SULAZ_0952 putative transposase
FT                   DNA-binding domain family; SPTR: C1DUY8 Putative
FT                   transposase DNA-binding domain family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44874"
FT                   /protein_id="ADO44874.1"
FT                   /translation="MEGTLVNGTKSKPYMGKDTPGRVPFPLVSIHQKLLETSYLKPKSL
FT                   IKYSHADKYELGKMER"
FT   gene            complement(469180..471513)
FT                   /locus_tag="Hydth_0474"
FT   CDS_pept        complement(469180..471513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0474"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="COGs: COG1067 ATP-dependent protease; InterPro
FT                   IPR001984:IPR008269:IPR020568; KEGG: pmx:PERMA_0008
FT                   peptidase S16, lon domain protein; PFAM: peptidase S16 lon
FT                   domain protein; SPTR: C0QSZ1 Peptidase S16, lon domain
FT                   protein; PFAM: Lon protease (S16) C-terminal proteolytic
FT                   domain; TIGRFAM: lon-related putative ATP-dependent
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44875"
FT                   /protein_id="ADO44875.1"
FT                   /translation="MALKKLSADELFLSFSYNRGTGDVSPVELFPGQDRVEKAFDLALS
FT                   SSSDGYNVFVSGPESVGRTVYTLKRLKEASQNKPPPEDVCYVNNFENPLRPLYLLLPAG
FT                   MGKKLSQNIDRAIEDLKEALPKAFESKEYEDEIAKINKMADQQRERILQELGEEAQRHN
FT                   LGVLFTPAGIRLLPIMGRRLVSEEELLSNEKLQEAYERNLSAFEERFREFMRKLRELDH
FT                   NVADQILDLRRRVAYYVVEKVFSRFENGYKSHEHVRNFINRLKEEIVKSADLFMLWHTS
FT                   KGNLAAMRSLERAFNAFRVNVIVDNSDLKGLPVVHEEVPTLQNLFGRVSYTVEMGVLQA
FT                   DHMSISAGSLHRARGGYLVLRAIDLLKNPYLWNAFKKVLMHKKIHMAGGVLEDSLLPYV
FT                   GISPEPVPADIKVFLIGDPLLYQLLSLYDPEFNRLFKVKAEFNPIIDLNEDFVESFPKI
FT                   IKKIIVDEGIKDLTAEALSELLRYAVTLSGSRKKVSLLMGYIVDVIREANTLSGDSQSI
FT                   DAKHIKRAIEEKIYRSNLIEEKIRKAIEEGKIIVKVDGRHTGQVNGLSVYELGDISFGK
FT                   PSRISASVYIGEKGVINIEREVELSGPIHSKGVLILTGYIGNKYGKDFPIHLSCNITFE
FT                   QSYEEVEGDSASVAELIAILSAISGIPVRQDIAITGSVDQHGNIQPVGGIKEKVEGFYK
FT                   VCKVLGLTGQQGVVVPSRNYDNLILDDELIDHVKAGRFHIYTAESVDDVIELMFDMKAE
FT                   KFHKLVSKKLYEFYKKVAKPKEKG"
FT   gene            complement(471515..471835)
FT                   /locus_tag="Hydth_0475"
FT   CDS_pept        complement(471515..471835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0475"
FT                   /product="protein of unknown function DUF77"
FT                   /note="COGs: COG0011 conserved hypothetical protein;
FT                   InterPro IPR002767:IPR016198; KEGG: aae:aq_2067
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF77; SPTR: O67847 Putative uncharacterized protein; PFAM:
FT                   Domain of unknown function DUF77; TIGRFAM: conserved
FT                   hypothetical protein TIGR00106"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44876"
FT                   /protein_id="ADO44876.1"
FT                   /translation="MSFIVFVSMTPLGKEESVSKYVARVVDIVDKSGLDYVLTPMGTIV
FT                   EGEDWDQVMEVLKKGFEALKTDCNRISIVMKIDYRKGRTKGLVSKVRAVEEKVGRDIKK
FT                   AM"
FT   gene            complement(471852..472823)
FT                   /locus_tag="Hydth_0476"
FT   CDS_pept        complement(471852..472823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0476"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="COGs: COG1559 periplasmic solute-binding protein;
FT                   InterPro IPR003770; KEGG: aae:aq_775 hypothetical protein;
FT                   PFAM: aminodeoxychorismate lyase; SPTR: A8UTF2 Putative
FT                   uncharacterized protein; PFAM: YceG-like family; TIGRFAM:
FT                   conserved hypothetical protein TIGR00247"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44877"
FT                   /protein_id="ADO44877.1"
FT                   /translation="MKLLKFLAPLSLIVAYIFYSFLPVSLEKKTVEIPYGMPSTDIAWY
FT                   LYREGVIRSPVSFLFIHTIKKGRLEAGEYEFDGLVFPWDVYRKIHYGFRKTYKITIPEG
FT                   SDVYDIASVLDSYKICKAEDFLKYALSPKTAQNYGLNTFSMEGFLFPDTYLFSKNTHPL
FT                   TVISVMYRNFLKKTEPLRRELEKSGMSLEEWVTIASLIEKETALKEERPLVSAVIHNRL
FT                   KKGMKLQIDPTVIYAMKRKGIWNGKLSSKDLDIDDPYNTYAYFGLPPSPICNPGLDSLE
FT                   SALRPAKVNYLYFVANGNGGHRFSSTYSEHLANVKAYIELKK"
FT   sig_peptide     complement(472749..472823)
FT                   /locus_tag="Hydth_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(472820..473221)
FT                   /locus_tag="Hydth_0477"
FT   CDS_pept        complement(472820..473221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0477"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="COGs: COG0816 endonuclease involved in recombination
FT                   (possible Holliday junction resolvase in Mycoplasmas and B.
FT                   subtilis); InterPro IPR005227:IPR006641:IPR012337; KEGG:
FT                   aae:aq_1498 hypothetical protein; PFAM: Holliday junction
FT                   resolvase YqgF; SMART: Resolvase RNase H domain protein
FT                   fold; SPTR: O67469 Putative Holliday junction resolvase;
FT                   PFAM: Uncharacterised protein family (UPF0081); TIGRFAM:
FT                   conserved hypothetical protein TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44878"
FT                   /protein_id="ADO44878.1"
FT                   /translation="MKVLALDYGSKRIGLALGDTSLNIASPLGVFENREGVVEKIRNLI
FT                   SEYRVSLLIVGLPLTPRGQKGQRAKEVEEFVKKLRESLPEEIELLMWDERYTTKEAYWL
FT                   LQDLPPTKRKKLKDSLSAYIILKEYLESL"
FT   gene            complement(473218..473403)
FT                   /locus_tag="Hydth_0478"
FT   CDS_pept        complement(473218..473403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_0914 hypothetical protein; SPTR:
FT                   A8UTF4 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2892)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44879"
FT                   /protein_id="ADO44879.1"
FT                   /translation="MEKNMATWDRAVRVLLGIIFLYLAFTKGGAWWILGIIGIVFIGTS
FT                   AVGFCPLYKVLGFKTG"
FT   gene            complement(473436..473888)
FT                   /locus_tag="Hydth_0479"
FT   CDS_pept        complement(473436..473888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4353 conserved hypothetical protein;
FT                   InterPro IPR008304; KEGG: aae:aq_1966 hypothetical protein;
FT                   PFAM: conserved hypothetical protein; SPTR: O67778 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1122)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44880"
FT                   /protein_id="ADO44880.1"
FT                   /translation="MNAFEEFIETLKEGIVCKGKRLYLSKRDKGRFAEEENLTLSLDER
FT                   SLLFAKVFYGRKPYWREWIELFNIEPEFFSSPFEDELYQLISRHFGRIFVEYYEDRETS
FT                   FQLEKGVPAENTRLGQKLIKCGYKYLRNWYYPEGWMEGGQKLQGEK"
FT   gene            complement(473875..475101)
FT                   /locus_tag="Hydth_0480"
FT   CDS_pept        complement(473875..475101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0480"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="COGs: COG0124 Histidyl-tRNA synthetase; InterPro
FT                   IPR004516:IPR004154:IPR006195:IPR002314:IPR 015807; KEGG:
FT                   aae:aq_122 histidyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Anticodon-binding domain protein;
FT                   PRIAM: Histidine--tRNA ligase; SPTR: A8UW82 Histidyl-tRNA
FT                   synthetase; TIGRFAM: histidyl-tRNA synthetase; PFAM:
FT                   Anticodon binding domain; tRNA synthetase class II core
FT                   domain (G, H, P, S and T); TIGRFAM: histidyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44881"
FT                   /protein_id="ADO44881.1"
FT                   /translation="MAEFQSVRGFHDIFGQELKKFRYVSDTVRSLLKLYNFEEIILPVV
FT                   EYLEVFQRSIGEVTDIVQKEMFVFQDRKGRWLALRPEGTAGAVRAYIQNRLYALKPYVK
FT                   LFYEGPMFRYERPQAGRYRQFHQIGAEVFGTLDPQVDAQMIEMVHTILTKLGISATIEI
FT                   NSIGCRVCRPSYKKALSDYLEDVVGHLCDVCLDRKDKNPLRVLDCKVETCKEAVKQAPK
FT                   MVDYLCQECATHYETLKSYLDMLSIPYRENHHLVRGLDYYTKTVFEAVSDELGITIIAG
FT                   GRYDYLVEEMGGPPTPAIGFAVGIERISMLVKDLPQEEPLYMVIPFGDTLDYAFEVIKK
FT                   LRDMGKRVETSYKKANLKKQLELANKLKADYVVLIGEDEKRQNTITIKNMHTGMQESIS
FT                   FLELAHERL"
FT   gene            475151..476137
FT                   /locus_tag="Hydth_0481"
FT   CDS_pept        475151..476137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0481"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="COGs: COG0113 Delta-aminolevulinic acid dehydratase;
FT                   InterPro IPR001731:IPR013785; KEGG: aae:aq_2109
FT                   delta-aminolevulinic acid dehydratase; PFAM:
FT                   delta-aminolevulinic acid dehydratase; PRIAM:
FT                   Porphobilinogen synthase; SPTR: O67876 Delta-aminolevulinic
FT                   acid dehydratase; PFAM: Delta-aminolevulinic acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44882"
FT                   /protein_id="ADO44882.1"
FT                   /translation="MEFPKLRPRRLRSNESIRRLVRETKLSLDDLICPVFVRYGEGIEE
FT                   EVPSMPGVFRYSPDKVIDEVKKIRDLGIPAIILFGIPEHKDEVGSDTWSKEGIIQRTVR
FT                   LIKKEVPDIYVITDVCFCEYTTHGHCGVLKNHHVDNDATLENLKKQAVSHAESGADMLA
FT                   PSGMMDGMVKAIRSALDEANFYEIPIMAYSAKFASAFYGPFRDAAQSAPAFGDRRTYQM
FT                   DPSNAREALKEVLLDLQEGADIVMVKPALSYLDIIYRVKEATLLPVCAYNVSGEYSMIK
FT                   AAGKLGWIDERKVMWEVLTSIKRAGADMIITYFAKDVAILINRGELA"
FT   gene            476134..477435
FT                   /locus_tag="Hydth_0482"
FT   CDS_pept        476134..477435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0482"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="COGs: COG0621 2-methylthioadenine synthetase;
FT                   InterPro IPR013785:IPR002792:IPR013848:IPR007197:IPR
FT                   005839:IPR006463:IPR006638; KEGG: aae:aq_284 hypothetical
FT                   protein; PFAM: Protein of unknown function UPF0004 ;
FT                   Radical SAM domain protein; deoxyribonuclease/rho
FT                   motif-related TRAM; SMART: Elongator protein 3/MiaB/NifB;
FT                   SPTR: O66638 (Dimethylallyl)adenosine tRNA
FT                   methylthiotransferase miaB; TIGRFAM: RNA modification
FT                   enzyme, MiaB family; tRNA-i(6)A37 thiotransferase enzyme
FT                   MiaB; PFAM: TRAM domain; Radical SAM superfamily;
FT                   Uncharacterized protein family UPF0004; TIGRFAM:
FT                   tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme
FT                   MiaB; RNA modification enzyme, MiaB family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44883"
FT                   /protein_id="ADO44883.1"
FT                   /translation="MKYYIKTFGCQMNFNDSERIKGMLQTLGYQEAKDWQEADIILINT
FT                   CTIREKPDQKVFSHLGEYKKLKEQNPKALIGVCGCLAQRMGFELIQKSPVVDIMFSSFN
FT                   MHQLPELIQQAQAGYKAVAILENPPDDEDKLWDYPTVRDNPYCAYVTVMKGCDKNCTYC
FT                   VVPKTRGRQRSRSLESILKEVRDLVSDGVKEVHLLGQNVTAWGKDIGKHFSELLYRVAE
FT                   IDGVERIRFTTGHPKDLDEGIAKAMGEIKKVCEHIHLPFQAGSDRILKLMDRGYTKEEY
FT                   LEKISMLKEYVKGITFSTDVIVGFPTETEEDFEETLDMLKKVRFEQVFSFKFSPRPDTP
FT                   AYSMEGQVPDQVKTQRMSRLLQLQKEIMGEVAKSYEGTIQEVLIESIEHGNKLIGRTRT
FT                   NRWVSMEGGVEMLGKVVKVKVIRSYPFNMECELV"
FT   gene            477449..477931
FT                   /locus_tag="Hydth_0483"
FT   CDS_pept        477449..477931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0483"
FT                   /product="protein of unknown function DUF151"
FT                   /note="COGs: COG1259 conserved hypothetical protein;
FT                   InterPro IPR003729; KEGG: aae:aq_283 hypothetical protein;
FT                   PFAM: protein of unknown function DUF151; SPTR: A8URN5
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   ACR, COG1259"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44884"
FT                   /protein_id="ADO44884.1"
FT                   /translation="MIEMVVHGVTLDPVSQMPIVVLRAKDNEEVLLPIWIGIFEADSIV
FT                   RELQKIEPPRPMTYELLKSIVQQMGGVVEKIVITDLRDSTYYAEVHILHGSNTLIVDSR
FT                   PSDAINLALRFEAPIYVEPEVLEKSKVPKPEEDEEKQHLREWLENIKPEDFEKGLS"
FT   gene            complement(477923..478354)
FT                   /locus_tag="Hydth_0484"
FT   CDS_pept        complement(477923..478354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_935 hypothetical protein; SPTR: A8UW21
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44885"
FT                   /protein_id="ADO44885.1"
FT                   /translation="MRSWVYYIQLRAYYQDGTFREEGALYVVAIPDEEKLKDVDMECYA
FT                   KEYLPQQTALSSARAYAVGTDIAIKDISPYQLAGYRKDMDLYVFKEGIGFEEGLSRVFK
FT                   ILLDHLAESGEIKMVEPVIDVGTPSADVMYACLKKALST"
FT   gene            complement(478356..478997)
FT                   /locus_tag="Hydth_0485"
FT   CDS_pept        complement(478356..478997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0485"
FT                   /product="peptidase M50"
FT                   /note="COGs: COG1994 Zn-dependent protease; InterPro
FT                   IPR008915; KEGG: aae:aq_1853 hypothetical protein; PFAM:
FT                   peptidase M50; SPTR: A8UT92 Putative uncharacterized
FT                   protein; PFAM: Peptidase family M50"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44886"
FT                   /protein_id="ADO44886.1"
FT                   /translation="MDLREAVITIPAIMMAVILHEYAHGWMAYKMGDATAKEAGRLTIN
FT                   PIPHIDLFGTIILPAMFILVGSPILFGWAKPVPINPLRFRDLKLGTFFVSTAGIGMNLL
FT                   LALLSGFFYRLIDAGYLDFLGSAVVLPLAIFCAKSVLINVVLAVFNAIPIPPLDGSRAL
FT                   MSFFSIKYWELFYRFEMYGFLIITLLLFTGVLGRIIYPPILFLYNLFLGS"
FT   gene            479038..479787
FT                   /locus_tag="Hydth_0486"
FT   CDS_pept        479038..479787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0486"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro
FT                   IPR002347:IPR002198:IPR016040:IPR011284; KEGG: aae:aq_1716
FT                   3-oxoacyl-[acyl-carrier-protein] reductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR: O67610
FT                   3-oxoacyl-[acyl-carrier-protein] reductase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase; PFAM: short
FT                   chain dehydrogenase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44887"
FT                   /protein_id="ADO44887.1"
FT                   /translation="MFCIDLSGKRALITGSTRGIGKSIAEHLAKAGASVIITGRDKAKA
FT                   EEVAKELNQKYSTQAFGIELRLDDPQSIKSGYEQVEKLIEGVDILVNNAGITKDKLFLR
FT                   MSLEDWEEVIKVNLTGTFFITSLAIKSMLKNRWGRVINISSVVGFMGNVGQVNYSSTKA
FT                   GLVGFTKSLAKELASRNITVNAVAPGFIETDMTAVLSEDIKQNYLKNIPLGRFGKPEDV
FT                   AGAVLFLCSSLADYITGEVLHVNGGMY"
FT   gene            479791..481389
FT                   /locus_tag="Hydth_0487"
FT   CDS_pept        479791..481389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0487"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="COGs: COG0550 Topoisomerase IA; InterPro
FT                   IPR000380:IPR013824:IPR013826:IPR006171:IPR
FT                   013497:IPR005733:IPR006154:IPR003601:IPR003602; KEGG:
FT                   aae:aq_657 topoisomerase I; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain protein; PRIAM: DNA
FT                   topoisomerase; SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain protein;
FT                   SPTR: A8UWF0 DNA topoisomerase; TIGRFAM: DNA topoisomerase
FT                   I; PFAM: Toprim domain; DNA topoisomerase; TIGRFAM: DNA
FT                   topoisomerase I, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44888"
FT                   /protein_id="ADO44888.1"
FT                   /translation="MNLFIVESPTKAKSIAKYLGNGWVVRATLGHIKDLPERELGVDIK
FT                   TLEPKYVWLKGKKKIVDGIKKAAKKAKKIYLGTDPDREGEAIAYFLKEELLKVNTSIYR
FT                   ATFYEITKKAITEAIGGASDINLNLVSAQFSRRVLDRLIGYKLSPFLWRDLKERGLSVG
FT                   RVQSPTLRLIVERERQIQNFKRKKYYYIKAEFVVDGVEFSAVFKQRFEKPSNAEPFMKK
FT                   LKDVMFVVKSVSKEMQKEPPPKPFNTVSLQAEASKILGISVDKVQKMAQKLYEEGLITY
FT                   PRTDSYRMNKEKAQEFMKYIERTYGKDYVGRLRKYKEKALAWGAHECIRPTSLDKKPES
FT                   VLELKLWSLISSRALASLSSDAIREKFFVVLLALSDHTLEFTAEGSKLVFDGWTRIYPK
FT                   EVKDRALPHLEEGQVIKPKRIYIEEVEVPPPPRYTEGSLVRTLENLGIGRPSTYATIIK
FT                   TLKDRGYVVLEKGYLKPTEMAFKVVDYLMEKFPNLMDYGFTKYMEDNLDAVEEGKKDWK
FT                   EVVRESYRRVLNAKE"
FT   gene            481376..482371
FT                   /locus_tag="Hydth_0488"
FT   CDS_pept        481376..482371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0488"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="COGs: COG1397 ADP-ribosylglycohydrolase; InterPro
FT                   IPR005502; KEGG: aae:aq_534 ADP-ribosylglycohydrolase;
FT                   PFAM: ADP-ribosylation/Crystallin J1; SPTR: A8USF8
FT                   ADP-ribosylglycohydrolase; PFAM: ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44889"
FT                   /protein_id="ADO44889.1"
FT                   /translation="MLRSKFRGTLLGAALGDAIGKCVEDITKEEVYDFYGSRVEGFVEP
FT                   HPLSPSYGSHPEEISDETKITLILLESVVDKKAIDPQDFYKRLILWREDEKSHRYPDPA
FT                   LLTALDLLSSGISLEEAGFSSASVEGILRCIVVGLFHFYNPLLASEGARLVSIMTHRSP
FT                   EVYDASAVLAVMISNLIRDAYHLDNLDERVKLLEELKLFVKHDRHKTYLDRVAELLQEG
FT                   ADLERAINTLGNSTYVFESLPLSLFIFLSNIDEPMKALWDAVNSYGDFGGDTDAIGYLV
FT                   GAYLGAYLGQEIFPLDLVENLENSGYYISLADKLYHVVEEHIERRLQDAL"
FT   gene            482361..482603
FT                   /locus_tag="Hydth_0489"
FT   CDS_pept        482361..482603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0489"
FT                   /product="RNA chaperone Hfq"
FT                   /note="COGs: COG1923 Uncharacterized host factor I protein;
FT                   InterPro IPR001163:IPR005001:IPR010920; KEGG: aae:aq_108b
FT                   host factor I; PFAM: Like-Sm ribonucleoprotein core; SPTR:
FT                   A8USF7 Host factor I; TIGRFAM: RNA chaperone Hfq; PFAM: LSM
FT                   domain; TIGRFAM: RNA chaperone Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44890"
FT                   /protein_id="ADO44890.1"
FT                   /translation="MPYKLQESFLNTARKRRVKVTIYLVNGVRLQGRVRSFDLYTILIE
FT                   DGRQQTLVYKHAITTIIPAEKLEIEFEEEGVPGAV"
FT   gene            complement(482616..482948)
FT                   /locus_tag="Hydth_0490"
FT   CDS_pept        complement(482616..482948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0490"
FT                   /product="Sucraseferredoxin family protein"
FT                   /note="COGs: COG3411 Ferredoxin; InterPro
FT                   IPR012335:IPR009737:IPR012336; KEGG: hya:HY04AAS1_1394
FT                   putative ferredoxin 2Fe-2S protein; PFAM: Sucraseferredoxin
FT                   family protein; SPTR: A8USF6 Ferredoxin, 2Fe-2S; PFAM:
FT                   Respiratory-chain NADH dehydrogenase 24 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44891"
FT                   /protein_id="ADO44891.1"
FT                   /translation="MNFKHLFICVNQRPPGHPMGSCAEKGSRDIYQKFMEKLQMDPELF
FT                   MSVVITPTGCLGPCGMGPTMVVYPDGVWYGNVRPEDVEEIVNNHLKNDQPVERLVVSKG
FT                   KPPGMF"
FT   gene            complement(483016..484989)
FT                   /locus_tag="Hydth_0491"
FT   CDS_pept        complement(483016..484989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0491"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG0210 Superfamily I DNA and RNA helicase;
FT                   InterPro IPR014016:IPR014017:IPR000212; KEGG: aae:aq_793
FT                   ATP-dependent DNA helicase REP; PFAM: UvrD/REP helicase;
FT                   SPTR: O66983 ATP-dependent DNA helicase REP; PFAM: UvrD/REP
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44892"
FT                   /protein_id="ADO44892.1"
FT                   /translation="MLNPSQERAVKHFGKPLLIVAGAGSGKTKTLTYKLEHLVVKRGLR
FT                   QDRILILTFTNKAAREIRERIVKLTNKEVPWAGTFHSIALKILRQEGYKMGIDPSFSII
FT                   DEDDRKKILKEVLRRMNLSKDMLEVANNYITSRRESLREPEDSTLEEVYRQYSSVLKSR
FT                   NFLDFSELLFKTYQLLKNYSDGWRDFFEFVMVDEFQDTNIIQYEMVKLLAKENICVVGD
FT                   PNQCIYEWRYARPDNMLKFVEDFKPDIIKLEYNYRSKAHIIAVANAVLSASKAQWKSLT
FT                   PVLKPVRDGEEKPVVRRFSDPLEESLWIAREIKRLLSRYKPQDIAILVRALYLTDIFER
FT                   TFFNARIPYKIVGSVKFFERAEIKDVLAFLKLMVNPSDELSFKRCLENVQIGERTFAII
FT                   KRFHQGDWIASSILAIKHMSEEKSKRLYHLIRNLIKLKQSIDEYPTALWEILEHVGYLN
FT                   YMQVKYQKDYKEREENIKELFRFLEEKKKEGASVLEVLEEVMLISQEEETAQAVNIMTI
FT                   HASKGLEFPVVFLPRLEEGILPHEKSKEDIQELEEERRLFYVAITRAKDMLYMTYTRDK
FT                   NSKPSRFLSDIPKEHLDLSSFKVKKTTYSLELKRNNLKVGDMVIHRVFGKGKVIALEEE
FT                   RATVDFGDKVKTIHTDFLEPIG"
FT   gene            complement(485001..486092)
FT                   /locus_tag="Hydth_0492"
FT   CDS_pept        complement(485001..486092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0492"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095; KEGG: sul:SYO3AOP1_1123
FT                   transposase, IS605 OrfB family; PFAM: transposase IS605
FT                   OrfB; SPTR: A7BLI4 Transposase ISC1316; TIGRFAM:
FT                   transposase, IS605 OrfB family; PFAM: Putative transposase
FT                   DNA-binding domain; TIGRFAM: transposase, IS605 OrfB
FT                   family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44893"
FT                   /protein_id="ADO44893.1"
FT                   /translation="MQAKEIKRSLLFSLEFANAGKKKFLDQLWEEYKNALQYFVDKGFD
FT                   ERSLPSYEHVKTYSHKTWLSKRYLGCALLQAVDILKSVFQRKKKVNKPEVKKVSLKLDK
FT                   RFYRLERGNNSFNFWFLLRNPKDKNWVHFPVKNYRYAQKYFDEWKLSSGMELLKRDGKW
FT                   FLKLTFKKEVVLEERGPKGIDIGYRKLITLSDGQVFGREIKEIIEKKILPKKQGSKRFK
FT                   RVLDYLKTEVNRVLKQVIDGSFSPVLEKLKNLKRGKRGKWRRDINRRFNYWMYGYVLRR
FT                   IKELCEVAGVQWHIVPASYTSRTCPQCGYEDRANRDGEWFHCLNCGYENDADVVGAVNI
FT                   LWRFGREPIVPYPAKPPSVSLNL"
FT   gene            486179..487378
FT                   /locus_tag="Hydth_0493"
FT   CDS_pept        486179..487378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_271 hypothetical protein; SPTR: A8UST2
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44894"
FT                   /protein_id="ADO44894.1"
FT                   /translation="MKIAFLKTGNETGPNRHILALLRHFQNKGLQVKEFDLTNGDIQQT
FT                   VNQMLEFSPTFSLDVNATGVIVGQQGEERIPICDAFGFVHVSIFTDDPLLYFPTLLDMR
FT                   TANNFLPVLCDLKYMDSLRMLGINKGLFYITPFVEREFMREPQGEKDIEVVFVGPVSDP
FT                   EVLAKQVINNLQEHLIPFFFEVAEFMFRNPEVSVHVASEYILSMFHQNLQEEINKWRNE
FT                   KPEEYLRLLNDISIYATSKKRWYLLSFLDGIDLKIVGEFQGELREGHEILPTSSYEDFL
FT                   EVLGRSYMAILSFPFSVPSGIGFTPLEVGFMGCAPLIDYRMTLQGFLTPGSECITYLPL
FT                   DRADIEEKILYYLEHPDEALSIGQSVRQKVLQKFTPEDRGDFLISVFEQILEGVKKSSE
FT                   "
FT   gene            487378..488034
FT                   /locus_tag="Hydth_0494"
FT   CDS_pept        487378..488034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0494"
FT                   /product="protein of unknown function DUF554"
FT                   /note="COGs: COG1811 Uncharacterized membrane protein
FT                   possible Na+ channel or pump; InterPro IPR007563; KEGG:
FT                   hya:HY04AAS1_0471 protein of unknown function DUF554; PFAM:
FT                   protein of unknown function DUF554; SPTR: A8UST3 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF554)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44895"
FT                   /protein_id="ADO44895.1"
FT                   /translation="MFPGFGTLVNASLILLGSFVGLRASRYIPTSLKDGAINAIGLFTL
FT                   MLGVKLLYENKPETLKVFFTILIGSALGHLAKIEESLHELLKNRGGDSLSGFVSASVLF
FT                   TVGPMTLLGCILEGTKGDSTLILSKAFMDGFSSIILSSSLGKSVAFSAFFVLIFQGSLT
FT                   MLAFYLGSFLPKDSMSNALFVGGGLMLLTGAKILGLLERIKVLNFFPSLFISLLV"
FT   sig_peptide     487378..487449
FT                   /locus_tag="Hydth_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(488130..489395)
FT                   /locus_tag="Hydth_0495"
FT   CDS_pept        complement(488130..489395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0495"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="COGs: COG3259 Coenzyme F420-reducing hydrogenase
FT                   alpha subunit; InterPro IPR001501:IPR018194; KEGG:
FT                   pmx:PERMA_0690 nickel-dependent hydrogenase, large subunit;
FT                   PFAM: nickel-dependent hydrogenase large subunit; SPTR:
FT                   C0QP83 Nickel-dependent hydrogenase, large subunit; PFAM:
FT                   Nickel-dependent hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44896"
FT                   /protein_id="ADO44896.1"
FT                   /translation="MEVKIKALTRVEGEGALDIVLDKDQIKDLKLRIYEPPRYFEEILR
FT                   GKPYHFIPDVTARICGICPVAYQMSGVQAVEDAFGIEVPEDILLLRRLMYYGEWIQSHA
FT                   IHIFFLHLPDFYGVSSIAQLAKVDRELVQGGLRLREVGSKIIQMLGGRTSHPVSVTVGG
FT                   FHSLPEHPSVSCKDIEEAIDICYRLLEKLKHLKFPHFELKNILFVSLTDEDYPILSGDI
FT                   LTSEGEVINKKEFKEYFVEYAVHYSTAKHARTKGGSIYVVGPLARFNNNYQKLSPLATE
FT                   YAHKLPIKFPELNPYKSILIRMVEILHSLERSHQIIRDYKKPEVIKVSYQVKAGEGFGV
FT                   SEAPRGILWHSYQFDQQGNILKADIVPPTSQNQDAMEHSLKERCNQLKKEESIIREEAE
FT                   KLIRSFDPCISCATHFLKVNII"
FT   gene            complement(489386..490066)
FT                   /locus_tag="Hydth_0496"
FT   CDS_pept        complement(489386..490066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0496"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="COGs: COG1941 Coenzyme F420-reducing hydrogenase
FT                   gamma subunit; InterPro IPR006137; KEGG: saf:SULAZ_0894
FT                   putative [NiFe] hydrogenase, delta subunit; PFAM: NADH
FT                   ubiquinone oxidoreductase 20 kDa subunit; SPTR: C1DUT4
FT                   Putative [NiFe] hydrogenase, delta subunit; PFAM: NADH
FT                   ubiquinone oxidoreductase, 20 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44897"
FT                   /protein_id="ADO44897.1"
FT                   /translation="MKIGVFKFSSCDGCQIVFFELEHMLRYLEKLQVLYFLEAQSENHY
FT                   GEFDISFVEGSVSNREDEERILDIRRRSGMLVAIGACAISGGVQSAGNFEGIIKSEPID
FT                   AFVKVDYQLPGCPINKEILENFLKSILHGKSPYVPEYPVCLECKRRGAVCITVAKGEVC
FT                   LGPITRAGCGAICPSFERGCYGCYGPVHKPNLESFLAYFPQAYQTIKLSANAYNKIYRE
FT                   KLWK"
FT   gene            complement(490063..490623)
FT                   /locus_tag="Hydth_0497"
FT   CDS_pept        complement(490063..490623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0497"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="COGs: COG0218 GTPase; InterPro
FT                   IPR001806:IPR002917:IPR019987:IPR005225; KEGG: aae:aq_1815
FT                   hypothetical protein; PFAM: GTP-binding protein
FT                   HSR1-related; SPTR: A8URN8 Putative uncharacterized
FT                   protein; TIGRFAM: ribosome biogenesis GTP-binding protein
FT                   YsxC; small GTP-binding protein; PFAM: GTPase of unknown
FT                   function; TIGRFAM: ribosome biogenesis GTP-binding protein
FT                   YsxC/EngB; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44898"
FT                   /protein_id="ADO44898.1"
FT                   /translation="MKVEFLGSYREDLPKDHFKEVVFVGRSNVGKSSLINMLVGEPVAR
FT                   VSKEPGRTRSINAFLLEGRIKLVDVPGYGFAKVSKAERESWKRLIESYFRERRQNIRCV
FT                   FVLIDSKVGPTDLDKLMIEWLRHINIPYKVVLTKTDKASQKELSKSLELLKVVGVNEVI
FT                   ITSAKEGKGKKELYRSILEVVEG"
FT   gene            complement(490620..491849)
FT                   /locus_tag="Hydth_0498"
FT   CDS_pept        complement(490620..491849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0498"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /note="COGs: COG0285 Folylpolyglutamate synthase; InterPro
FT                   IPR013221:IPR004101:IPR018109:IPR001645; KEGG: aae:aq_2045
FT                   folylpolyglutamate synthetase; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein; PRIAM: Tetrahydrofolate synthase; SPTR:
FT                   O67833 Folylpolyglutamate synthetase; TIGRFAM: FolC
FT                   bifunctional protein; PFAM: Mur ligase family, glutamate
FT                   ligase domain; Mur ligase middle domain; TIGRFAM:
FT                   folylpolyglutamate synthase/dihydrofolate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44899"
FT                   /protein_id="ADO44899.1"
FT                   /translation="MLLYNLYRGKDYHIVPTLERIQKASQFLGLERLPYTSLQVGGTNG
FT                   KGSTCAFSEMILRQHGYKTGWFVSPHLVEEEERWRINGEKMPSEVLEEYVRELKPIFEK
FT                   FELTYFEACTLIALEYFKDQKVDVAVFEVGMGGRWDATRVCNPSVCVITNVERDHTKWL
FT                   GRDVESRAVEKLGIYRKGFPLVLGSMKFPLYSKALDLCDDRDLIVGGIDFFSYGRVSRY
FT                   ETLLEHYEWKDIRLENVPLGLWGKWQIGNASLAITAASCLIKPDLKRLKQALQNTRWEG
FT                   RMEIVRREPLLVLDGAHNTDSIKKVVREVKRYMGSLTPVFTGLKEKEWRESMHFLRELS
FT                   HRIYLVQIKHHRGEDLLELESYAKKVGFEEVMLLSSSEDVLCLEEDIIVIGSLYLVGEV
FT                   KQALKKVKKS"
FT   gene            complement(491888..492097)
FT                   /locus_tag="Hydth_0499"
FT   CDS_pept        complement(491888..492097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0499"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="COGs: COG1278 Cold shock protein; InterPro
FT                   IPR012156:IPR002059:IPR012340:IPR019844:IPR
FT                   011129:IPR016027; KEGG: hya:HY04AAS1_0926 cold-shock
FT                   DNA-binding domain protein; PFAM: Cold-shock protein
FT                   DNA-binding; SMART: Cold shock protein; SPTR: B4U902
FT                   Cold-shock DNA-binding domain protein; PFAM: 'Cold-shock'
FT                   DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44900"
FT                   /protein_id="ADO44900.1"
FT                   /translation="MALKGTVKWFSKEKGYGFITRDDNQGDVFVHFSAIQQRGFKTLEQ
FT                   GQRVEFEIEEDSKGPRAKNVRPIS"
FT   gene            492255..492431
FT                   /locus_tag="Hydth_0500"
FT   CDS_pept        492255..492431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0500"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="InterPro IPR003369:IPR006312; KEGG: aae:aq_064b
FT                   hypothetical protein; PFAM: sec-independent translocation
FT                   protein mttA/Hcf106; SPTR: O66477 Sec-independent protein
FT                   translocase tatA/E-like protein 2; TIGRFAM: twin-arginine
FT                   translocation protein, TatA/E family subunit; PFAM:
FT                   mttA/Hcf106 family; TIGRFAM: twin arginine-targeting
FT                   protein translocase, TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44901"
FT                   /protein_id="ADO44901.1"
FT                   /translation="MHFPLPWQLILILLVVFVIFGASRLPELGKGLGEGIRNFKKALSG
FT                   EEEQKKVPEKEGG"
FT   gene            492434..492643
FT                   /locus_tag="Hydth_0501"
FT   CDS_pept        492434..492643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0501"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="InterPro IPR003369:IPR006312; KEGG:
FT                   hya:HY04AAS1_0191 twin-arginine translocation protein,
FT                   TatA/E family subunit; PFAM: sec-independent translocation
FT                   protein mttA/Hcf106; SPTR: A8UW15 Putative uncharacterized
FT                   protein; TIGRFAM: twin-arginine translocation protein,
FT                   TatA/E family subunit; PFAM: mttA/Hcf106 family; TIGRFAM:
FT                   twin arginine-targeting protein translocase, TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44902"
FT                   /protein_id="ADO44902.1"
FT                   /translation="MFHTPTLPELIVILAIIFLLFGASRLPEAGKALGEGIRNFKKALS
FT                   GETEEEKKAKEVKAQELDKEEKKA"
FT   gene            492667..492963
FT                   /locus_tag="Hydth_0502"
FT   CDS_pept        492667..492963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0502"
FT                   /product="twin-arginine translocation protein TatB"
FT                   /note="KEGG: hya:HY04AAS1_1118 twin-arginine translocation
FT                   protein TatB; SPTR: B4U9J3 Twin-arginine translocation
FT                   protein TatB; PFAM: mttA/Hcf106 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44903"
FT                   /protein_id="ADO44903.1"
FT                   /translation="MDFPEIALILLVAFIFLGPEKMMELATKMGELLRKIRETWDELRY
FT                   QMYVENINKKVLEEQEEIQSTEEATHEVKEDGTTGTTQDASDRTSEGTQKQTD"
FT   gene            492917..493651
FT                   /locus_tag="Hydth_0503"
FT   CDS_pept        492917..493651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0503"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="COGs: COG0805 Sec-independent protein secretion
FT                   pathway component TatC; InterPro IPR002033:IPR019822; KEGG:
FT                   aae:aq_1267 hypothetical protein; PFAM: Sec-independent
FT                   periplasmic protein translocase; SPTR: O67305
FT                   Uncharacterized protein aq_1267; TIGRFAM: Sec-independent
FT                   protein translocase, TatC subunit; PFAM: Sec-independent
FT                   protein translocase protein (TatC); TIGRFAM: Twin arginine
FT                   targeting (Tat) protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44904"
FT                   /protein_id="ADO44904.1"
FT                   /translation="MPLTEHLRELRSRLIKSILALLVGTGASFYFASYIFEVLKEPIKR
FT                   SYPKVQLITLSPTEPLFILIKISLVFGLILASPVVLYQIWRFVEPAMYPNEKKLILPIT
FT                   FFSIILFLLGGSFAYFAVLPIALKFLIGIGFSQLQATPFLSVNLYVSFLLKMIVGFGLA
FT                   FEMPIVLYLLQRAGIVTEEQLKSFRKYFIVIAFTVGALIAPDVTTQVLMAIPLLLLYEI
FT                   SILLGKLTKKKSKTKAIEVAQE"
FT   sig_peptide     492917..493012
FT                   /locus_tag="Hydth_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            493648..494589
FT                   /locus_tag="Hydth_0504"
FT   CDS_pept        493648..494589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0504"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0702 nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR016040:IPR001509; KEGG: aae:aq_135
FT                   NADH dehydrogenase (ubiquinone); PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: O66532 NADH dehydrogenase
FT                   (Ubiquinone); PFAM: NAD dependent epimerase/dehydratase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44905"
FT                   /protein_id="ADO44905.1"
FT                   /translation="MKVLITGSTGFVGRYMVKALLNEGFEVASIVRNLDKLRRLYGEKV
FT                   KGYEGNFEDKASIRKAFEDFKPDYLIHLIGILYEEKSKGITFHKVHYIYSKNLYQVAKE
FT                   FDIKKVLHMSALGTHKNAPSSYHKTKYQTEQELIKTGLNYTIFRPSIILGPEQRLFFDM
FT                   WSITRYLRVIALPSGGHYLFQPVDVRDVVCCFLKAIKSEETNGKIYEVCGDKKVSFKKL
FT                   LEDVFSYWNRKVLLLPMPKALMYLGGLLIERIMEPPPFSSDQMLMMWRDNICGLDPEVE
FT                   SQGVQKVCQKAPIPYQESLLWSLKEFKNLMIT"
FT   gene            494627..495262
FT                   /locus_tag="Hydth_0505"
FT   CDS_pept        494627..495262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1318 transcriptional regulator protein;
FT                   KEGG: aae:aq_2056 hypothetical protein; SPTR: A8USK1
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44906"
FT                   /protein_id="ADO44906.1"
FT                   /translation="MIEVKPVEQDLEALVSRVFLKAIELLGGFSKLVEYRTLTWLPSLV
FT                   RAAYAVVLREEYFKTEQEIAQIVGLTGQTVRNILRADPTITMEKIRRLEELVEEEKKEM
FT                   KVHTAGGLAKLAYKLIKEGHEESRLFVEYCERIAYALDIPWAYMTLRRLKGVDFPIKSA
FT                   EEVKERLSGVYIKGRPAQDVISELEYPIKDPAELLHKIKENLKMHGIE"
FT   gene            495331..498666
FT                   /locus_tag="Hydth_0506"
FT   CDS_pept        495331..498666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0506"
FT                   /product="protein of unknown function DUF490"
FT                   /note="COGs: COG2911 conserved hypothetical protein;
FT                   InterPro IPR007452; KEGG: aae:aq_2054 hypothetical protein;
FT                   PFAM: protein of unknown function DUF490; SPTR: A8USK0
FT                   Putative uncharacterized protein; PFAM: Family of unknown
FT                   function (DUF490); TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44907"
FT                   /protein_id="ADO44907.1"
FT                   /translation="MLLRGIQVELRGFYIDAKGKKIGVESFLLFVPSSKGRTLFIGAKS
FT                   VSLGPEGIYAGSVSVIEVSKEVSKEPFDYDFTHLVKLSEKVKARAGKVYVSINTLPLKE
FT                   SITVFVGDTKLERGNITSHEWSRVFYMKGNSTHQLYVLLKEAHAKGGIFYADDVIVTAT
FT                   SYTFYGRGEWRGKEGNFYANGFIKGYESENFKVPVLKVQGKGKLTYTSLKVDFSVETDL
FT                   LEIKGRNMGSLSGRGEYTYTFGKEERIRGSFTAGESFVSIDYRIHPDDILYANFKNVPL
FT                   DNHLLRIDTPFRLALWGSLTLYPTRKELSLKGFSENLFFLEQSFRGINVELSLDYSKNA
FT                   GKIYLSVNDPAKIILSGYFSKKDFEGDLSVYMLPYTYEGFSAYINYLGSVSYREGVFHA
FT                   YGSGKLIKPIYRDVSPGDITFNINLADDNYGIVFSGIGFGGEGKGSIKERVFAGTVLFK
FT                   GFSMNYTNLKVDNLVGGFALKISPAQTQITGGGEALLTKDEVSALVRAGVDLTKGGDWH
FT                   GTFSAHLQDIRRGDLHVNQVDIKGRVRKSLISAEYSSKYAKGRVEYSLSDSSFSSSGEL
FT                   SIEEGDYSAKAHYTLHGRKEGFSAQLSGQGSYKGYNFPLRASLTRESGKLRGFVKGFST
FT                   KVGLLSVSLADSFLEGTEDKGILKLGDITLSINSERLLTVQSSSGQLSIKDRSFLLPLS
FT                   LSGGLRGKAEVSYGESGLSISSQGVLDLEKLSNLIKSRVFTYAKGEISYTLQKEGKFFR
FT                   IRVFSAQDIEVRSRFLAVPLKGRVYALYNGKVWEGFANLKGDDADLKAQVVGDDKLLSV
FT                   KLATQRLPILFRSESVRFNGFAKANGEITTDYRKVRIKADVDLSGNLIIKNIARKIQEK
FT                   PEGYKLIDLDIKLSTAEPLRISLPEGYIYSYADGQIKGSLYKPDYRVKLSLVGGSLEYF
FT                   NREFHVREGTLLMSPERTTLDLTMMAPTPDYNIIIGIKGDAGNPKAFVRSEPPRDTREV
FT                   LTSLILGGPAGEGMFSLSSALVAQFPEFSKLLQGVEKAIGTDVRVNISPTTSPTGEAAV
FT                   NTKVSKDITNRLNIEYQQSTLKDPKETYGGANVKITPNTSVGVKVYSNNAQEYKVRFRK
FT                   KFDF"
FT   gene            complement(498644..499174)
FT                   /locus_tag="Hydth_0507"
FT   CDS_pept        complement(498644..499174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0507"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="COGs: COG0558 Phosphatidylglycerophosphate synthase;
FT                   InterPro IPR004570:IPR000462; KEGG: aae:aq_2154
FT                   phosphotidylglycerophosphate synthase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; SPTR: O67908
FT                   CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; TIGRFAM:
FT                   CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44908"
FT                   /protein_id="ADO44908.1"
FT                   /translation="MLGFYRNLPNILSLLRLFLSPLLLSADKNLLPYLFSILALTDALD
FT                   GFLARRFKRETQLGRILDPLADKVLLLTALFVCTFELKNMPQILLFSLLARDVFILLGA
FT                   SVIYLKLKKVPKPSLWGKITTTVVALSVLLCMFLHSPFINFLLSSLCLLFIIISWIDYA
FT                   VKGIKTFKNQTSS"
FT   sig_peptide     complement(499100..499174)
FT                   /locus_tag="Hydth_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(499155..500486)
FT                   /locus_tag="Hydth_0508"
FT   CDS_pept        complement(499155..500486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0508"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="COGs: COG0815 Apolipoprotein N-acyltransferase;
FT                   InterPro IPR003010:IPR004563; KEGG: aae:aq_819
FT                   apolipoprotein N-acyltransferase; PFAM: Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase; SPTR:
FT                   A8UVN4 Apolipoprotein N-acyltransferase; TIGRFAM:
FT                   apolipoprotein N-acyltransferase; PFAM: Carbon-nitrogen
FT                   hydrolase; TIGRFAM: apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44909"
FT                   /protein_id="ADO44909.1"
FT                   /translation="MKRSLLAILNGILLYLPFSSYNLWFLIFPGIFMLLRRPNQMHYLL
FT                   TGFTFFFLSLRCVNIASIEYGDINPFLAYTLFALFCLFLTIYQMNLPLYMWKKMGGRLW
FT                   LLPVLYTLFEVARSYVPYGGFPWLIVGETSVNFPAVKYSLRFLTVYGGSLLIWYITYLA
FT                   FKRRFLALLALLSFSFLLGLSAKQQILKALEDAKILKVALLQTAVPQQDKLSDKKFREY
FT                   TDEMLSMVSQAVKEKPDLVVLPESAFAFFFSDEFDRGRQELFELSYQAPILVGLVDIRE
FT                   GLKPYNSAYLVADGQLVGYYDKIRLLPIGEYMPFPFGFLKDVFSAISGLDYVPGTQKRP
FT                   IVYKNIQVATPICFEIAYWDLVKELSKKANLVAVLTNDGWFNHSDCSYQHFMWAKVRAI
FT                   ENGKFILWVNNSGDTAVINPFGEVVKKMPYMKRGILIEYVRLLP"
FT   sig_peptide     complement(500421..500486)
FT                   /locus_tag="Hydth_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(500483..500908)
FT                   /locus_tag="Hydth_0509"
FT   CDS_pept        complement(500483..500908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0509"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="COGs: COG2510 membrane protein; InterPro IPR000620;
FT                   KEGG: aae:aq_1741 hypothetical protein; PFAM: protein of
FT                   unknown function DUF6 transmembrane; SPTR: A8UTG7 Putative
FT                   uncharacterized protein; PFAM: EamA-like transporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44910"
FT                   /protein_id="ADO44910.1"
FT                   /translation="MKAILLTISASLVWGFAPSLFKMVLKEGIPPSVALIFHNLSAFII
FT                   ATLITAILGERIFISPKYLMLTFLGGFLSGFLGLYLFFLALRHGDVSVVSPIASTSPLW
FT                   SAVFAWLLLGEKLSFTKLLGIALIIIGVSLLSVSFKR"
FT   sig_peptide     complement(500843..500908)
FT                   /locus_tag="Hydth_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(500905..501711)
FT                   /locus_tag="Hydth_0510"
FT   CDS_pept        complement(500905..501711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0510"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="COGs: COG0708 Exonuclease III; InterPro
FT                   IPR004808:IPR005135:IPR000097; KEGG: saf:SULAZ_0920
FT                   exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; SPTR: A8UTG8
FT                   Exodeoxyribonuclease III; TIGRFAM: exodeoxyribonuclease III
FT                   Xth; exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/Exonuclease/phosphatase family; TIGRFAM:
FT                   exodeoxyribonuclease III; exodeoxyribonuclease III (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44911"
FT                   /protein_id="ADO44911.1"
FT                   /translation="MQGKDKDNRSFKIASYNVNSINTRKELVLSWLERDPVDILCLQEL
FT                   KTTDENFPKEDFMKMGYECYTHGQKTYNGVAICSRFLLEEVFKGMGDATYDQEKRVIGG
FT                   RFKDVWIINAYFPHGESRGGRKFFWKLGFYEKFLRFITESFSPNDKIVLVGDMNVAMED
FT                   IDVYDPVLLKDTIGTMKEERDALKKLISWGFVDAFRYLYPEKRQFTWWDYIGGMVWKDQ
FT                   GMRIDYILITKPLLAYLRDVYVDMWPRKRRNPKPSDHAPIVGVFEL"
FT   gene            501773..502045
FT                   /locus_tag="Hydth_0511"
FT   CDS_pept        501773..502045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0511"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="COGs: COG0776 Bacterial nucleoid DNA-binding
FT                   protein; InterPro IPR000119:IPR020816:IPR010992; KEGG:
FT                   sul:SYO3AOP1_0867 histone family protein DNA-binding
FT                   protein; PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; SPTR:
FT                   A8UR82 Putative uncharacterized protein; PFAM: Bacterial
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44912"
FT                   /protein_id="ADO44912.1"
FT                   /translation="MTKAELVSAVAKGAGITKKQADAALKSAISAIAGSLKKGERVAIP
FT                   GFGIFTVRKRAARKGRNPRTGAVINIPARKVVTFRPAKDLRESIK"
FT   gene            502105..502180
FT                   /locus_tag="Hydth_R0014"
FT   tRNA            502105..502180
FT                   /locus_tag="Hydth_R0014"
FT                   /product="tRNA-His"
FT   gene            complement(502206..503618)
FT                   /pseudo
FT                   /locus_tag="Hydth_0512"
FT   gene            complement(503679..503879)
FT                   /locus_tag="Hydth_0513"
FT   CDS_pept        complement(503679..503879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0513"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: C6JFE3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44913"
FT                   /protein_id="ADO44913.1"
FT                   /translation="MYVNFAIRKILQEQLPVNKFEILSAKRDKDGVYKVEAQDDRFIYF
FT                   LCFQVGRDDVKVLYYDFKERV"
FT   gene            complement(503881..504081)
FT                   /locus_tag="Hydth_0514"
FT   CDS_pept        complement(503881..504081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3083 hypothetical protein; SPTR:
FT                   C9RUM7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44914"
FT                   /protein_id="ADO44914.1"
FT                   /translation="MKALILDRRGCVIGKLPVPLPIPYRGGYSLLEINGSLYRLTGACE
FT                   EGFFVKPWTLPAPAFEKEKED"
FT   gene            complement(504078..504863)
FT                   /locus_tag="Hydth_0515"
FT   CDS_pept        complement(504078..504863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0515"
FT                   /product="DNA single-strand annealing protein RecT"
FT                   /note="InterPro IPR018330; KEGG: chy:CHY_1689 prophage
FT                   LambdaCh01, recombination protein Bet; PFAM: DNA
FT                   single-strand annealing protein RecT-like; SPTR: Q3ABH5
FT                   Prophage LambdaCh01, recombination protein Bet; PFAM: RecT
FT                   family; TIGRFAM: phage recombination protein Bet"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44915"
FT                   /protein_id="ADO44915.1"
FT                   /translation="MLSKANTNTIVREEDYKKVLQMLRVALPSLAKVDDETLITAVAYA
FT                   RHLGLDPLRKEVHFVPYYNKELNKTIIQPIVSYTEYLKRAERSGKLKGWSCKFRKEGDE
FT                   LVAVVEIKRVDWEIPFVWEVPLSEVKRDTPLWQSHPLFMLKKTAIAQAFRMCFPEETSH
FT                   LPYEEAEFWEEPSIPEQTQPTKTDVDTDTESDYITEAQRKRFFAIVKKELGYREDAIKE
FT                   ILKERFGIESTAEIPKDKYEEIIDYFRSLSKPIEAEAQS"
FT   gene            complement(504876..505169)
FT                   /locus_tag="Hydth_0516"
FT   CDS_pept        complement(504876..505169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein ; K12869 crooked neck;
FT                   SPTR: B3SCA0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44916"
FT                   /protein_id="ADO44916.1"
FT                   /translation="MRALRKLYFRAVRTACAPTIEEYRDWRGRKYTRIYYFALPKYLED
FT                   LPHARWLVSSSKTLRALGIFRFFIIGWLARKEYQIRRNLRRLIVYKKEELHF"
FT   sig_peptide     complement(505119..505169)
FT                   /locus_tag="Hydth_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(505166..505531)
FT                   /locus_tag="Hydth_0517"
FT   CDS_pept        complement(505166..505531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A4HHL9 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44917"
FT                   /protein_id="ADO44917.1"
FT                   /translation="MSAKEEFERTWEEVNYPASKMQGFGWVYTLFWVPYHHRRVHTAPT
FT                   PTLPKAEIPLGRWSYFQPLHLSTPPLKSLNPFSGTVGHLSYLLIYSTTALLSTPSGRAV
FT                   SPHHRYKVLARKFPIKR"
FT   gene            complement(505528..505764)
FT                   /locus_tag="Hydth_0518"
FT   CDS_pept        complement(505528..505764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0518"
FT                   /product="DNA gyrase subunit A"
FT                   /note="KEGG: lbf:LBF_0009 DNA gyrase subunit A; SPTR:
FT                   B0SK36 DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44918"
FT                   /protein_id="ADO44918.1"
FT                   /translation="MLKRIRSIKDGWEMTLSLFAVFASLVVLVLSLRLQAEAQRVVEEN
FT                   QYLRYHLVQVCKYIDTLPKRERVVFDVCLEVGK"
FT   sig_peptide     complement(505657..505764)
FT                   /locus_tag="Hydth_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(505740..505967)
FT                   /locus_tag="Hydth_0519"
FT   CDS_pept        complement(505740..505967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0519"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000789; KEGG: hypothetical protein;
FT                   K12603 CCR4-NOT transcription complex subunit 6; SPTR:
FT                   Q7RFI3 Arabidopsis thaliana At3g58560/F14P22_150-related"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44919"
FT                   /protein_id="ADO44919.1"
FT                   /translation="MTLKVVELNANSRCEFDLFYYRHLWLTPYLLAVQQVKGWVLYEVL
FT                   KYEPNLLIVREIRKLKDLEEVEQCLREYAV"
FT   gene            complement(506066..506413)
FT                   /locus_tag="Hydth_0520"
FT   CDS_pept        complement(506066..506413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK19955 gene product from transcript
FT                   GK19955-RA; SPTR: B4MSD9 GK19955"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44920"
FT                   /protein_id="ADO44920.1"
FT                   /translation="MKEVKTIGRSMEALAVSLRENHDFLNFLRGHGVLAERILNPPYPF
FT                   LMDWFRRYERVQELLAEARALKLSGWIKKRLKTLREETSYVELTNEQILELLFDFIDDL
FT                   ETVISAEVERC"
FT   gene            506544..506789
FT                   /locus_tag="Hydth_0521"
FT   CDS_pept        506544..506789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0521"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018247; KEGG: ppd:Ppro_0168 hypothetical
FT                   protein; SPTR: A1AKD4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44921"
FT                   /protein_id="ADO44921.1"
FT                   /translation="MKKVLLVLVVLGGAFALDRLYDYRLPKSSRPYKDYWGNSYKHYDN
FT                   LWKDTDRDGVMNYYDYNDRNPNIWTPYQKGYKNWDW"
FT   sig_peptide     506544..506591
FT                   /locus_tag="Hydth_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(506797..506952)
FT                   /locus_tag="Hydth_0522"
FT   CDS_pept        complement(506797..506952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44922"
FT                   /protein_id="ADO44922.1"
FT                   /translation="MEVVATIFISITNMKMYPASRLGNPKRTDLMVEAYLLDDFIDYIQ
FT                   RHRRTR"
FT   gene            complement(506995..507657)
FT                   /locus_tag="Hydth_0523"
FT   CDS_pept        complement(506995..507657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0523"
FT                   /product="putative phage repressor"
FT                   /note="COGs: COG2932 transcriptional regulator protein;
FT                   InterPro IPR011056:IPR001387:IPR019759:IPR015927:IPR
FT                   010982; KEGG: hya:HY04AAS1_0817 putative phage repressor;
FT                   PFAM: helix-turn-helix domain protein; Peptidase
FT                   S24/S26A/S26B, conserved region; SMART: helix-turn-helix
FT                   domain protein; SPTR: B4U8P3 Putative phage repressor;
FT                   PFAM: Helix-turn-helix; Peptidase S24-like"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44923"
FT                   /protein_id="ADO44923.1"
FT                   /translation="MVKLIEMKATRRGYFIGEKLKKLLQEKGLSIYRLAKLTGLTQSGL
FT                   SMIINNQRAVSPAILRKIAETLNIPEVYFIEEEPTKEYPPSPEVIEREYIAIPIITGVG
FT                   AGGEVITDDYTLIKRTQLPKKTVSAFEVEGDSMEPTIPKDWLVLVDPTDLQLYEGGIFL
FT                   FASQGNGLFIRRVHKVDNQWELVPDNRKYAPQKLTEEIKVLGRVLKKLPKIEPMEVE"
FT   gene            507727..507975
FT                   /locus_tag="Hydth_0524"
FT   CDS_pept        507727..507975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pph:Ppha_2388 transcriptional regulator, XRE
FT                   family; SPTR: A4N1A6 Putative uncharacterized protein;
FT                   PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44924"
FT                   /protein_id="ADO44924.1"
FT                   /translation="MVKQTELARKIGKAPSAISQILHKKRRADLPTAVAIEKASDGQLK
FT                   VEKLVRPEVAQALKEYLRLRCPSMPKNVDVGEEDVSK"
FT   gene            507962..508360
FT                   /locus_tag="Hydth_0525"
FT   CDS_pept        507962..508360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mka:MK0690 SMC1-family ATPase; SPTR: Q4XEI8
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44925"
FT                   /protein_id="ADO44925.1"
FT                   /translation="MLVSELKDKLTDSLNKVVRKYSARVVAKVFRVKPPTVWQWSAGER
FT                   ENPLTKTLEFLMWLKHRDPEMFTEIASVFMQVVSEEAHKTLQIKEFAVKLFKYYIDDHK
FT                   YDVKERAELEREFKRLLEEVKILEEVKR"
FT   gene            508357..510309
FT                   /locus_tag="Hydth_0526"
FT   CDS_pept        508357..510309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0526"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002694:IPR000463; KEGG: aoe:Clos_1278
FT                   DNA primase; SPTR: A8V3J3 Putative uncharacterized protein
FT                   (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44926"
FT                   /protein_id="ADO44926.1"
FT                   /translation="MKGEQAIKILWQTLFPVKFAKGEYAEVIYDDGDRHFKYALHIETL
FT                   EELEEFIREYNEKVNFAICPNTREPKRLAKRTGYTEIKRQKAILIDIEDPESHTLKKPE
FT                   EVRHYIIEFAKSVPESIRKAVKFSAYTGGGGLICIELSRWVERGEIEIVYDWLRERVKD
FT                   FRYVDKSSLNPAQAQRLIGTINAKYKVETFIFKLNENCESLDVDAIITEFNARQNVEIE
FT                   RHAEIERHKGKIKNIEEIVREIKKRIKFKDLGLEGEDYGYYERISCPFHPPDRTPSFVI
FT                   YHNGDGDVGVDFHTGEAHDIIGIYQKLYEKDFITAVRELAQRAGIKVVLSSEEKKKLQK
FT                   EQALADFDPHAYITEELKIRSAIRYRINGEYHFDFFVENREGEVVKLSESLFKLQEWRY
FT                   SLRLFGAHTGYKPAPLPAKAQEEAWELVIDALFEVSEKDEEFDKSELPWELEELQRVIR
FT                   EAPATDIMDDFVLSKSRYVKLVVGDTVYVSLTALLRRLKINPTFERINLKKVSQLLREL
FT                   GAKPERIYVDGYRIRAWRLPEGDWRVVDTMDTTGHYKGDGSVHKESLETRGADGFVDTM
FT                   DTIEEDEKKVMKKNSIENGCVVSTSGHIQNVETQAFEIGMDTMDSMDTTTGGQSVQRGD
FT                   KKVDEDDDDLSWLNF"
FT   gene            510326..511906
FT                   /locus_tag="Hydth_0527"
FT   CDS_pept        510326..511906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0527"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG0210 Superfamily I DNA and RNA helicase;
FT                   InterPro IPR014016:IPR000212; KEGG: nph:NP0930A helicase;
FT                   PFAM: UvrD/REP helicase; SPTR: Q3ITH7 Probable helicase;
FT                   PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44927"
FT                   /protein_id="ADO44927.1"
FT                   /translation="MVEKIIGPPGTGKTTQVVKRTAELVGRGEVRTDKICATSLTRATK
FT                   WALLGKFRSKGVNIGEENIRTLHSWAYKSFLKDGKKPRIVSQKEIAEFFKNKGFEYEIP
FT                   DTSGQENEYAVYETGKDGNRLLQMFNLARITWDGEAPLRHTKMVYKQVEQDCPVSFRTF
FT                   VLLFKDYINWLRDNDLYDYTRLLTEAFKGGLSIQGDLLILDEFQDLGNLHNLIVKRWFE
FT                   NFKYVLVCGDDDQAIFTFAGATPTHLINLRGDREYVLPVSYRLPRGVHELAEGVISANK
FT                   QRIPKTFKPRDETGRVDTLFSLEDALALLQNGEKKSLLLARNNYFVEQWKEILDSYNIP
FT                   YKEIGKHVPIPALATHLRTLKRIKEGKPVDDKDIITLIAYLKGAIRKLTGKKQIRTHLI
FT                   AEIGECIKKRQWTGTAGQVAYWILTRSPEELFTEHDAKVIKKWEKRVEDLHKWLNPAIQ
FT                   VGTIHSAKGLEADRVILDTRITKKVVETFMQEPEAERRVLYVGITRAKEELYLLRLAKS
FT                   YTYEHLGLL"
FT   gene            511914..512378
FT                   /locus_tag="Hydth_0528"
FT   CDS_pept        511914..512378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0528"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012337; KEGG: fno:Fnod_1720 crossover
FT                   junction endodeoxyribonuclease RuvC; SPTR: A8V1X8 Putative
FT                   uncharacterized protein; PFAM: Crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44928"
FT                   /protein_id="ADO44928.1"
FT                   /translation="MSRIMTIDPGYSALGYAVGEENKLIEYGTVYFKGKEETRLTEIYL
FT                   KIKELIQRHNPDTVLIEDYRVYKDGYKGKHKTAIVVGIICAIAYEHKIKPTFVFHNSWK
FT                   AKFQRVYFTIVNRLSEEWKKALGEGSEHSRDAVMMLLPEVVSLKALLKGG"
FT   gene            512381..512569
FT                   /locus_tag="Hydth_0529"
FT   CDS_pept        512381..512569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aae:aq_1945 RNA polymerase beta prime subunit;
FT                   SPTR: O67763 DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44929"
FT                   /protein_id="ADO44929.1"
FT                   /translation="MLKEFYKRGQRVRHTKIGEVLTVVRDEGGVKVVVRDKYGLELEVL
FT                   RDNLVPSGGCENDSSSC"
FT   gene            512550..513353
FT                   /locus_tag="Hydth_0530"
FT   CDS_pept        512550..513353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0530"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="COGs: COG0175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase; InterPro
FT                   IPR014729:IPR002500; KEGG: bvu:BVU_2844 putative sulfate
FT                   adenylate transferase, subunit 2; PFAM: phosphoadenosine
FT                   phosphosulfate reductase; SPTR: A5ZE69 Putative
FT                   uncharacterized protein; PFAM: Phosphoadenosine
FT                   phosphosulfate reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44930"
FT                   /protein_id="ADO44930.1"
FT                   /translation="MIAVLVSGGKDSTATLLVALERFPKERVIPIFTDTGWESSITYAY
FT                   LNYLETKLSIEIVRLKSRKWQDLLTCIKEKKMFPHGNQRFCTYHLKLIPTAEFLAEHPE
FT                   IEEVWLGIRASESFRREKKYGDLTPEDTYSYVETATGLPAELRQKIKHLRARLPIVDWT
FT                   EEEVFRFLKEKGIERNPLYDMGHSRVGCYPCILGGLREWKACWKTEEGRANILKLIELE
FT                   KELREMGYNGRIKDNYDGEKLLRLLKMEDVQGDLFKEETCEFCKV"
FT   gene            513512..513802
FT                   /locus_tag="Hydth_0531"
FT   CDS_pept        513512..513802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aae:aq_1144 p-aminobenzoate synthetase; SPTR:
FT                   A6CLQ5 YfjO"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44931"
FT                   /protein_id="ADO44931.1"
FT                   /translation="MREEKTLKIKAKSDFEIKILRKIINGEMNGFIRGDYLYYEAGNGF
FT                   LWIRVEVEIEKEAEEGRMKEITFIDLIKALVWFLVLLVFMVLVVVVVSKVI"
FT   gene            513815..514762
FT                   /locus_tag="Hydth_0532"
FT   CDS_pept        513815..514762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0532"
FT                   /product="metallophosphoesterase"
FT                   /note="InterPro IPR004843; KEGG: ttu:TERTU_3463 Ser/Thr
FT                   protein phosphatase family protein; PFAM:
FT                   metallophosphoesterase; SPTR: C9DC36 Gp52; PFAM:
FT                   Calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44932"
FT                   /protein_id="ADO44932.1"
FT                   /translation="MEELVAKALELAREGLPSRRKLMEKLKVSEALAREIRAIVKYLMM
FT                   KNGSEPISFDLNPVDIIDIPEPLDKNDRGPYRLKGYRRIGVISDVHFPYHDKTALKTAL
FT                   KKLYELEIDTLVMNGDIVDFYSVSFWERRPDRRNLQKERELALMAFDRIRKIFPDAEII
FT                   YKEGNHEERLARFLSRKAPELYDIEELQTDTFLRLKDFGIVYVKEKRRIEAGELDIIHG
FT                   HEYRSFASVNIAISYLRKSFRNILIGHFHRRQEDTKKDIRDELSGAWVVGCLCDLKPDY
FT                   SPNNEWTHGFAFVELFENKHFQVRNFLIQGEEVF"
FT   gene            514762..515097
FT                   /locus_tag="Hydth_0533"
FT   CDS_pept        514762..515097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apt:APA01_05700 glycerate dehydrogenase; SPTR:
FT                   C1QBD3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44933"
FT                   /protein_id="ADO44933.1"
FT                   /translation="MRLFKELSDSELLYCREIAKKIRIANRKYERACEILNGGRSVITI
FT                   GQGKPAKNHVENAYVNKVVWQEFLSALDESEKKLVEEIVEGLDYFTKDELLMLGKINST
FT                   GQMLGLW"
FT   gene            complement(515119..515649)
FT                   /locus_tag="Hydth_0534"
FT   CDS_pept        complement(515119..515649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A8BA49 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44934"
FT                   /protein_id="ADO44934.1"
FT                   /translation="MSFNEALFKYELVKYLHEEPPTYTSLSLTRGEAVKLVGEGKLKEV
FT                   EENLRKTIQQHLKDLPPDFEIPISLRFSPIQTSITITSKDFTSEELEITYYPLDVLLKY
FT                   IDQTLLKKAQLFKKLPEILSASSLTLVKKKRLLVLRAYKNKTRKALLTTTNKDPTLIEA
FT                   LEYLIDLHRHLKS"
FT   gene            complement(515646..516020)
FT                   /locus_tag="Hydth_0535"
FT   CDS_pept        complement(515646..516020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_2406 hypothetical protein; SPTR:
FT                   C6RFK9 PolyA polymerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44935"
FT                   /protein_id="ADO44935.1"
FT                   /translation="MLNAEVVITAYKFVSPLSRKEARERLGVLKRYLLPFEKELSKETF
FT                   REIFLSLFGKEVEEVEVQKGLFIFLYNYLLRKAKGEELLKEDEEYEIVKQYEHLVKHFP
FT                   NIDPKHYRGDVLKFFRGGSS"
FT   gene            complement(516013..516867)
FT                   /locus_tag="Hydth_0536"
FT   CDS_pept        complement(516013..516867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_0546 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein; SPTR: A9KI99 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44936"
FT                   /protein_id="ADO44936.1"
FT                   /translation="MKIWKLVKEAEGYRVYSSEVRNPEEWDNKKGGYVLKGIEEIPELS
FT                   QEGWEYTLTGGQYPELIVYDPSKIAIVWLSAREREEWEKGKLKVEGMLDWYPASVHKGW
FT                   KIVRRQAILILDATKGKVYENYTIESYDPQEPTPKDIEKVESLLKSAKRVIDGDETIEK
FT                   TTEPDPENPYITHIRYDKCEFCKKIQEKFNNPYTSCFVHSIYESIISTSPRKSVVVVRN
FT                   EHLRDEELKRTIDRIVIQPSPSVALAVLTKEGDVLFLKKEGKPLVKLNCLKGNVFEEVL
FT                   QNA"
FT   gene            complement(516979..517302)
FT                   /locus_tag="Hydth_0537"
FT   CDS_pept        complement(516979..517302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: DUF1776 family protein; SPTR: Q9URV8 UPF0744
FT                   protein C106.03"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44937"
FT                   /protein_id="ADO44937.1"
FT                   /translation="MRTVRKEVIAEAWRKLSKKQKRELLEEILYLLERNSTDAAPVFLQ
FT                   YDPVDDEMYVRSHFIGRGAVVRRFCPSFLEDWLPREWGKRARLQRLEELIEETLEELDG
FT                   LEF"
FT   gene            complement(517388..517885)
FT                   /locus_tag="Hydth_0538"
FT   CDS_pept        complement(517388..517885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Peptidylglycine alpha-amidating
FT                   monooxygenase COOH-terminal interactor; SPTR: A8UTR2
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44938"
FT                   /protein_id="ADO44938.1"
FT                   /translation="MSDLQKKLYRLYEKSLGKDMFEVKEEERVESEEGQVRMFFMTPPE
FT                   FILVLKKEGDLNVIVPLTSYLQLAITNKYPPLIRWKGFRLVPLPFWVYANEKLLQKYSV
FT                   PVFKLSNLEKIREYVKSARTKGIGKWREKFIEKTAERYADLSLSSLLYNFTEYDEDHKK
FT                   GT"
FT   gene            518203..518763
FT                   /locus_tag="Hydth_0539"
FT   CDS_pept        518203..518763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0539"
FT                   /product="transposase IS4 family protein"
FT                   /note="InterPro IPR002559; KEGG: aae:aq_aa40 hypothetical
FT                   protein; PFAM: transposase IS4 family protein; SPTR: O70075
FT                   Uncharacterized protein aq_1391/aq_1640/aq_aa40; PFAM:
FT                   Transposase DDE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44939"
FT                   /protein_id="ADO44939.1"
FT                   /translation="MKTEALIGIVRGKSVAVGVKAGVAYSDENRLLLEILKDFPFRSSY
FT                   FVGDAYYGKSVEVLKRVKKLGMKAVVPVRDTMRRKVRDEYRLWVKGNYERMRKVYKKYR
FT                   YRVEQFFGTIKNLFGDRDRVCDFHIASLYVLGRFVLYNLMVLAELLLLSLKLLRVMVFF
FT                   RHWNTSAWGIFKHSPQALDNLTT"
FT   gene            518841..519239
FT                   /locus_tag="Hydth_0540"
FT   CDS_pept        518841..519239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2026 chromosome segregation SMC
FT                   protein; SPTR: B5JWI7 Chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44940"
FT                   /protein_id="ADO44940.1"
FT                   /translation="MRTAHLRIVEKLLDYYRNPENWGKSLKQVAQAFGHSYPYILKCIQ
FT                   LYGTERFRKEKDAIYHEILSEASNIAIARLYEMLLSEDKEEFKQAQAEVRQWYKTVFGE
FT                   KQYHTHEAGDKLSTLLSALAEIRQKYAK"
FT   gene            519229..520623
FT                   /locus_tag="Hydth_0541"
FT   CDS_pept        519229..520623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0541"
FT                   /product="phage uncharacterized protein"
FT                   /note="InterPro IPR002052:IPR006517; KEGG: cjr:CJE0249
FT                   phage uncharacterized protein; SPTR: C3XLY5 Putative
FT                   uncharacterized protein; TIGRFAM: phage uncharacterized
FT                   protein; PFAM: Terminase-like family; TIGRFAM: phage
FT                   uncharacterized protein (putative large terminase),
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44941"
FT                   /protein_id="ADO44941.1"
FT                   /translation="MQNETIEVLDLLLSKPLPDLAELLFPHYCTHKPADIHYELAELLT
FT                   ESKQNLVIAFPREFAKSTYVWIFFPAWNILHCKYRYIVYIASSKERAEEQLRNLRAEIT
FT                   AHPLLSSLIEIKKDNADELEYLDLASMNRCLIRAYGAGQNLRGIRYHEKRPDIVILDDI
FT                   EDSESVQSETQRKKLKEWFHADVRPLSSTGRIFVIGTVLHEDSLLNNLLTNPPFSFRGL
FT                   RYGIIDEEGKPTWEDRFTLEWIERKREDYRAQGLLHVFYREYMNIALAPEEQIFKKEYF
FT                   QYYDPVRLDTLNFNIFTTVDLAISKSDTADFTAIATVAVSPENHWFVLDIDYGRYDPSE
FT                   QIEAIFRAVKKYKPLIVGIEKVAYQSALAHFLQKEMLARGLFFRVQELKAEKKKELRIQ
FT                   ALQPRFTIKAVWFPAGAHFLTELESELLMFPRGKHDDLIDALAYMEQIAYPPIHHSEGE
FT                   LPSWSL"
FT   gene            520643..522499
FT                   /locus_tag="Hydth_0542"
FT   CDS_pept        520643..522499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_1943 hypothetical protein; SPTR:
FT                   A9BYP0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44942"
FT                   /protein_id="ADO44942.1"
FT                   /translation="MKIKDEEKILSYVLADIQNAENFYQQVIEPKLIERYQLYNADPEY
FT                   YAQKFPKLFQRSKITLTDIADTIEWAMPSLMRIFFGGEDVVSIVGRQAEDVKKADILQE
FT                   LINFQIQNQNQGFLIFYKWFKDALIGGLGVVKCYWEREYETQKKEIVLGWDELQLAQHD
FT                   PTAVVESAQDLGNGIYRVALKISRLSKNQPCLENVPATEFIFHPSTLSVKDSPFVAHRK
FT                   VVTVDYLKRKEKEGIYKNVDKVIESASSDDLRYTQMADYYLKPYKKYAVSESDQDLARR
FT                   KVLLYECYTKYDINNDGLLEDVIITVGNNTILRIQENIYGRPPFFVLAPILEPYQLWGK
FT                   SFADVLKDIQDLKTALVNQIIVNVGMNNDYKIAINDTLVNVQDIVNDKPVIRMKAGADI
FT                   RQAIMPLPTQPLAPWSFNFLEYIEGTKENRTGITRYNQGLDGRSLNKTASGISMIMQAA
FT                   NQRLELIARIFAETGIKDLFSFLVYLNQQFIDQKTVIRLTNKSLPIAPDDLSGEFDVVI
FT                   SAGIGVGTKQTNMANLQLLLQLYPKLLQLGIATPKNVYNLVKNLIEEMGYKNVDDFLQD
FT                   PEQAQMKMMMGGLNGGITGEIGIPQGGIPQGVNSSAGEGLPQ"
FT   gene            522671..523492
FT                   /locus_tag="Hydth_0543"
FT   CDS_pept        522671..523492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0543"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008979; KEGG: bcg:BCG9842_A0121
FT                   hypothetical protein; SPTR: B7IZJ4 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44943"
FT                   /protein_id="ADO44943.1"
FT                   /translation="MPITGLSSSTLKTRFFNILAGGNATDLENFLSQFTSAYDKLVLNS
FT                   EIFSNPAVMDAVVNSPQLATVFNSTTALNMFFASSVAITQLGRSYNGIQTLAQNAQAMR
FT                   SAIQSQELLNLISRNPSFRQIFTSSTAIPSKSVPTMTSNTTPEGQALGSSIYSSSNDFY
FT                   KAFDKNSTTLWEPATPNPSEWVGYMFSVPVFVHTLSYTNIENINLCVVQRSSDGTSWED
FT                   ILTFSPALRLATPVQLPLPLLVNYYKYYRILTVSTSGYPLIRELDFSGFTQ"
FT   gene            523504..523689
FT                   /locus_tag="Hydth_0544"
FT   CDS_pept        523504..523689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC1872 replication initiation protein
FT                   REP; SPTR: Q97HY4 Replication initiation protein REP"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44944"
FT                   /protein_id="ADO44944.1"
FT                   /translation="MIFVIIDKQTKRVLGFTYSSEYKTYHPEVELIQISQDSEVFLSAT
FT                   PQSYVYDASTNSFVIK"
FT   gene            523702..524664
FT                   /locus_tag="Hydth_0545"
FT   CDS_pept        523702..524664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: retinitis pigmentosa GTPase regulator-like
FT                   protein; SPTR: A8UYW5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44945"
FT                   /protein_id="ADO44945.1"
FT                   /translation="MDEHNQGTPVEQPKAQEEQKPEIALTHEGELSVDLSSWGLSEEEG
FT                   EQPEKQETQEQAQGEKQEYYTPEEIQKIGIDKLDPNRIPPELLPWYKSMQADYTRKTQA
FT                   LAEERKAIEKLLDKALTDPELAKRFIQDPELVQTAQKHPQLAQKLMAVSQLAQPKKNPF
FT                   DDIVEQAKRMVEAQFGEPFDEFNPKHTLALTLAGQNILARQAQMLQIYNRIGEIREKEP
FT                   AFEEIDRLAEQKLYSLPYAEALKIERAIKVGDIDTVLRFWEDVRKEYYQQKLTTKQEPP
FT                   KVESAGTGEVKTKPSFDPRELAHLSEEEKVRWFIEAGLV"
FT   gene            524687..525562
FT                   /locus_tag="Hydth_0546"
FT   CDS_pept        524687..525562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0546"
FT                   /product="putative phage major head protein"
FT                   /note="KEGG: dac:Daci_1946 putative phage major head
FT                   protein; SPTR: A8UYW7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44946"
FT                   /protein_id="ADO44946.1"
FT                   /translation="MALTTYTAVGNREDLSDIITNISPTETPLYSMFGKATAKATYHEW
FT                   IEDSLAAPGTNAMVEGANYPIADPQTRVRKGNYTQIFAKGYGISETQEAVLKAGIKSEI
FT                   AYQMQKAMKEIARDVEYAIINNTAAVAGNATTARQMGGIQAFVITNVLANGGSPRALTE
FT                   TLLNDGIQQAWQAGGNPDVVVVSGKNKRTVSSFTAGVTKTVAAEDKKLVSTVDVYESDF
FT                   GLVRIVADRWMPDSKVFILEKGRFKIAYLRPFKQQEIAKVGDRIERVVVGELTLEVRAE
FT                   KANAIIADIA"
FT   gene            525652..525915
FT                   /locus_tag="Hydth_0547"
FT   CDS_pept        525652..525915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0547"
FT                   /product="asparagine synthetase B"
FT                   /note="KEGG: cyt:cce_4003 asparagine synthetase B; SPTR:
FT                   A8UYW9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44947"
FT                   /protein_id="ADO44947.1"
FT                   /translation="MAVIFDYDEKTGKITLTRVVDITPYLRANYEERKEIGKGISKSKV
FT                   WRKVASIPIDVLISHGIDINDDEAIKDFIKKHPEYRTSEGGF"
FT   gene            525918..526097
FT                   /locus_tag="Hydth_0548"
FT   CDS_pept        525918..526097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smt:Smal_0995 GCN5-related
FT                   N-acetyltransferase; SPTR: A8UYX1 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44948"
FT                   /protein_id="ADO44948.1"
FT                   /translation="MVKMKKPEKHEATHWIFGVDVLGKDIIEVPEYLVSLFEEEGFTRI
FT                   SDEKPKKEREKERG"
FT   gene            526101..526661
FT                   /locus_tag="Hydth_0549"
FT   CDS_pept        526101..526661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A8UYX3 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44949"
FT                   /protein_id="ADO44949.1"
FT                   /translation="MTVAEAVLRLRTLLNDPQAIEFTDAELINYINQAQDYIVLSAVNL
FT                   GFQGFLKNVNLTLTNDQALLPSDFIREYSVSANNYILNSVPPDAEVTDKTYKIIGNTLY
FT                   SKNASVSLYYFYSLPNYSNLSDTIQIPQIFNNLLFEICVYLAKNRIEVPNAFDVQLSSL
FT                   YEQKIAQLVSAYGMSFIERPMPF"
FT   gene            526672..528291
FT                   /locus_tag="Hydth_0550"
FT   CDS_pept        526672..528291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_1816 Ig family protein; SPTR: A8UYX6
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44950"
FT                   /protein_id="ADO44950.1"
FT                   /translation="MIVSAINFAGVVNTKPPNSLNANELVNCTNFYVTPYGSLKARRGL
FT                   SLLGSLPSADFRSICYFSKTNLLYLASGTTLYSFDPASGRFTVIGNVDTPECSFIEAFG
FT                   KLWIADGGKLKYYDGTTFGTVDDFIYKTQTIGTGDGTTTSFTGTLATPVTPSSVSVSYT
FT                   VGSTTYTAVDDGKGNITGDYISTGTVNYQTGSISLTFSTAPANGTQINVKYSNSEVINV
FT                   FADDIAFKDERIYVAYGSDIYISLVRDPSAWFFISVNKQDGAKIKGIHVYYDKLVIFKG
FT                   DPKPAIYILSGYNLQTYTLSRVAQHVSVNNKYSVRPFLGDLYFNWGRSVYALSKLLGYG
FT                   EVEPVPLTLHFDTYDTTSQERFALPLPGEYVIFFLSRSDALPFAFTPERNACTFLNFAV
FT                   PCVCGVVVGTDVYLAGGGGVFKFAPINTDAGINIAYSVDFAHIGNYINNTLVKRIAIRV
FT                   LPFMDGDLSVFVKGKRVLFTQITPPSVWDRALWDSARYGTDTNTPIYKRQVIFGRTLDF
FT                   TMRTGTPLELFAFEIDMEVKHG"
FT   gene            528284..528637
FT                   /locus_tag="Hydth_0551"
FT   CDS_pept        528284..528637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A8UYX9 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44951"
FT                   /protein_id="ADO44951.1"
FT                   /translation="MADPIVRLYDFQPGTIIKSSEVDNELNQLISFLNRIWTNGSWDGV
FT                   VWKLLAQYVSSDNWTVSDLRTFLAAAHNPDGTIKSDGISDALIYAHNHDSTAHPEVQSA
FT                   LSLLSAGVAFFMS"
FT   gene            528648..528911
FT                   /locus_tag="Hydth_0552"
FT   CDS_pept        528648..528911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tel:tlr1645 hypothetical protein; SPTR: Q8DIE5
FT                   Tlr1645 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44952"
FT                   /protein_id="ADO44952.1"
FT                   /translation="MLAIASLNNQTDVVIYTAPAGKTVFAFVDIYAVSSTNITLKINNT
FT                   VFLSQPLSAGVSLSIKLILNGGDSITASSTGQANFFVHGIVQ"
FT   gene            528922..529860
FT                   /locus_tag="Hydth_0553"
FT   CDS_pept        528922..529860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_0144 cold-shock DNA-binding
FT                   domain-containing protein; SPTR: A8UYY2 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44953"
FT                   /protein_id="ADO44953.1"
FT                   /translation="MGWVPGWEIDPADVGWDTGGSRYFSINKDFVDWVQQNRPDLYNAA
FT                   VNLIDKAGAVQERSNGPASWYNIDFASPAAKGAFSDIYRAATQAYTAAAFGTTPEALYG
FT                   PGAGQIGSSRGGYYGGGGGYYGGGGGGMYVATSGGQSLSGNVNFSGLYPPILQQLADFQ
FT                   LRLMSSPEFQDVFNTILGGGVNSKTLSAFNDVNNKLIESWKDLTRPVFQTNILGAIEGL
FT                   ANRGVLDSSVAKGLLGSISSEYMTQLSNYATQLLRDAYEKAYSQPFSAVKALIPFMSLA
FT                   QVSGGGGTSSSSSYSYNPAPLVGLLTSLIGL"
FT   gene            529871..530569
FT                   /locus_tag="Hydth_0554"
FT   CDS_pept        529871..530569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kpe:KPK_0775 flavodoxin FldB; SPTR: C6K2G9
FT                   GpH"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44954"
FT                   /protein_id="ADO44954.1"
FT                   /translation="MDFGLGLALGLGSTLLGGLLGGGDAPETSSYFIPKPQGYANLARY
FT                   YQGILTKMLNDMLDIQAPIPGDNSTPIGDQPQPMPRITSSRLPQLRDNIKTAFDVLVSG
FT                   TPYFDASQLKAWENLPTVDVLGMKIPVYGVGRARARMLNEALGLMANQLALDQQQKERY
FT                   LKNVLTPIDVMNFLFQIPLSYSREAEFPISAGVVQYPSMSTTLGGLLSGFGQGLLQYTL
FT                   MNNLLRGIGG"
FT   gene            530573..531607
FT                   /locus_tag="Hydth_0555"
FT   CDS_pept        530573..531607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK22572 gene product from transcript
FT                   GK22572-RA; SPTR: B4R3V7 GD16626"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44955"
FT                   /protein_id="ADO44955.1"
FT                   /translation="MDYFGQYMQMGRGLLAPIVDTIQRLALMKLQQQEQMSALQKRAEI
FT                   VQNLASQLTSSLPSDTETKIENPPSFTLPTPTLFKPSSVSTVPQPSKITEQPKSPTEYA
FT                   QELYEKTLPILAQANVYGLDFSPMLSNLIKKQEETFQSLNKFQTMTKVLPKLFPDMDQN
FT                   TASYLALGIAQGDISVKDIKDLRKKDVQFIQAKSADGTVYVLGFDKDSGGQVFSAKIQP
FT                   DLNLLQQITSVKEGAILRRELALEGARHANRMAEIQLEKSLQNNDTKYQHVKIRVPASQ
FT                   EEIKQNPVLGVQGKEIPALFDPRSGNFYDPVTKQQIDPRTGSPVSQSPNTRQPARSVFD
FT                   LYRR"
FT   gene            531610..535035
FT                   /locus_tag="Hydth_0556"
FT   CDS_pept        531610..535035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sml:Smlt1976 hypothetical protein; SPTR:
FT                   A8UZ10 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44956"
FT                   /protein_id="ADO44956.1"
FT                   /translation="MPNLEQVLSYLDPAFANASQEQRNAILNDLKGNPQKIDKVLSYLD
FT                   PQYAKAPPEMKTKILKDLSGVSLPEKIGRAFAYGAGELAEDMGQILKKGRGLVEKLPFV
FT                   PKTQGQGLAETLIQLGQEAKSYWIPEQYKEVYDFPGSSIVQEIPSLIGFSPVLKTGGAV
FT                   GKAIARKLGQKGLTEAIAENVGAGLGYSATQATSGDYTGQDVLTQTALDVGVGAGGYTV
FT                   GKWLSSLLKGKTPEQAVKVLDTLEAKLPEGEQKEAVKLVKQKLIKKSPQPAETTATPAE
FT                   TVIQKPTIEELTVKGNEKPVSDEVLNFYAGGPSTEQLKGLTKVPEDPLTYAKDLGVEKP
FT                   AKEARAGIFANAKRWVLPQYEWLKETPETASVYRAAKDYTEGFEKDIKTWLQDRLGQIK
FT                   ETIKNLPDEDRAKIVDYVEGKTKELPESYKPVANQIRQYLDDIYNYAKGQGLNISYRKD
FT                   YFPHIFDGHIRVQVGDEFKSAKTWDEALEIAKKGIDEGQQVNIKAMLPPSIYELRITNP
FT                   RFWSLVNELKDGVELTTEEVKGLLQEAGIGRRPKYRFVSNLLERKYDIDGYIKDPEVAL
FT                   PIYTFNIIKKIHQDRFLSEFEKGYEQIKDPRLRRMLDEYKTQVLGYPTKPEEVAADTIN
FT                   AFLKTPFGRWFLDKLGRSVGTEVSPYDVRRIAGQTNYWLNYLPDLGLSISSALVNSTQT
FT                   LTNTLPILGAKKSALAGMLKYTRALLTDNEQIKKELFDAGILTESSFEGLRFSLSGLKD
FT                   LPMSLFSGVEVLNRVATYGAAKEYGLREGTEGMLKTLNKLLGVPEHDPLYKLIQSNVPL
FT                   EKKATEFAKEVVDKTQFRYEKFQNPRALGSLSKLALPYKTYLINQLLLSYRMLTGAKAN
FT                   PREAILFFAAPVLLAGKDGNPLTAWTWGALNELYGHITGKDLEEDIKDKLGKAGDVLLE
FT                   GLPKQVGVDIRGAVKLDFPNPFDERFYGRPGRILKDVYDIAKGEKGTDALKEELTPKFV
FT                   KSISQAYDIIRSGYVKDNKGRVIKEGDWKDALLTSLGVKPTEYYDFLEKKDLIYKMEKK
FT                   FKNDYEPLINEYTDSIISGDEDRRRDSLKSINSALQELNNKIQNSEGQRQKAYLYLYLR
FT                   LAGALKDESLIRRMKERLAPSSGDKYKQMLIQEE"
FT   gene            535052..535333
FT                   /pseudo
FT                   /locus_tag="Hydth_0557"
FT   gene            535347..535589
FT                   /locus_tag="Hydth_0558"
FT   CDS_pept        535347..535589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0558"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: C4WE04 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44957"
FT                   /protein_id="ADO44957.1"
FT                   /translation="MFDLLRRLLGLASAYSSAERQYGKKWYKSKTIWVNLIAFIALLLS
FT                   EKLGISLTKEEQGALLVVINIALRIITKEPIVWSD"
FT   gene            535577..535744
FT                   /locus_tag="Hydth_0559"
FT   CDS_pept        535577..535744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0559"
FT                   /product="splicing factor 4"
FT                   /note="KEGG: similar to CG31550-PB, isoform B; K13096
FT                   splicing factor 4; SPTR: A5KRP6 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44958"
FT                   /protein_id="ADO44958.1"
FT                   /translation="MERLKKVIERYKNSRVRVEIGSETGMEDSPEYRIQEEKRGKGILK
FT                   KLGIKLTFRF"
FT   gene            535755..535979
FT                   /locus_tag="Hydth_0560"
FT   CDS_pept        535755..535979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Zfp169, Zfp169_predicted; zinc finger protein
FT                   169; K09228 KRAB domain-containing zinc finger protein;
FT                   SPTR: C3YHL9 Putative uncharacterized protein (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44959"
FT                   /protein_id="ADO44959.1"
FT                   /translation="MGREISYICDACGSDCTEHYYIVSVVRRGEGHSVLHVNGDDPILC
FT                   PECALSVITLLSHLEGMGWKEEEDEDDGF"
FT   gene            535960..536544
FT                   /locus_tag="Hydth_0561"
FT   CDS_pept        535960..536544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0561"
FT                   /product="protein of unknown function DUF847"
FT                   /note="COGs: COG3926 Putative secretion activating protein;
FT                   InterPro IPR008565:IPR018537; KEGG: hba:Hbal_2383 protein
FT                   of unknown function DUF847; PFAM: protein of unknown
FT                   function DUF847; Peptidoglycan binding domain; SPTR: C1TPL6
FT                   Putative secretion activating protein; PFAM: Predicted
FT                   Peptidoglycan domain; Predicted lysozyme (DUF847)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44960"
FT                   /protein_id="ADO44960.1"
FT                   /translation="MKTTAFDYALLFTLKWEGGYVNDPNDPGGETNYGITRRTLELARQ
FT                   KGLVFKESVKDIDREDAAVIYRRFYWEPLKCDDMPLWVAVLVFDTGVNQGIRYAGLHLQ
FT                   SALNNLKHHGGAYFSLAEDGMIGDKTLSALRELSIHPLEVKQLFIRLYCVNRDIRYTEL
FT                   VGNNPKLKKFLKGWFFRTSSLQDYANSLMEV"
FT   gene            536547..536648
FT                   /locus_tag="Hydth_0562"
FT   CDS_pept        536547..536648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44961"
FT                   /protein_id="ADO44961.1"
FT                   /translation="MKKKAVKKPAVAIVILAEKKKGGKKNGRKKKGS"
FT   gene            536623..536757
FT                   /locus_tag="Hydth_0563"
FT   CDS_pept        536623..536757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44962"
FT                   /protein_id="ADO44962.1"
FT                   /translation="MAGRKKVPEIVEHAVADIMKKKKVSREQAYAIAVGQFQKEEEEG"
FT   gene            536799..537005
FT                   /locus_tag="Hydth_0564"
FT   CDS_pept        536799..537005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A7XXU2 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44963"
FT                   /protein_id="ADO44963.1"
FT                   /translation="MAKKSKKNWIQSAIKKPGSFTQWCKKRGYEGVNEECIAEGMKSKD
FT                   PKTRARARLAKTLRGMSKRRRKK"
FT   gene            537002..537253
FT                   /locus_tag="Hydth_0565"
FT   CDS_pept        537002..537253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spi:MGAS10750_Spy1810 M protein; SPTR: Q9ZIX5
FT                   Mrp22"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44964"
FT                   /protein_id="ADO44964.1"
FT                   /translation="MSDKLLEHGEKIAKLETKVDLLYHAVNELKQQNNRIEEKLDTHMA
FT                   HIASLQSRVAGIAFVVGAIVSGITSLLFKLIGFKVGES"
FT   gene            537250..537438
FT                   /locus_tag="Hydth_0566"
FT   CDS_pept        537250..537438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44965"
FT                   /protein_id="ADO44965.1"
FT                   /translation="MKVFLLSLFIVFLVFRSGEGWSYRVLDKANGRFIIMVQLTDTSFL
FT                   QIEFAKDGIKLQELLVS"
FT   gene            537495..538970
FT                   /locus_tag="Hydth_0567"
FT   CDS_pept        537495..538970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0567"
FT                   /product="Glycine cleavage system P-protein"
FT                   /note="COGs: COG1003 Glycine cleavage system protein P
FT                   (pyridoxal-binding) C-terminal domain; InterPro
FT                   IPR015421:IPR020580:IPR015424; KEGG: aae:aq_1903 glycine
FT                   dehydrogenase subunit 2; PFAM: Glycine cleavage system
FT                   P-protein-like; SPTR: A8UWQ1 Glycine dehydrogenase subunit
FT                   2; PFAM: Glycine cleavage system P-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44966"
FT                   /protein_id="ADO44966.1"
FT                   /translation="MLKSPQEEALMKLIFELSKRGRKSFALPSLDVPEVSLEEYLGEHF
FT                   RKELDFPEVSELDAVRHYTNLSKLNYSVDTNFYPLGSCSMKYNPRIAEEISRWEEFTDM
FT                   HPMTPEDYAQGSLEVIYRLKELLKELGGFSEVSLEPAAGAQGELLGLLLMRTYHTDRGK
FT                   EYKRKILIPDSAHGTNPASAAVCGFEVITVKSDTNGELDWRDFSDKLKDDVAGLMITNP
FT                   NTLGIFERRIKDMAQALHEKDALLYMDGANFNALVGIAKPGLWGVDIMHFNLHKTFGTP
FT                   HGGGGPGGGAVGVSEKLVPYLPVPQVEFDGEKYFLSWDRPKSVGKMLSFYGHFSVMLKA
FT                   LAYILSYGNEISRVAKYAVLNARYLRHLLKGCLLDPYEHVPCMHEFVLSALNLVQYDIK
FT                   AIDIAKALLDRGFYAPTVYFPLIVKEALMIEPTETESVDTLRAFAKSLMEIIEEAKRDP
FT                   QKVKASPEKTPVRRIKEVEANRKPVLRYAFKSS"
FT   gene            complement(538957..540042)
FT                   /locus_tag="Hydth_0568"
FT   CDS_pept        complement(538957..540042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0568"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: aae:aq_1882 DNA
FT                   polymerase III beta chain; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: A8UQZ0 DNA polymerase III
FT                   beta chain; TIGRFAM: DNA polymerase III, beta subunit;
FT                   PFAM: DNA polymerase III beta subunit, C-terminal domain;
FT                   DNA polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44967"
FT                   /protein_id="ADO44967.1"
FT                   /translation="MRFSVDREEFLDALTKAKSATEKKSALPVLNNFLLQAQKDRLIVK
FT                   ATDLENFLTFSVRAEVYEEGVVAVNADKLTSVIKAIPSATLQAQLLEDKLSITGGRSKF
FT                   NLTALEAEDFPEFPEVKVSSQIPAVDFLKAIDKTEYAISKEDTRYALQGMYIHEHKGKT
FT                   HFVGSDGHRLALYFTPSPFSLELLIPRKSLKVIEGLLKDYIGEISIGKDGSFAHLQGED
FT                   FQLSIRLLEGEYPDYLSVIPESFNIEVLINKSEFLSALKRLSAIAESSAFPVKISLQDN
FT                   LAVFEITEPEYGEGRDEVDIEYSQEPMELGFNGKYLIEALESFDTEKVWLKIVDPDSAI
FT                   VLDSEDKESDPYMCLVMPMRI"
FT   gene            540059..542521
FT                   /locus_tag="Hydth_0569"
FT   CDS_pept        540059..542521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0569"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="COGs: COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase; InterPro
FT                   IPR000644:IPR001667:IPR003156:IPR002646:IPR 017985; KEGG:
FT                   aae:aq_411 poly A polymerase; PFAM: Polynucleotide
FT                   adenylyltransferase region; CBS domain containing protein;
FT                   phosphoesterase RecJ domain protein; phosphoesterase DHHA1;
FT                   SMART: CBS domain containing protein; SPTR: A8UST1 Poly A
FT                   polymerase; PFAM: DHH family; CBS domain; Poly A polymerase
FT                   head domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44968"
FT                   /protein_id="ADO44968.1"
FT                   /translation="MEKVIFLEEGADLDALSSAYGLLLIYPESSIFKPKHLSRRASEVF
FT                   RDFRHLFRIREDLPQEFDLILADTHHYEVYLEEFKGKVKDIIIYDHHPAHMAGVKGKVQ
FT                   QVGSTTTLVVEELMERNMDISPVSATLLSFGIYEDTGFLSYEGTTSRDARALAWLLEKG
FT                   ADLRIVRKYLSDTLSKEQIDMLSKHLQSIESLFFNGKKIVIATLKAEEYEPDLLRIIYD
FT                   LREVRDSSALFVIVSAGYKTYVFGRSLRGELDVNKILEHFGGGGHTFASATKLEGAHAE
FT                   RVKSVLTSLLEGKRVALKVKEVMTSPPFVLHQDTGISDAILELSQRNFAGAPVVDDAGK
FT                   LVGVIYKKSLVRALKHYPEGRVRDFMLEEFHTLTPEDFIWKAEEILSRYGEKLIPVVEG
FT                   DRLVGVITRLDLLYSMRQQTAYLKAYERKIKLPPHIEEVGREIGIIAEGLGFKAYLVGG
FT                   VVRDILLGKEVWDVDFVVEGDAIKVAELLAQKHKVEFHPFPEFGTAHVKVKGLKLELAT
FT                   TRRETYPHPGAYPLVEYASLREDLLRRDFTINAMAVSVNSQDFGTLIDYFGGLRDLKDR
FT                   LIRVLHPLSFVEDPVRILRALRFAGRLGFKLSKSTERLLRSAVSLGAISSAPKGRIMNE
FT                   VRLALREERFLEILELYRKYQILAEIFKGITWSPKLEKKLLRLRDIITWHKIEFPKEVM
FT                   DYGWVYLLVLLEEMKEEEGMAFLRDISAPSWVRETYKIMKRGSKSTEKSLLEAKRNSEV
FT                   YLSLKNKPLYFLLMLMTKENLKEKVKLYLEKLRFVKVNVEKFRGLSGRELGEAIEKEKM
FT                   KIMDEALE"
FT   gene            542533..543390
FT                   /locus_tag="Hydth_0570"
FT   CDS_pept        542533..543390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0570"
FT                   /product="permease"
FT                   /note="COGs: COG0701 permease; InterPro IPR005524; KEGG:
FT                   mka:MK1407 permease; PFAM: permease; SPTR: A8UQJ9 Pyridoxal
FT                   phosphate biosynthetic protein PdxJ; PFAM: Predicted
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44969"
FT                   /protein_id="ADO44969.1"
FT                   /translation="MSMVSLLLSSFYQYCIEILPYFLFAALITSLIQAYVNLNLLRRFL
FT                   TGSKLAPVFTASFGGLLPLCSCSMVPVAQLINHLSKNYSSVVAFLMVAPVVSPITVALT
FT                   YGFFGLKMALLRVFATLVFALVVAYAMDVLFKKNKGPSLHITAGQKSEKKAEIFVKSLR
FT                   YNLFFTGRYLLIGIAIASLIKTFVPIQVVKYIAGSPLSYPLISLVSIPIYVCSGEDVPI
FT                   AKALVQIGFTHGNAFTFMLASSGICMPTILAVKSFLPSRVVFAYAVSWFLLSTLLGFAI
FT                   DVLF"
FT   sig_peptide     542533..542607
FT                   /locus_tag="Hydth_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            543421..543774
FT                   /locus_tag="Hydth_0571"
FT   CDS_pept        543421..543774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0571"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="COGs: COG2018 Uncharacterized distant relative of
FT                   homeotic protein bithoraxoid; InterPro IPR004942; KEGG:
FT                   aae:aq_1847 hypothetical protein; PFAM: Roadblock/LC7
FT                   family protein; SPTR: A8USR5 Putative uncharacterized
FT                   protein; PFAM: Roadblock/LC7 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44970"
FT                   /protein_id="ADO44970.1"
FT                   /translation="MDRYAQVLQELIKNTGLEGASLVSADGLPISSVLKPGLEEDRIAA
FT                   MSAAILSLGERVAEELAKGGLEQITIKGDNGYVILTGVGHDAVMVVLADNNAKLGLLLM
FT                   EIKKAQEKLKALI"
FT   gene            543785..544477
FT                   /locus_tag="Hydth_0572"
FT   CDS_pept        543785..544477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aae:aq_1845 hypothetical protein; SPTR: A8USR6
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44971"
FT                   /protein_id="ADO44971.1"
FT                   /translation="MALTGDLSTFSFVDIFQILAKDRRSGILLVEWQDMTVAYYVKEGE
FT                   VVFARPVDRVFRVYAERDFDNLIDKLRISKESLPKTVERFLISKLGSKEGVFSFTPGFI
FT                   RYNSDMPFYYPIEKLIMIAARTLTPEEVERKISDEMLTFERAHDYVEKIRKAELTREEE
FT                   RILMLVDGERSVADIRRESGLDNLTVDRTLYGLLALGVLRRKKREKRHKPSITLELLAK
FT                   IIERIKEL"
FT   gene            544477..545025
FT                   /locus_tag="Hydth_0573"
FT   CDS_pept        544477..545025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0573"
FT                   /product="small GTP-binding protein"
FT                   /note="COGs: COG2229 GTPase; InterPro
FT                   IPR001806:IPR004130:IPR005225; KEGG: aae:aq_1844
FT                   hypothetical protein; PFAM: protein of unknown function ATP
FT                   binding; SPTR: A8USR8 Putative uncharacterized protein;
FT                   TIGRFAM: small GTP-binding protein; PFAM: Conserved
FT                   hypothetical ATP binding protein; TIGRFAM: small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44972"
FT                   /protein_id="ADO44972.1"
FT                   /translation="MKPIKKIKIVVAGPFAAGKTQFINTVSEIKTVSTERRTRAVGERN
FT                   VKDYTTVAMDFGKIRIDEEHELYLFGTPGQSRFDFMWDILGEGALGIIILVDSTDPSTF
FT                   HEARKIINFFQSRFPVPMVVGANKQDLPNAWSPEDVRVALDIDEEEGIPVLPVSAIDKN
FT                   NVKNVLLTLLNIIREELLS"
FT   gene            complement(545022..546044)
FT                   /locus_tag="Hydth_0574"
FT   CDS_pept        complement(545022..546044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0574"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="COGs: COG0002 Acetylglutamate semialdehyde
FT                   dehydrogenase; InterPro
FT                   IPR000534:IPR012280:IPR000706:IPR016040; KEGG: aae:aq_1879
FT                   N-acetyl-gamma-glutamylphosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; PRIAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; SPTR: A8UQT2
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, dimerisation domain;
FT                   Semialdehyde dehydrogenase, NAD binding domain; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase, common form"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44973"
FT                   /protein_id="ADO44973.1"
FT                   /translation="MEQALRVCIYGATGYTGIELLRILAHHHYVRIVSAVSRTYAGKHI
FT                   SDLLPYFSNSYLSKVPLSEEPQEDFDLAFLCLPHETSLELTPTLLEKGKSVIDLSGAYR
FT                   ISRGELYPEFYGFEHTHKELLNFAVYGLPEIFRNSIKGARLVANPGCYPTVALLSLYPF
FT                   LREGVDFDSIIVDAISGVSGAGRKTTQHFHYPEMEQNIMAYSVQKHRHTPEMEDVIKRL
FT                   SRRDIKVRFTPKVVPASRGMLSTVYIPTQEKRIRDLFYETYKEEKFVKVVQEPPMTKHV
FT                   IGTNMCLIYPYYDERTDTAVVISAIDNLGKGASSQAVQNMNIMMGIDESAGIENLPLFP
FT                   "
FT   gene            complement(546029..546469)
FT                   /locus_tag="Hydth_0575"
FT   CDS_pept        complement(546029..546469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0575"
FT                   /product="ribosomal protein S9"
FT                   /note="COGs: COG0103 Ribosomal protein S9; InterPro
FT                   IPR014721:IPR000754:IPR020574:IPR020568; KEGG: aae:aq_1878
FT                   ribosomal protein S09; PFAM: ribosomal protein S9; SPTR:
FT                   A8UQT1 30S ribosomal protein S9; PFAM: Ribosomal protein
FT                   S9/S16"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44974"
FT                   /protein_id="ADO44974.1"
FT                   /translation="MITKLKDFRIGFDNAYYGTGRRKESIARVWLLRNTDKMIVKVKDS
FT                   GKEFLLKDYVQRSSLFNKILYPLKLTGLEGKFGIYATVEGGGISGQAEAIMYGIGKALL
FT                   KYNPDLRPTLKKAGLLKRDAREKERKKYGLMKARKGYRWSKR"
FT   gene            complement(546466..546900)
FT                   /locus_tag="Hydth_0576"
FT   CDS_pept        complement(546466..546900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0576"
FT                   /product="ribosomal protein L13"
FT                   /note="COGs: COG0102 Ribosomal protein L13; InterPro
FT                   IPR005822:IPR005823; KEGG: aae:aq_1877 50S ribosomal
FT                   protein L13; PFAM: ribosomal protein L13; SPTR: O67722 50S
FT                   ribosomal protein L13; TIGRFAM: ribosomal protein L13;
FT                   PFAM: Ribosomal protein L13; TIGRFAM: ribosomal protein
FT                   L13, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44975"
FT                   /protein_id="ADO44975.1"
FT                   /translation="MKTYRVRPEDVVRNWWIVDAEGKTLGRLASQIAKILRGKHKPYYQ
FT                   PDVDCGDFVVVLNAGKVKVTGKKLEQKVYASHTNYPGGIKERTLKWMLENKPEEVIRLA
FT                   VKRMLPKNRLGHRMLKRLKVYSGSEHPHQAQKPQTLEVKA"
FT   gene            547031..547546
FT                   /locus_tag="Hydth_0577"
FT   CDS_pept        547031..547546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0577"
FT                   /product="PEBP family protein"
FT                   /note="COGs: COG1881 Phospholipid-binding protein; InterPro
FT                   IPR008914:IPR005247; KEGG: aae:aq_1250 hypothetical
FT                   protein; PFAM: PEBP family protein; SPTR: A8UUH2 Putative
FT                   uncharacterized protein; PFAM:
FT                   Phosphatidylethanolamine-binding protein; TIGRFAM:
FT                   conserved hypothetical protein TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44976"
FT                   /protein_id="ADO44976.1"
FT                   /translation="MVLYLLLVLSSLVMGGKLMKVESPSFKNGEVIPQKYTCDGENVSP
FT                   PIAWSGFPEGTKSFVLIVDDPDAPIGTFTHWVVYDIPANTVSLKENFPKSKQVDNIKQG
FT                   INDFGRVGYGGPCPPPGHGYHRYFFKVYALNVESLGLPPGATKEQVESRMKSHILSEGQ
FT                   MMGRYRRD"
FT   sig_peptide     547031..547090
FT                   /locus_tag="Hydth_0577"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(547543..548370)
FT                   /locus_tag="Hydth_0578"
FT   CDS_pept        complement(547543..548370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0578"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.8"
FT                   /note="COGs: COG0320 Lipoate synthase; InterPro
FT                   IPR013785:IPR007197:IPR003698:IPR006638; KEGG:
FT                   ate:Athe_0701 lipoic acid synthetase; PFAM: Radical SAM
FT                   domain protein; PRIAM: Lipoyl synthase; SMART: Elongator
FT                   protein 3/MiaB/NifB; SPTR: B9MQ24 Lipoyl synthase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM superfamily;
FT                   TIGRFAM: lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44977"
FT                   /protein_id="ADO44977.1"
FT                   /translation="MDWLKVKAPQNQVIERTLRVIKKYSLNTVCEESLCPNISECFSEG
FT                   TATFMLMGKVCTRACKYCHVATGRPQKPDASEPHRLYLAVKELALKHTVLTSVDRDDLK
FT                   DYGSGHFKRCVEYIKFRMPEVTIEVLVPDFRGDVSAMKKLISSSPDIIAHNIETVERLF
FT                   KQVRPQGDYRRSLNALKYYADNSNRPVKSGIMVGLGESLDEILKTFEDLRRAGVSRLVI
FT                   GQYLSPSPRHYQVRKYYRPEEFERLRELALSFGFERVLSLPLARSSYHAQNLV"
FT   gene            complement(548372..549175)
FT                   /locus_tag="Hydth_0579"
FT   CDS_pept        complement(548372..549175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0579"
FT                   /product="Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulfur cluster binding domain protein"
FT                   /note="COGs: COG0543 2-polyprenylphenol hydroxylase and
FT                   related flavodoxin oxidoreductase; InterPro
FT                   IPR012165:IPR017927:IPR008333:IPR001433:IPR
FT                   019480:IPR017938; KEGG: pmx:PERMA_0693 putative [NiFe]
FT                   hydrogenasegamma subunit; PFAM: Dihydroorotate
FT                   dehydrogenase, electron transfer subunit, iron-sulphur
FT                   cluster binding domain; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   SPTR: C0QP85 Putative [NiFe] hydrogenasegamma subunit;
FT                   PFAM: Oxidoreductase FAD-binding domain; Iron-sulfur
FT                   cluster binding domain of dihydroorotate dehydrogenase B;
FT                   Oxidoreductase NAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44978"
FT                   /protein_id="ADO44978.1"
FT                   /translation="MHTENPYLLREGRVKKVIREAEGVFTFYIETPIKAFPGQYNMLYA
FT                   FGMGEAPITIAHAENGHLIHTVRAVGDVTKHIDTLKEGDILYYRGPYGNTWDIESAYGK
FT                   HLLIVSGGLGLAATRWIYEKALKEASAFKKLVHLYGAKDYDSLIYRYLYQQWGMGENFL
FT                   ITLDKPDERWKGPKGLITELLKMVNVEPDTVVFMCGPDPMVKAFIAELEKRGVSVRNIY
FT                   VSLERHMKCSVGTCGHCMIGPFFVCKDGPIFRYDRIREFFERKEV"
FT   gene            complement(549176..549673)
FT                   /locus_tag="Hydth_0580"
FT   CDS_pept        complement(549176..549673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0580"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="COGs: COG1566 Multidrug resistance efflux pump;
FT                   InterPro IPR006143; KEGG: aae:aq_986 hypothetical protein;
FT                   PFAM: secretion protein HlyD family protein; SPTR: O67111
FT                   Putative uncharacterized protein; PFAM: HlyD family
FT                   secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44979"
FT                   /protein_id="ADO44979.1"
FT                   /translation="MSLLRLSSILLCFSLAFAKEIKVYAIVEGQVKKVYVKEGDKVKVG
FT                   NVLVEIDPTLYITRRESLSAELESQKLNLEKVERDFKRYEELFNRDLLSKSEYEDWKNR
FT                   YERERSRYISLQAQVERINKLIEYCTLRAPTNGVIRKVLIREGSFVNGTMIPQTLLIME
FT                   ER"
FT   sig_peptide     complement(549620..549673)
FT                   /locus_tag="Hydth_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(549651..550931)
FT                   /locus_tag="Hydth_0581"
FT   CDS_pept        complement(549651..550931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0581"
FT                   /product="outer membrane efflux protein"
FT                   /note="COGs: COG1538 Outer membrane protein; InterPro
FT                   IPR003423; KEGG: aae:aq_1670 hypothetical protein; PFAM:
FT                   outer membrane efflux protein; SPTR: A8UU84 Putative
FT                   uncharacterized protein; PFAM: Outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44980"
FT                   /protein_id="ADO44980.1"
FT                   /translation="MMYLLVILIFSFALGQEVIRLTPQKAYELAWENNAELRKLRYDIE
FT                   SANFQLEEAKNYFLPYVMLGGGLVYNSKTEEWEKPFGVSFISLLYEYKKTSSRIRSAEL
FT                   SSEIKKEALRQLERDIKVRILELFAQANLYKKLTEVKREEMAIAYVRFDRAQQRKELGL
FT                   ATNLEVYQLESIYREKRKDLLQAQYEYNRALLEIKKLVGMDMDTLIDVQDIDLKPQVGD
FT                   IDREKLLAYILKNNPILKIKKKQVETYDELIRQAENILTPRMQIRGEVGNTIRIGIPQT
FT                   RAYNQTGWRAGIEIFVPLFDASSLYRIGSLKAQKRMAQVDLEDTLNELKLLSNSAEYRY
FT                   LYLLAQWDSAVSKNRYAEENLMLRRSEYELELAFDLGYAMAEKSETERQLMQAKYDLLL
FT                   FLARLYALAGLDPYLIFEKSDEFIKTQ"
FT   sig_peptide     complement(550887..550931)
FT                   /locus_tag="Hydth_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(550928..551422)
FT                   /locus_tag="Hydth_0582"
FT   CDS_pept        complement(550928..551422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG2143 Thioredoxin-related protein; InterPro
FT                   IPR012335:IPR017936:IPR012336; KEGG: aae:aq_1669
FT                   hypothetical protein; SPTR: A8UU85 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function, DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44981"
FT                   /protein_id="ADO44981.1"
FT                   /translation="MRKLLMLIFILPFVAFSAVGIPFLKPSLLNLKDDLEDAKRDGKYL
FT                   FIMFHQEGCPFCDKMRKVTFQDKAVQEYFSKHFYMVEIDIRGANEVVDVDGKKMTERQF
FT                   AHKYGVRLTPVFMFFDQKGNVVAKVPGYIEPKDFLLIGRYMVEGHYRDTNLVKFIKENK
FT                   K"
FT   sig_peptide     complement(551372..551422)
FT                   /locus_tag="Hydth_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            551458..552108
FT                   /locus_tag="Hydth_0583"
FT   CDS_pept        551458..552108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0583"
FT                   /product="Rhomboid family protein"
FT                   /note="COGs: COG0705 membrane protein; InterPro IPR002610;
FT                   KEGG: aae:aq_1327 hypothetical protein; PFAM: Rhomboid
FT                   family protein; SPTR: A8UVF7 Putative uncharacterized
FT                   protein; PFAM: Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44982"
FT                   /protein_id="ADO44982.1"
FT                   /translation="MIPIKDINRSRSFPIVNTFLILLCAAVWLHQVGLDEYQENIFIYK
FT                   YGLVPADVFQRPYTLLTHMFLHGSWLHIIGNMWFLWIFGDNVEDRLGRLRYLLFYIISG
FT                   LGAALLQTFVSFVLGGEDVPMVGASGAISGVLGAYLWLFPHARILALVPIFFFLTFMEV
FT                   PALLFIGLWILIQVINGILTLPFAQAGGVAWFAHIGGFAVGYILVKVFYTKRW"
FT   gene            552108..553073
FT                   /locus_tag="Hydth_0584"
FT   CDS_pept        552108..553073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0584"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="COGs: COG1995 Pyridoxal phosphate biosynthesis
FT                   protein; InterPro IPR005255; KEGG: aae:aq_852 pyridoxal
FT                   phosphate biosynthetic protein PdxA; PFAM: Pyridoxal
FT                   phosphate biosynthetic protein PdxA; PRIAM:
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; SPTR: A8UYF6
FT                   Pyridoxal phosphate biosynthetic protein PdxA; TIGRFAM:
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; PFAM:
FT                   Pyridoxal phosphate biosynthetic protein PdxA; TIGRFAM:
FT                   4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44983"
FT                   /protein_id="ADO44983.1"
FT                   /translation="MMLKIGITIGDPAGVGPELVVKLLDHLNPKNAYIIYGERKIIERA
FT                   MRLLGKEHTLRDIYVIDEVKAPGTYIADLDISETDRPIPSLTSGKVAVAYLGRAVVDAA
FT                   YSHIHGLLTMPINKFWAKMAGFSYEGQTEFLAQACNVKDYAMLMYSEKMKVVLLSTHVP
FT                   LRDAIEKVKAQNIKSKVEFVVREFKRLFGYEPSVGVLGLNPHAGEMGQMGREDMEEILP
FT                   AVEELKAKGIKVDGPLSPDSAFLKTDAFDVFLCMYHDQGLIPFKLLAFREGVNLTLGIP
FT                   FVRTSPDHGTAYDIAWKGIADISSSLHALRLCEELATKRA"
FT   gene            complement(553074..553985)
FT                   /locus_tag="Hydth_0585"
FT   CDS_pept        complement(553074..553985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0585"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterPro IPR011990:IPR019734:IPR013026:IPR001440:IPR
FT                   013105:IPR006597; KEGG: saf:SULAZ_1707 tetratricopeptide
FT                   TPR_2 repeat protein; PFAM: Tetratricopeptide TPR_2 repeat
FT                   protein; TPR repeat-containing protein; SPTR: C4FL63
FT                   Tetratricopeptide repeat domain protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2225);
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44984"
FT                   /protein_id="ADO44984.1"
FT                   /translation="MKRQVFKNLLLSVSFLLSSCASAPFYANECRRYLEAGDYQRAIQR
FT                   GKEAIDAYAKNTEPYLCVSTAYLQMGHLEKAIDILKEAERQAPSYEDLALIYNKLGFLY
FT                   HLKGDLDLALTYHQKHLLVSRELSDTKGESTALANMADIYESKGDYTKALFYYNKSVEI
FT                   STDPTDITFAYTNMARIYQKKGENEKALENYLKAYTYAKKTNDRKFIAVSLINVGDAYR
FT                   LVKDFKSASEYLISGLELAKQEKDKKLQAYAYARLGFLYRDKGDRRTAKEFLKRAYDMY
FT                   ISLNDKSGAKSTLSELKKLEGR"
FT   sig_peptide     complement(553899..553985)
FT                   /locus_tag="Hydth_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            554022..554309
FT                   /locus_tag="Hydth_0586"
FT   CDS_pept        554022..554309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0586"
FT                   /product="protein of unknown function DUF503"
FT                   /note="COGs: COG1550 conserved hypothetical protein;
FT                   InterPro IPR007546; KEGG: hya:HY04AAS1_0361 protein of
FT                   unknown function DUF503; PFAM: protein of unknown function
FT                   DUF503; SPTR: A8UTD7 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF503)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44985"
FT                   /protein_id="ADO44985.1"
FT                   /translation="MLLGILKVELFFPENGSLKEKRYYLRSIKDKIKANFNVSVAEIDH
FT                   HDLWQRSQMAIVCVGAERSIVEETLAKVRNFFDRNYPEFIIGMSLDYLKV"
FT   gene            complement(554310..554726)
FT                   /locus_tag="Hydth_0587"
FT   CDS_pept        complement(554310..554726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0587"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="COGs: COG1310 metal-dependent protease of the
FT                   PAD1/JAB1 superfamily; InterPro IPR000555; KEGG:
FT                   aae:aq_1691 hypothetical protein; PFAM: Mov34/MPN/PAD-1
FT                   family protein; SMART: Mov34/MPN/PAD-1 family protein;
FT                   SPTR: A8UU72 Putative uncharacterized protein; PFAM:
FT                   Mov34/MPN/PAD-1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44986"
FT                   /protein_id="ADO44986.1"
FT                   /translation="MLRIKGSALEKAITQAERDYPYETCGLLLGKIEGDVRTVFGCFET
FT                   PNANPDRKNDRYEIDAKDYLKAEEKARQFGLEIVGVYHSHPDHPDRPSAFDEERAFEGW
FT                   SYLILSVNKGKVVSYRSWELFEGKFRQEEIYIFG"
FT   gene            complement(554729..555739)
FT                   /locus_tag="Hydth_0588"
FT   CDS_pept        complement(554729..555739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0588"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="COGs: COG0136 Aspartate-semialdehyde dehydrogenase;
FT                   InterPro IPR012080:IPR000534:IPR012280:IPR005986:IPR
FT                   016040; KEGG: aae:aq_1866 aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerisation region; Semialdehyde dehydrogenase NAD -
FT                   binding; PRIAM: Aspartate-semialdehyde dehydrogenase; SPTR:
FT                   A8UQL4 Aspartate-semialdehyde dehydrogenase; TIGRFAM:
FT                   aspartate-semialdehyde dehydrogenase; PFAM: Semialdehyde
FT                   dehydrogenase, dimerisation domain; Semialdehyde
FT                   dehydrogenase, NAD binding domain; TIGRFAM:
FT                   aspartate-semialdehyde dehydrogenase (peptidoglycan
FT                   organisms)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44987"
FT                   /protein_id="ADO44987.1"
FT                   /translation="MGYRVAIVGATGEVGRAFLKVLEERDFPVDDIQLFASERSEGTFL
FT                   TFRGQKVKVQALNKRGDFKGIDIALFSAGSSVSKEYAPKFASDGAVVIDNSSAWRLDPQ
FT                   VPLVVPEVNPEDVKEHKGIIANPNCSTIQMVVALKPIYDAVGIEAIIVSTYQSVSGAGA
FT                   KAIRELERQTRAWCKGDKIPDPEALPKRIAFNVIPQIDVFTENGYTKEEMKMLNETRKI
FT                   MHDPNIKVSATTVRVPVFYGHSEAVSVKLKKEISPEEVKKILSKAKGVIVFDETSSYPT
FT                   ALDVAGRDEVFVGRIRRDLVFDPGISMWIVADNIRKGAATNAVQIAELLTQFAMV"
FT   gene            555794..557101
FT                   /locus_tag="Hydth_0589"
FT   CDS_pept        555794..557101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1807 4-amino-4-deoxy-L-arabinose
FT                   transferase and related glycosyltransferase of PMT family;
FT                   KEGG: pmx:PERMA_0445 hypothetical protein; SPTR: C0QU70
FT                   Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44988"
FT                   /protein_id="ADO44988.1"
FT                   /translation="MSLLPNINTYQFRNEESLRVTIAYEMSKSSQYLQPYLLGEPYYNK
FT                   PPLFNWLIALYSNFIPWSELTARAVSLTFLALTLLVIFIFSYHLFKNLSLSLLSALSFL
FT                   TFGNVLFFYGYLAEIDMTFAFFTFCMMLSLHVWLRQDKLLWGVCASFLAGIGALLKGFP
FT                   AYAFYALTFLSLVIYQIRWNILTSRKVLLVHSISLILPALWLVNTCDPLLYLKTLFDES
FT                   FSRVSSGDFSRTKHMLTFPFFNLKDMLPNSLLFLVALYMLIRQRKFEFPQDIRLLSLVF
FT                   FVNYLPYLFSNSAGRYVMPLYPLLAVIFSFYMHKSTENAGFRKLFYTTILLTILLRFAY
FT                   GFVYFEYFNQRESSRKLIAEKIIKSIDLSSAIECQCRQELSVCLYVSLAKGEPLKQKLP
FT                   NALYSISCEEEKTGEVLMRFHVDSYQIKLLRLKPNG"
FT   gene            complement(557078..557752)
FT                   /locus_tag="Hydth_0590"
FT   CDS_pept        complement(557078..557752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0590"
FT                   /product="protein of unknown function DUF500"
FT                   /note="COGs: COG2930 conserved hypothetical protein;
FT                   InterPro IPR007461; KEGG: gem:GM21_2073 protein of unknown
FT                   function DUF500; PFAM: protein of unknown function DUF500;
FT                   SPTR: C6E930 Putative uncharacterized protein; PFAM: Family
FT                   of unknown function (DUF500)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44989"
FT                   /protein_id="ADO44989.1"
FT                   /translation="MKFIFAILALVSLALAVDKEDMERLVEESTWVVKDLRLGAEGIPE
FT                   ELLKRARGVIVCPGLIKGAFIFGGGGGNCTVSYRNPTTGEWSAPAFYTLAQASVGFQIG
FT                   VESVDLLLVVNTDRGMRSLLRNKVKLGADLSVAAGPAGRSASASTDLALKADIYSYSKA
FT                   KGIFAGVSLQGAVLIPYEDGISAYYGKHLTPKEILFGKVQMPPSAVKFTQTLKALTVRF
FT                   QP"
FT   sig_peptide     complement(557705..557752)
FT                   /locus_tag="Hydth_0590"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(557749..558834)
FT                   /locus_tag="Hydth_0591"
FT   CDS_pept        complement(557749..558834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0591"
FT                   /product="putative (NiFe) hydrogenase, beta subunit"
FT                   /note="InterPro IPR017896:IPR017900:IPR009051; KEGG:
FT                   pmx:PERMA_0694 putative [NiFe] hydrogenase, beta subunit;
FT                   SPTR: C0QP86 Putative [NiFe] hydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44990"
FT                   /protein_id="ADO44990.1"
FT                   /translation="MFFLEKDRLIEVFERLKGDYTVIAPKIEKGAILYQRVSAFEDLPF
FT                   GYRDHQKPGYYRIEKMDTEEFFTYTHPVNSLKNFLHPPELTLIRVEKGDKRVRFSYDVP
FT                   RERYAFFDVRACDLKALKILDGVFIEKNNFPDPYYRSLRENIFVVAVNCTYATDVCFCA
FT                   TLSSGPEVKEGFDICLTEIREGFVVEVGSNKGMELLKDMHLKEANKEQIKEKERRVANL
FT                   KVREEKLPEDLRDRLYEAMEHPFWDQVAKRCLACTNCTQVCPTCFCFDVLEINDMDLKE
FT                   SVRMRVWDSCFNSSFATLHKFNLRESIMSRYRQWLMHKFAYWVDQFDTLGCVGCGRCIT
FT                   WCPVGIDVLESVKELLKEIGS"
FT   gene            complement(558834..559943)
FT                   /locus_tag="Hydth_0592"
FT   CDS_pept        complement(558834..559943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0592"
FT                   /product="peptide chain release factor 2"
FT                   /note="COGs: COG1186 Protein chain release factor B;
FT                   InterPro IPR005139:IPR000352:IPR004374; KEGG: aae:aq_1840
FT                   peptide chain release factor 2; PFAM: Class I peptide chain
FT                   release factor; PCRF domain protein; SPTR: O67695 Peptide
FT                   chain release factor 2; TIGRFAM: peptide chain release
FT                   factor 2; PFAM: PCRF domain; RF-1 domain; TIGRFAM: peptide
FT                   chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44991"
FT                   /protein_id="ADO44991.1"
FT                   /translation="MLADIKNKLEELKEKLLDVQQAMDISSMKEELKKIDMSMSSTNFW
FT                   EDQGKAKEITQRRKWLEETIKEFERIKSTLETLQELLEEVDEEDLETLSMIAEEIQSVE
FT                   KPIRDLEIKTFLSEEMDKNNAYLTVQAGAGGTEACDWASMLLRMYRRWAEKHGYEVEVI
FT                   DINPDDVAGIKSATLLIKGPYAYGYLKGESGVHRLVRISPFDANARRHTSFASVSVVPQ
FT                   IDEKINIEIREEDIQMETFRASGAGGQYVNKTDTAVRIRHIPTGITVSCQQERSQFQNR
FT                   LKALELLKAKLYQLELQKLEEKKKALEGEKTDIGWGYQIRSYVFQPYQMVKDLRTGLEV
FT                   GNVDAVMDGDIDSFIEEYLRWKAKEKVKV"
FT   gene            559964..560995
FT                   /locus_tag="Hydth_0593"
FT   CDS_pept        559964..560995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0593"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="COGs: COG0536 GTPase; InterPro
FT                   IPR014100:IPR006073:IPR006169:IPR002917:IPR 005225; KEGG:
FT                   aae:aq_2069 GTPase ObgE; PFAM: GTP1/OBG sub domain protein;
FT                   GTP-binding protein HSR1-related; SPTR: A8UU76 GTP-binding
FT                   protein; TIGRFAM: GTP-binding protein Obg/CgtA; small
FT                   GTP-binding protein; PFAM: GTPase of unknown function;
FT                   GTP1/OBG; TIGRFAM: Obg family GTPase CgtA; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44992"
FT                   /protein_id="ADO44992.1"
FT                   /translation="MFVDKVKIHVKAGDGGDGAVAFLREKYKPFGGPAGGDGGKGGDVI
FT                   LLATSRKHTLYDFKHKRHFRAKSGEKGRGKNQHGKDGEDLVLEVPLGTVVIDASSGKVL
FT                   CDLTEEGQRCVVAKGGRGGRGNARFATPTNQAPRYAEKGEKGEEKWIVLELKLIADIGI
FT                   IGLPNAGKSTLISKLTKAKPKIADYPFTTLSPVLGVMQLEDGRRIVLADIPGLIEDASA
FT                   GKGLGLEFLRHIERTKLLLHLIDVSDLRQTDPVDAFKKVNAEMEKYHPKLLEKRQIVVG
FT                   TKIDMLSDKNTLQKLEEEFSKMGYPFVAISSHTGEGLEELKEIIIKEMEVETVDKSYTK
FT                   PLQ"
FT   gene            560964..561338
FT                   /pseudo
FT                   /locus_tag="Hydth_0594"
FT   gene            561329..561808
FT                   /locus_tag="Hydth_0595"
FT   CDS_pept        561329..561808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0595"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG1225 Peroxiredoxin; InterPro
FT                   IPR012335:IPR017936:IPR000866:IPR017937:IPR 012336; KEGG:
FT                   sus:Acid_3880 redoxin domain-containing protein; PFAM:
FT                   alkyl hydroperoxide reductase/ Thiol specific antioxidant/
FT                   Mal allergen; SPTR: A8USJ6 Peroxiredoxin-like protein;
FT                   PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44993"
FT                   /protein_id="ADO44993.1"
FT                   /translation="MPLKVGERAGNFELSSYEGKRYSLYETPGYVLLVFYKVTCPTCQL
FT                   TLPFVEKMYKLYGDAITFYGIVQDSDKDAKEFANKYGLTFPQLVDYPTYQVSQKYGVEV
FT                   VPTLYLLNPEKTIEFVSSSFVKADLDKLNSRLSAVAGKEEVDIFAGTHVPVFKPG"
FT   gene            561850..562521
FT                   /locus_tag="Hydth_0596"
FT   CDS_pept        561850..562521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0596"
FT                   /product="alanine racemase domain protein"
FT                   /note="COGs: COG0325 enzyme with a TIM-barrel fold;
FT                   InterPro IPR011078:IPR001608; KEGG: aae:aq_274 hypothetical
FT                   protein; PFAM: alanine racemase domain protein; SPTR:
FT                   O66631 UPF0001 protein aq_274; PFAM: Alanine racemase,
FT                   N-terminal domain; TIGRFAM: pyridoxal phosphate enzyme,
FT                   YggS family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44994"
FT                   /protein_id="ADO44994.1"
FT                   /translation="MSCEKLREVEERLQKACERAGRKREEVVLLGASKSVPAQRIREFY
FT                   ACGLSTFGENRVQEFLKKYQALEDIAIDWHFIGRLQSNKVKYILGKVSLIHSLDRDSLA
FT                   QEINKRANVVQNVLIEVNVAGEKTKGGIVPENLLAFYQHLLSYKNLRVLGLMCIPPYTE
FT                   DPEKARPYFAKLRELKEKLESEFLVKLPHLSMGMSTDFEVAIEEGATIVRIGTLLFGER
FT                   R"
FT   gene            562537..563949
FT                   /locus_tag="Hydth_0597"
FT   CDS_pept        562537..563949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0597"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="COGs: COG0008 Glutamyl- and glutaminyl-tRNA
FT                   synthetase; InterPro
FT                   IPR020060:IPR014729:IPR020061:IPR020752:IPR
FT                   020751:IPR020058:IPR001412:IPR004527:IPR008925; KEGG:
FT                   aae:aq_1221 glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; SPTR: O67271 Glutamyl-tRNA synthetase; TIGRFAM:
FT                   glutamyl-tRNA synthetase; PFAM: tRNA synthetases class I (E
FT                   and Q), catalytic domain; TIGRFAM: glutamyl-tRNA
FT                   synthetase, bacterial family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44995"
FT                   /protein_id="ADO44995.1"
FT                   /translation="MVITRFAPSPTGYLHLGNARTAIFSYLFARHHRGKFILRIEDTDL
FT                   ERSTKEFEAMLLEDLKWLGLDWDEFYRQSERFDIYREYAQRLIELGHAYPCFCTPEELS
FT                   IERQEAEKKGIPYRYSGKCRVLDKKQVEELKESGKSYTIRFKVPYGEYVVFEDLIKGHI
FT                   AINTDDFGDFVIIRSDGTPTYNFVVVIDDALMGITHVIRGEDHIPNTPKQILIYRALGF
FT                   DVPKFAHLPVILGEDRSKLSKRHGAVSVRNYREEGYLPQALFNYLCLLGWSSPQEGKEI
FT                   YSKEELIEIFDLKDINTSPAVFSKEKLRWMNGVYIREVLSLEELIDGITPFLKQAGYDV
FT                   SDRDYLKRVLEKTRDSFETFKEAGDRLKPFFVDDFDISQDAWSELENARVYDILSVFLE
FT                   KIKDRQLNAQSVKEMAREIQKELNVKAKDVWHSLRIALTGELEGVGVDILCDILPKEKI
FT                   VLRVERLLKKIA"
FT   gene            563946..564992
FT                   /locus_tag="Hydth_0598"
FT   CDS_pept        563946..564992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0598"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /note="COGs: COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase; InterPro
FT                   IPR004276:IPR007235:IPR006009; KEGG: aae:aq_1177
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; PFAM:
FT                   Glycosyltransferase 28 domain; glycosyl transferase family
FT                   28; SPTR: O67238
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase;
FT                   TIGRFAM:UDP-N-acetylglucosamine--N-acetylmuramyl-
FT                   (pentapeptide) pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase; PFAM: Glycosyltransferase
FT                   family 28 N-terminal domain; Glycosyltransferase family 28
FT                   C-terminal domain; TIGRFAM:
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44996"
FT                   /protein_id="ADO44996.1"
FT                   /translation="MKFFVAGGGTGGHFFPALALIECMLERGLNVEFVGSQRGIEYRFK
FT                   DSIPCKAHFLKSHPFVGKGPLEKAKAVYYALTEGLKLLRHTSNAKGVVFGGYASLPLGL
FT                   ALSLRRKGLYLHEQNSVPSTTNTLLSKFSEKVFITFEHSRRFFPQDKVIKTGLPVRKRL
FT                   LQNFIKEDIKESFGFDKGKPVLLVMGGSQGASFLNQLATEIFSSLPLQGIHITGERDKD
FT                   KVESFYKERKLPVKVFAFSEDMSHIYGASDLAISRAGASSITELSLFGIPSLFIPFPFS
FT                   ARDHQFYNAKEIEDLGGGLVIKQEDATLQKVINGIELMLSQRDNFSRNIKRFANPYACQ
FT                   DILRLLVA"
FT   gene            565051..565941
FT                   /locus_tag="Hydth_0599"
FT   CDS_pept        565051..565941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0599"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="COGs: COG1210 UDP-glucose pyrophosphorylase;
FT                   InterPro IPR005835:IPR005771; KEGG: hya:HY04AAS1_0611
FT                   UTP-glucose-1-phosphate uridylyltransferase; PFAM:
FT                   Nucleotidyl transferase; SPTR: B4U837
FT                   UTP-glucose-1-phosphate uridylyltransferase; TIGRFAM:
FT                   UTP-glucose-1-phosphate uridylyltransferase; PFAM:
FT                   Nucleotidyl transferase; TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44997"
FT                   /protein_id="ADO44997.1"
FT                   /translation="MQVRKAVLPVAGWGTRFLPATKAMPKEMFPIIDKPVIQFIVEECI
FT                   SADIENIIFVTGRHKRPIEHHFDINTDLEKHLEQCGKMDLLRNIMEISRLINPIYVRQK
FT                   EQLGLGHAVLVAEPVVGYEPFVVALGDIIIKDERNVLERMIEVYNRFGKSVIAVFEVDL
FT                   KDVSKYGIVDGRLIERDIYIVDHLIEKPKPEEAPSHLAIVGRYLFTPRIFEKLKITPPG
FT                   KGGEIQLTDAIRLLIEDEAVYAIKIDAKVYDTGTPLGYIQTVLDFALQRDDIRDDLISY
FT                   LRQLLSNNIPQIDTV"
FT   gene            complement(565907..568498)
FT                   /locus_tag="Hydth_0600"
FT   CDS_pept        complement(565907..568498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0600"
FT                   /product="surface antigen (D15)"
FT                   /note="COGs: COG4775 Outer membrane protein/protective
FT                   antigen OMA87; InterPro IPR010827:IPR000184; KEGG:
FT                   aae:aq_050 hypothetical protein; PFAM: surface antigen
FT                   (D15); surface antigen variable number repeat protein;
FT                   SPTR: A8URZ1 Putative uncharacterized protein; PFAM:
FT                   Surface antigen variable number repeat; Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44998"
FT                   /protein_id="ADO44998.1"
FT                   /translation="MFFLLLLISPLIVTGKVFIMSNYPLPGNNLEKVVNEKNYLQMVEV
FT                   IKNIEGVKDVFTMQEGGDVYVYVERYPILKKVVIKGNVALWRDTIMSHLGLYEGMPLKD
FT                   INKESIEERLRRLYRDEGFLDAKVGVTLDLTEDGYVYLYIGIDEGDIYFTAGGRYEGTS
FT                   FKEDELNKALGLVKGQIARESEFEDKVFTLQDFYINRGYLDSFVYFKGIKKEELKKPFL
FT                   NVLFPTDERITRKPLRMVGSLVDGFSNFIRHPVGVFEALTGRAKVAYPTFSIIEGSKYK
FT                   IEFEGAKYFDSNYLLDISQLKEKGVDPFSLEEAKEILESAYKKKGFFDVSISYKAQGSY
FT                   VVFSIAEGERYTALLEGEEFPYDEDVIKSILDKEVQKLKREKYTLAEGSYSLKVDRDKK
FT                   IVYVELNINKGKRQILSRFLYKGNDREIAKIFREYNDKLPAVYNTDLIEALNIDIKNYL
FT                   LRKGYMEGDFSIDVSLQEDEESIYYTYIYTVKEGPRYKLGEDLYYGYHHTSSRELSYMT
FT                   VRREFYSESDTNRTLSNMITSDIFSGVKIDTFLDKDKKEVHRLIQLSEDKRGLYDLSLG
FT                   YNTEEKIVIDTFLGWKNLLGIGWNTGLRYRKTGKRELYNLELSDNFLFTRKLWFKASIF
FT                   RNYEEHRSYTLTSKGFTSSLGYRLTNNTSVGPIVSRTTNLALGERIDISKYGIFLLREY
FT                   KDDIFSPKRVHYDSVSITRATGDREYTKFELSTFYLIPLRKGLKLSFKVAGGYVGRSAP
FT                   IFERFFLGGLRDLRGYNFESVGQPNGGRYYTFGRIELEFPIKGPFVGIIFGDAGNVGDK
FT                   LSQTIKNPKKDAGISAGIKTPVGPIRFDVAIPLEKSAPRRIRLYLSVGYYY"
FT   gene            568520..569638
FT                   /locus_tag="Hydth_0601"
FT   CDS_pept        568520..569638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0601"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro
FT                   IPR001176:IPR015421:IPR004839:IPR015424; KEGG: aae:aq_421
FT                   aminotransferase; PFAM: aminotransferase class I and II;
FT                   SPTR: O66737 Aminotransferase (AspC family); PFAM:
FT                   Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADO44999"
FT                   /protein_id="ADO44999.1"
FT                   /translation="MERISKISPFMVMEILKEASNIDHVIHMEIGEPDLDPPPSVIESL
FT                   ERAIKDRRYFYTPSLGIGELREKIAEHYYKKYRVDISPHRVVITTGTSGAFLVAYSILM
FT                   SAGEKVVLADPSYPCYKNFAHLLDINPVFLPVDESTNYIISVDMLKEHRDIKALHISSP
FT                   SNPTGSVYGKEDLASLVEYCQERDIYFISDEVYQGLVYDREEHTALEFSDGAIVISGFS
FT                   KWFCMPGFRIGWMILPEELIPKAERVIQNVFISAPTLSQYAALGAFDYEYLEKVKQTFK
FT                   KRRDILYEGLKDLFEVPVKPEGAFYIWANIDRYSEDSETFCREVLKNAKVAITPGTDFG
FT                   KNKTENFVRFSYTKDEEALREGLRRIKNYLIK"
FT   gene            complement(569623..570279)
FT                   /locus_tag="Hydth_0602"
FT   CDS_pept        complement(569623..570279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0602"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="COGs: COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)protein; InterPro
FT                   IPR006664:IPR006665; KEGG: aae:aq_2147 peptidoglycan
FT                   associated lipoprotein; PFAM: OmpA/MotB domain protein;
FT                   SPTR: O67903 Peptidoglycan associated lipoprotein; PFAM:
FT                   OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45000"
FT                   /protein_id="ADO45000.1"
FT                   /translation="MKRSLFLSLALLGSVAFAEQSLDPCGSPKEVYSKYLLDKCYKGYF
FT                   DAIIEAKKKSEEALNKANEALGKANEALNKANDLEGRVSKLEGIVDDHEKRIKALESRE
FT                   IPKGGWQLEEIGAVYFDFDKFNIKKSQAPKLDDIASKIQSDTREVLIVGFADTRGSSKY
FT                   NFNLSMYRAQIVASYLAKKGVDIGRMRIASYGKEVAKLISPKYAEQRVVRIYFIK"
FT   sig_peptide     complement(570226..570279)
FT                   /locus_tag="Hydth_0602"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(570349..570675)
FT                   /locus_tag="Hydth_0603"
FT   CDS_pept        complement(570349..570675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0603"
FT                   /product="methionyl-tRNA synthetase, beta subunit"
FT                   /note="COGs: COG0073 EMAP domain; InterPro
FT                   IPR012340:IPR002547:IPR004495:IPR016027; KEGG: aae:aq_422
FT                   methionyl-tRNA synthetase beta subunit; PFAM: t-RNA-binding
FT                   domain protein; SPTR: A8UWP7 Methionyl-tRNA synthetase beta
FT                   subunit; TIGRFAM: methionyl-tRNA synthetase, beta subunit;
FT                   PFAM: Putative tRNA binding domain; TIGRFAM: methionyl-tRNA
FT                   synthetase C-terminal region/beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45001"
FT                   /protein_id="ADO45001.1"
FT                   /translation="MEVIGIEDFLKLDIRLAKIVDAQRVEGSEKLLKLKVSLGGEERVV
FT                   VAGIAKHYKPDELIGKKILLLANLKPRKILGIESQGMVLALSDGERLSLIVPDREMEEG
FT                   TRVS"
FT   gene            complement(570700..571551)
FT                   /locus_tag="Hydth_0604"
FT   CDS_pept        complement(570700..571551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0604"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_1581 hypothetical protein; SPTR:
FT                   A8UU71 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45002"
FT                   /protein_id="ADO45002.1"
FT                   /translation="MKRIITAATILLFSCGGGGGGGGTTPPASSVSLYFTDDMSVYPSI
FT                   LVTVYEVNLCSDQQCQQKVNLFSSQQGLEVDLAKLNGILQYITTTSIPQGTYNRLEVVM
FT                   DKNLTITDPSNQTHPAVFSPMQEKPNKPNTVQCDTQKCYIRFNGTVNPFATGKLIVDFV
FT                   LKEFEVNTLTSPWLVTEVKMKPLTPEEMRGISYEREIHLRVQSVNAQSNSFTGTWMGKT
FT                   FTVNISPNIRECEIYKIKYPPNTCVNQIAPSMCLEVKVQEDPATSTTLTAIKIETDKKC
FT                   MN"
FT   sig_peptide     complement(571462..571551)
FT                   /locus_tag="Hydth_0604"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(571572..573056)
FT                   /locus_tag="Hydth_0605"
FT   CDS_pept        complement(571572..573056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0605"
FT                   /product="glycosyl transferase family 39"
FT                   /note="COGs: COG1807 4-amino-4-deoxy-L-arabinose
FT                   transferase and related glycosyltransferase of PMT family;
FT                   InterPro IPR003342; KEGG: aae:aq_1220 hypothetical protein;
FT                   PFAM: glycosyl transferase family 39; SPTR: O67270
FT                   Uncharacterized protein aq_1220; PFAM:
FT                   Dolichyl-phosphate-mannose-protein mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45003"
FT                   /protein_id="ADO45003.1"
FT                   /translation="MLYLLLLIVAANYYLNLGLSQVWMPNESFYAEASKNMMETGDFLT
FT                   PYYNGNVRIEKPPLTYWIVSLGYYLFGINEWGLRFFHATLGLLLGIITFLLSYEQSKNY
FT                   KVSLLSALILLTSFQFFANARYASPEIPFTFFIALSIYFWLKAYKKNHIPLLLLAFICS
FT                   TLAILTKGPAGFVIPAGVVFFYLLVSDPKELLKKRYYLLTLLLIPPSFWWHIFEFFSHK
FT                   KEFLEVFYVENLKRVYAGNDPFYFYFLDTAVSFMPYSFLVFFALLWTFIKKKKELTIFV
FT                   VWLLLVFLIFSFIKSKIPVYVLPAYPAMAILTANFVLSSDWKSIIKYSSTFITLLISSA
FT                   ILLTTFYFQLETAYAVLALLPLPFLLRNYAIAPLVAGIAFLIFANTGLLHYLESFRHYK
FT                   EVGNFIKNLDPSNTLKTYQVGYFHHNLPFYADRTIIRDRYPEKPSIVIFKIGSFEGCKP
FT                   TKLWKLYTSSESRFITFLLDTKRGKRLEEFGVCLYN"
FT   gene            complement(573071..574285)
FT                   /locus_tag="Hydth_0606"
FT   CDS_pept        complement(573071..574285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0606"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterPro IPR001453:IPR005110:IPR005111:IPR020817; KEGG:
FT                   aae:aq_030 molybdenum cofactor biosynthesis protein A;
FT                   PFAM: MoeA domain protein domain I and II; molybdopterin
FT                   binding domain; MoeA domain protein domain IV; SPTR: O66448
FT                   Molybdenum cofactor biosynthesis protein A; TIGRFAM:
FT                   molybdenum cofactor synthesis domain protein; PFAM:
FT                   Probable molybdopterin binding domain; MoeA N-terminal
FT                   region (domain I and II); MoeA C-terminal region (domain
FT                   IV); TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45004"
FT                   /protein_id="ADO45004.1"
FT                   /translation="MIPYEEALSKVLEHTKLIDTERVFINQSLGRVLAEDVMADTDKPP
FT                   FDNSAMDGYAVRYEDIKDASQEKPVKLKVLGEIPAGEETAYKMEKGTAVKIFTGAPIPE
FT                   GADTVIPFELTQEENHYILIKEPLKLGSNVRRKGEEIKEGEVVLKAGTLIRPYEMGIMA
FT                   SVNRVVVSVYRKPRVAVLATGDEIKDVGEPIEKLSQIRSSNSYVLFAQILRSGGEPHYL
FT                   GIVKDNEEEIGKFLKHIDYYDVFITTGGVSMGGKDYVQHLVKEYGIDVKFHRVRIKPAK
FT                   PVLFGTYKDRGLFFGLPGNPVSCTMAFDLLVHPALLKMSGRKDYIPKVFKAILKEDFIR
FT                   RDAERREFVRAFVSFDGEKAYCSYSHKTQSHMLTSYIDMNAYMVVYEGIKEIKKGSLVD
FT                   VIMFP"
FT   gene            complement(574296..575498)
FT                   /locus_tag="Hydth_0607"
FT   CDS_pept        complement(574296..575498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0607"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG1812 S-adenosylmethionine synthetase;
FT                   InterPro IPR002795; KEGG: aae:aq_1226 S-adenosylmethionine
FT                   synthetase; PFAM: S-adenosylmethionine synthetase (MAT);
FT                   PRIAM: Methionine adenosyltransferase; SPTR: A8UR31
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase (AdoMet synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45005"
FT                   /protein_id="ADO45005.1"
FT                   /translation="MANIVVTPMTFAPVYQQFAEIVERKGIGHPDTICDNLAENLSREL
FT                   CRWYLSEFGAIMHHNVDKALLVGGVSNAYFGGGEVIQPIEIYLVGRAILEKNTKRLDIE
FT                   ELVRETAKNWLRNNIKNMDVDKHVKIYTKIRPGSKDLVELFERFQKRGEVPLANDTSFG
FT                   VGFAPFDDLERAVYEAERFLNSEALKKEHPEVGEDIKVMGVRIENKIRLTVALAFVSKY
FT                   IKNINEYFARKEELTRKVKTYIEGLLGREVQVHINTADSKENGSVYITVTGTSAEQGDD
FT                   GQVGRGNRVNGLITPYRPMSLEAAAGKNPISHIGKMYNTVASIITQRVVKEVEGIEEAY
FT                   CYIVSQIGKPINEPQILDVKVRTSRNINTLQEEVKKIAKEELDRMPSIWKGFLEGIYTV
FT                   A"
FT   gene            complement(575539..576558)
FT                   /locus_tag="Hydth_0608"
FT   CDS_pept        complement(575539..576558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0608"
FT                   /product="glycine cleavage system T protein"
FT                   /note="COGs: COG0404 Glycine cleavage system T protein
FT                   (aminomethyltransferase); InterPro
FT                   IPR006223:IPR006222:IPR013977; KEGG: aae:aq_1458
FT                   aminomethyltransferase (glycine cleavage system T protein);
FT                   PFAM: glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel; SPTR: O67441
FT                   Aminomethyltransferase; TIGRFAM: glycine cleavage system T
FT                   protein; PFAM: Aminomethyltransferase folate-binding
FT                   domain; Glycine cleavage T-protein C-terminal barrel
FT                   domain; TIGRFAM: glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45006"
FT                   /protein_id="ADO45006.1"
FT                   /translation="MKSPLYELHRQLKAKMFEFAGWQMPLYYSSIKEEVKAVRDECGIF
FT                   DVSHMGRILMKGPSALETLDYLTTNHVKKLSPGKVQYSMITNHQGGVVDDITLYMLDQE
FT                   SFMLCINAANRKKVINWLSKYHHVEDISGSTLQLALQGKKSVDVLSALFPVGEIKRYNF
FT                   KVFDGIIVSRTGYTGEDGFEIYASIKEGLGIFKELIKYAKPCGLGARDVLRIEAGLPLY
FT                   GHEISEDITPFEANLDRFVCTDKDFLGKSAMLKREIHRKLFGLELLQRGVPREDYRIYL
FT                   SDMEIGRVSSGTYSPTLDKGIALCFVDISFRKEGLEVELDVRGKRLKALLRNYPFVHR"
FT   gene            576583..577641
FT                   /locus_tag="Hydth_0609"
FT   CDS_pept        576583..577641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0609"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="COGs: COG0795 permease; InterPro IPR005495; KEGG:
FT                   aae:aq_359 hypothetical protein; PFAM: permease YjgP/YjgQ
FT                   family protein; SPTR: O66685 Uncharacterized protein
FT                   aq_359; PFAM: Predicted permease YjgP/YjgQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45007"
FT                   /protein_id="ADO45007.1"
FT                   /translation="MLGKYVLFFYIKLFIVVNAILLGIVSSYALAELLFLFKEKSANIA
FT                   ISYLLNLLPISFFYLLPFSAVITMMILLKHIFSKKLDLIVQSFGVSPLKFLLNIILFLV
FT                   FVSFFNLIMSFDVYPESNKNLYSIEKEFKKRQEVEDLIVRNAWFFKEESGERIYINFQF
FT                   VDIKDGNIAGVFLVKSSKSNILEVIQSDRGSWKGDIILLPIAKVWNIKEGNFVAKGISI
FT                   KLFEIKNAQPIGEKVEHISLHQLLLLYSLGKRVGLNYHLYLSEIIRRFLSSLSPIAIGI
FT                   TVMSYAIKRRSILAGFLSFVPAFFFYWFSFVLTRFFSESVSFNPLYGLFAYIPLVILSL
FT                   KGLYYLGKGFRV"
FT   sig_peptide     576583..576675
FT                   /locus_tag="Hydth_0609"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(577600..578340)
FT                   /locus_tag="Hydth_0610"
FT   CDS_pept        complement(577600..578340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0610"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="COGs: COG0149 Triosephosphate isomerase; InterPro
FT                   IPR013785:IPR000652:IPR020861; KEGG: aae:aq_360
FT                   triosephosphate isomerase; PFAM: triosephosphate isomerase;
FT                   PRIAM: Triose-phosphate isomerase; SPTR: O66686
FT                   Triosephosphate isomerase; TIGRFAM: triosephosphate
FT                   isomerase; PFAM: Triosephosphate isomerase; TIGRFAM:
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45008"
FT                   /protein_id="ADO45008.1"
FT                   /translation="MKLISANWKMNMTPSQTKEYLYNFLPLVEDVKDREILLCVPYTSL
FT                   CIASEMLKDKHVKFGAQNVHYEPKGAFTGEISVSMLKDLGVSYVIVGHSERRWLFGESD
FT                   EIINKKLIACLGSGIRPILCVGERQDEREAGLTFKVIETQVKLALSSLEDYTDMIDIAY
FT                   EPVWAIGSGNPATPEDAQKVHRFIKELLESLNKNYKGTTRILYGGSVNIHNASEFMKMP
FT                   DIDGLLVGGASLDPEAFSQIVKSF"
FT   gene            578453..579625
FT                   /locus_tag="Hydth_0611"
FT   CDS_pept        578453..579625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_0960 hypothetical protein; SPTR:
FT                   B4U936 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45009"
FT                   /protein_id="ADO45009.1"
FT                   /translation="MRKSLLAMAALMGATVLPSQAAVIRVDEDTFANMGLKLQIWAQHL
FT                   GKTTPGGKDYNDFSINGARVYFSGQVNKFVQFGANLDFALYQGSSGRTNHGGTRESRAN
FT                   DAFINLKPMEEFQIMAGVYRLPFSRASLTDSYTYLIPTGYGYSTRGNLFAPFTIGSNVA
FT                   NAYRDTGLTVWGNIADGMLKYQIGIFDGRWDHVHPLGVKDNLAFAGRIQFTPTMLGFKG
FT                   EKGFTLADTYLGKQNVLSIGLGYNTQKWDNGAGDSATGKAWTVDAMWEQKFGDIVPNLQ
FT                   LGYQDRKDMPAGTTSPIAKSKDRAYYVQGQLLYDQVVGLGKPALAIRYEKLDDRTAANK
FT                   DTNRTGVFLNYYIKGQDAKIQLGADVVSLKNKSPNEKNYTDWTLALQTQF"
FT   sig_peptide     578453..578515
FT                   /locus_tag="Hydth_0611"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(579673..580533)
FT                   /locus_tag="Hydth_0612"
FT   CDS_pept        complement(579673..580533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0612"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /note="COGs: COG0382 4-hydroxybenzoate
FT                   polyprenyltransferase and related prenyltransferase;
FT                   InterPro IPR000537:IPR006371; KEGG: aae:aq_052
FT                   4-hydroxybenzoate octaprenyltransferase; PFAM: UbiA
FT                   prenyltransferase; SPTR: O66464 4-hydroxybenzoate
FT                   octaprenyltransferase; TIGRFAM: 4-hydroxybenzoate
FT                   polyprenyltransferase; PFAM: UbiA prenyltransferase family;
FT                   TIGRFAM: putative 4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45010"
FT                   /protein_id="ADO45010.1"
FT                   /translation="MTIKDKLKSYAQLVKFEHTIFALPFALASLLILYKSLPSPQKVFW
FT                   VVVALVSARTAGMALNRLIDLPIDQKNPRTKNWVHASGKVKKHDMLAIILVSSMIFLVS
FT                   TAFINLYTFLLSPVVLFLLWLYPYSKRFTNFPHLVLGAVYFLIPLGVDIALNERVSFLS
FT                   ILLGMAMAFWVAGFDVLYSLQDYEFDKRHGIGSLAVKLGIKNAILMARLFHMATLLCLL
FT                   ALGFASPKLSFIYFIGLILLSGFLFYEHSLVKPYDLSKVNKAFFTVNGYISLVFLLVVL
FT                   LDIIF"
FT   gene            580562..581962
FT                   /locus_tag="Hydth_0613"
FT   CDS_pept        580562..581962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0613"
FT                   /product="replicative DNA helicase"
FT                   /note="COGs: COG0305 Replicative DNA helicase; InterPro
FT                   IPR016136:IPR007694:IPR018062:IPR007692:IPR
FT                   007693:IPR003593; KEGG: aae:aq_1472 replicative DNA
FT                   helicase; PFAM: DnaB domain protein helicase domain
FT                   protein; SMART: AAA ATPase; SPTR: A8UVS9 Replicative DNA
FT                   helicase; TIGRFAM: replicative DNA helicase; PFAM:
FT                   DnaB-like helicase N terminal domain; DnaB-like helicase C
FT                   terminal domain; TIGRFAM: replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45011"
FT                   /protein_id="ADO45011.1"
FT                   /translation="MTYLDIEPPHDELAERAVLGAMILDPETIPQVLEYLREEDFYLEH
FT                   HRLLFSLLYKLWEDKGKDWDDIVLREYIKRYGLSDKIDMAFVYALVEEAAKGALLEEAI
FT                   NLVKEKSGLRNLLDLSLNALKGIKEEPDFNRLLEFMLHKVLEISEKQTITHYYHIKEVA
FT                   SKVIEIIEKHRKAERLITGRATGFLDLDVLTTGFHPSDLIIVAARPGMGKSSFMLSMAV
FT                   NMAMEEKVPVVIYSLEMSKEQLTMRALSMLSGVPLQNLRRGFIKEEERNRLISSALELS
FT                   SYNIYIDDTPTLSTTDLRIKTRKLKKERGVEVVFIDYLQLLRSPRRLSSRQEEVAEISR
FT                   NLKALAKELELPVVALAQLSRQVEHRSDKRPQLADLRESGQIEQDADLIIFIHRPEYYK
FT                   KNPPPEEQGIAEIIVAKQRQGPTGIVKVAFIKETASFKPLEYKEAQKVEEYEPDLEEFS
FT                   EEDYDLDF"
FT   gene            582047..583459
FT                   /locus_tag="Hydth_0614"
FT   CDS_pept        582047..583459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_1321 hypothetical protein; SPTR:
FT                   B4UA45 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45012"
FT                   /protein_id="ADO45012.1"
FT                   /translation="MLELILTKEKLTQREKLVFFRSMLKAEMDVLNEYCVNGGIPKRYK
FT                   IELCHLHNIKKVNIARLLSIIEFYDPEFIKVLALTDPRVRTFIGYYLDFLKTNPYGYEA
FT                   LEPQNLFGNWDFIKYKLKILFPELTLDEIDRFKFKRKEFIRYLREKLGEAEELIESKLN
FT                   KATWYESVPYLELEEEMSKEWHPEPIMTEEDWAFIRRHIKGRKNIFIREGQGERFVYVD
FT                   VDIPDEELDKYKKDREGLKKLLMQKYNIDESGAEQILRKAGWESDTYHIIPPIHTDVVL
FT                   NYGELEEAVKKELEEEDRGMSYYDLANFIRYLGGLELEQLNYYELIYDKVEEEVQDIID
FT                   TIIRTQRRILGKMFGIFYTVDPLMAEAIITINPARMDFLKGLAVKETVRGKEFHLYSNP
FT                   TAWRIVKERIVSRFPEVSQEDIEKFKGRRDEFVKYLAEKTHKSQQTIENALEECGWTKS
FT                   EEIPAFLRQIGP"
FT   gene            complement(583439..584338)
FT                   /locus_tag="Hydth_0615"
FT   CDS_pept        complement(583439..584338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0615"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="COGs: COG0685 5 10-methylenetetrahydrofolate
FT                   reductase; InterPro IPR004620:IPR003171; KEGG: aae:aq_1429
FT                   5,10-methylenetetrahydrofolate reductase; PFAM:
FT                   methylenetetrahydrofolate reductase; PRIAM:
FT                   Methylenetetrahydrofolate reductase (NAD(P)H); SPTR: A8UU31
FT                   Methylenetetrahydrofolate reductase; TIGRFAM:
FT                   5,10-methylenetetrahydrofolate reductase; PFAM:
FT                   Methylenetetrahydrofolate reductase; TIGRFAM:
FT                   5,10-methylenetetrahydrofolate reductase, prokaryotic form"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45013"
FT                   /protein_id="ADO45013.1"
FT                   /translation="MKIGELLKKGTFSISFEFFPPKTEEGERELFDTIKSLECLSPTFV
FT                   SVTYGAGGSTRDRTKRVVERIHQQTHMTVMAHLTCIAHSREEIISILREYKEIGIENIL
FT                   ALRGDLPANMPNFKPPDGACKHANELVRLIRSSFGEHFSVGVASYPEGHPESPNMEWEI
FT                   RYFKKKVMEGADFSITQMFFINDYYYRFIDMCYKEGIDIPIIPGIMPITNFRQISKFAS
FT                   MCGATIPDDLIKRLEPHMDDQEETTKIGVEFAIKQCEDLLKNGVPGLHFYTLNKSRATL
FT                   EIYQAIKDKVLALRSYLP"
FT   gene            complement(584301..584648)
FT                   /locus_tag="Hydth_0616"
FT   CDS_pept        complement(584301..584648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0616"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM_2091 putative transport channel
FT                   protein; SPTR: A8UU35 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45014"
FT                   /protein_id="ADO45014.1"
FT                   /translation="MQDTLKIFYRVITDYTDIRWAKTRDDLISKIIKVLRAFGEGKTPE
FT                   EVIKEKALSTEVEGSLNYLYDFVQGHREELDRLINALSLFLKSPAPCKMRIIKLTEVFV
FT                   EDRRAAQEGNL"
FT   gene            complement(584649..584948)
FT                   /locus_tag="Hydth_0617"
FT   CDS_pept        complement(584649..584948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0617"
FT                   /product="GYD family protein"
FT                   /note="COGs: COG4274 conserved hypothetical protein;
FT                   InterPro IPR014845; KEGG: tye:THEYE_A1821 hypothetical
FT                   protein; PFAM: GYD family protein; SPTR: A8UW97 Putative
FT                   uncharacterized protein; PFAM: GYD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45015"
FT                   /protein_id="ADO45015.1"
FT                   /translation="MALFVMLTTLTDEGMKTLKHRPERIKEVDREVMERFGVKLIAQYA
FT                   VMGPYDFVNILEAPDNDTVVKMAIELGSRGTIRTLTMPAIDVDQLIKDLQELSK"
FT   gene            585079..586488
FT                   /locus_tag="Hydth_0618"
FT   CDS_pept        585079..586488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0618"
FT                   /product="cytochrome c class I"
FT                   /note="InterPro IPR009056:IPR003088; KEGG: tgr:Tgr7_0683
FT                   cytochrome c class I; PFAM: cytochrome c class I; SPTR:
FT                   C7HXX4 Cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45016"
FT                   /protein_id="ADO45016.1"
FT                   /translation="MDVLGFYPMWYVPTVGSAFTIAIIATIHVMASHTSVGASILLAYL
FT                   ATKAYRENQPQIYDYIKKYLLGLLIFSYVSGSITGPGIWFSATVANPRGISALIHNFVW
FT                   VWAAEWVWFVAEVTLVYILFYTLGRIDQRSWLRLAWTFAIGSWATMYIIVGILSFMLSP
FT                   GHEKWFTTGNILDAFYNKNYFPHLLERTSFMFAIAGTVGLAIAGLMRKDISEKTYKEIV
FT                   KTLSYWGMGGVVFGLVFFIWYISTLPNRSDVILENVVPIYLKLPIMAIILLVLAHFFLT
FT                   AVRPTMARFWVAYPLYILIFFMGVYPEEKIRETLRKPYVAGEFMWVNQIVARDVPAKGI
FT                   KSEVPLIDQKGLLKLNAFVPEGLKNLTPQNQIMAGKTVAVLACSGCHNVTGSTGLRPFG
FT                   QKFAGMTDPNAVYSFLTSYLRDNHPPYMPKLVGTDEEIRALSAYIADMISKGGSVSAKI
FT                   EVPASSSEAKK"
FT   gene            586502..587797
FT                   /locus_tag="Hydth_0619"
FT   CDS_pept        586502..587797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_0684 hypothetical protein; SPTR:
FT                   B8GME4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45017"
FT                   /protein_id="ADO45017.1"
FT                   /translation="MQEVVRWFLLAVLSFMIVGGKLALAVDTSAMLKAMADPAGAPFFP
FT                   VVMQVLQVLTWALHILFVYTSIGGLFFAIYGFTRRDENWQKLSRATIELSKVSVSLAIV
FT                   LGVAPLLFYQVIYDPLWYSSANLSAWWYILFIVFLLIGYYFIWGAYLTKDKPTISMFMS
FT                   ILGIIFLLLVGFIIHVVNYQSLYPEKWVEWYTSGGTTMNTSGWNIYAFNIFRYLSFLVF
FT                   PSVAVTGIFLMLYNWYFRSREDMDKEYLDWAGKVGARFALYAGGGWIVAQVLYIFTIPA
FT                   DWGAKGSIFTWLTLLGLLLVIGVVFAAQKNPAKMAIPSLISGVVALLLIAIFREYLRVA
FT                   STARFGYSVYDYKMNLEFLSPLLFFGTLLTGLVLYAYAWWMAYRAGRTPKGKVYEASET
FT                   EHHLGDASVFVVILWAIVFIGVGLIVIARNYA"
FT   sig_peptide     586502..586576
FT                   /locus_tag="Hydth_0619"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            587936..589258
FT                   /locus_tag="Hydth_0620"
FT   CDS_pept        587936..589258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0620"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR014729:IPR001763:IPR000541:IPR011063; KEGG:
FT                   sai:Saci_0378 PP-loop family protein; PFAM: Rhodanese
FT                   domain protein; PP-loop domain protein; SMART: Rhodanese
FT                   domain protein; SPTR: Q4JBN5 PP-loop family protein; PFAM:
FT                   PP-loop family; Rhodanese-like domain; TIGRFAM: conserved
FT                   hypothetical protein TIGR00269"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45018"
FT                   /protein_id="ADO45018.1"
FT                   /translation="MEFRLDGIVHINYGKCGIGKINLELKPLGKCSRCKKNEAIINLAY
FT                   ARQRLCKDCFNDFFVNRVRRVVEEFRMFKPGERVAVAVSGGKDSVALLHALKKAFPEQD
FT                   IYAFYINLGIKYYSDHLEKKVIELAEMVGVPIEIYNLKEKEGYTIDDFLLTKYKNKMCS
FT                   VCGLIKRNIFTTLAVRVNADTVATGHNLDDTVSTMMSLFFAGDFEGIARLKPVLKPLIK
FT                   GQPRKIKPLITTPEIEDLYYVALNELPVQECGCPHGEFTPIKGMKKWLDEMEKEQPDIK
FT                   FRLLSVFRRKFIPLVDRGLGEEGVEEVRACTVCGMPSSSEICSKCRRVMELMEIKERRG
FT                   EIKMEITFEELERLREKERVVLLDVRDRKEYEVYTLEGAINIPADEIQKRWKELLKYKR
FT                   THKVVVFCNAGRSSYAVAVKLRNLGFDAYSLKGGIISHIQP"
FT   gene            complement(589341..590174)
FT                   /locus_tag="Hydth_0621"
FT   CDS_pept        complement(589341..590174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0621"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="COGs: COG0741 Soluble lytic murein transglycosylase
FT                   and related regulatory protein (some contain LysM/invasin
FT                   domains); InterPro IPR000189:IPR008258; KEGG:
FT                   saf:SULAZ_1370 peptidoglycan-binding LysM:lytic
FT                   transglycosylase, catalytic; PFAM: Lytic transglycosylase
FT                   catalytic; SPTR: A8UVN9 Putative uncharacterized protein;
FT                   PFAM: Transglycosylase SLT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45019"
FT                   /protein_id="ADO45019.1"
FT                   /translation="MRRGIGAVLICSSLFSCTQAVKQAVMPRSGDKIQLVQKGSFSFSE
FT                   EEERFIVKEAKNLNIPIPDREEIKRYISYFLQNKPYLEKTLQRAEYYLPIIKPIVEKSG
FT                   LPSELSLLPVIESGFNPLAVSRSGAAGLWQFIPSTARRYGLRVDEHVDERFDVIKSTEA
FT                   AVRYLKDLYSMFGNWELALAGYNCGENCVKYRTAGVDFWITKDMLPEETRNYVPAFFAV
FT                   LLITRDPVKYGLFSEGIKTLKKESQSAHAELSKVERSQRERIITLENGAKIIIKE"
FT   sig_peptide     complement(590109..590174)
FT                   /locus_tag="Hydth_0621"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            590454..591269
FT                   /locus_tag="Hydth_0622"
FT   CDS_pept        590454..591269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0622"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="COGs: COG2890 Methylase of polypeptide chain release
FT                   factors; InterPro IPR002052:IPR004556:IPR019874:IPR007848;
FT                   KEGG: aae:aq_099 protoporphyrinogen oxidase; PFAM:
FT                   methyltransferase small; SPTR: A8UY00 Protoporphyrinogen
FT                   oxidase; TIGRFAM: protein-(glutamine-N5) methyltransferase,
FT                   release factor-specific; modification methylase, HemK
FT                   family; PFAM: Methyltransferase small domain; TIGRFAM: HemK
FT                   family putative methylases; protein-(glutamine-N5)
FT                   methyltransferase, release factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45020"
FT                   /protein_id="ADO45020.1"
FT                   /translation="MKVQELLKRPSKVSLRDRELLLAHLLKVKVGEVYLLLDRHVSKEM
FT                   EEEYMRSLSLLEEGYPLQYLLGEWDFYGRTFRVEEGVLIPRPETELLVEKVLEKVPPNK
FT                   EAVGFEIGVGTGCISITLLLERPKLIMYADDLQEKAVHLAETNARLHKVEDRLFLKVGD
FT                   MFEPVKGMVFDFVISNPPYIPQKEWAGLPKGVKLEGKVSLIGGEKGYEFYERFAKEVGK
FT                   FLKEDGFFALEIGHDQGKILEDIFSQEGFFAQVYKDYAGQDRVILGWKR"
FT   gene            591257..592522
FT                   /locus_tag="Hydth_0623"
FT   CDS_pept        591257..592522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0623"
FT                   /product="CBS domain containing protein"
FT                   /note="COGs: COG1253 Hemolysins and related protein
FT                   containing CBS domains; InterPro
FT                   IPR000644:IPR001412:IPR000276:IPR002550:IPR 005170; KEGG:
FT                   aae:aq_101 hemolysin; PFAM: CBS domain containing protein;
FT                   protein of unknown function DUF21; transporter-associated
FT                   region; SPTR: O66507 Hemolysin; PFAM: CBS domain; Domain of
FT                   unknown function DUF21; Transporter associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45021"
FT                   /protein_id="ADO45021.1"
FT                   /translation="MEAIGFSLGVLFFIILEGIFAGAEIALISTDRSKVLALYRKTGYG
FT                   FLRDFHENPEEYITLSMLGYTISIVFASTFYTLMVITLSDYLPYIKGYEVLFSLTLVIF
FT                   TLLFGEILPKSVFQKYSDKLLIPSLWYLSKIRVITFPVLVLSRKTSRYLTEFFRKRYSE
FT                   RISKIDIIKLLEEIELQESKIKIAVKLLTLRESTASEIVKPIYEVVMIDEFSTVGHALR
FT                   RMKESGFTKLPVYKQRVDDITGYVDMFDIMDAPPSSLIREFVKPVCLFSEFTPLQDVLE
FT                   TFRGGSSRMGLVVDERGIILGIVTFDDVIREILGQIGDSFAQPEEPIKEIEKDKWIVDG
FT                   MFDKHEFEKIAGVKFPEGPFLTLGGFIIYHLRRIPKKGEVVLCCGLRFLVLQSDRRKVK
FT                   KLMVERHVQEQKAQGHTERAKT"
FT   gene            592473..593150
FT                   /locus_tag="Hydth_0624"
FT   CDS_pept        592473..593150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0624"
FT                   /product="DNA repair protein RadC"
FT                   /note="COGs: COG2003 DNA repair protein; InterPro
FT                   IPR001405; KEGG: aae:aq_1610 DNA repair protein RadC; PFAM:
FT                   DNA repair protein RadC; SPTR: O67541 UPF0758 protein
FT                   aq_1610; TIGRFAM: DNA repair protein RadC; PFAM: Protein of
FT                   unknown function (DUF2466); TIGRFAM: DNA repair protein
FT                   radc"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45022"
FT                   /protein_id="ADO45022.1"
FT                   /translation="MYKSKRLKDIPKELRPREKIKSLGSQSLSDEELLALVLGSGTKEE
FT                   DVLSLSRRIIKLGWERLKSMSVNELIKEIKGIGEAKACQIKALIELSRRMYEPHAHTVI
FT                   NSPEDVYNLLKDKMDNRREHLWALYLTPSNTLIEYDLVAVGRLNSVFADPKDILYGAVR
FT                   SVCHSIILAHTHPGGEPKPSKADIDFTQRVKKACEILGFELLDHIIITKKGYFSMREGG
FT                   VVS"
FT   gene            593147..595523
FT                   /locus_tag="Hydth_0625"
FT   CDS_pept        join(593147..594439,594441..595523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Hydth_0625"
FT                   /product="Phosphoketolase"
FT                   /EC_number="4.1.2.9"
FT                   /note="COGs: COG3957 Phosphoketolase; InterPro
FT                   IPR019790:IPR019789:IPR018970:IPR005593; KEGG:
FT                   dtu:Dtur_0362 putative phosphoketolase; PFAM: Xylulose
FT                   5-phosphate/Fructose 6-phosphate phosphoketolase-like;
FT                   D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase; PRIAM: Phosphoketolase; SPTR: B8DZ47
FT                   Phosphoketolase; manually curated; PFAM: XFP N-terminal
FT                   domain; D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase; XFP C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45023"
FT                   /protein_id="ADO45023.1"
FT                   /translation="MKLRNLISCWKACCYVSAGMIYLRDNPLLKEPLKKEHIKLRLLGH
FT                   WGASPGISFAYIHASRAVKEYNLNCIFVPGPGHGAPGFIAPVYLEGTLSEYYPQFSQDE
FT                   EGLGNLFRAFSFPGGLGSHCTPEIPGSLQEGGELGYSLSHAYGAVFDNPDLIAVTLVGD
FT                   GEAETGPLATSWHCNKFINPIKDGAVLPILLLNGYKINNPSLLARIEEDELLSLFRGYG
FT                   YEPKLVQGEEDEEVHQKMMETVDWCVERILGVWEEARSSEKPFRPRWPMIILKIPKGWT
FT                   APKKVDGHYIEGYWRSHQVPIADVREHEAHLKILEEWLKSYQPEELFDEKGRLKEDIRQ
FT                   VFPEGSKRLGSNPHANGGLLRVPLKLPSLSEFAVEVKEPAKVYQENTRWLGSFLREVIR
FT                   SNPNNFRVFGPDETHSNRLYHVFEFGKTWMAKTLPEDEDEGYLSPFGRTLEMLSEHTVE
FT                   GLLEGYILTGRHGILNTYEGFAPIVSSMVNQFGKWLDISSDVPWRMPISSLNLLLTSVV
FT                   WRQDHNGFTHQDPGFINAIVDKWPNIVRVYFPPDANTLLCTVWQCLQSTGRINIIVADK
FT                   QKHPQYLNLEEALRHVEKGIGIWEFGSNHPEEEPDVVIASCGDIPTKEALHASWMIGNA
FT                   FPDIKIRFVNVVNLFCLTPNTEHPDGLTDRDFDSYFTKNKPVIFNFHGYPWLIHRLTYR
FT                   RANHANFHVRGYRENRKIGIDSTYLTPLLKGRGGITTPLQLAILNQIDRFSIAMDVIER
FT                   VPSLQERGGNFKDKLKNMQIQAIEYAYAHGIDKPELEE"
FT   gene            595523..596599
FT                   /locus_tag="Hydth_0626"
FT   CDS_pept        595523..596599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0626"
FT                   /product="acetate kinase"
FT                   /note="COGs: COG0282 Acetate kinase; InterPro
FT                   IPR000890:IPR004372; KEGG: sun:SUN_1996 acetate kinase;
FT                   PFAM: acetate and butyrate kinase; SPTR: A6QBT0 Acetate
FT                   kinase; TIGRFAM: acetate kinase; PFAM: Acetokinase family;
FT                   TIGRFAM: acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45024"
FT                   /protein_id="ADO45024.1"
FT                   /translation="MKYTLALNYGSSTLKYALFGDLKRLEGGTLKMGDVQQILLSILKT
FT                   FKRIDLTVHRVVHGMDLDSPMLIDGASFEVLKKLVAFDPLHNAFALTGIELCMKELPNV
FT                   PHYVVFDTSFFKVLPITSKAYAVPFSLFEEGIKRYGFHGISYSYLLKEASKLLRKSISS
FT                   VNLIMLHLGSGASICAVQSGKPVDTSMGMTPLEGLVMSTRAGDLDPGVVLHLLRKGKSL
FT                   EEVERMIYKEWGIKGMTGTSDMRQVIEEYTRGNESAKLAIHLYVYRIKKYIGAYYAVLP
FT                   KLDALVFSGGVGENSPLVRKLVCRGLEKLGIIIDERINQKGQLPLCISRRDSEVKVLVI
FT                   RTDEELEMVRQLRRALKG"
FT   gene            596596..597474
FT                   /locus_tag="Hydth_0627"
FT   CDS_pept        596596..597474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0627"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="COGs: COG0190 5 10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase;
FT                   InterPro IPR016040:IPR020630:IPR020631:IPR000672; KEGG:
FT                   aae:aq_1898 methylenetetrahydrofolate dehydrogenase; PFAM:
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   NAD(P)-binding domain; Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, catalytic domain; PRIAM:
FT                   Methylenetetrahydrofolate dehydrogenase (NADP(+)); SPTR:
FT                   O67736 Bifunctional protein folD; PFAM: Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain;
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45025"
FT                   /protein_id="ADO45025.1"
FT                   /translation="MKVMHILLDGKSLSESIRDQIKTYVERITSRGYREPSLAVVLVGD
FT                   DPASHIYVKNKRKACERVGIKSLFYHLPQNTKVPELLDLIASLNSDESVDGILVQLPLP
FT                   QHIPQEEVILSISPKKDVDGFHPENMGKLVARIEGGFIPCTPLGIDLLLKHYNIDLKGK
FT                   NVVIVGAGFIVGRPLALLMLWRDATVCVCHIHTKDITQYTKKADILISATGVPHLIKRD
FT                   MVKEGAVVVDVGISKVGEKVLGDVDFERVKDKVYAITPVPGGVGPMTVTALLLNTLQAY
FT                   RQNMNLKDGDL"
FT   gene            597461..598108
FT                   /locus_tag="Hydth_0628"
FT   CDS_pept        597461..598108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0628"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: aae:aq_1270 hypothetical protein; PFAM:
FT                   Methyltransferase type 11; SPTR: A8UUI0 Putative
FT                   uncharacterized protein; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45026"
FT                   /protein_id="ADO45026.1"
FT                   /translation="MEIFDKYALLYDEWYERPFGKSAYKLELECLKSLYNQKGLSLEIG
FT                   VGSGRFAQALGIKYGVDTSKGLLRMAHKRGVRPILAKAEELPFKDSVFDSALIVVSLCF
FT                   FEDPLASLKEAYRVLKEGSFLLLGLVLSESPWAEFYREKAKKGHPIYSYAKFYSYPQLL
FT                   SLIQSAGFKKDKAYTTLFEEPQDKYPVKNRRIVEGFSPEGGFFCLRALKLSF"
FT   gene            complement(598097..598546)
FT                   /locus_tag="Hydth_0629"
FT   CDS_pept        complement(598097..598546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0629"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="COGs: COG0764
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratase; InterPro IPR010084:IPR013114; KEGG: aae:aq_056
FT                   (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; SPTR: O66468
FT                   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase;
FT                   TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM: FabA-like domain; TIGRFAM:
FT                   beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45027"
FT                   /protein_id="ADO45027.1"
FT                   /translation="MMDIREIMEVLPHRYPILLVDKILEIQIGKRIVGLKNVSINEPYF
FT                   QGHFPGFPLMPGVYILEAMAQVGGILMIKSLGLEIGKYAIVFAGIDEARFKKPIYPGDQ
FT                   LIMELEVVSLKRTLSKMKGKATVDGQVVAEAVLYAAARELKELKR"
FT   gene            598632..599099
FT                   /locus_tag="Hydth_0630"
FT   CDS_pept        598632..599099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0630"
FT                   /product="cytochrome c class I"
FT                   /note="COGs: COG4654 Cytochrome c551/c552; InterPro
FT                   IPR009056:IPR003088:IPR002324; KEGG: hya:HY04AAS1_1163
FT                   cytochrome c class I; PFAM: cytochrome c class I; SPTR:
FT                   P15452 Cytochrome c-552; PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45028"
FT                   /protein_id="ADO45028.1"
FT                   /translation="MKKVLLSGVLSIALLASCQKKAEETAPAEQPAQQPAQEQPTQPSQ
FT                   PAGEQKQPSGEQKPAEQKPAEQKSQGPAKDMTALAQQKGCFACHDINAKKVGPAYKDVA
FT                   KKFAGQPGAVDELAKRIKNGGVGTWGQVPMPPQNVTDEEAKELAQWILSLK"
FT   sig_peptide     598632..598694
FT                   /locus_tag="Hydth_0630"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            599078..599332
FT                   /locus_tag="Hydth_0631"
FT   CDS_pept        599078..599332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0631"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_0313 hypothetical protein; SPTR:
FT                   A8UW17 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45029"
FT                   /protein_id="ADO45029.1"
FT                   /translation="MDPIPEVKGSLRTFIELHFKKQVEVSQSYLRDTLLFFLFAEYFGL
FT                   DNPLGIYALDLYPYLMEEFHLWHKSLGIERSSLDFIPCC"
FT   gene            599323..600129
FT                   /locus_tag="Hydth_0632"
FT   CDS_pept        599323..600129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0632"
FT                   /product="Anion-transporting ATPase"
FT                   /note="COGs: COG0003 ATPase involved in chromosome
FT                   partitioning; InterPro IPR003348; KEGG: iho:Igni_1326
FT                   arsenite-transporting ATPase; PFAM: Anion-transporting
FT                   ATPase; SPTR: A8USX1 Anion transporting ATPase; PFAM:
FT                   Anion-transporting ATPase; TIGRFAM: arsenite-activated
FT                   ATPase (arsA)"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45030"
FT                   /protein_id="ADO45030.1"
FT                   /translation="MLLRVIFFGGKGGVGKSTLACATALRLSEKGKTLLVSIDPAHSLS
FT                   GILKVKVGDDLVRINEYLFAVELSAERLVEDYVNNVLSAIGEMMPSLKSGLKEYARHVK
FT                   HSPTALETAVLDGIANYLEADFQFVVVDSAPTGQMVRIFQTAKMVEGWFSFLEKLAKER
FT                   QKLETFMGRSDKVFDLIKKRREKLERLVRVLREKAIIFAVANEETLSIEEAFDLEKYLK
FT                   EFKVYRVMNKWKSAEGDFLKVGYLQAPYGIERLSLLDVEELLKVIV"
FT   gene            600141..601532
FT                   /locus_tag="Hydth_0633"
FT   CDS_pept        600141..601532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0633"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG0531 Amino acid transporter; InterPro
FT                   IPR004841:IPR002293; KEGG: saf:SULAZ_1269 amino acid
FT                   permease-associated region; PFAM: amino acid
FT                   permease-associated region; SPTR: C1DVV1 Amino acid
FT                   permease-associated region; PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45031"
FT                   /protein_id="ADO45031.1"
FT                   /translation="MLWKEIFRKKCYAVDEGRFPRKLGLLDLTFLGVGAIIGAGIFVIT
FT                   GQASALYAGPGIVLSFLLGAVAIGISALVYAELSSAYPISGSAYSYTYATIGEIVAWLV
FT                   GWNLLVEYGVATAAVATGWSGYLRTFLEQNFGFTLPHILTGAYDPSKGTLMDLFAFLGV
FT                   VAVFFLLTLGIKESATVNTLIVVLKLLTLITFLLFGIRHIDFSNLENFLPYGWIGVWHA
FT                   ASLIIFAYLGFDAVSTVAEETKHPTKNVPLGLLLSLGISTLLYMSVSFILVGMVNYKEL
FT                   NVPDALAFAMYKVGNPHVANLIATGAVITITSVMLVMGLGFTRIIYALSRDGLLPSGLS
FT                   RVHPKFKTPYVSTLIGGVILSLLAGFIPLKVLAELVNIGTLFAYFMVGIGVIVLRRSGE
FT                   ITATFRVPYAKILLPINLLLLLFIMMGLPKETWMRFVVWNALGLAIYFLYGYRKSRAYE
FT                   RSYEA"
FT   gene            601529..602059
FT                   /locus_tag="Hydth_0634"
FT   CDS_pept        601529..602059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0634"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="COGs: COG1525 Micrococcal nuclease (thermonuclease)
FT                   homologs; InterPro IPR006021:IPR002071:IPR016071; KEGG:
FT                   saf:SULAZ_0225 thermonuclease (TNase) (micrococcal
FT                   nuclease)(staphylococcal nuclease); PFAM: nuclease (SNase
FT                   domain protein); SMART: nuclease (SNase domain protein);
FT                   SPTR: A8UTC7 Micrococcal nuclease-like protein; PFAM:
FT                   Staphylococcal nuclease homologue"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45032"
FT                   /protein_id="ADO45032.1"
FT                   /translation="MKKVFILLLLFLCSCRSEEGAKLTVNAKNVPCKITRVVDGDTFRC
FT                   RIDAEEITVRLIGVDTPESKENPKAKRDADRTGMSLEEITRMGREAYQFTKSLIPVGTT
FT                   VYLETDVQLTDRYGRVLAYVWLPDGRMLNEVLLKEGYAQVYTIPPNVKYQDLFLSAQRK
FT                   AREGKRGFWKQWF"
FT   sig_peptide     601529..601588
FT                   /locus_tag="Hydth_0634"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            602129..603883
FT                   /locus_tag="Hydth_0635"
FT   CDS_pept        602129..603883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0635"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="COGs: COG0028 Thiamine pyrophosphate-requiring
FT                   protein; InterPro
FT                   IPR000399:IPR018506:IPR012846:IPR012001:IPR
FT                   012000:IPR011766; KEGG: aae:aq_451 acetolactate synthase
FT                   large subunit; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein domain
FT                   protein TPP-binding; SPTR: A8USR2 Acetolactate synthase;
FT                   TIGRFAM: acetolactate synthase, large subunit, biosynthetic
FT                   type; PFAM: Thiamine pyrophosphate enzyme, central domain;
FT                   Thiamine pyrophosphate enzyme, N-terminal TPP binding
FT                   domain; Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain; TIGRFAM: acetolactate synthase, large
FT                   subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45033"
FT                   /protein_id="ADO45033.1"
FT                   /translation="MARKGADIVIETLKEEGVEYIFGHPGGAIMEVYDALYRDGSIKHI
FT                   LTRHEQGAGHMAEGYAKATGKVGVAMSTSGPGATNLVTAIADAYMDSVPVVFITGQVPT
FT                   HLIGNDAFQEVDIVGITRPITKHNFLVKRIEDLPMILRQAFYIAKTGRPGPVLVDIPKD
FT                   ITQKISDVEIPSLEEVKSSLPGYKPHTEGNPQQIKKAARLIAEAKRPVLYVGGGAVQAE
FT                   AQKELVELAELMKVPVTTTNMGKGAFPESHPLALHMLGMHGTYYANMAVYNCDLLIAVG
FT                   ARFDDRVTGKVEEFAPQASIIHIDIDPASISKNIVVDVPIVGDVKVVLRKLIEEIKKEG
FT                   AKLLYPEERQKWLEQIEKWKKLHPLTYRKSDKVIKPQYVIEEIWKVTKGDAIIATGVGQ
FT                   HQMWAAMFYRYSFPRQFINSGGLGTMGFGLPAGIGAKIGRPEKEVFVIDGDGSFMMTMQ
FT                   ELITAVHYRVPVKIAIINNGYLGMVRQWQELFYEKRYAEVDLSIQPDFVKLAEACGAVG
FT                   FRAEKPSEVREVLEEAMKVQDKPVLLDFHVDREENVLPMVPAGKSYRDMILEDGKKGVE
FT                   ADTMYLVG"
FT   gene            603896..604465
FT                   /locus_tag="Hydth_0636"
FT   CDS_pept        603896..604465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0636"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="COGs: COG0440 Acetolactate synthase small
FT                   (regulatory) subunit; InterPro
FT                   IPR004789:IPR002912:IPR019455; KEGG: aae:aq_1851
FT                   acetolactate synthase; PFAM: Acetolactate synthase, small
FT                   subunit-like; amino acid-binding ACT domain protein; SPTR:
FT                   O67703 Acetolactate synthase small subunit; TIGRFAM:
FT                   acetolactate synthase, small subunit; PFAM: ACT domain;
FT                   Small subunit of acetolactate synthase; TIGRFAM:
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADO45034"
FT                   /protein_id="ADO45034.1"
FT                   /translation="MSDITAVKAPALREIKKGRVRKHIITLLVRNELGVLARIATLIAG
FT                   KGYNIEGLSVGETHEKGLSRMTIEVIGDDVVIDQVVKQLRKLIDTIKVRDLTDIPHIER
FT                   ELALIKVHTATPRARDEVLRLTEIFRGKIVDVSQSTYTVEITGTEDKINAFIELVKPFG
FT                   IMEMARTGKVALKREMASTEEEQLWK"
FT   gene            604456..605922
FT                   /locus_tag="Hydth_0637"
FT   CDS_pept        604456..605922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Hydth_0637"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="COGs: COG0260 Leucyl aminopeptidase; InterPro
FT                   IPR000819:IPR008283; KEGG: aae:aq_2099 leucyl
FT                   aminopeptidase; PFAM: peptidase M17 leucyl aminopeptidase
FT                   domain protein; PRIAM: Leucyl aminopeptidase; SPTR: O67868
FT                   Probable cytosol aminopeptidase; PFAM: Cytosol
FT                   aminopeptidase family, catalytic domain; Cytosol
FT                   aminopeptidase family, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Hydth_0637"
FT                   /db_xr