(data stored in ACNUC8465 zone)

EMBL: CP002222

ID   CP002222; SV 1; circular; genomic DNA; STD; PRO; 3254376 BP.
XX
AC   CP002222;
XX
PR   Project:PRJNA52949;
XX
DT   03-OCT-2010 (Rel. 106, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Lactobacillus plantarum subsp. plantarum ST-III, complete genome.
XX
KW   .
XX
OS   Lactobacillus plantarum subsp. plantarum ST-III
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae;
OC   Lactobacillus.
XX
RN   [1]
RP   1-3254376
RX   DOI; 10.1128/JB.01159-10.
RX   PUBMED; 21037001.
RA   Wang Y., Chen C., Ai L., Zhou F., Zhou Z., Wang L., Zhang H., Chen W.,
RA   Guo B.;
RT   "Complete genome sequence of the probiotic Lactobacillus plantarum ST-III";
RL   J. Bacteriol. 193(1):313-314(2011).
XX
RN   [2]
RP   1-3254376
RA   Wang Y., Chen C., Ai L., Zhou F., Zhou Z., Wang L., Zhang H., Guo B.,
RA   Chen W.;
RT   ;
RL   Submitted (27-SEP-2010) to the INSDC.
RL   State Key Laboratory of Dairy Biotechnology, Technology Center of Bright
RL   Dairy & Food Co., Ltd, 228 Jiangchangsan Road, Shanghai, Shanghai 200436,
RL   China
XX
DR   MD5; db88303b87169096f6a6cf12c72a92f7.
DR   BioSample; SAMN02603896.
DR   EnsemblGenomes-Gn; EBG00001139964.
DR   EnsemblGenomes-Gn; EBG00001139965.
DR   EnsemblGenomes-Gn; EBG00001139966.
DR   EnsemblGenomes-Gn; EBG00001139967.
DR   EnsemblGenomes-Gn; EBG00001139968.
DR   EnsemblGenomes-Gn; EBG00001139969.
DR   EnsemblGenomes-Gn; EBG00001139970.
DR   EnsemblGenomes-Gn; EBG00001139971.
DR   EnsemblGenomes-Gn; EBG00001139972.
DR   EnsemblGenomes-Gn; EBG00001139973.
DR   EnsemblGenomes-Gn; EBG00001139974.
DR   EnsemblGenomes-Gn; EBG00001139975.
DR   EnsemblGenomes-Gn; EBG00001139976.
DR   EnsemblGenomes-Gn; EBG00001139977.
DR   EnsemblGenomes-Gn; EBG00001139978.
DR   EnsemblGenomes-Gn; EBG00001139979.
DR   EnsemblGenomes-Gn; EBG00001139980.
DR   EnsemblGenomes-Gn; EBG00001139981.
DR   EnsemblGenomes-Gn; EBG00001139982.
DR   EnsemblGenomes-Gn; EBG00001139983.
DR   EnsemblGenomes-Gn; EBG00001139984.
DR   EnsemblGenomes-Gn; EBG00001139985.
DR   EnsemblGenomes-Gn; EBG00001139986.
DR   EnsemblGenomes-Gn; EBG00001139987.
DR   EnsemblGenomes-Gn; EBG00001139988.
DR   EnsemblGenomes-Gn; EBG00001139989.
DR   EnsemblGenomes-Gn; EBG00001139990.
DR   EnsemblGenomes-Gn; EBG00001139991.
DR   EnsemblGenomes-Gn; EBG00001139992.
DR   EnsemblGenomes-Gn; EBG00001139993.
DR   EnsemblGenomes-Gn; EBG00001139994.
DR   EnsemblGenomes-Gn; EBG00001139995.
DR   EnsemblGenomes-Gn; EBG00001139996.
DR   EnsemblGenomes-Gn; EBG00001139997.
DR   EnsemblGenomes-Gn; EBG00001139998.
DR   EnsemblGenomes-Gn; EBG00001139999.
DR   EnsemblGenomes-Gn; EBG00001140000.
DR   EnsemblGenomes-Gn; EBG00001140001.
DR   EnsemblGenomes-Gn; EBG00001140002.
DR   EnsemblGenomes-Gn; EBG00001140003.
DR   EnsemblGenomes-Gn; EBG00001140004.
DR   EnsemblGenomes-Gn; EBG00001140005.
DR   EnsemblGenomes-Gn; EBG00001140006.
DR   EnsemblGenomes-Gn; EBG00001140007.
DR   EnsemblGenomes-Gn; EBG00001140008.
DR   EnsemblGenomes-Gn; EBG00001140009.
DR   EnsemblGenomes-Gn; EBG00001140010.
DR   EnsemblGenomes-Gn; EBG00001140011.
DR   EnsemblGenomes-Gn; EBG00001140012.
DR   EnsemblGenomes-Gn; EBG00001140013.
DR   EnsemblGenomes-Gn; EBG00001140014.
DR   EnsemblGenomes-Gn; EBG00001140015.
DR   EnsemblGenomes-Gn; EBG00001140016.
DR   EnsemblGenomes-Gn; EBG00001140017.
DR   EnsemblGenomes-Gn; EBG00001140018.
DR   EnsemblGenomes-Gn; EBG00001140019.
DR   EnsemblGenomes-Gn; EBG00001140020.
DR   EnsemblGenomes-Gn; EBG00001140021.
DR   EnsemblGenomes-Gn; EBG00001140022.
DR   EnsemblGenomes-Gn; EBG00001140023.
DR   EnsemblGenomes-Gn; EBG00001140024.
DR   EnsemblGenomes-Gn; EBG00001140025.
DR   EnsemblGenomes-Gn; EBG00001140026.
DR   EnsemblGenomes-Gn; EBG00001140027.
DR   EnsemblGenomes-Gn; EBG00001140028.
DR   EnsemblGenomes-Gn; EBG00001140029.
DR   EnsemblGenomes-Gn; EBG00001140030.
DR   EnsemblGenomes-Gn; EBG00001140031.
DR   EnsemblGenomes-Gn; EBG00001140032.
DR   EnsemblGenomes-Gn; EBG00001140033.
DR   EnsemblGenomes-Gn; EBG00001140034.
DR   EnsemblGenomes-Gn; EBG00001140035.
DR   EnsemblGenomes-Gn; EBG00001140036.
DR   EnsemblGenomes-Gn; EBG00001140037.
DR   EnsemblGenomes-Gn; EBG00001140038.
DR   EnsemblGenomes-Gn; EBG00001140039.
DR   EnsemblGenomes-Gn; EBG00001140040.
DR   EnsemblGenomes-Gn; EBG00001140041.
DR   EnsemblGenomes-Gn; EBG00001140042.
DR   EnsemblGenomes-Gn; EBG00001140043.
DR   EnsemblGenomes-Gn; EBG00001140044.
DR   EnsemblGenomes-Gn; EBG00001140045.
DR   EnsemblGenomes-Gn; EBG00001140046.
DR   EnsemblGenomes-Gn; EBG00001140047.
DR   EnsemblGenomes-Gn; EBG00001140048.
DR   EnsemblGenomes-Gn; EBG00001140049.
DR   EnsemblGenomes-Gn; EBG00001140050.
DR   EnsemblGenomes-Gn; EBG00001140051.
DR   EnsemblGenomes-Gn; EBG00001140052.
DR   EnsemblGenomes-Gn; EBG00001140053.
DR   EnsemblGenomes-Gn; EBG00001140054.
DR   EnsemblGenomes-Gn; EBG00001140055.
DR   EnsemblGenomes-Gn; EBG00001140056.
DR   EnsemblGenomes-Gn; EBG00001140057.
DR   EnsemblGenomes-Gn; EBG00001140058.
DR   EnsemblGenomes-Gn; LPST_Cr0001.
DR   EnsemblGenomes-Gn; LPST_Cr0002.
DR   EnsemblGenomes-Gn; LPST_Cr0003.
DR   EnsemblGenomes-Gn; LPST_Cr0004.
DR   EnsemblGenomes-Gn; LPST_Cr0005.
DR   EnsemblGenomes-Gn; LPST_Cr0006.
DR   EnsemblGenomes-Gn; LPST_Cr0007.
DR   EnsemblGenomes-Gn; LPST_Cr0008.
DR   EnsemblGenomes-Gn; LPST_Cr0009.
DR   EnsemblGenomes-Gn; LPST_Cr0010.
DR   EnsemblGenomes-Gn; LPST_Cr0011.
DR   EnsemblGenomes-Gn; LPST_Cr0012.
DR   EnsemblGenomes-Gn; LPST_Cr0013.
DR   EnsemblGenomes-Gn; LPST_Cr0014.
DR   EnsemblGenomes-Gn; LPST_Cr0015.
DR   EnsemblGenomes-Gn; LPST_Ct0001.
DR   EnsemblGenomes-Gn; LPST_Ct0002.
DR   EnsemblGenomes-Gn; LPST_Ct0003.
DR   EnsemblGenomes-Gn; LPST_Ct0004.
DR   EnsemblGenomes-Gn; LPST_Ct0005.
DR   EnsemblGenomes-Gn; LPST_Ct0006.
DR   EnsemblGenomes-Gn; LPST_Ct0007.
DR   EnsemblGenomes-Gn; LPST_Ct0008.
DR   EnsemblGenomes-Gn; LPST_Ct0009.
DR   EnsemblGenomes-Gn; LPST_Ct0010.
DR   EnsemblGenomes-Gn; LPST_Ct0011.
DR   EnsemblGenomes-Gn; LPST_Ct0012.
DR   EnsemblGenomes-Gn; LPST_Ct0013.
DR   EnsemblGenomes-Gn; LPST_Ct0014.
DR   EnsemblGenomes-Gn; LPST_Ct0015.
DR   EnsemblGenomes-Gn; LPST_Ct0016.
DR   EnsemblGenomes-Gn; LPST_Ct0017.
DR   EnsemblGenomes-Gn; LPST_Ct0018.
DR   EnsemblGenomes-Gn; LPST_Ct0019.
DR   EnsemblGenomes-Gn; LPST_Ct0020.
DR   EnsemblGenomes-Gn; LPST_Ct0021.
DR   EnsemblGenomes-Gn; LPST_Ct0022.
DR   EnsemblGenomes-Gn; LPST_Ct0023.
DR   EnsemblGenomes-Gn; LPST_Ct0024.
DR   EnsemblGenomes-Gn; LPST_Ct0025.
DR   EnsemblGenomes-Gn; LPST_Ct0026.
DR   EnsemblGenomes-Gn; LPST_Ct0027.
DR   EnsemblGenomes-Gn; LPST_Ct0028.
DR   EnsemblGenomes-Gn; LPST_Ct0029.
DR   EnsemblGenomes-Gn; LPST_Ct0030.
DR   EnsemblGenomes-Gn; LPST_Ct0031.
DR   EnsemblGenomes-Gn; LPST_Ct0032.
DR   EnsemblGenomes-Gn; LPST_Ct0033.
DR   EnsemblGenomes-Gn; LPST_Ct0034.
DR   EnsemblGenomes-Gn; LPST_Ct0035.
DR   EnsemblGenomes-Gn; LPST_Ct0036.
DR   EnsemblGenomes-Gn; LPST_Ct0037.
DR   EnsemblGenomes-Gn; LPST_Ct0038.
DR   EnsemblGenomes-Gn; LPST_Ct0039.
DR   EnsemblGenomes-Gn; LPST_Ct0040.
DR   EnsemblGenomes-Gn; LPST_Ct0041.
DR   EnsemblGenomes-Gn; LPST_Ct0042.
DR   EnsemblGenomes-Gn; LPST_Ct0043.
DR   EnsemblGenomes-Gn; LPST_Ct0044.
DR   EnsemblGenomes-Gn; LPST_Ct0045.
DR   EnsemblGenomes-Gn; LPST_Ct0046.
DR   EnsemblGenomes-Gn; LPST_Ct0047.
DR   EnsemblGenomes-Gn; LPST_Ct0048.
DR   EnsemblGenomes-Gn; LPST_Ct0049.
DR   EnsemblGenomes-Gn; LPST_Ct0050.
DR   EnsemblGenomes-Gn; LPST_Ct0051.
DR   EnsemblGenomes-Gn; LPST_Ct0052.
DR   EnsemblGenomes-Gn; LPST_Ct0053.
DR   EnsemblGenomes-Gn; LPST_Ct0054.
DR   EnsemblGenomes-Gn; LPST_Ct0055.
DR   EnsemblGenomes-Gn; LPST_Ct0056.
DR   EnsemblGenomes-Gn; LPST_Ct0057.
DR   EnsemblGenomes-Gn; LPST_Ct0058.
DR   EnsemblGenomes-Gn; LPST_Ct0059.
DR   EnsemblGenomes-Gn; LPST_Ct0060.
DR   EnsemblGenomes-Gn; LPST_Ct0061.
DR   EnsemblGenomes-Gn; LPST_Ct0062.
DR   EnsemblGenomes-Gn; LPST_Ct0063.
DR   EnsemblGenomes-Gn; LPST_Ct0064.
DR   EnsemblGenomes-Tr; EBT00001556631.
DR   EnsemblGenomes-Tr; EBT00001556633.
DR   EnsemblGenomes-Tr; EBT00001556636.
DR   EnsemblGenomes-Tr; EBT00001556637.
DR   EnsemblGenomes-Tr; EBT00001556638.
DR   EnsemblGenomes-Tr; EBT00001556639.
DR   EnsemblGenomes-Tr; EBT00001556640.
DR   EnsemblGenomes-Tr; EBT00001556642.
DR   EnsemblGenomes-Tr; EBT00001556643.
DR   EnsemblGenomes-Tr; EBT00001556645.
DR   EnsemblGenomes-Tr; EBT00001556646.
DR   EnsemblGenomes-Tr; EBT00001556647.
DR   EnsemblGenomes-Tr; EBT00001556649.
DR   EnsemblGenomes-Tr; EBT00001556650.
DR   EnsemblGenomes-Tr; EBT00001556651.
DR   EnsemblGenomes-Tr; EBT00001556652.
DR   EnsemblGenomes-Tr; EBT00001556654.
DR   EnsemblGenomes-Tr; EBT00001556656.
DR   EnsemblGenomes-Tr; EBT00001556657.
DR   EnsemblGenomes-Tr; EBT00001556659.
DR   EnsemblGenomes-Tr; EBT00001556660.
DR   EnsemblGenomes-Tr; EBT00001556661.
DR   EnsemblGenomes-Tr; EBT00001556662.
DR   EnsemblGenomes-Tr; EBT00001556663.
DR   EnsemblGenomes-Tr; EBT00001556664.
DR   EnsemblGenomes-Tr; EBT00001556665.
DR   EnsemblGenomes-Tr; EBT00001556667.
DR   EnsemblGenomes-Tr; EBT00001556668.
DR   EnsemblGenomes-Tr; EBT00001556669.
DR   EnsemblGenomes-Tr; EBT00001556670.
DR   EnsemblGenomes-Tr; EBT00001556671.
DR   EnsemblGenomes-Tr; EBT00001556672.
DR   EnsemblGenomes-Tr; EBT00001556673.
DR   EnsemblGenomes-Tr; EBT00001556675.
DR   EnsemblGenomes-Tr; EBT00001556676.
DR   EnsemblGenomes-Tr; EBT00001556677.
DR   EnsemblGenomes-Tr; EBT00001556678.
DR   EnsemblGenomes-Tr; EBT00001556680.
DR   EnsemblGenomes-Tr; EBT00001556681.
DR   EnsemblGenomes-Tr; EBT00001556682.
DR   EnsemblGenomes-Tr; EBT00001556683.
DR   EnsemblGenomes-Tr; EBT00001556684.
DR   EnsemblGenomes-Tr; EBT00001556685.
DR   EnsemblGenomes-Tr; EBT00001556686.
DR   EnsemblGenomes-Tr; EBT00001556687.
DR   EnsemblGenomes-Tr; EBT00001556688.
DR   EnsemblGenomes-Tr; EBT00001556689.
DR   EnsemblGenomes-Tr; EBT00001556690.
DR   EnsemblGenomes-Tr; EBT00001556691.
DR   EnsemblGenomes-Tr; EBT00001556692.
DR   EnsemblGenomes-Tr; EBT00001556693.
DR   EnsemblGenomes-Tr; EBT00001556694.
DR   EnsemblGenomes-Tr; EBT00001556696.
DR   EnsemblGenomes-Tr; EBT00001556698.
DR   EnsemblGenomes-Tr; EBT00001556700.
DR   EnsemblGenomes-Tr; EBT00001556702.
DR   EnsemblGenomes-Tr; EBT00001556703.
DR   EnsemblGenomes-Tr; EBT00001556705.
DR   EnsemblGenomes-Tr; EBT00001556706.
DR   EnsemblGenomes-Tr; EBT00001556707.
DR   EnsemblGenomes-Tr; EBT00001556710.
DR   EnsemblGenomes-Tr; EBT00001556711.
DR   EnsemblGenomes-Tr; EBT00001556712.
DR   EnsemblGenomes-Tr; EBT00001556713.
DR   EnsemblGenomes-Tr; EBT00001556714.
DR   EnsemblGenomes-Tr; EBT00001556715.
DR   EnsemblGenomes-Tr; EBT00001556716.
DR   EnsemblGenomes-Tr; EBT00001556717.
DR   EnsemblGenomes-Tr; EBT00001556718.
DR   EnsemblGenomes-Tr; EBT00001556719.
DR   EnsemblGenomes-Tr; EBT00001556720.
DR   EnsemblGenomes-Tr; EBT00001556721.
DR   EnsemblGenomes-Tr; EBT00001556722.
DR   EnsemblGenomes-Tr; EBT00001556723.
DR   EnsemblGenomes-Tr; EBT00001556724.
DR   EnsemblGenomes-Tr; EBT00001556725.
DR   EnsemblGenomes-Tr; EBT00001556726.
DR   EnsemblGenomes-Tr; EBT00001556727.
DR   EnsemblGenomes-Tr; EBT00001556728.
DR   EnsemblGenomes-Tr; EBT00001556729.
DR   EnsemblGenomes-Tr; EBT00001556730.
DR   EnsemblGenomes-Tr; EBT00001556731.
DR   EnsemblGenomes-Tr; EBT00001556732.
DR   EnsemblGenomes-Tr; EBT00001556733.
DR   EnsemblGenomes-Tr; EBT00001556734.
DR   EnsemblGenomes-Tr; EBT00001556735.
DR   EnsemblGenomes-Tr; EBT00001556736.
DR   EnsemblGenomes-Tr; EBT00001556737.
DR   EnsemblGenomes-Tr; EBT00001556738.
DR   EnsemblGenomes-Tr; EBT00001556739.
DR   EnsemblGenomes-Tr; EBT00001556740.
DR   EnsemblGenomes-Tr; EBT00001556741.
DR   EnsemblGenomes-Tr; EBT00001556742.
DR   EnsemblGenomes-Tr; EBT00001556743.
DR   EnsemblGenomes-Tr; EBT00001556744.
DR   EnsemblGenomes-Tr; LPST_Cr0001-1.
DR   EnsemblGenomes-Tr; LPST_Cr0002-1.
DR   EnsemblGenomes-Tr; LPST_Cr0003-1.
DR   EnsemblGenomes-Tr; LPST_Cr0004-1.
DR   EnsemblGenomes-Tr; LPST_Cr0005-1.
DR   EnsemblGenomes-Tr; LPST_Cr0006-1.
DR   EnsemblGenomes-Tr; LPST_Cr0007-1.
DR   EnsemblGenomes-Tr; LPST_Cr0008-1.
DR   EnsemblGenomes-Tr; LPST_Cr0009-1.
DR   EnsemblGenomes-Tr; LPST_Cr0010-1.
DR   EnsemblGenomes-Tr; LPST_Cr0011-1.
DR   EnsemblGenomes-Tr; LPST_Cr0012-1.
DR   EnsemblGenomes-Tr; LPST_Cr0013-1.
DR   EnsemblGenomes-Tr; LPST_Cr0014-1.
DR   EnsemblGenomes-Tr; LPST_Cr0015-1.
DR   EnsemblGenomes-Tr; LPST_Ct0001-1.
DR   EnsemblGenomes-Tr; LPST_Ct0002-1.
DR   EnsemblGenomes-Tr; LPST_Ct0003-1.
DR   EnsemblGenomes-Tr; LPST_Ct0004-1.
DR   EnsemblGenomes-Tr; LPST_Ct0005-1.
DR   EnsemblGenomes-Tr; LPST_Ct0006-1.
DR   EnsemblGenomes-Tr; LPST_Ct0007-1.
DR   EnsemblGenomes-Tr; LPST_Ct0008-1.
DR   EnsemblGenomes-Tr; LPST_Ct0009-1.
DR   EnsemblGenomes-Tr; LPST_Ct0010-1.
DR   EnsemblGenomes-Tr; LPST_Ct0011-1.
DR   EnsemblGenomes-Tr; LPST_Ct0012-1.
DR   EnsemblGenomes-Tr; LPST_Ct0013-1.
DR   EnsemblGenomes-Tr; LPST_Ct0014-1.
DR   EnsemblGenomes-Tr; LPST_Ct0015-1.
DR   EnsemblGenomes-Tr; LPST_Ct0016-1.
DR   EnsemblGenomes-Tr; LPST_Ct0017-1.
DR   EnsemblGenomes-Tr; LPST_Ct0018-1.
DR   EnsemblGenomes-Tr; LPST_Ct0019-1.
DR   EnsemblGenomes-Tr; LPST_Ct0020-1.
DR   EnsemblGenomes-Tr; LPST_Ct0021-1.
DR   EnsemblGenomes-Tr; LPST_Ct0022-1.
DR   EnsemblGenomes-Tr; LPST_Ct0023-1.
DR   EnsemblGenomes-Tr; LPST_Ct0024-1.
DR   EnsemblGenomes-Tr; LPST_Ct0025-1.
DR   EnsemblGenomes-Tr; LPST_Ct0026-1.
DR   EnsemblGenomes-Tr; LPST_Ct0027-1.
DR   EnsemblGenomes-Tr; LPST_Ct0028-1.
DR   EnsemblGenomes-Tr; LPST_Ct0029-1.
DR   EnsemblGenomes-Tr; LPST_Ct0030-1.
DR   EnsemblGenomes-Tr; LPST_Ct0031-1.
DR   EnsemblGenomes-Tr; LPST_Ct0032-1.
DR   EnsemblGenomes-Tr; LPST_Ct0033-1.
DR   EnsemblGenomes-Tr; LPST_Ct0034-1.
DR   EnsemblGenomes-Tr; LPST_Ct0035-1.
DR   EnsemblGenomes-Tr; LPST_Ct0036-1.
DR   EnsemblGenomes-Tr; LPST_Ct0037-1.
DR   EnsemblGenomes-Tr; LPST_Ct0038-1.
DR   EnsemblGenomes-Tr; LPST_Ct0039-1.
DR   EnsemblGenomes-Tr; LPST_Ct0040-1.
DR   EnsemblGenomes-Tr; LPST_Ct0041-1.
DR   EnsemblGenomes-Tr; LPST_Ct0042-1.
DR   EnsemblGenomes-Tr; LPST_Ct0043-1.
DR   EnsemblGenomes-Tr; LPST_Ct0044-1.
DR   EnsemblGenomes-Tr; LPST_Ct0045-1.
DR   EnsemblGenomes-Tr; LPST_Ct0046-1.
DR   EnsemblGenomes-Tr; LPST_Ct0047-1.
DR   EnsemblGenomes-Tr; LPST_Ct0048-1.
DR   EnsemblGenomes-Tr; LPST_Ct0049-1.
DR   EnsemblGenomes-Tr; LPST_Ct0050-1.
DR   EnsemblGenomes-Tr; LPST_Ct0051-1.
DR   EnsemblGenomes-Tr; LPST_Ct0052-1.
DR   EnsemblGenomes-Tr; LPST_Ct0053-1.
DR   EnsemblGenomes-Tr; LPST_Ct0054-1.
DR   EnsemblGenomes-Tr; LPST_Ct0055-1.
DR   EnsemblGenomes-Tr; LPST_Ct0056-1.
DR   EnsemblGenomes-Tr; LPST_Ct0057-1.
DR   EnsemblGenomes-Tr; LPST_Ct0058-1.
DR   EnsemblGenomes-Tr; LPST_Ct0059-1.
DR   EnsemblGenomes-Tr; LPST_Ct0060-1.
DR   EnsemblGenomes-Tr; LPST_Ct0061-1.
DR   EnsemblGenomes-Tr; LPST_Ct0062-1.
DR   EnsemblGenomes-Tr; LPST_Ct0063-1.
DR   EnsemblGenomes-Tr; LPST_Ct0064-1.
DR   EuropePMC; PMC3019943; 21037001.
DR   EuropePMC; PMC3156400.
DR   EuropePMC; PMC4241660; 25395634.
DR   EuropePMC; PMC4476817; 25757029.
DR   EuropePMC; PMC4616932; 26319882.
DR   EuropePMC; PMC4995803; 27559429.
DR   EuropePMC; PMC5077127; 27776158.
DR   EuropePMC; PMC5722076; 29192090.
DR   EuropePMC; PMC6309078; 30593274.
DR   EuropePMC; PMC6629832; 31338086.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01767; SMK_box_riboswitch.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002222.
DR   SILVA-SSU; CP002222.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3254376
FT                   /organism="Lactobacillus plantarum subsp. plantarum ST-III"
FT                   /sub_species="plantarum"
FT                   /strain="ST-III"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:889932"
FT   gene            1..1368
FT                   /gene="dnaA"
FT                   /locus_tag="LPST_C0001"
FT   CDS_pept        1..1368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="LPST_C0001"
FT                   /product="chromosomal replication initiation protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97226"
FT                   /protein_id="ADN97226.1"
FT                   /translation="MLERNDLWNLIKFSMEQDLSKITFQTFVEPAKPLQLDKAQMTIEV
FT                   PTQLHRDYWEKNLAAKFTDIAMQATNEQIRPVMITEEERQQLTRDKDSQVTTGNVAGQQ
FT                   PTTATTPTFMRETKLNPKYTFDTFVIGKGNQMAHAAALVVSEEPGTMYNPLFFYGGVGL
FT                   GKTHLMHAIGNKLLETDPTSNIKYVTSESFTNELINAIQTKKQEAFREEYRNVDLLLVD
FT                   DIQFFANKEATQEEFFHTFNALYEDDKQIVLTSDRLPNEIPQLQDRLVSRFKWGLSVDI
FT                   TPPDLETRIAILRNKADLEGIEIPDDTLSYIAGQIDSNVRELEGALARVQAYSRLNNSP
FT                   ITTSLVADALKSLHLSSKLSEVSIPVIQEKVAKYFHVTMADLKGKKRNKQIVIPRQIAM
FT                   YLSRELTESSLPRIGNEFGGKDHTTVIHAHDKITKALKTDAELQKAVGDLTGQLKS"
FT   gene            1546..2685
FT                   /gene="dnaN"
FT                   /locus_tag="LPST_C0002"
FT   CDS_pept        1546..2685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="LPST_C0002"
FT                   /product="DNA-directed DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97227"
FT                   /protein_id="ADN97227.1"
FT                   /translation="MKFTINRSAFIKELNNVQRAISSKTTIPILTGLKLDVNTDAITLT
FT                   GSDADISIETTIPASDDNNTLVVEDAGSIVLPARFFSEIVKKLPEDTMTVNVVDGFQTQ
FT                   ITSGAASFTINGLDPENYPHLPEIDTTNTITLAGDVLKELIGQTVIAVSNQESRPILTG
FT                   VHFILANGEFLAVATDSHRLSQRRIKLPEANNANYDVIIPGKSLTELSRMIGDNNPDVQ
FT                   MRLSENQVLFVLGNTSFYSRLLEGNYPDTSRLIPKESNTTVEISAPALSAAIERASLLS
FT                   HESRNNVVRFSVNPTDKTITIFGNSPDVGEVTEQLQPTDLSGDELEISFNPDYMKEALR
FT                   SFGQAMIKISFTMALRPFTLVPTEEGENFIQLITPVRTF"
FT   gene            3210..3443
FT                   /locus_tag="LPST_C0003"
FT   CDS_pept        3210..3443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97228"
FT                   /protein_id="ADN97228.1"
FT                   /translation="MKQPIDIKTPYMTLGQLLKETAIIGSGGQAKWFLKETTVLVNGEP
FT                   DDRRGRKLYPGDTIEVEDNGSFFIRSNQETTD"
FT   gene            3444..4568
FT                   /gene="recF"
FT                   /locus_tag="LPST_C0004"
FT   CDS_pept        3444..4568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="LPST_C0004"
FT                   /product="recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97229"
FT                   /protein_id="ADN97229.1"
FT                   /translation="MYLENLVLHDFRNYADLTINFSQGVNVLLGENAQGKTNLLEAIYV
FT                   LALTRSHRTANDKELIRWQTTTATLQGRLHKSTGAVPLELELGRRGKRAKVNHLEQAKL
FT                   SQYVGNLNVIVFAPEDLSIVKGAPAVRRRFMDMEFGQMSPKYLYNLSQYRTILKQRNQY
FT                   LRQLNRQQAKDKVYLGVLSDQLAAFGAEIIHKRLQLLQQLEKWAQAVHSEITQEQEQLT
FT                   FHYVTQVPTADQTSVDHIYQTLQALYQQQQAKEIFQGTTLLGPHRDDLQFGVNGKNVQT
FT                   FGSQGQQRTTALSVKLAEIDLMKAETGEYPVLLLDDVLSELDAARQTHLLTAIQDKVQT
FT                   FLTTPSLDGVARKLINAPKVFEVSHGTLHEEEPH"
FT   gene            4565..6511
FT                   /gene="gyrB"
FT                   /locus_tag="LPST_C0005"
FT   CDS_pept        4565..6511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="LPST_C0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97230"
FT                   /protein_id="ADN97230.1"
FT                   /translation="MTENEKETKLEQAREYDASQIQVLEGLEAVRKRPGMYIGTTSSQG
FT                   LHHLVWEIVDNGIDEALAGFANVIHVTVEKDNSITVTDNGRGIPVDIQEKTGKPALETV
FT                   YTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSTLDVKVTRNGHVYYMDFERGKVKTP
FT                   MKIIGDAPDDAHGTAVHFVPDPDIFRETTTYDINILTTRIRELAFLNKGLRITIRDNRP
FT                   DEPTEDDFLYEGGIRHYVEYLDKNKTVLFPEPIYVEGEQNGITVEVALQYTDDYHSNLM
FT                   TFTNNIHTYEGGTHEEGFKRALTRVINDYARKNNLLKESDANLSGEDVREGMTAVVSVK
FT                   HPDPQFEGQTKTKLGNSDARAAVDRLFSEHFSKYLMENPSVARKVVDKGLLASKARVAA
FT                   KRAREVTRKKSGLEISNLPGKLADNSSKDPEISELFIVEGDSAGGSAKQGRSRLTQAIL
FT                   PIRGKILNVEKASIDKILANEEIRSLFTAMGTGFGGDFDLSKANYHKLIIMTDADVDGA
FT                   HIRTLLLTLFYRYMRPLVDAGFVYIAQPPLYQVRQGKFVKYIDSDEELSEVMGQLAPSP
FT                   KPVVQRYKGLGEMDAEQLWETTMDPDKRRLLRVRDEDAADADGVFSMLMGDQVKPRREF
FT                   IEDNAKFVQDLDV"
FT   gene            6676..9237
FT                   /gene="gyrA"
FT                   /locus_tag="LPST_C0006"
FT   CDS_pept        6676..9237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="LPST_C0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97231"
FT                   /protein_id="ADN97231.1"
FT                   /translation="MADSDLSNNRISDVNLSKTMRTSFLSYAMSVIVARALPDVRDGLK
FT                   PVHRRILYGMSELGVTPDKPYKKSARIVGDVMGKYHPHGDSAIYESMVRMAQDFSYRYM
FT                   LVDGHGNFGSVDGDGAAAMRYTEARMSKIAVEMLRDINKDTVDWQPNYDDTEREPAVLP
FT                   ARFPNLLVNGATGIAVGMTTNIPPHNLAEVISAIHLLMDNPDATVADLMEVLPGPDFPT
FT                   GGIVMGKSGIRKAYQTGRGNIIVRAKVDIQDQKNGKQRIIVTELPYMVNKAKLIERIAG
FT                   LARDKEIEGITDINDESDREGMRIVIDVRRDASASVILNNLYKMTLMQTNFGFNMLAIV
FT                   KGAPKVLSLKQILIYYLEHQEDVIRRRTEFDLKKAQARAHILEGLRIALDHIDEIIAII
FT                   RQSQTSEIAKNQLMDNYGLSDKQAQAILDMRLVRLTGLEREKIESEYQDLLKAIADYKE
FT                   ILASKDRINQIIYEELMEIQRKFGDKRRTELMVGEVLSIEDEDLIEEEEVAVTLTHNGY
FT                   IKRLPTTEFKSQHRGGRGIQGMDVHDDDFIEHLLTTSTHDVLLFFTNAGKVYRMKAYEI
FT                   PEYGRTAKGIPVINLLGVNSGEKIQAVVNVTGDASASDNYLFFTTVKGVVKRTPVQEFA
FT                   NIRSNGLKAITLKDDDELIGVTITDGHQNVIIGTHDGYAVSFDETTVRSMGRTASGVRG
FT                   IRLRDDDFVIGFDVLKPDSNVFIITEKGYGKQTPAADYPIKGRGGKGIKTANVTEKNGH
FT                   LAGLTTVDGQEDIMVMTNQGVMIRFNIATVSQTGRATLGVRLMRLGDDGQVATMAKVDP
FT                   EPEVDETVATDATTEAPVDDQTVNADATTTEPTTDSNDSNE"
FT   gene            9860..10159
FT                   /gene="rpsF"
FT                   /locus_tag="LPST_C0007"
FT   CDS_pept        9860..10159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="LPST_C0007"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97232"
FT                   /protein_id="ADN97232.1"
FT                   /translation="MSESKKYEITYIVRPDIDDAAKTALVDRFDKILTDNGAQVIDSKD
FT                   WSKRRFAYEIGGFNEGTYHIVNLTATDDAALNEFDRLSKINDDILRHMIVKRED"
FT   gene            10196..10798
FT                   /gene="ssb"
FT                   /locus_tag="LPST_C0008"
FT   CDS_pept        10196..10798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="LPST_C0008"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97233"
FT                   /protein_id="ADN97233.1"
FT                   /translation="MINRTILVGRLTRDPELRYTNGGAAVATFTIAVNRQFTNQNGERE
FT                   ADFISCVIWRKAAENFANFTHKGSLVGIDGRIQTRNYENQQGVRVYVTEVVVENFSLLE
FT                   SRAESERHQSANGGSGNNNYNNGNSNYNNNNNGYSNQGQNAAPQQSSANNNNPFGNGNT
FT                   GNASSAAPSSSANNNNQADPFANNGDQIDISDDDLPF"
FT   gene            10837..11073
FT                   /gene="rpsR"
FT                   /locus_tag="LPST_C0009"
FT   CDS_pept        10837..11073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="LPST_C0009"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97234"
FT                   /protein_id="ADN97234.1"
FT                   /translation="MAQQRRGGRRRRKVDFIAANHIEYIDYKDTDLLRRFISERGKILP
FT                   RRVTGTSAKNQRSLTIAIKRARIMGLLAFVSED"
FT   gene            11254..13266
FT                   /locus_tag="LPST_C0010"
FT   CDS_pept        11254..13266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0010"
FT                   /product="exopolyphosphatase-related protein (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97235"
FT                   /protein_id="ADN97235.1"
FT                   /translation="MKKIFSREKIPFFLQNQQLRLLALVIFSLSLIMLVTGYLMNWIFG
FT                   TVVLILIVMAVVISYNTLIELSSSANEYISDLSYRIKRGEQEALIQMPIGVMIFNSDQT
FT                   IEWINPYLQRYFGDKDVLGYRLEDIEPTLAATLNAHLDEPATIRWQDYQFDVRVQQSTN
FT                   TVYMMDVTKYAELTDQFEDEKLVIGQIFLDNYDEITQSMTDTDISNLNNYVTNELSKWT
FT                   QMFGMYLKRLDDDHFFLLGYASSLRRVEENKFRILDRIRESTSKQNFPLTLSIGIAYGE
FT                   RNMNNLADLAQSNMDLALGRGGDQVVVKSEDEPARFYGGKTNPMEKRTRVRARMISQTL
FT                   QELMNQSDQIFVQGHRQPDMDAVGACLGIRRIAEMNGKQCWIVLDEQNVHSDIQRLLDQ
FT                   LKSDENIESAIISPEEALEKATDQSLLIMADHSKPSISMSQALYERLENRVMIIDHHRR
FT                   GEEFPENPVLVYIEPYASSTCELITEMFEYQSHDAEPINKIEATAMLTGIVIDTKSFSL
FT                   RSGSRTFDAASYLRSAGADSLLVQQFMKENVDSYLQRNHLIETVEFVNQDMALCVGEDD
FT                   QVYDPVTAAQAADSLLSMSGVDASFVITRREDGRVGISARSLGEINVQVYMEKLGGGGH
FT                   LSNAATQIEGQSVEAVKQSLIDLLTATDEPTTESN"
FT   gene            13279..13731
FT                   /gene="rplI"
FT                   /locus_tag="LPST_C0011"
FT   CDS_pept        13279..13731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="LPST_C0011"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97236"
FT                   /protein_id="ADN97236.1"
FT                   /translation="MQVIFLNDVRGKGKRGQIKNVPDGYAQNFLIKKGLAKEATKAAIN
FT                   TLKAEQKSEAARAAEELAEAKQVKTVLEADETVVELKAKAGTDGRLFGSIPSKQIATAL
FT                   ADQYQVKLDKRKIELPEPIRVLGYTNVPVKLHPEVTAKIRVHVVEK"
FT   gene            13747..15171
FT                   /gene="dnaC"
FT                   /locus_tag="LPST_C0012"
FT   CDS_pept        13747..15171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /locus_tag="LPST_C0012"
FT                   /product="replicative DNA helicase DnaC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97237"
FT                   /protein_id="ADN97237.1"
FT                   /translation="MNNDVLDQTPPQNIEAEKAVLGAIFLNSDALVEAMEFVEAQDFYR
FT                   RAHQIIFASMVTLNDRDEAIDAVTVSDLLTAQNQLDDVGGMSYIAELAGSVPTAANAGY
FT                   YAKIVAQKATVRRLIKTATEITQKAYTENDDVTTLLDDAERDIMNVSEQRNQSGFKSIS
FT                   DVLNASIEEIDRLYQNDDDITGLPTGFAELDKMTAGLQPDNLIILAARPAVGKTAFVLN
FT                   IAQNVATKTDTTVAIFSLEMGAESLVNRMLCAEGSIDAGHLRTGQLNEEEWEHLVVAMG
FT                   SLSKASIFIDDTPGIKMSEIRAKSRRLAKEQGNLGLIVVDYLQLIEGSNTESRQQEVSE
FT                   ISRQMKKLAKELGVPVIALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRED
FT                   YYDREGGDDDDGGNFGGGGDFNGGDPRDEDASEDVGEVEVIIEKNRAGARGTVKLLFVK
FT                   PFNKFSSVSYAQDPQA"
FT   gene            15393..16616
FT                   /locus_tag="LPST_C0013"
FT   CDS_pept        15393..16616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0013"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97238"
FT                   /protein_id="ADN97238.1"
FT                   /translation="MAQKQLIKTPWLIAGQFMNNIGMSFIWPLTTIYMHNVLGKSLTET
FT                   GIVLMLNSVANVLASTIGGRIFDRGNPYHLLLMGITLNGLANFALIFFHGWPWYPMLLV
FT                   VTGFASGWLNTMFNALAASVPRDKVRRTFTLMYLAANLGVVFGTMLVGIVYSMGMALLF
FT                   SMTTSLFVIFLIIALFEYNVDSSNVTGVDPRQGQDVHLPRANFHIVWTFFISLFIIWLL
FT                   YEQWVSNLSVYMTNLGMPLRNYSFLWTINAGLLVLIQSILSLLGNRIKNLYNQFFFGML
FT                   FVGLSFLSLVIAHDYPHFIFAMILLTIGEATWSPAMPTLVSQLSPVSAKGRYQGLVQAF
FT                   CALGRSLGPLFGGVIIDNWSYKVLFLLAFVVLLIVLAVNIGVVHFNLRKAVNYMKTDVQ
FT                   TDVSRETK"
FT   gene            16629..17435
FT                   /gene="proB"
FT                   /locus_tag="LPST_C0014"
FT   CDS_pept        16629..17435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="LPST_C0014"
FT                   /product="gamma-glutamyl kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97239"
FT                   /protein_id="ADN97239.1"
FT                   /translation="MAVVKVIRKLKAKRVVIKVGTSTLVYPDGSINLRAIDQLAFVISA
FT                   MRHRGREVVLVSSGAIGVGLNYMGLKQRPKAIPEQQAIAAIGQTELISIYKERFAIYEQ
FT                   KIGQLLLTRDIFVYPKSHHNVLNTFEALLKQNVVPIVNENDTVAVDELDHETKFGDNDQ
FT                   LSAIVATNIGADLLIMLSDIDGFYDGNPNADARAQLLGHIEKVDQHTYKLAGGSGSRFG
FT                   TGGMVTKLKAAERMIDANGQMILANGADPTIIFQILAGEPVGTLFG"
FT   gene            17454..18692
FT                   /gene="proA"
FT                   /locus_tag="LPST_C0015"
FT   CDS_pept        17454..18692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="LPST_C0015"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97240"
FT                   /protein_id="ADN97240.1"
FT                   /translation="MVDLEQLGQQAQQASYTLGLLSTAQKNQVLTAMATALTSHQDEIL
FT                   AANAQDLENPQVPVKFVDRLRLTADRIQDMAIGLKQVVSLPDPIGNVDRAWRNEAGLMI
FT                   AKERVPLGVIGMIFEARPNVTVDASALCFKTGNAVILRGGKEALHSNQALVQVLRGALR
FT                   AEAVDENAIQLITDTSHATAAKFMQLTDYVDVLIPRGSARLIQTVLAKATVPVIETGAG
FT                   NCHVYVDKDAQLQMATDIVINGKVQRPSVCNATEKLLIHREVAADYLPSMIQALREQGV
FT                   EVRGDAATQAIVPDVVPATDADWGTEYNDLIIAVKVVDSEAAAITHINRYNTQHSEAIV
FT                   TDNYQAGKLFQQRVNAACVYINASTRFTDGFEFGFGAEIGISTQKLHARGPMGLAELTS
FT                   YKYVIDGNGQIRH"
FT   gene            19153..20769
FT                   /locus_tag="LPST_C0016"
FT   CDS_pept        19153..20769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0016"
FT                   /product="lipoprotein precursor, peptide binding protein
FT                   OppA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97241"
FT                   /protein_id="ADN97241.1"
FT                   /translation="MKKRIWISSIAIVALGLVLTGCGSQQSSQQKTLNVTATQSIATAD
FT                   PNKADDIASQAAIAQFMEGLYTTNQKGKVVPAIAKKVVKPTNNGKTYTFNLRHNAKWSN
FT                   GKKVTAADFVYSVQRQVDPNTKSQEVGHVAEIKNATAITAGKKAVKTLGVKALGKYKLQ
FT                   ITLQQRVPYFNYRLATEIYPLNKQFTEKYGNKYGTSAQRTLSNGPYVLKSWNGTNDTWK
FT                   YVKNPYYYDRKQVRIKNIKVQTVKNNSTAENLFQSNEVQVTQITGTQVSAAEQGSLKSQ
FT                   MKVTKLNQLYFMLWNQKRSALQNTDLRRAVSYALNRQSLVKNVLKDGSVAATSLVPAGN
FT                   TKNPTTGKDFNTDTGNLYPYSPAKAKQYWQKAQASLGKQKLTLQLLTNDNDINKSVAEY
FT                   IQAAIEKNLSGVTVNVKSVPLTNEISTLSKGDFDFATLSWSSDFQDPVDFLNKASITNS
FT                   VNFGKFNNAKYEQLISTITADKQSTKARYQTMQQAAKLVAQQQGVTPIYQTAAAHLISN
FT                   KVGGVHFTLLRDALYRYAYWK"
FT   gene            complement(20817..21026)
FT                   /locus_tag="LPST_C0017"
FT   CDS_pept        complement(20817..21026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97242"
FT                   /protein_id="ADN97242.1"
FT                   /translation="MPILDKVALLSGQTGHKPLKDNDYYDWSPRTLQTDSGQLFTVKPV
FT                   VIRFIAPFAKTSKKARKNAFFRAS"
FT   gene            21100..23004
FT                   /gene="glgB"
FT                   /locus_tag="LPST_C0018"
FT   CDS_pept        21100..23004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="LPST_C0018"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97243"
FT                   /protein_id="ADN97243.1"
FT                   /translation="MVKQTTEMNDASYLFNTGAGFNSQDYLGCHLAASGRAVFRVWAPH
FT                   AKAVGVVGDFNDWQPSALKLLGATGIWQGQVPNVHAGQLYKFQITTPTGQVQLKIDPFA
FT                   QQFERKPGDAAVVVEPMTMRWHDSLWLARRKKSRAANRPINIYEVHLGSWRRHLDGSYY
FT                   TYAELAAELIPYVKQRGYTHIELMPVMEHLLDASWGYQQLGYFAPTSRFGKRDSFLSFV
FT                   DQCHQANIGVFVDWVPGHFIRNYDALYQYDGTPTFEYADPERANNRRWGAWNFDLGKTQ
FT                   VQSFLISSAEYWLDQCHLDGLRVDAVSNMLYCDYDEGREGQVNQYGDNRNLEGIAFLQK
FT                   LNTTVLTHHPDILMIAEESSAYPQVTGSVANGGLGFNYKWNMGWMHDTLDFFMMDPLYR
FT                   HDHFNLLTFAFVYMFDERFILPFSHDEVVHGKKSLMHKMPGDRYNQFANLRTMLTYMAA
FT                   FPGKQLNFMGSEWGQFLEWRDWSALEWVDLKDDLNHRMQQFTTQLNAVYRHNRPLWEQD
FT                   HDPAGIIYTHTDDPDSSTMGFIRQAKRKYSFVVAAFNFVPVERQDYRIGVPYRGRYELL
FT                   LNTEAQAFGGTWTKLETTFTAVDKPYRGQPTSFTVTLPAMGALLIRPVKVIGGVKHAR"
FT   gene            22994..24133
FT                   /gene="glgC"
FT                   /locus_tag="LPST_C0019"
FT   CDS_pept        22994..24133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="LPST_C0019"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97244"
FT                   /protein_id="ADN97244.1"
FT                   /translation="MQDEMLGIILAGGQGTRLGKLTKDTAKPAVPFGGRYRIIDFTLSN
FT                   CANSGVNTVGVITQYQPLELNAHIGSGASWGFDSLNGGVTVLQPYSSSEGEKFFQGTAH
FT                   AIYQNIEYIDQQDPKYLLVLSGDHIYKMDYDAMLKYHQEKKASLTVGVIHVTNEEAKRF
FT                   GMMNTDATDRIIEFEEKPEHPKSDKASMGIYIFNWPTLRDYLVKSYATDKSLEDFGKNV
FT                   IPSYLANNESVYAYAFKGYWRDVGTIKSLWQANMEFLSPHNRLNIGDRYWRIYSKAEVL
FT                   PPMFLTETSQVNNAMVVDSCYVAGEIDHSILSQRVSVGMGSRVVDSMIMPGATIGKNVV
FT                   IDHALIGEDAVIGDDAQIIGTTDKIAVVGYHETMGVEQP"
FT   gene            24130..25302
FT                   /gene="glgD"
FT                   /locus_tag="LPST_C0020"
FT   CDS_pept        24130..25302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgD"
FT                   /locus_tag="LPST_C0020"
FT                   /product="glucose-1-phosphate adenylyltransferase, subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97245"
FT                   /protein_id="ADN97245.1"
FT                   /translation="MRREQVSAIINLLEPSDALQPLTAVRPVGMLPFGGRYRLVDFQLS
FT                   SVINAGIQNVMVTVPRSGRSVADHLRSGRDWSLNTIRGGLFLSPYNDLKLVAPEKKAAL
FT                   LHHYYDNSIQFLKCSQSEYSVVMSTRNVGNIDLKALLRYHEERNSPVTAVYKRVDPASL
FT                   IPENTILQLTAKGEATAVVPMSKAKISPKTKQVAKSMAIYLMSTVDLIELLQSANQRGD
FT                   MISLEELMRQAVIQHNANAFEYTGFQANIHDINSYFAANMAVLDEANFRALFYSSRRIY
FT                   TKVKNEIPTFFATGSQCRDSLCGTGGYIEGQLDHSVIFRDVLINRDSQVKNAIIMQGAR
FT                   IGAGCKLENVIIDKDAVIGPNLVLKGTSTTPLVISKGQHVFQQAEVAVHD"
FT   gene            25295..26734
FT                   /gene="glgA"
FT                   /locus_tag="LPST_C0021"
FT   CDS_pept        25295..26734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="LPST_C0021"
FT                   /product="starch synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97246"
FT                   /protein_id="ADN97246.1"
FT                   /translation="MTRVLFAAAEAAPFYKTGGLGDVSMALPRALQAEGIETRVVIPYY
FT                   PHQMPTEYQQQLVPVTHFTVQVGEHAMYCGIKTLTVAHVQYYLIDNLDYFGREGLYGYW
FT                   DDGARFAFFQMAVCEMMEQIDYIPDILQLNDWHTAFIPVLLAEKYYWIEAYRDIKTVLT
FT                   IHNLQFQGVYDPIILDSLFRIGTETYTEAGVAFYDQVNWLKGGINFADAVNTVSPTYAQ
FT                   EIQTPAFGERLDGVLRANRYKLSGILNGIDMQLYDPATDLALTANYSAKNLKPKRQNKR
FT                   ALQRRLGLPVKNVPVLAVVSRLTKQKGIDLLLDALNPFLQQQDVQLIVLGTGDPALERA
FT                   LRTYQSAYPQKVVAAIQFDTQLAQQIYAASDIFLMPSAFEPCGLSQMMAMHYGTLPIVH
FT                   AVGGLRDTVIPYNRYTDQGTGFSFDDYQPAVLRKIMVLAVTLYRQHPLVWRQLQHQAMT
FT                   CDFGWEHSAQQYRATYQKLMR"
FT   gene            26754..29150
FT                   /gene="glgP"
FT                   /locus_tag="LPST_C0022"
FT   CDS_pept        26754..29150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="LPST_C0022"
FT                   /product="glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97247"
FT                   /protein_id="ADN97247.1"
FT                   /translation="MKLTCAQFKKDFLSEIETLYSTSLSDTSTIGQFIALGQLVRRYNS
FT                   QSWTRTAKFYRDHHQKQVYYFSIEFLPGRLLASNLLNLNLLTTVKKGLTELGLDFETIS
FT                   QAEPDPALGNGGLGRLAACYMDAMASLKIAGNGNGIRYRYGLFKQVFMDGYQVELPDDW
FT                   LHHGNVWETRRDNKSCIVQFGGNVWLQPQADGSLQPQSENTEDVLAVPYDVGIVGYHND
FT                   ITNTLRLWSAELPPSATYSSQDQRDRISEITKVLYPDDSNSAGQQLRLRQEYFFSSAGV
FT                   QSIVRDFCATHHGIKLLGKKVAIHINDTHPTLVIPEMMRLLMDEHHCSWEVAWTLTTQV
FT                   MSYTNHTILQEALETWPIDMFKNLLPRIYQIIAEIDRRYREQQTPIFGKALVDQTAPLG
FT                   NGQVRMAYLAVIGSHSVNGVAPLHTELLKTDVLRGLYQVYPERFNNKTNGIATRRWVQL
FT                   ANQPLAQLIDQTIGSDWRRQPDLLQTLLPYQQDDHFLYQLGQVKLTNKQALAAYVQRTM
FT                   GIKIRTDAIYDVQIKRLHAYKRQLLHVFEILREYFAIKDHPQQPVVPRVHIFGAKAAPS
FT                   YHYAKAIIKLINVVADMVNQDPAIGDRLKIVFIPNYGVSIAELIIPAADVSEQISTASK
FT                   EASGTSNMKLMANGALSLATYDGANIDIMQAAGAENEYPFGLKVNEVYDYYHRGNYHAA
FT                   DFYDADPELKRLLDSLIDGTIPGIPTVGREIYDSLLRYNDEFFVLADYRAYVTQQQQIS
FT                   RDFQNQPTWQQRSLANIAASGHFAADLAVARYADDIWQVPHERLN"
FT   gene            29168..30985
FT                   /gene="amy1"
FT                   /locus_tag="LPST_C0023"
FT   CDS_pept        29168..30985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amy1"
FT                   /locus_tag="LPST_C0023"
FT                   /product="alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97248"
FT                   /protein_id="ADN97248.1"
FT                   /translation="MQVTYNSFLPTYKTPFGAVTRQTPVQFTISVQTVTPVKQIDLCVA
FT                   HDGQWDDEQALPLHPISPTMYTATFIPTQVGLYFYYFRIETATMTAYYGCVDGGYGGPG
FT                   VQYVLREHVQMYQLTILKAVETLPQWYREGVAYQIFVDRFNNGNADGHVNAPKPNSFIY
FT                   GQLTDRPLYVRDEHRAILRWNFYGGNLRGISAKIPYLQRLGVTIIYLTPIFEASSNHRY
FT                   DTGDYLKIDPVVGDLTDFDNLVAAVHRAGMRLILDGVFNHVGVDSKYFNQAGHYPTVGA
FT                   TQSTTSPYYPWFTFIHYPHDYDSWWGIRDLPTVDKDDPTYRDFIFGKPDSVIDYWTQRG
FT                   VDGWRLDVADELPDDFIAGIRRTLDRYPDKVLIGEVWEDASHKLAYGMRRHYLEGGGLQ
FT                   AVMNYPLRRLIIHVLNGTLTPAEWWRELMTLKENYPATTFRFNFNNIGSHDTPRILTML
FT                   AEDRQRLRLAVQLLLTLPGVPCLYYGDEALMMGGEDPDNRAFYPWQDADQAQVQLVADW
FT                   ANWRQRHPWLNTAHFVPFYLADYGIGYLYWQADQTVMVIVNVTTEPRTMTSHDLKLSGV
FT                   PIKLAQAIQRCLVTQTLGGEQLRLIENFT"
FT   gene            31318..32085
FT                   /locus_tag="LPST_C0024"
FT   CDS_pept        31318..32085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0024"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97249"
FT                   /protein_id="ADN97249.1"
FT                   /translation="MYQAVVFFDLDGTLMQDDKTVAASSVRAIQQLRANHVLPVIATGR
FT                   NVFEVQDVMTTTGIDSIVSANGSYVAYQGQFLSAHELDKELLTDITHFANRQQNALAYY
FT                   NNAGFALSHRDALTTSNYRALRQTARVAPHFYEHQHINFLLTFDPLNAAQYRQRYRGRL
FT                   HFVRNNPRALDTMQWGVSKAVGIQDILTKAHLTKVPTYAFGDQLNDIEMFRMIQTPIAM
FT                   GNGHPQVKQLARYVTADNMHGGIAQGLQHFDLI"
FT   gene            complement(32237..32908)
FT                   /gene="pgmB1"
FT                   /locus_tag="LPST_C0025"
FT   CDS_pept        complement(32237..32908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgmB1"
FT                   /locus_tag="LPST_C0025"
FT                   /product="beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97250"
FT                   /protein_id="ADN97250.1"
FT                   /translation="MVKFAAIKGFVFDLDGVITDTSTFHSQAWHQIADKVGVSWNDQLA
FT                   DALKGISRMDSLNLILAQGHRENDFTPAQKQALATEKNTNYLQLVNQMTPANILPGITA
FT                   FLTELTTAGYALSLASASKNAPLVLRKLGLSDYFTKAVDPASLKHGKPDPEIFRRGAEI
FT                   LGLNPADCIGVEDAAAGVQSIKGAGETAIGIGDPTVLAAADINFTDTTQLTLANIKAQL
FT                   N"
FT   gene            complement(32926..35646)
FT                   /gene="map1"
FT                   /locus_tag="LPST_C0026"
FT   CDS_pept        complement(32926..35646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map1"
FT                   /locus_tag="LPST_C0026"
FT                   /product="glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97251"
FT                   /protein_id="ADN97251.1"
FT                   /translation="MKLIRLRIENDAMDIAYHPVSGQAATAHYLIAYNSDQTIGENLEN
FT                   IKVRLAGLQFDAAILENGLSYPFSDTIVGVNYDRIDVGLALTNLLNIPVVSQAAVDQLG
FT                   LVAAVKAKSAYLKWHLDYYGQYHGVRNNGQEAMLTIGNGYFGLRGAFLESHADKDNYPG
FT                   TYVAGVYDQTTTTVHDHQVKNEDLVNLPNAQFMTFGIDHQTPFTLNEHDLQDAYRSLDL
FT                   KTGLLTTTKLIQLASGHQLRIRSQKVANMRDWHRYSIRYQVTPLNFAGSLQIYTEIDGS
FT                   VVNSNVSRYNVFDQHHLKTMGIETAANTVYLSGQTKSSHINYTIGAKLTSPDVPAIENF
FT                   NSTQQPQGVQQTVSLAVEAGKTYTFDKNVVIATSNDHSDPQLTHVQAELDQSSFDNTVT
FT                   TSKDYWEATWRATDIKIRGDITSQRLLRVNIYHSFVSAAAIESGQLDASVGARGLHGEA
FT                   YRGHVFWDEMFILPFYTLHRPELAKQLLAYRYRRLPMARKNAEAEGYAGAMYPWQSASK
FT                   GDEQSQFTHLNPITKTWDPDNSRLQRHVSLDIAYNVWFYYHVTQDRDFLTHYGMEMLLS
FT                   IAAFWISKADYDQANGRYNISGVMGPDEFHENYPNSTTAGLKNNAYTNIMVAWLFDTIT
FT                   TLRAQMPQAAFQAAAQAAQFDSTAEQALTTISHQLTLEINRRGIIAQFEGYFNLPTLDF
FT                   QAYRQKYGDIARMDRILKAESKTPDAYQVAKQADALMAFYNFDVTTVQKIIEKMGYQLP
FT                   KEYLTHNIQYYLARTTHGSTLSRIVYAVLNQLDDNDDDAWKLFSEALASDYYDIQGGTT
FT                   AEGIHLGVMCATLNLTTRNFGGVNPLGAHLQVSPRLPEHWQTLKFKHLFRGVHYVFVID
FT                   HQRVTVTADQPSTIMIGKQHCQLQAKKPLSVTYTD"
FT   gene            complement(36034..36483)
FT                   /locus_tag="LPST_C0027"
FT   CDS_pept        complement(36034..36483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97252"
FT                   /protein_id="ADN97252.1"
FT                   /translation="MQHTTRQAALHMIQTAPVFTLATVDADGFPTMVALSPLPIKRSLE
FT                   ELYFYTSRQTSTTQNIQNWRQASLFYYQLSDYASIMLRGKLSLVGTNVFEQDWRAELTD
FT                   FQQQLNYKDPVILRFQTSSIKIRQMMTIDHLELVDQPTDGPAHLD"
FT   gene            36681..36881
FT                   /gene="cspL"
FT                   /locus_tag="LPST_C0028"
FT   CDS_pept        36681..36881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspL"
FT                   /locus_tag="LPST_C0028"
FT                   /product="cold shock protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97253"
FT                   /protein_id="ADN97253.1"
FT                   /translation="MKNGTVKWFNADKGFGFITGEDGTDVFVHFSAIQTDGFKTLDEGQ
FT                   KVTYDEEQGDRGPQATNVQPQ"
FT   gene            36964..37197
FT                   /locus_tag="LPST_C0029"
FT   CDS_pept        36964..37197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97254"
FT                   /protein_id="ADN97254.1"
FT                   /translation="MVGMDFVDVYGIKHENCTLVAPAREYQRVVIFMDALGRRFVAMGP
FT                   DPQPTKYGSSSQHWHQAQPSAAPEGYFHIDQE"
FT   gene            complement(37372..37447)
FT                   /locus_tag="LPST_Ct0001"
FT   tRNA            complement(37372..37447)
FT                   /locus_tag="LPST_Ct0001"
FT                   /product="tRNA-Lys"
FT   gene            37771..38478
FT                   /gene="rrp1"
FT                   /locus_tag="LPST_C0030"
FT   CDS_pept        37771..38478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrp1"
FT                   /locus_tag="LPST_C0030"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97255"
FT                   /protein_id="ADN97255.1"
FT                   /translation="MKKILVVDDEKPISDIMKFNLTKEGYEVHVAADGEEALQKVDEVH
FT                   PDLILLDLMLPKMDGLEVARQVRKNYDMPIIMVTAKDSELDKVLGLELGADDYVTKPFS
FT                   NRELVARVKANLRRQGAPSAQPAEVEENSDIEIGDLVIHPEAYMVSKRGENIELTHREF
FT                   ELLHYLAQHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKVEDNPSHPKWLVTR
FT                   RGVGYYLRNPENE"
FT   gene            38492..40366
FT                   /gene="hpk1"
FT                   /locus_tag="LPST_C0031"
FT   CDS_pept        38492..40366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpk1"
FT                   /locus_tag="LPST_C0031"
FT                   /product="histidine protein kinase; sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97256"
FT                   /protein_id="ADN97256.1"
FT                   /translation="MLRFKRKNFFKTINFKIALVFALLLLITLEIVGAIFVKQLESKNI
FT                   QDFKQSVQIPTYIDNSLSEQLTVSSTRKANGQIKTILSNYNNTNVDEIQVVDSKGTIRG
FT                   TSDVNDQSVVGQKTTDRNVKNAIYNNRTYTKSTYDTQNNGRYYVSIVPLYSSNSAGNSS
FT                   QLVGVLYVRANMKSVYSTINNIMGIFVIASLAAMVLGLGIAIIIARAITRPIEEMKQQT
FT                   QRIARGDYAGQVRVYSDDELGQLAKAINNLSIRVEESQESTEAERRRLDSVLSHMSDGV
FT                   IATDRRGNITIINETASDFMDVTAEKAIGNSILDILKIRDDYSLRDLIENQDELMLDFS
FT                   SNERDLILNAYFSLIQRESGFISGLVCVLHDVTEQQKIDNDRKQFVSNVSHELRTPLTS
FT                   LRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVN
FT                   INEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIK
FT                   YSPDGGVVTCRLLETHNRVIISISDQGLGIPRADLGHVFDRFFRVDKARSRAQGGTGLG
FT                   LAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYEPYEEEDLWDDDSQA"
FT   gene            40347..41672
FT                   /locus_tag="LPST_C0032"
FT   CDS_pept        40347..41672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0032"
FT                   /product="YycH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97257"
FT                   /protein_id="ADN97257.1"
FT                   /translation="MTTHKLRRFILPILLTILILLSVVLSMYIWLNPSRYEHESKVSTT
FT                   SSNSSLTTRTIDDIYLPTQLIHTNSQGGQSLLINKNVSLVSQFSEQLRKWDARSISKVR
FT                   ITSAKSYRALLNGTDSYVLNFPDSITVSMFNTVFKQHLSNFRSSEFSRIVIPINDTNHI
FT                   YFLNDDHHEIYSVRLKKKSLSSLKKVLAVDKVKRIAVKMTYEDNTTYIDYPKQVTMQHY
FT                   SYLMSKAAASEIANRLLDADGNSTVSVHNRSGKQEYTTGSYKRMTVDSKLGTVYFEDYS
FT                   DSGTTRNLSLTNQLKKSFNLLTSLGVPMDNIRYYGFDATSNSVIYRSYVEGFPIFNQTE
FT                   NGDVRIQLTSNGLDRYYFSLYSLQVPVPTTGQKQAVTLPSSTSVLKRLKAAGYKDSKIG
FT                   SIELGYEWSQNKSSKLVIDLTPTYYVYYNGTWRTYTSMLSGS"
FT   gene            41684..42538
FT                   /locus_tag="LPST_C0033"
FT   CDS_pept        41684..42538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0033"
FT                   /product="YycH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97258"
FT                   /protein_id="ADN97258.1"
FT                   /translation="MNFRRIEWIFLLAFVVLDIFLGFMFVQTSSKSTQTTGDTATTIIR
FT                   EMRADNISFKNPDTSEGTGYYIAGSNESGLKQLLSQLTEQTARVQSGGKLVSTLRATTT
FT                   IDTRNPKADLTTFMSQRTNVIHGTEYVYDADLSSNGDYVFVQKVADGEIMTGAGQVHLF
FT                   VNKNKQLTSYTQTYVNHVKTLREKAVTISEKKALVALYQYNQVASSSRVVWAKLGYSRL
FT                   LKLKDSSVYVPTWIFAVRGKNSSNVTLHRINAFTGSSMKNGSTASDTSSLDATVGMMWN
FT                   AID"
FT   gene            42900..43715
FT                   /locus_tag="LPST_C0034"
FT   CDS_pept        42900..43715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0034"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97259"
FT                   /protein_id="ADN97259.1"
FT                   /translation="MVLKLATDDMKVSILASGSTGNVTYIETPEHKVLVDAGLSGKKIA
FT                   NLMASIDRDINEVDSLFISHEHTDHCHSAGILARKYGMDVYANQGTWDAMAHKIGNVPA
FT                   ELCHVFDPNTTLGLGDLDVESFSVSHDAAEPQFYELHHAGKSFVIITDTGYVSEHVEGV
FT                   IKDADGYLFECNHDLEMLRMGRYPWPLKQRIIGDEGHLSNEDGANALMDVIGRHTKRIY
FT                   LGHRSQDNNLKSLAHLTVASMMTERDFGVEHDFQLYDTEPEQATKLITL"
FT   gene            43826..45088
FT                   /gene="htrA"
FT                   /locus_tag="LPST_C0035"
FT   CDS_pept        43826..45088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="LPST_C0035"
FT                   /product="serine protease HtrA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97260"
FT                   /protein_id="ADN97260.1"
FT                   /translation="MANKSLIKVAVTALVAGLIGGGVAYGGINYFQNNNIATSSTSVPT
FT                   GSNKSGSTSTTNVKVNVSSQATKVFENNKAAVVSVINLQKKSSSSSWSGILGGDDSSGS
FT                   DSSSSSDSSSSKLEEYSEGSGLIYKKSGDAAYIVTNNHVVSGSSAIRVIMSDGTKLSAK
FT                   IVGTDSVTDLAVLKINSSKVTKTASFGNSDNIKVGETALAIGSPMGSNYATTLTQGIIS
FT                   AKKRTVATTNTSGQTTGYATVIQTDTAINSGNSGGPLFNIAGQVIGINSMKLASDNSGT
FT                   SVEGMGFAIPSNEVVKIINELVQKGEVVRPALGVATYDLSNISSSDQKSVLKLPTSVTK
FT                   GVVIMKTYSGSPAKAAGLTKYDVITELGGKKVTSLATLRSALYAHSVNDTVTVKYYHNG
FT                   KLKTANMKLTETTKTLTKQSN"
FT   gene            45643..46122
FT                   /locus_tag="LPST_C0036"
FT   CDS_pept        45643..46122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0036"
FT                   /product="SPOUT methyltransferase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97261"
FT                   /protein_id="ADN97261.1"
FT                   /translation="MNIKIICVGKLKEKYFKQGIAEYAKRMSKFAKFQIVEVPDEKAPE
FT                   SLSNAEMENVKAKEGQRILEKIKDRDYVYALAILGKERSSEEFAAEIDKLTTYGHSDID
FT                   FVIGGSLGLSPEVLKRADTQISFGRFTLPHQLMRLVLSEQVYRAFMINVGSPYHK"
FT   gene            46605..47180
FT                   /locus_tag="LPST_C0037"
FT   CDS_pept        46605..47180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0037"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97262"
FT                   /protein_id="ADN97262.1"
FT                   /translation="MREKDLDKEKSIIDEVSRIILKEGIADVSMSKIAKASGISSSTIY
FT                   VYFSNKEDLLKQVYLAKKRQLAAFLSQNINTKPNNSVKFVQQFMYALYDFGMQYYEALM
FT                   IIEQFNNSPILDSLKIKKEESYQGFEQLFEAVKHTPEFVISSPAVILGFVYAPIVLFVK
FT                   ALKTRQIDNKTIMIDQVVVMCMNALLKK"
FT   gene            47246..47500
FT                   /gene="aldH"
FT                   /locus_tag="LPST_C0038"
FT   CDS_pept        47246..47500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldH"
FT                   /locus_tag="LPST_C0038"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97263"
FT                   /protein_id="ADN97263.1"
FT                   /translation="MTTINEMHQIFYLQKTQYDRAQPMTYEERVTVLNQIEVLIRDNIS
FT                   ELITALQADFGQRDPLQIVSADLTGPLATIAYGRLQEIT"
FT   gene            complement(47507..48430)
FT                   /locus_tag="LPST_C0039"
FT   CDS_pept        complement(47507..48430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97264"
FT                   /protein_id="ADN97264.1"
FT                   /translation="MSTTILSFQNRVVIETLHNEGRSLRYIANYLGFSKTTIFNELHRL
FT                   NSEYQAGLAQTDFERKVSQRGRKSSLTKNLKHLIEEKIQVHKWSPEQVAHVVGIAYKTV
FT                   YNWIDQGWLDIQLPDLPDHGIRRHRAKEKRGTFNHGRSIEERPHKVETRQEFGHFEADT
FT                   VLSGKRKGQAVATFVERKSRLTIVKRLHGRDSQSMTQAVLELASQLQDKLKTLTVDHGK
FT                   EFANYQTIERRTGTQVYFAHAYSPHERGSNENRNRVLRRFIPKGQAIEELSDHQLVQIN
FT                   WYLNSRPLKCLNWHTPIEIFLLNLRH"
FT   gene            48589..49731
FT                   /gene="aldH"
FT                   /locus_tag="LPST_C0040"
FT   CDS_pept        48589..49731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldH"
FT                   /locus_tag="LPST_C0040"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97265"
FT                   /protein_id="ADN97265.1"
FT                   /translation="MALTGTKQYVYNEPLGVVGIMSPFNAPIDLALDPAVEAIAAGNRV
FT                   MVKISEYTPQTAALVQKLSQQYLNEKNFAVVTGEADIAAQFSALDWDKLVFTGGSETGK
FT                   KVLSAAAPNLTPVVLELGGKNPAVVLPDANKQMTAAKIARSRSGNSGQICLDTDYVLLP
FT                   TDQLDEYVRLITAQLAQAFPTYINNSEYSAIINDRSYDRILGMLTEARQRGTRLITINP
FT                   NNELVPDVKRRLIPLTLAINPDRDLQIARNEIFGPILSIFTYDSLDEAIAFINSHEKPL
FT                   AMYLFGRSSRHLNQIISQTSSGGVDINELSLHAGSHSMGFGGVGYSGMGRYKGGKTGFE
FT                   TFSNQKSVYKQGVLAKYTTRLMVPIHNKRNEKLLKRMLGL"
FT   gene            49939..50571
FT                   /locus_tag="LPST_C0041"
FT   CDS_pept        49939..50571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97266"
FT                   /protein_id="ADN97266.1"
FT                   /translation="MGKVSSLKLKTNRRCIYITTIKEITEAIKADPDNAEYTAKGWDPL
FT                   FHVLPTATILVISQAPGRIAQNTKTYFNDASGDRLRDWMGVTREQFYQSDRIAVMPLDF
FT                   YYPGKGKSGDLPPRKGFMDKWHEPLLAMMPNVQLTLLVGQYAIKAYLGRSRQKTLTATV
FT                   QNYQDYLPDYFPLVHPSPLNYGWQKKNPWFQATVVPDLQRRVQIALK"
FT   gene            50820..51470
FT                   /gene="pnb"
FT                   /locus_tag="LPST_C0042"
FT   CDS_pept        50820..51470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnb"
FT                   /locus_tag="LPST_C0042"
FT                   /product="P-nitrobenzoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97267"
FT                   /protein_id="ADN97267.1"
FT                   /translation="METIKAIHTRHSVRAFKDDPIEPQLLTTIVTDAQQTPSWGNSQPW
FT                   QVYIATGHALTNIKQHYATAAEQGITEDADLAKVHRGDFSAFASQNMGHWVGTFRPVID
FT                   SDPTTYWDSRANLYRAPAIAYLVLDANPNSWSIYDLGAFSQTLMLAATARGVQSVPSYE
FT                   LVKYPAIVRNALGMPADKVVAMGIALGYEKPEKPLNQFRTDRVATPQVLHIIN"
FT   gene            51585..51953
FT                   /locus_tag="LPST_C0043"
FT   CDS_pept        51585..51953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0043"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97268"
FT                   /protein_id="ADN97268.1"
FT                   /translation="MTTKQRTYKIKSYVNASHAVRWATGSGKKHTHTWEIVCELHTVDA
FT                   MVAFYDIEKNLHQALDELSGKFLNDLPEFKTVNPTVENVTEYLFTKIDKTLRDNGAQLL
FT                   RIEVSDSPTRAYCISVTE"
FT   gene            complement(52020..52781)
FT                   /locus_tag="LPST_C0044"
FT   CDS_pept        complement(52020..52781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0044"
FT                   /product="fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97269"
FT                   /protein_id="ADN97269.1"
FT                   /translation="MINDDGIIICTQKCCSLATLFDRTFQRSVWFESERNYIMQPTITT
FT                   YQYSYITQQVNQLISAELAVNDLQIRAVVRAQAIERITPLLPSDDPITANFLSHLQTDR
FT                   LTRAKAPQLLETLIPLIIPFPSLTTKQLSKLFRKVKKLKQPVWSQLALHELTYLGWNDG
FT                   GNQKKYLVIPDHDRLIGIQGDLAPQTVKGVCAICQTIGNVALFMSTTKSSGLGPYTRNG
FT                   NYICRDSNQCNRQLTDPQALADFLAVVRPKQ"
FT   gene            complement(53015..55384)
FT                   /locus_tag="LPST_C0045"
FT   CDS_pept        complement(53015..55384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0045"
FT                   /product="fumarate reductase, flavoprotein subunit
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97270"
FT                   /protein_id="ADN97270.1"
FT                   /translation="MKYIALIGTAAQQSYNRELLQFMKHHFSQRATIDVNEITGIPLFN
FT                   EPTQNHIPATVQALNDKISQADGVIIGVPEYDHAIPAALKNVIEWLSYQLHPFANKPVM
FT                   LVGTSLGVQGTCRAQGDLRNILNAPGVDAQVLPGNEYMLSYAAKAFDQNGQMTDAPSIK
FT                   FLERCFDNFEKYVKALNGTPALNVNWHGNYDVIVLGFGGAGASAARFAADNGAHVLVVD
FT                   AAPFGREGGNTRYSAQHVVTGESLDKLTAYYQALGAPFSTPTKTLNAYLSGMSKIPAYF
FT                   EKYLGIKAVSWKHDIKPGDAVAIKKTMAEYPELAGSDTIDFALVHKRDKDAALWKLLRQ
FT                   KVLERADNIDVWLDSRAQHLIQDPNTKVIQGVQIKRGERLLNIHANNGVVLAMGGFENN
FT                   PELKQTYLHSDNLTPLGTLYNRGDGIKMAQEVDAKMWHMTNYESHGILPGITFKEDANE
FT                   RGRQIEHWPLLKNGSIFVIADDGTRYFQEDAKHRHGHVYTHGSWLIPMNNQHPYLIFDQ
FT                   TQYDAFKQEESQDGQLPYPKFMTKLVSAPTIAQLAAKLGVPANNLQQTVTDFNHYTEVG
FT                   RDFEFGRDPQTMRQLDDGPYYAIAAANDVLNTQGGPQRNENAQILNVNDEPIPHLFGAG
FT                   ELGGIVANCYQGGGNLAECLIFGKLAGENAARPKVDSESVTANEANGINDLVDGETASN
FT                   VKLAADQYLGSSNAGLGGKVIVRVTYNDHKIQAVDVIQHHESEDVGLTAIDQIPQEIVA
FT                   ANSTSVDAVSGASASSRAIKEAVQNALKQVKDSVTN"
FT   gene            55850..57265
FT                   /locus_tag="LPST_C0046"
FT   CDS_pept        55850..57265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0046"
FT                   /product="cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97271"
FT                   /protein_id="ADN97271.1"
FT                   /translation="MLSEIKWKGFLLPLIFGIGLWLVTPLRPVAISIMAWHLFAIFVAT
FT                   IIACITKPLPMMAVTLIGIVVATLTGVFTMDEVATGFGNSTAWMVAMCMFMAAGFIKSG
FT                   LGKRIAYLFVSLFGKRTLSLAYALSFVDAVLAIGIPSNNARVNGIMYPIIDNLSREMGS
FT                   DPKQGTQRKLGSFLVFNEYEVNNITSGLFLTGLAGNMVAIGLAKMQGITVTWMQWFTAA
FT                   CVPGILSLLIIPWVLYKVYPPEVKQTPGAHRWATTRLAALGKMTASEKIMSITFILAIV
FT                   LWLIGTKIGIDATEVSFIAVVILLITGVLTTNDLLNEHFAWNILVWLSIIMMMSKKLMT
FT                   LGFFPWFSKTLGHLLNGMNWISVLIILFLAYFYLHYMFPSVSTQISALYAGFLSIAIGA
FT                   GVPHVLAALLLAFAGSINLSTTPYSAGPAALLSSTGYVTSAEWWRLSAIIGVIFNVIWL
FT                   GGGLLWTKLLGFW"
FT   gene            57357..58262
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0001"
FT                   /note="transcription regulator"
FT   gene            complement(58332..58757)
FT                   /locus_tag="LPST_C0047"
FT   CDS_pept        complement(58332..58757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97272"
FT                   /protein_id="ADN97272.1"
FT                   /translation="MTVAIRYQTRNGNTQAFAEQIASVAGVPAQSIDTPVEQADTLFFG
FT                   GGTYFMKPDKTASAFMKNLDPTKIKQIALFTTSGGPEMVSDKALTKIATEKGIPVIGHF
FT                   HQVMGGKGMKIIGSAGGKLKDEQIELVKEFAQKMLAR"
FT   gene            59092..59517
FT                   /gene="arsC"
FT                   /locus_tag="LPST_C0048"
FT   CDS_pept        59092..59517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="LPST_C0048"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97273"
FT                   /protein_id="ADN97273.1"
FT                   /translation="MPKIYFLCTGNACRSQMAEGFAQQLLGPNWQVASAGVETHGLNPL
FT                   AVQVMSEVGIDISDHVSKLIDLTYLNQCAVVVTLCGDARDRCPVTPATVTRLHWPLPDP
FT                   ARTTGSVSDQLLVFRQVRDQIKARVIDLARTLNVSAT"
FT   gene            59843..60703
FT                   /locus_tag="LPST_C0049"
FT   CDS_pept        59843..60703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0049"
FT                   /product="short-chain dehydrogenase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97274"
FT                   /protein_id="ADN97274.1"
FT                   /translation="MKDFKDKVMFITGAAHGFGQVIAEGAADRGMKLTIVDIDEPALKK
FT                   TYQHILDKGAEVLMVTADVTKEASVDDAVEQAMEKFGRIDLLINNAGIALPGRIWELPT
FT                   RDWEWIMHINLMSQVYAMKRVIPIMIQQKTHADILNVASIAGLVDTPGMPSYHASKFAS
FT                   VGMTEATVYDLQRANIDIDMHVMCPGFVQTDLYHTENHRPVQYSDPTDPYYQSEAYLKG
FT                   QQFAKYVITNGKPIDTIADTVFKALEDNRFYILTHPEYNPLIEDRVKRIVTDGAPDVHI
FT                   MDGIM"
FT   gene            60735..61580
FT                   /locus_tag="LPST_C0050"
FT   CDS_pept        60735..61580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0050"
FT                   /product="acetoacetate decarboxylase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97275"
FT                   /protein_id="ADN97275.1"
FT                   /translation="MASFIASDQDVKNFLTAPSMNDQEGIGFAYATDEAVLKALIPAPL
FT                   KLMAPVVCGYVVHMGKPTFSAPYLEESLFALVSYKDKMMGAYPINLLLHGPGAESGVIA
FT                   GREGAGIPKKLADAIELRRNDNSATATVERHGKTLLNVSWTAGELNDPSIMKQFAGQLA
FT                   LGKEAEMNSFFYKYDIDQHEDGTNHFSNVQLVATQLRSLADQVEPGNLSIQLESTDDDP
FT                   FGELKVLKPLGAAWFHFDTSVMFNTLKLDEVDAATTMPKLLTGRYDRSFFNPKAATYII
FT                   "
FT   gene            61608..62261
FT                   /locus_tag="LPST_C0051"
FT   CDS_pept        61608..62261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0051"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97276"
FT                   /protein_id="ADN97276.1"
FT                   /translation="MSEAVKNLVNNDLADVMFNRHSVRQFDPNVKIGRDELQKMIAEAA
FT                   TAPSACNLQSWHFVVVDTPEAKAKFKQAVMKFNYPQVDSASAIVFIAGDTQSHYVYRDV
FT                   WNKVYEDGNITKERLDQILGTFLPLYENATPDFLKFDATIDCSVVGMQLLLVARAHGYD
FT                   ANAFSGIDFEKMIPTLGLDPKRYVPVMGIAIGKAAQEPLHTTRYDAKTQTDFLA"
FT   gene            62431..63966
FT                   /locus_tag="LPST_C0052"
FT   CDS_pept        62431..63966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97277"
FT                   /protein_id="ADN97277.1"
FT                   /translation="MQLKPLLRQLATTFEVTVDPTFTHNPEVTHVQFVDPTEALASHRL
FT                   YLSPDSGQLVQLAYSWHGHRQSVGLVNLGTGLTTIIAAQNQLLKLLMTLGQCLQHDVQI
FT                   QAAINQLAIQAITADFDTTLAQAVHLLENPLAIIDLNGEILTRSHTTQLNGTSIHAAVE
FT                   TNRVGRWLLDHGFAPDTPDFLTQVYVAEDQLSAGPMLITPLANGTEPIGYLVMPALNKP
FT                   LNDRQALLINSIGQVIAGSLVKNQIMPTAESQRDRLLNLLLTEHQGGTFADQFAEQHVQ
FT                   LPTAMVLIRCEPLADQAPMILQQRLQYLMMPRFKQVLVSTYQQQCVALIPISLVAYNQN
FT                   QFKLTLQQITKQADCRLIVSQHYVNPEDTFAAYTVCERTAQLKTGRGRVIFCEDQFYNL
FT                   ALARVNHLEILPFFINPALRLLLAYDQQNHTELVPTLDVYLRATCNLTRTAKQLYVHPN
FT                   TLRNRLHHITTLTGCDLRDAETCFKLAASFKLRQFLTQHQYQYRPDIPIPTQD"
FT   gene            complement(63910..64113)
FT                   /locus_tag="LPST_C0053"
FT   CDS_pept        complement(63910..64113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97278"
FT                   /protein_id="ADN97278.1"
FT                   /translation="MTTVANHMPARRSNRNGGPIIAVHPEFTDLLIMTDPTIFPQTVAR
FT                   FYAHLILGRNWNIRSILVLMLG"
FT   gene            64296..64967
FT                   /gene="pgmB2"
FT                   /locus_tag="LPST_C0054"
FT   CDS_pept        64296..64967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgmB2"
FT                   /locus_tag="LPST_C0054"
FT                   /product="beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97279"
FT                   /protein_id="ADN97279.1"
FT                   /translation="MSKFADIKGFVFDLDGVIADTSVYHSQAWHQLADELGVAWSEELA
FT                   DNLKGVSRMDSLNLILKTGGKENDYTEAEKVAYAAKKNTNYLNLLKGMDKTAILPGIED
FT                   FLADLAKHGYRLSLASASKNSPLVLEQLGLAHYFEARVDPATLKHGKPDPEIFARGAEV
FT                   LGLKPEECAGVEDAKVGIQSINGASETSIGIGDPAILTGADVNFTSTSELTLANLKAAL
FT                   A"
FT   gene            complement(65053..66069)
FT                   /gene="bsh2"
FT                   /locus_tag="LPST_C0055"
FT   CDS_pept        complement(65053..66069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsh2"
FT                   /locus_tag="LPST_C0055"
FT                   /product="choloylglycine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97280"
FT                   /protein_id="ADN97280.1"
FT                   /translation="MCTSLTYTNSHGGHFLARTMDFNVDFETRIMFMPRHYRVTGDLGD
FT                   FTTTYGFIGAGRQLNHEIFTDGVNECGVSIAALYFPNHAIYQPHSNQDKIDLAPHDFVA
FT                   WVLGKITSVADLRERVKDVQLISSTAELINEIPPLHFIISDQTGETAVLEPTSGELRLL
FT                   NNPVGVLTNSPNLKWQLQNLSKYGTLTNTERPLNKFINYQPGSQGPGTGALGLPGDYTS
FT                   MSRFARTVFLKHYAQVPATTTDTVNLLQHILNAVTIPKGAKVAANGQATYTEYRSYMDL
FT                   NHQTYALELYENPGVIQQVNLTDHLLEKQTVPLEYVLSRTPHVQLLTPDVATLPAAH"
FT   gene            66342..67685
FT                   /locus_tag="LPST_C0056"
FT   CDS_pept        66342..67685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0056"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97281"
FT                   /protein_id="ADN97281.1"
FT                   /translation="MNKERKSVMPLSQRHHMTIPWKDFIRNEDVPAKHASLQERTSIVG
FT                   RVGILMLSCGTGAWRVRDAMNKIARSLNLTCSADIGLISIQYTCFHHERSYTQVLSIPN
FT                   TGVNTDKLNILEQFVKDFDAKYARLTVAQVHAAIDEVQTRPKQYSPLVFGLAAGLACSG
FT                   FIFLLGGGIPEMICSFLGAGLGNYVRALMGKRSMTTVAGIAVSVAVACLAYMVSFKIFE
FT                   YNFQILAQHEAGYIGAMLFVIPGFPFITSMLDISKLDMRSGLERLAYAIMVTLIATLVG
FT                   WLVATLVSFKPADFLPLGLSPLAVLLLRLPASFCGVYGFSIMFNSSQKMAITAGFIGAI
FT                   ANTLRLELVDLTAMPPAAAAFCGALVAGLIASVVNRYNGYPRISLTVPSIVIMVPGLYI
FT                   YRAIYSIGNNQIGVGSLWLTKAVLIIMFLPLGLFVARALLDHEWRHFD"
FT   gene            67834..68580
FT                   /gene="ptp1"
FT                   /locus_tag="LPST_C0057"
FT   CDS_pept        67834..68580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptp1"
FT                   /locus_tag="LPST_C0057"
FT                   /product="protein-tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97282"
FT                   /protein_id="ADN97282.1"
FT                   /translation="MEGITNLRSLGGYRNKNQQVIKDGLIYRSGQLDQLTPAQTQYLAT
FT                   TLGITRIVDMRSADERHQFPDATWPHVQYHVLDVLAQVMTNDASLQSMISSTGAVHDRM
FT                   VQLYEQLALDPTARQSYCQFIQLLLVPDQPLLFHCFAGKDRTGVGAALFLKILGISDEQ
FT                   IMADYLLTNQARAAANQQILATMASQLSDEQQRAVNQALLVDADYLSHYFEVIKARYDT
FT                   FSNYLQTGLGLTSAECQQLRELYLTK"
FT   gene            complement(68653..70089)
FT                   /locus_tag="LPST_C0059"
FT   CDS_pept        complement(68653..70089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0059"
FT                   /product="4-hydroxyphenylacetate-3-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97283"
FT                   /protein_id="ADN97283.1"
FT                   /translation="MHTIEQLNDGRAVYLNGHRVNVADVPIFRKTLALNNQYYDLQHNH
FT                   PEVHTYQENGHRYDIAFKVPRTVADLQQKHRAYQEIAQSNSGMLGRTPDFLNTGMAVLA
FT                   ERAAFLGQNQYTDFAANARNYAKEVKANDIFISHALQNPQLNRQKAINAIPSGYAGVHT
FT                   IERNQDGIFVSGAKMVNTMAPIADDLLIFNPPELLLENGDSSYAVAFATPLNNPGVKII
FT                   CRKLLDHPTASITDYPLSNALDEIDAYIVFDHAFIPWSKVFVENNVEMSNRFFIDSGMF
FT                   SHTSHQDEVRGITKLELATSLALRIAHILGLDGFLGVQEKLGRLTANLELIKGTITRSE
FT                   DNGHLDEFGIYTPSLQALQAVRSTLPEYYDEALRVTQHLAAGSMVGVPSFAEFDGDNAT
FT                   ILNQALTTDRATAKTRTRLLNLAFDLTSSGFGQRQLMYEYYHGGDPMRIRAQHYQRADL
FT                   QAGNQMIDRLLSADNANTHE"
FT   gene            complement(70172..70672)
FT                   /locus_tag="LPST_C0060"
FT   CDS_pept        complement(70172..70672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97284"
FT                   /protein_id="ADN97284.1"
FT                   /translation="MGAYVKLKTDHNLEVIIMDVQSFFEQAKTTLKLTQSTPLQSAYQF
FT                   GSDPDKLAQLVLTGTKTATTSAYDLYETDEPLPKVGAYDVILDAHNQPVCVTRTDQVMI
FT                   TPYLDIDATHAYLEGEGDRTYAYWRRVHDAFFKQEYQSEHQRFDPHTAQMVLERFHVVY
FT                   PVH"
FT   gene            70765..71433
FT                   /locus_tag="LPST_C0061"
FT   CDS_pept        70765..71433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97285"
FT                   /protein_id="ADN97285.1"
FT                   /translation="MRINVLQHTPNEGPGMIADWAHAHGHTMYVYHPYQFGVLPTADET
FT                   EMLVILGGPMSPNDTLPWIKQERDLIQQLLDRDIPMFGACYGAQQIAKTLGYPVTKAPA
FT                   KEVGWAPIYRQSPVIPGIPAKLSVLHWHEEMFTVPAEATLLFSSDRVTNQGFVWKHRVV
FT                   GLQFHFEPAADNVREMVVNDYRYIAGSVLNRTAAEILQTPVPRENQQVLNAILNYITAE
FT                   "
FT   gene            complement(71506..72477)
FT                   /locus_tag="LPST_C0062"
FT   CDS_pept        complement(71506..72477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97286"
FT                   /protein_id="ADN97286.1"
FT                   /translation="MSPLKSFLGVIYMNRSERLNQELIFLSYRQEFHIKELMQEFNISK
FT                   RTALRDVNSLEQLGLSFYVEPGRYGGYQLMQQQLWVPILLNSQEINALFFALKALSLLS
FT                   ATPFEKSYHTIYKKLMATLSLSNQRQVAKLQRVVNYYSIPNLDAPTHLSDLLTAILDEN
FT                   VVQLTMTTVTARFQIFDLLYRHGIWFFSGVNLDNNAWGIYRCDTIKAFQTSEQPARYTW
FT                   KQLAQRQRSYDHHHHNIRYKCALTPLGREHVQKNNYPNMHLTHQNDQDYLIGGYNQDEL
FT                   AYMVDYLLGLGRNVRIIYPEALKTAYLQELQQIQGFYQRLVF"
FT   gene            72560..73207
FT                   /locus_tag="LPST_C0063"
FT   CDS_pept        72560..73207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0063"
FT                   /product="acyl carrier protein phosphodiesterase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97287"
FT                   /protein_id="ADN97287.1"
FT                   /translation="MTKTLIINAHPDFRNAAHYSVQLEQTFLQLFQTRFPNDTVDVLNL
FT                   YDTVIPQATVPELLGIWEKQAQHVNLSIEEQRLFAINQQLLQQFKAHHRIVIAMPLHNF
FT                   NVPARLKDYIDNILVARETFRYTENGSVGLMTDNYRVMLLQASGSIYTRNDRYTPMEFS
FT                   RLYLDKMFTEIMGFDRFEIVRAQGLQTNGVAVSQALKQAKMDLKAAFERFYD"
FT   gene            73469..75487
FT                   /gene="fusA1"
FT                   /locus_tag="LPST_C0064"
FT   CDS_pept        73469..75487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA1"
FT                   /locus_tag="LPST_C0064"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97288"
FT                   /protein_id="ADN97288.1"
FT                   /translation="MKRIVAGIIAHVDAGKTTLSEALLYRSGALRQLGRVDNGDAFLDT
FT                   DVLEKQRGITIFSHQANLQYKDINLTLLDTPGHVDFATQTEQVLSVLDVAILVVSATDG
FT                   VQGYTRTLWRLLARYDVPTILFVNKMDAPGTDSDQLIQQIQQTLSPGCVAFNTPGAGDT
FT                   LEDRPVIPTAAVEDIAMQNDEVLTDYLETGTLSDATIRQMIQRREVFPCYFGAALKLDG
FT                   VDALMAGLDYWTTPQLTRPEFGARVFKITHDDQGERLTWIRMTGGTLRPKDIVYDDQKV
FT                   NQLRVYNGTKYATTSALTAGSVGAITGLTGTRPGQGLGQAATSLQPVMQPVLTYALDPQ
FT                   REELHTCLAALRQLEDEDPQLHVTWSEPLQELRVQVMGTIQLEVLQQILQDRFQLTVKF
FT                   GTGSILYQETITQAVEGVGHFEPLRHYAEVHLLLTPAPRGSGLQFTTDCSLEVLGRNWQ
FT                   HQVVSNLQAKTQVGVLIGAPLTDVKVTLVSGRASNVHSVGGDFREATWRALRQGLMMLK
FT                   QRGDCQLLEPWYRFRLEVGQEQVGRAMTDIQRMNGQFDAPVANTSVATDGTDLTTITGT
FT                   APVAAMQDYSQTVRAYTHGQGQLECIVDGYRPCHNEMAVVDKAKYVPTADLENTPDSVF
FT                   CAHGAGYPVAWNQVPEMAHVPYVYSNTELAHFKAPSK"
FT   gene            75505..76191
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0002"
FT                   /note="hypothetical protein"
FT   gene            76197..77081
FT                   /locus_tag="LPST_C0065"
FT   CDS_pept        76197..77081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0065"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97289"
FT                   /protein_id="ADN97289.1"
FT                   /translation="MKKIAPLFVGLGAISFGIPASLFKIARRQGVVNGPLLFWSFLSAV
FT                   VILGVIQILRRARLRNQQTNWKQIGLVIAAGTASGFTNTFYIQALKLIPVAVASVMLMQ
FT                   AVWLSTLLGAVIHHRRPSRLQVVSIVLVLIGTILAAGLFPITQALSPWGLILSFLAACS
FT                   YACTMQFTASLGNNLDPLSKTWLLCLGAFILIAIVWSPQLVTAPTTPATVGWGVLIALF
FT                   SMVFPLVMYSLFMPYLELGIGPILSSLELPASIIVAFVLLDETIDWVQMVGVVIIITAV
FT                   ILPNVLNMRRVRP"
FT   gene            77269..77760
FT                   /locus_tag="LPST_C0066"
FT   CDS_pept        77269..77760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0066"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97290"
FT                   /protein_id="ADN97290.1"
FT                   /translation="MALTYRIVRAEADSDFGKIRQLYYETWQSAYRDLMPASYLQQLTP
FT                   ATWRPERRWQNMLLAMTADGEVVGVCTFGPARHANYEGWGELYSLYVHPNYHHHGIGQQ
FT                   LIIQAHRRLKAVYPQNYLLVLANNAVAQRFYQRNGFHDTGQIYVDHAPFGVLHERIFED
FT                   "
FT   gene            complement(77791..78465)
FT                   /locus_tag="LPST_C0067"
FT   CDS_pept        complement(77791..78465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0067"
FT                   /product="intracellular protease/amidase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97291"
FT                   /protein_id="ADN97291.1"
FT                   /translation="MKKVLIVETNITRYQGTNEPTGLWLGEAAEFVDEMQQAQIAVDYV
FT                   SPNGGFVPLDPRSMKYTDAATMAVYEDSDFINRALKNTLKPSQVDPDDYTAIYYTGGHG
FT                   VMWDFPDNPELQAIALAIYQHGGYVTSVCHGIAGLLNIKDQTGQYLIAGKTITGFTATE
FT                   ELIAGKKRIVPFLNRERATAHGAIFSQHRFYREYAITDGQLITGQNPFSARAVARQLIA
FT                   KL"
FT   gene            complement(78511..79515)
FT                   /locus_tag="LPST_C0068"
FT   CDS_pept        complement(78511..79515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0068"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97292"
FT                   /protein_id="ADN97292.1"
FT                   /translation="MKAAIITKYKQITPMVTEVPVPTIAPTDVLVKIVAASVNPIDLKT
FT                   KDGDLRLLLQYTMPLIMGSDFAGVITAVGDQVPDFKVGDAVYGRAPKDRIGTFAEFIAI
FT                   DHQAIALKPANLNFEEAAAIPLVGLTSYQALHDIMNIQPGQKVFIPGGSGGIGIIAIQL
FT                   AKYFGAYVATTTSAKHFDLVQSLGADKIIDYHQQDFTDVLSHYDAVLDTRGGQSLEAAF
FT                   QIIKPGGQIVSIAGLPNARFGKDYGLPIWKQWLLGLATWKLSRLEQQAQATYSFLFMQP
FT                   SGQQLVRLRQLIEQGVIKPVVDRIIPLTDINAALEYSHSGHATGKIIISIQPN"
FT   gene            79697..80005
FT                   /locus_tag="LPST_C0069"
FT   CDS_pept        79697..80005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0069"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97293"
FT                   /protein_id="ADN97293.1"
FT                   /translation="MAIFKKGVPIFTILQDENRQRILVMLCRTDQMTVNQITAQIALSR
FT                   PAVSHHLKLMLDAGILAVSKTGTERYYRANMTATLKLLKALTASLEADLAHTQSVDE"
FT   gene            complement(80174..81508)
FT                   /locus_tag="LPST_C0070"
FT   CDS_pept        complement(80174..81508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0070"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97294"
FT                   /protein_id="ADN97294.1"
FT                   /translation="MNDLFEKAPIPKAYFHLAFPVVLGMVASMIYNLADTFFVAQTGNA
FT                   DLVAGIALGSPLFSFMLAVGDIFGLGGSAVISRVLGRHDYHQSARISSFCFYIAIALSL
FT                   VLTALLLLFEQPILGLLGATAATRPYIADFYRILVLGSTFIIVSLVPGNIIRTEGLAQL
FT                   SMIATISGTVLTIILDPLFLFGFHWGASGVAFANVLGYAVNTSLLVFFMRRAKTLSLAP
FT                   KLAHISRPTLKAVVAVGIPASLTNLTQSFGMMILNSYLAAYGAQTVAAMGIVQKVYMVV
FT                   MMVMVGFAFGAQPLVGYTYGAKNWQRLRATLRFDLKVEGGYATICAIILMIFAPQLIKL
FT                   FMNQPAIVTMGTQMLRAMLITTPLVGFILVFTTVFQSVGAGLSALAMALSRQAILLGIA
FT                   IVILAQFFGLTGIIWAQAVADVLTCLLGWLLYRHTFKDIQVPSSN"
FT   gene            complement(81711..81866)
FT                   /locus_tag="LPST_C0071"
FT   CDS_pept        complement(81711..81866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97295"
FT                   /protein_id="ADN97295.1"
FT                   /translation="MMVLSIITVLGMGLIAATGVHFINGAQAMHAGTVGHHVGQMPANL
FT                   HQIDLR"
FT   gene            82108..82437
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0003"
FT                   /note="hypothetical protein"
FT   gene            complement(82419..82667)
FT                   /locus_tag="LPST_C0072"
FT   CDS_pept        complement(82419..82667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97296"
FT                   /protein_id="ADN97296.1"
FT                   /translation="MHNPPSLKYESYSKPEATHFQLRIIWLLSIVTSPSSREAARMADE
FT                   RPLNSVQFVVGYFNTEPFKLNIRVPSPLFRNIQLLLR"
FT   gene            82860..83744
FT                   /gene="pepI"
FT                   /locus_tag="LPST_C0073"
FT   CDS_pept        82860..83744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepI"
FT                   /locus_tag="LPST_C0073"
FT                   /product="prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97297"
FT                   /protein_id="ADN97297.1"
FT                   /translation="MDVQEGYMPFNGYQTYYRIVGDRQSNKTPLVLLHGGPGSTHNYFE
FT                   GFDDLAVQTGRPIVMYDQLGCGRSSIPDDDQLWQAATWVAELRALRTYLDLPEIHLLGQ
FT                   SWGGMLAIIYGCDYRPQGIKSLILASTLSSARLWAQEQHRMIRLMSPVDQSAIATAERL
FT                   QDFTGAAYLTANQHFMTQHASGPITADDPEFLRRSKRVGTTAYNVAWGPNEYNPTGTLA
FT                   DYEYTDRLQYLQMPTLVTSGTDDLCTPLVAKTMVDQLPHATWTLFPRSRHMAFIDENTA
FT                   YMTRLRHWLAAHD"
FT   gene            complement(83926..84414)
FT                   /locus_tag="LPST_C0074"
FT   CDS_pept        complement(83926..84414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97298"
FT                   /protein_id="ADN97298.1"
FT                   /translation="MAPDVFTQPALDYIQANLRILSGFYGILRPFDGIVPYRLEMQARL
FT                   AVGQAKNLYAFWGDRLYQALTPRPEPIINLASQEYAKTIAPYLAPHQSMIDIVFASFID
FT                   GKLKTKATLAKMARGAMVRFLAEHQIDDVTAIRTFDHPDYQFDEKRSTANRFVFIYQH"
FT   gene            84842..85276
FT                   /locus_tag="LPST_C0075"
FT   CDS_pept        84842..85276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97299"
FT                   /protein_id="ADN97299.1"
FT                   /translation="MDISLLKQVVQSTNKIALSTAVNNEADVKIVNFVWYEAQPDTLYF
FT                   SSVKTSPALKVYDQNPDIAFITIPNDGTAGNPYLRAQHVKLQRSTKTMTDLLPQYLETV
FT                   PNYQQVWDAIGSTLVVFELKLTDLFVDAGVGGEKQTLTFN"
FT   gene            complement(85378..87021)
FT                   /locus_tag="LPST_C0076"
FT   CDS_pept        complement(85378..87021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0076"
FT                   /product="extracellular protein, peptide binding protein
FT                   OppA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97300"
FT                   /protein_id="ADN97300.1"
FT                   /translation="MSLSGTHKLILTIGSVVIIGGIGFTVNAHSHPATTKQSQVINLSA
FT                   GSEIMSLDPAKMTDSVSNSQVTQVDEGLYRLNSQSQPVNALATKTTVTNGGHTYIIQLR
FT                   HDARWSNGNRVTAHDFVYSWRRTLDPKSKSEFTYVFTNIKNADAIAAGKKKPSTLGVKA
FT                   NGDYQLTITLSKPVAYFKKILAVSTFYPVNQPAVNKYGKKYGTSAATTVYNGPFTLTGW
FT                   TGTNNTWTLKKNPAYYDHKLVKLHQINYQVIKSNTTAYNLYQSNKLDSVTLNGEQSVQN
FT                   KNNQELKTLAGGQISFIQYNHHDHVAANRELRTALSLAINRSQLTNKVLENGSLPAKSF
FT                   GVRNMAKNPKTGTDFVNDATVDGTVNYNLNQARAAYHKAQRQLGKKSLTLTITCGDDDN
FT                   SHQVAEFIQGQLTSHLPGLKVTIKAMPFTAMLGKVSKGAFQLNLTSWSMDFADPSQSLT
FT                   ILTGDSNSNMGHYQSKAYDQAMQAADGPDALNATKRYQDLVQAAKTALTDQAVTPLYEG
FT                   RSHLLVKSHLKGVIYNNFSGAANYRTAYVK"
FT   gene            87689..88438
FT                   /locus_tag="LPST_C0077"
FT   CDS_pept        87689..88438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97301"
FT                   /protein_id="ADN97301.1"
FT                   /translation="MSFRVVAGYFGEFSDEAKRANQDLGVIGMSFQYQCNLVYPEGAGP
FT                   NFGFRTDAQAIDVFDALKVGYDGFKVQAGLIKAMGLVDYQLVGGRYELVGHDFRELPLA
FT                   EINANLETMPGLLAQGPMPVRYVTYRRTDDPIDAVGFSGNWALGDSGGFRQLSETLAEP
FT                   MQAPVAALIKAIDQLGLTLQQINLPTPQSSTALPTHLSDDVHQANVDVWVVLTQPQGDE
FT                   QQVLQTIHNAQECNEKLCEALTRVYLK"
FT   gene            88543..88668
FT                   /locus_tag="LPST_C0078"
FT   CDS_pept        88543..88668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0078"
FT                   /product="group 2 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97302"
FT                   /protein_id="ADN97302.1"
FT                   /translation="MLLETYQHRSFIKQTGNISIERDWEKLFDEAWLIKHLRGYR"
FT   gene            88696..89475
FT                   /locus_tag="LPST_C0079"
FT   CDS_pept        88696..89475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0079"
FT                   /product="adenylyl transferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97303"
FT                   /protein_id="ADN97303.1"
FT                   /translation="MMTSTPRLLQAIQQTTTAILKTNLVGIYLHGSYVLGSYNEQVSDL
FT                   DYLIVVRRSLTLAEKRQLMTATITQLWPLAPHKGLEFHVLLLSATQHFVHPCPFDFHFS
FT                   KYHYEDYQRTPLAYLKAMHGTDPDLAAHLTILQAAGQVLLGPAITTVFGPIPAVAYWDS
FT                   IKSDIANAETAIVQLPMYTVLNLCRVRAYQQDQLIISKQAGGEWGLQQLPTQWHPLIRQ
FT                   ALAAYAGQQDEQVIRWSRPNLVAFARIMLAELGLKSE"
FT   gene            complement(89543..89776)
FT                   /locus_tag="LPST_C0080"
FT   CDS_pept        complement(89543..89776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97304"
FT                   /protein_id="ADN97304.1"
FT                   /translation="MLNPNTEIHRGWNRRVVTGKTLAECDERLVKYLNDQDYGSGEFVV
FT                   LHENDGSNENTGYDLPDGDNCYISFLIYNSRL"
FT   gene            complement(89797..90528)
FT                   /locus_tag="LPST_C0081"
FT   CDS_pept        complement(89797..90528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0081"
FT                   /product="cobalt ABC transporter, ATP-binding protein
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97305"
FT                   /protein_id="ADN97305.1"
FT                   /translation="MVLIKLVNICYDYPDTCGLKDLSLTVNSGDFICLMGPNGSGKSTL
FT                   LRLLSGLASPTSGAYQFHDQPITTTYLADAQNRQQLHQRIGMVFQNTDVQLFNTSVTEE
FT                   VAFGPRQLGLSAAMVAQRVADCLQLTDCANLADRVPYQLSGGEKKRVALASVLALNPEI
FT                   LLLDEPLNGLTIAAQQQMLTLLQRLQAAGKTIIMASHNYQQVQAVGERFIIFNSTHQVD
FT                   ADLTRADLDQQPARQAQLMTL"
FT   gene            complement(90530..91351)
FT                   /locus_tag="LPST_C0082"
FT   CDS_pept        complement(90530..91351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0082"
FT                   /product="cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97306"
FT                   /protein_id="ADN97306.1"
FT                   /translation="MKPTRPNTDIPAWLQTTTTTPTPAIKAKFWQRNQRHLRQLLSRLA
FT                   QPAPVTATSHWRVAPQFKLIQLLLLVILIALSNNLILLWSLALLVGCQLLWLPPRQLRR
FT                   FMGSWLISVGMAMLFVLPSYWLAGPTTLLFFGLKTSLMLANAQYYRLTTPFQDLLAGLK
FT                   ALHCPDLLIMTLAIAITYLRMLGQHLLLTMEALELRTVAPTAHPYRLIGALFGNLYLKS
FT                   YTYALELYAAMEARGFNGHYVRSTGRRTHWRDYLALSPAIIVWILFIFWRH"
FT   gene            complement(91326..92312)
FT                   /locus_tag="LPST_C0083"
FT   CDS_pept        complement(91326..92312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0083"
FT                   /product="cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97307"
FT                   /protein_id="ADN97307.1"
FT                   /translation="MHIPDNYLSPATCGTLVTAMAPVWTVAVLKVKVQIKKHHETLPML
FT                   GIAASLAFLIMMFNLPIPGGTTAHAVGGTLLAVLIGPWAACLALTVTLLLQALLFGDGG
FT                   ILAFGANALNMAVIMPFVGYACYRLGQKWHHEKLGLAIGAYLGINMAALVAGIELGLQP
FT                   ILAHTASGAPLYCPYGLNITIPAMLTAHLLVAGWVEVVFTLLVFQFVKRVAPTNLYQTP
FT                   TRRNQRPWIALLLGLAVLSPLGLLASNTAWGEWSPQELQQRLAQQHISTHAPQGMVHGF
FT                   HFQALFSDYAIAGLPVSVGYILSAITAVLIFLLLIRGLQHETDTSQH"
FT   gene            complement(92327..92992)
FT                   /locus_tag="LPST_C0084"
FT   CDS_pept        complement(92327..92992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0084"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97308"
FT                   /protein_id="ADN97308.1"
FT                   /translation="MVLTDIEYLLSYLEAHHVPTIKKKRHTYLTYHGLAEHYTYVLKDG
FT                   IIKNSIILQDGREYNLSYIAKPDVISLLRDEVSRSTDQPFNVRIESEYATFYQVNRVAF
FT                   WKYVNSTPELQNYVKNYYRKKLSENILRLQRMVMNGKKGAICAFIYSLVDLFGRKVNEG
FT                   ILIDFVVTNDDIAGFCGISSRSSVNRMLKELRTDGVITVKNHKFIIQDVSYLLDQIAN"
FT   gene            93245..94519
FT                   /locus_tag="LPST_C0085"
FT   CDS_pept        93245..94519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97309"
FT                   /protein_id="ADN97309.1"
FT                   /translation="MVAIDLPYDKRTITAQIDDENYAGKLVSQAATYHNKLSEQETVEK
FT                   SLDNPIGSDKLEELARGKHNIVIISSDHTRPVPSHIITPILLRRLRSVAPDARIRILVA
FT                   TGFHRPSTHEELVNKYGEDIVNNEEIVMHVSTDDSSMVKIGQLPSGGDCIINKVAAEAD
FT                   LLISEGFIESHFFAGFSGGRKSVLPGIASYKTIMANHSGEFINSPKARTGNLMHNPIHK
FT                   DMVYAARTAKLAFIINVVLDEDKKIIGSFAGDMEAAHKVGCDFVKELSSVPAIDCDIAI
FT                   STNGGYPLDQNIYQAVKGMTAAEATNKEGGTIIMVAGARDGHGGEGFYHNLADVDDPKE
FT                   FLDQAINTPRLKTIPDQWTAQIFARILVHHHVIFVSDLVDPDLITNMHMELAKTLDEAM
FT                   EKAYAREGQAAKVTVIPDGLGVIVK"
FT   gene            94521..95261
FT                   /locus_tag="LPST_C0086"
FT   CDS_pept        94521..95261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0086"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97310"
FT                   /protein_id="ADN97310.1"
FT                   /translation="MATTAEILQQVAAGQLSPTAAAQQLEAGKTAALGFANVDLDRQRR
FT                   NGFPEVIYGAGKTATQIVGIVQALSQQTLPILTTRLSAEKFAALQPALPTAVYHATAQC
FT                   MTVGEQPAPKTPGYIAVVTAGTSDQPVAEEAAVTAETFGNRVERVYDVGVAGIHRLFAK
FT                   LDVIRGARVVIVIAGMEGALASVVGGLVDKPVIAVPTSVGYGTSFQGMTALLTMLNSCA
FT                   SGITVVNIDNGFGAAYSASMINQM"
FT   gene            95292..96083
FT                   /locus_tag="LPST_C0087"
FT   CDS_pept        95292..96083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97311"
FT                   /protein_id="ADN97311.1"
FT                   /translation="MQTLYLDAFSGISGDMFLGALLDLGLDFEQLKTELAKLHVHGYEL
FT                   TQQREAQSSIYGTSFDVQVAGGKDHGFVEHHHHQHEAGHHHDHEARHLADIEALIDGSD
FT                   LSDTVKHHAKAIFMEIAQAEAAVHHMPLAEVHFHEVGALDSIVDIVGCCIGLELMQIDT
FT                   IMASPLSDGSGFINVAHGQMPVPVPAVMQMRVGSAIPIQQRLDVHTELITPTGMGLVKT
FT                   LVREFGPLPENAVPTRVGYGFGKRDTGGFNALRAVLFEKKN"
FT   gene            96122..96553
FT                   /locus_tag="LPST_C0088"
FT   CDS_pept        96122..96553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97312"
FT                   /protein_id="ADN97312.1"
FT                   /translation="MIEANLDDQTGEGLGYVMNQLLTAGAYDVFFTPIQMKKDRPATKL
FT                   TVLGNVNDKDLLTKLILQETTTIGVRYQTWQRTIMQRHFLTVATPYGDVQVKVATYQDI
FT                   EKKMPEYADCAQLAQQFHIPFRTVYQAALVAVDQLDEEA"
FT   gene            96558..97274
FT                   /gene="glpF1"
FT                   /locus_tag="LPST_C0089"
FT   CDS_pept        96558..97274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF1"
FT                   /locus_tag="LPST_C0089"
FT                   /product="MIP family glycerol uptake facilitator protein
FT                   GlpF"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97313"
FT                   /protein_id="ADN97313.1"
FT                   /translation="MVHQLIAEFMGTALMIIFGVGVHCSSVLKGTKYRGSGHIFAITTW
FT                   GFGISVALFIFGNVCINPAMVLAQCLLGNIAWSLFIPYSVAEVLGGVVGSVIVWIMYAD
FT                   HFKASTDEISPITIRNLFCTAPAVRNLPRNFFVELFDTFIFISGILAISEIKTPGIVPI
FT                   GVGLLVWAIGMGLGGPTGFAMNLARDMGPRIAHAILPIANKADSDWQYGIIVPGIAPFV
FT                   GAAIAAWFMHGFFGIN"
FT   gene            97407..98129
FT                   /locus_tag="LPST_C0090"
FT   CDS_pept        97407..98129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97314"
FT                   /protein_id="ADN97314.1"
FT                   /translation="MALDVLGRDNVTAVVANSELFTDEEFDKAMSLAEELGANVQGTTL
FT                   DYLSDDHIKNNTPDSWYYAKKMFYSRLNDIAANNGSAAVLDGMIKNDENDYRPGLKARS
FT                   EAGARSLLQEADFFKTDVRALAQELGLTNWNKVASCSVSSRFPYGTTLTHDNIAQVMAA
FT                   EKYLRSLGFPTVRVRFHNDIARIELPEARIGDFLVFNDRVNRQLQSLGFRYVTLDLGGF
FT                   RSGRMNDTLTKAQLAIFA"
FT   gene            complement(98329..99306)
FT                   /locus_tag="LPST_C0091"
FT   CDS_pept        complement(98329..99306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0091"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97315"
FT                   /protein_id="ADN97315.1"
FT                   /translation="MQALVVPDPSAQTMEQLQWQERPMPNLGPTEVLIKTQAVGLNPVD
FT                   FKLVAAGNAAWQYPHTLGLDTAGIVEAVGAEVTNFRPGERVCGHANLANNGTFAEYVSL
FT                   PAAVLAKIPTTVSFEAAAASLCAGLTAYQALLRKANLNAAQTVLIHAGAGGVGSMAIQL
FT                   AKAAGKTVFTTVSQAKQAFVAPLHPDAQIDYHHEDVTTCIQDLTQQHGVDLIINTIGHA
FT                   DADLPRLAYNGQLVCVLATPDHFPSNQVVTISKLDLGGAHRSGNPAQVADLGQMTAALL
FT                   ALVQTGKVDPLITQVLHRDQLVSGLQQLQAGQVVGKLVVTFDAC"
FT   gene            99662..100453
FT                   /gene="thiM"
FT                   /locus_tag="LPST_C0092"
FT   CDS_pept        99662..100453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="LPST_C0092"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97316"
FT                   /protein_id="ADN97316.1"
FT                   /translation="MELQLLNTLRNHNPIVFNIANFVTVQDVANGLNALGASPIMSAEV
FT                   QEAETMVQIAGAVCINLGTLTTTQIDQMRVVGKLANQYHKPVVLDPVAVGAVPYRKEVA
FT                   LALLSDFQVDVIRGNAGEIAALAGMDWQAKGIDAGSGQGDLVEIAQACAQQFQCCVILS
FT                   GPTDVITDGQRVVKVANGTPLFQRHVGSGDLLSSIVAAFTAVSPTDVYQAAQVACLVLA
FT                   GAGELVASQLTADRPATFAIDLIDRLSLVTVSEIQTIAKVD"
FT   gene            100479..101303
FT                   /gene="thiD"
FT                   /locus_tag="LPST_C0093"
FT   CDS_pept        100479..101303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="LPST_C0093"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97317"
FT                   /protein_id="ADN97317.1"
FT                   /translation="MNEFPQVATIAGTDSGGGAGVMAALKTMQARHVFGTAVVVAVTAQ
FT                   NTLGVQDFMGMPTKLIDEQFASLAADLDIRACKTGMLADAEHVHAVVENLKRVDFGPLT
FT                   VDPVMIAKGGAALLAADAIKTVRDELLPLATVVTPNLPEAEQLTGQSITSNQAMVKAGH
FT                   SLQGLGADNVIIKGGHGDNPDLANDFVLLADGTAFWLSAPRIDTVRTHGTGDTLSACIT
FT                   AELAKGRSMAAAIKTAKAYVAGTIQDGIQVGYGHGPLNHWATPSEQVIVHDA"
FT   gene            101293..101946
FT                   /gene="thiE"
FT                   /locus_tag="LPST_C0094"
FT   CDS_pept        101293..101946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="LPST_C0094"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97318"
FT                   /protein_id="ADN97318.1"
FT                   /translation="MTLKFEPTQLRAYFVCGTQDVPGQDLNVVVQTALDAGITAFQYRD
FT                   KGNSQLTTAERFALGQQLRERCAQAHVPFIVDDDVELALALQADGIHVGQKDDRVTQVI
FT                   QRVANQMFVGLSCSTLAEVRIANQLEGIAYLGSGPIFPTTSKADADPVVGLTGLRQLVV
FT                   TATCPVVAIGGITVAQLPAIAATGAAGAAVISMLTRSPDMAATVKAMLTATEGH"
FT   gene            101946..103145
FT                   /locus_tag="LPST_C0095"
FT   CDS_pept        101946..103145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0095"
FT                   /product="purine-cytosine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97319"
FT                   /protein_id="ADN97319.1"
FT                   /translation="MKHDGIFRSQFLLWLGAAISIAEILTGTLMAPLGLTRGLAAIVLG
FT                   HLIGCGLFLVPAGYLGAKLHQSALASAQLAFGRGGVLLASGLNALQLVGWTAVMIVNAQ
FT                   LAMNSISGKLFGFRSPLLMATIVAILIIAWLLMGSQLLFKINNAVVGLLVLGTVLMLVM
FT                   VFMAPTTSQSVSPTSMTFGQAVELNVTMALSWLPLIGDYTQRVDRPLPVALVSAGGYML
FT                   GSLVMFVTGLLVVLRTGQTDITALLTRSGLGLVALLIIVFSTVTTTFLDTYSAATSLAN
FT                   LTGSRHVNRLAVGVTVVGLLIALTVAMTYYQNFLYLIGSVFTPLYAIIFVTYFVRHATL
FT                   PYWLNFCWWVVGIVAYYQLQAIDFIGGTTLLVLVGLSIAVWLTGIIVKPTALGYRELSH
FT                   "
FT   gene            103227..103967
FT                   /locus_tag="LPST_C0096"
FT   CDS_pept        103227..103967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97320"
FT                   /protein_id="ADN97320.1"
FT                   /translation="MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLV
FT                   LPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRAT
FT                   HAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPG
FT                   TTLAEYLGTTSDAIAINSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWH
FT                   PEMMQQVNSMQARLFAAFVRACVA"
FT   gene            104210..105802
FT                   /locus_tag="LPST_C0097"
FT   CDS_pept        104210..105802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97321"
FT                   /protein_id="ADN97321.1"
FT                   /translation="MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEII
FT                   PVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYD
FT                   DNAISVWTLQHAKLGYIARYQNQPYATLMDQGQRLYGIVTVLDQQKQHLELMLWRTTAV
FT                   PSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYHQVPLSPWLTPAD
FT                   ELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGIS
FT                   AQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSS
FT                   QPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTTITVEKLRQTLGDQ
FT                   TYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPI
FT                   QLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPD
FT                   WLRIFLHGWNDDF"
FT   gene            complement(105918..106388)
FT                   /locus_tag="LPST_C0098"
FT   CDS_pept        complement(105918..106388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0098"
FT                   /product="NTP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97322"
FT                   /protein_id="ADN97322.1"
FT                   /translation="MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWS
FT                   LPGGYLEYGETYATACLREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLV
FT                   KPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK"
FT   gene            106621..107985
FT                   /locus_tag="LPST_C0099"
FT   CDS_pept        106621..107985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0099"
FT                   /product="amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97323"
FT                   /protein_id="ADN97323.1"
FT                   /translation="MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVS
FT                   GAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIAL
FT                   GGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLG
FT                   LIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENP
FT                   QSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIIN
FT                   FVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGV
FT                   VLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPL
FT                   SPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL"
FT   gene            108013..108792
FT                   /locus_tag="LPST_C0100"
FT   CDS_pept        108013..108792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97324"
FT                   /protein_id="ADN97324.1"
FT                   /translation="MLLFWAFIALKLDINIIIRKSGGTMVKQGHYAKVSKQKRLRQLKQ
FT                   RRQAQEKRAVMPEMVSEFLQVRYHLTQAAKQRPVMRQMMQRFMAQWLAAGQAELSANGQ
FT                   TTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALS
FT                   PATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDS
FT                   TVIAQNTLSEAGLDDKTHQWLEKLKKLTPQDFNDHVE"
FT   gene            108817..109599
FT                   /gene="hpo"
FT                   /locus_tag="LPST_C0101"
FT   CDS_pept        108817..109599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpo"
FT                   /locus_tag="LPST_C0101"
FT                   /product="halo peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97325"
FT                   /protein_id="ADN97325.1"
FT                   /translation="MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQA
FT                   GYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLEQPILLGNSMGAATWFAYV
FT                   SLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATY
FT                   ARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVT
FT                   AQMALRGQSVVIPEAGHIVMAEQSAAFNKALLEFLATC"
FT   gene            complement(109795..112533)
FT                   /gene="pacL1"
FT                   /locus_tag="LPST_C0102"
FT   CDS_pept        complement(109795..112533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL1"
FT                   /locus_tag="LPST_C0102"
FT                   /product="cation transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97326"
FT                   /protein_id="ADN97326.1"
FT                   /translation="MIKDDNQSLNSNEEQNDTQNPPDADNLWQLDESALAAKYATDPEN
FT                   GLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSI
FT                   VIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNL
FT                   EAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPITETTPALADRKNMVYASTAV
FT                   TSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFL
FT                   LGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVET
FT                   LGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVD
FT                   WHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDS
FT                   LPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVV
FT                   ALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDH
FT                   PDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQ
FT                   ANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREG
FT                   RHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIF
FT                   EPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTM
FT                   SLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHT
FT                   TSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID"
FT   gene            112818..113576
FT                   /locus_tag="LPST_C0103"
FT   CDS_pept        112818..113576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0103"
FT                   /product="purine nucleoside phosphorylase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97327"
FT                   /protein_id="ADN97327.1"
FT                   /translation="MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQF
FT                   VTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVI
FT                   AVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLP
FT                   WQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTL
FT                   AQLEHYDPRHLGAGGVLVAIELATESLAAY"
FT   gene            complement(113619..113813)
FT                   /locus_tag="LPST_C0104"
FT   CDS_pept        complement(113619..113813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0104"
FT                   /product="stress-responsive transcription regulator
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97328"
FT                   /protein_id="ADN97328.1"
FT                   /translation="MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMF
FT                   PGIIAYLILWLLMKDPIKD"
FT   gene            complement(113879..114481)
FT                   /locus_tag="LPST_C0105"
FT   CDS_pept        complement(113879..114481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0105"
FT                   /product="oxidoreductase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97329"
FT                   /protein_id="ADN97329.1"
FT                   /translation="MFKIAIILGSTRSQANGRALFNHLKLIIDQLPTHSPIHYQFLDLA
FT                   NYQLPFFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDF
FT                   LAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGH
FT                   FIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD"
FT   gene            114595..115068
FT                   /locus_tag="LPST_C0106"
FT   CDS_pept        114595..115068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0106"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97330"
FT                   /protein_id="ADN97330.1"
FT                   /translation="MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQ
FT                   LSTTDIKIIAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEI
FT                   LVRLTTLGEAVADLHTQLDAAIAAKAQAIADDYSDAELRRFVSLMRRIREIKI"
FT   gene            115214..115636
FT                   /gene="hsp1"
FT                   /locus_tag="LPST_C0107"
FT   CDS_pept        115214..115636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp1"
FT                   /locus_tag="LPST_C0107"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97331"
FT                   /protein_id="ADN97331.1"
FT                   /translation="MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQ
FT                   YQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYML
FT                   PNVAADKITASQADGVLTITLPKTQPSENDGQIEIQ"
FT   gene            complement(115724..116179)
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0004"
FT                   /note="integral membrane protein"
FT   gene            complement(116176..116619)
FT                   /locus_tag="LPST_C0108"
FT   CDS_pept        complement(116176..116619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97332"
FT                   /protein_id="ADN97332.1"
FT                   /translation="MHVQLTISETIHQVFVTIHGPQLTPAIKELQRNIEALTNQQFINV
FT                   FQDCSLIKLPLQSVSRFYTANKRLYCETTTGAYLVHSHLHTLMDQLPPHQFLRISSSEI
FT                   VRIACVKNFTLTKWGSFQVNLTTGTTTYASRRYTQQIRKAAQL"
FT   gene            116851..118083
FT                   /locus_tag="LPST_C0109"
FT   CDS_pept        116851..118083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0109"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97333"
FT                   /protein_id="ADN97333.1"
FT                   /translation="MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGD
FT                   FTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVT
FT                   NVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGL
FT                   LAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLII
FT                   VMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRY
FT                   GDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNT
FT                   PVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVP
FT                   DIWKNGKRAVS"
FT   gene            118108..118473
FT                   /locus_tag="LPST_C0110"
FT   CDS_pept        118108..118473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0110"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97334"
FT                   /protein_id="ADN97334.1"
FT                   /translation="MASCLFCYLSLNMMLIQCIVSFMNIEISKQDQADQQRVAIFKALA
FT                   DANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLS
FT                   LQLATFDRFLPGFLATL"
FT   gene            118538..119731
FT                   /locus_tag="LPST_C0111"
FT   CDS_pept        118538..119731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0111"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97335"
FT                   /protein_id="ADN97335.1"
FT                   /translation="MTTTHQHSRYLTLGMMLAATNMRLPITMMPGLISSLKRTLGLPSS
FT                   MAGLLTTIPLLTFAIMSPLIAHWGRRFGNELTIYVMLIFLAVGSYLRVIPTIAALFIGT
FT                   LLVGIGADGGNVLIPAIIKDNFPTKIPVATSQYTLSMLLVGSLGTGLSGVLAAHWSLPL
FT                   TMAVLSVIGLINLVVWLPNLKYNHRAPTVAMTASDGQSTATHGSVWRRPLAWVVTAFFG
FT                   LQALVYYSLLTWLPTVFVAHGFSLIVAGNLVTVMQLSGLPMSYLVPATSGHRRGVWAMI
FT                   MVVGVGFIAGIGGILLSGTNFWVAALSCVLLGLGSGAAFSLAVVFFTQKTTNGFETADL
FT                   SGMAQSAGYLLAAVGPVLFGWLGGQLGWGPVLWLAIILSALLALSGSIIFQHATIYE"
FT   gene            119975..120823
FT                   /locus_tag="LPST_C0112"
FT   CDS_pept        119975..120823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0112"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97336"
FT                   /protein_id="ADN97336.1"
FT                   /translation="MTVLTTMYQLANGVNIPKVAFGTWQIPGGEATYQAVRAALAAGYR
FT                   HIDTALAYQNEASVGQAIRDSGIPREQIFVTTKLPAETKSYQGALNDFDRSLKNLGLDY
FT                   VDLYLVHAPWPWGQVGRVYDEANLDVWQAMEAIYQSGRAKAIGVSNFAVRDLKNILNQA
FT                   TIPPMVNQIQYYLGFTEPKITKFSEEHAMLVEAYSPLATGGVLDNPQVQAYADKYGVSV
FT                   AQLALRFVLQNGVLPLPKAVNPAHIEANTQLDFAISVADMQALNDLPDAAGSYMHNPTQ
FT                   G"
FT   gene            120900..121772
FT                   /locus_tag="LPST_C0113"
FT   CDS_pept        120900..121772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0113"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97337"
FT                   /protein_id="ADN97337.1"
FT                   /translation="MTTINAANAGTYAFDDQFKVNRMGYGVMQLTGPGTWGPYADPENG
FT                   VKVVKKALEYGVNFFDTADSYGPWFADRYLAAGLKDAANRDQIFISDKVGQTRQGPNVW
FT                   MPLGEPRYLRQQVEVSMMTLGIDHEDLVFLHRIDPHYSIADQVGELKKLQDEGKIKHIG
FT                   LSQVTVDQIKEAQQVAKIDAIENLYNVANHGDDDVVDYAASQKMAFLPWFPLATGELAQ
FT                   AGSVLSTMAQKYQVSPAQIALAWLLKRSDNIIPIPGTSSIEHLRDNVAAANVDLTTADF
FT                   NGLSQLSVK"
FT   gene            121872..122348
FT                   /locus_tag="LPST_C0114"
FT   CDS_pept        121872..122348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97338"
FT                   /protein_id="ADN97338.1"
FT                   /translation="MRKRIEQMSTRLMSDEPTIYLAGPWFTEGQPERLAKIEKLMDELE
FT                   LTYYSPRLDGIDLTPDATEADRNAVFTDNVDHLKRAKLVVAVVDGFDTGTIWETGTAYG
FT                   LDIPVAYYGETLADGTFNVMLAKSGKAVIENMTDLKAFLQDPTADDFQYTGTIR"
FT   gene            122653..124362
FT                   /locus_tag="LPST_C0115"
FT   CDS_pept        122653..124362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97339"
FT                   /protein_id="ADN97339.1"
FT                   /translation="MGALFMVKSKAIMIGAGLSNMAAAVYLIQDGHWDGKDITFYGVDM
FT                   HGANDGGATTDFTNEYWNKNHPMANTTGYVARGGRMLNYRTYVDLMDLLDRIPSVTEPG
FT                   MTAAEDTRDFDAKHRTYDIARLMQGGKGIINAGKLGFNNKDRTLLTKLIMMPDSEETKL
FT                   DNVSIAEYFKDDPHMFQTNFWYMWETTFAFRTQSSAQELRRYMHQMIYEFTQIEHLVGV
FT                   NRTRYNQFESMILPLIKYLQGQGVTFIDNKIVKDWQFKDTPMQDEITVTGLVIEDAQTG
FT                   ETEEVEVDEDTAVIFTNGSITDSATMGDYNTPAPENMDYGVSASLWKKATERFYNLGTP
FT                   DKFFNDRNASEWVSFTLTTKNHLFLNEIVRITTQEPGNALNSFLSTTPITPLNQKDVNM
FT                   SIVVHHQPHFTTQQPNETVLWGYFLYPRRQGEFVNKPYIKMTGKEMAQELIGQLSKVDP
FT                   GPGNIKDKEKEILDSIVNNIPVYMPYASALFNNRAKSDRPEVLPKHSTNLAFTGEFAEQ
FT                   PYQMIFTEQSAVRSGEIAAYHFAGVPMDNLVKTPRYDKDPKTLLKATKKMFD"
FT   gene            complement(124534..125346)
FT                   /locus_tag="LPST_C0116"
FT   CDS_pept        complement(124534..125346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0116"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97340"
FT                   /protein_id="ADN97340.1"
FT                   /translation="MKKLTSVVATLALALPLAASPFAMTTTANAATVTPKATTHALTKA
FT                   THFPAITMHAKAATTLNTIHFAADRAIAFVSPAKAKLSTKKTYTVTKTITLATGKHTSA
FT                   TYYLISEHGKALGWAKATTMIKGNAPTAKLKATKKTPKTKLTITKKTTKQAGPKATSAK
FT                   KATPKIKASKKVIKLTKQTTTKAKSTKLTIKHPKASIKPTKKVTTLATKKTLAQPTKTK
FT                   KMAPQLIKKTAKQNAKKAPKLATKKHLTVKTTTKHTPSKLTPKAAAKI"
FT   gene            125753..127129
FT                   /locus_tag="LPST_C0117"
FT   CDS_pept        125753..127129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97341"
FT                   /protein_id="ADN97341.1"
FT                   /translation="MKPTVRNLILQDHAQWLTDCSHEWQLLASLPYVVNPNESRQAWHH
FT                   CELCHKPVRYEYHVQNKHNHRELIVGSECVKKFMNAETRYLMVITTEDNFYAVAQYQTL
FT                   TTAVPTVPTIMFAQPWLPQLPAEQAPQARKLRQTTTQTVTTYLKRRTKQLPLQELKPAE
FT                   QTYQRLVHDEQTVIEAAERAARQAIVTNQQQRQAQAQQSAVKAEQTLRQSHAYQCYLQQ
FT                   LAAIIVMRPERPMAKQQFEKITPPATERPLVNSYQFGQMVTEYRQTGKIQVRRLAMLDH
FT                   QFVAALNQVTQQLDEQQTTRFYDDVFNSCWGWQYHQQATQRADWEHLLTTRWGQSLSLA
FT                   WFEQLAMQTTMPQTQQWLADNADAGMQAALQQRLAAHEDRQPIARDRMTRSELRQFCLR
FT                   EQPAAPTLEAFEQVFDQQYQLPVDRQATAHETLAYYYIARQYQGDHQRALQQLNWLLKV
FT                   "
FT   gene            complement(127198..128325)
FT                   /locus_tag="LPST_C0118"
FT   CDS_pept        complement(127198..128325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0118"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97342"
FT                   /protein_id="ADN97342.1"
FT                   /translation="MKGCFIVTSFNEPLKFKSGVTLRNRLMMSPMTTTQSFYNGSITHD
FT                   EIDYYTQRATGLGAVITGAANVEDLGKGWHGELSIAHDTMLPGLSALAHGIQSQGAKAI
FT                   VQIFHAGRMTHRAVLNGEQIVSASAVVALRDDAETPRAMSIDEIHATIAAFGEATRRAI
FT                   QAGFDGIELHGANTYLIQQFFSPHSNRRTDEYGGRTPQERFRFIDELLKAVFAAVDQYA
FT                   DRPFIVGYRFSPEEFEEPGIRLEDTLWLLSQLRESRLDYVHVSLNNYDRVSRDPQYQDK
FT                   SIMTYVHEALQGKLPLVGVGGVRTRDDVKTVLQTAELVAVGQQLLYDPTWAVKLAKNAD
FT                   NTMVTAPFEEAVEVTPLSRPLYEFAASRYHSVINS"
FT   gene            complement(128558..129397)
FT                   /locus_tag="LPST_C0119"
FT   CDS_pept        complement(128558..129397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0119"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97343"
FT                   /protein_id="ADN97343.1"
FT                   /translation="MQHELLIGYNDRHTFLNRLSGSTKLLCFVGLSVIGMMTYDTRYLI
FT                   GVMIFSLILFRFSKIHYRDIAFVLNVIIGFSVLNLVMVYVFAPHYGVSIYGTEHLLLGS
FT                   ADHYFNLTAEQLFYEFNLLLKYTFAVPLALIFLMTTNPSEFAASLNKIGISYRISYSVA
FT                   IALRYIPDVQADYRTISLAQQARGFEMSKKAHFMTRIRGGIQILLPLIFSSLDRIETIS
FT                   QAMELRRFGKGKHRTWYMAQRFKRNDYLALTLVALLIILGIALFKVNGGRFWNPFKA"
FT   gene            complement(129399..131099)
FT                   /locus_tag="LPST_C0120"
FT   CDS_pept        complement(129399..131099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0120"
FT                   /product="ABC superfamily ATP binding cassette transporter,
FT                   ABC protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97344"
FT                   /protein_id="ADN97344.1"
FT                   /translation="MSAPIISFKNFSFQYNSQTEPTLRDINLDIYPGEKVLIAGPSGSG
FT                   KSTLGRCLNGLIPQSYPGTVTGQARIAGQTITESSIFALSQDVGTVLQDPDSQFVGLTV
FT                   VEDMAFSLENDQQTQPAMRQATEQWAQTLDLQDLLTHRPQELSGGQKQRVAMAGVLIDN
FT                   SKILLFDEPLASLDPASGKASMALIDQLTHTQDLTVIIIEHRIEDVLQQPIDRLIVMQD
FT                   GAIVANDRPETILRQSLMTQLGLREPLYLSALKLAGVDLATCQHLDNLQALQVPDLTAT
FT                   LQNWTAGVQLQSPTVHDQPLLAIEHLTFGYDPAKPIINDITVTLHQGEMISLVGQNGTG
FT                   KSTLSNLITGFLMPQSGKVRFNGHSLADQSVKERADQIGYILQDPNQMISKTMIFDEVA
FT                   AGLVLRGVADDEVKRRVQAVLKVCGLYEFRHWPISALSFGQKKRVTIAAILVLEPAMLI
FT                   LDEPTAGQDLQHYTEMMTFLTKINQEQHMTIMLITHDMHLMLEYTDRTIVLGHGNILMD
FT                   ARPADVLTNASIIQQASLAKTSLYTLAEAHHLNPTEFVAKFVQAEREAR"
FT   gene            complement(131104..131664)
FT                   /locus_tag="LPST_C0121"
FT   CDS_pept        complement(131104..131664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97345"
FT                   /protein_id="ADN97345.1"
FT                   /translation="MQNKQSNSIRTVVATGIGAAVIFVLMKFVAIPTGVPNTQVNVAMG
FT                   FLALLGAIFGPVAAGLAVFIGHALNDFVTYGSPWWTWVIVDGLIGVAFGLAKNRLKIEN
FT                   GVLGTAKLVWFNIYQIIVNFIGWVLLAPTGDIIIYHEPANKVYLQGVITWIADSISVAI
FT                   IGTILLVLYARTRTQRGSLTKER"
FT   gene            132236..132988
FT                   /locus_tag="LPST_C0122"
FT   CDS_pept        132236..132988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0122"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97346"
FT                   /protein_id="ADN97346.1"
FT                   /translation="MTRPNDEGDVSSLAYKYETIADSLRQDIKSGKYTPGELMPDQNKL
FT                   AETFDTTRITIHKAIQLLIIEGMVYSKRGAGTFVRKDFGLTERRQETLVDKPLGTTQTN
FT                   AGKKVTSKVLELQARLPTKREAEQLLIDEMDPVYVIRRTRYVDGKVWAYEHTIMPTSIV
FT                   TLTKQVLEGSVYGYLEQHSGKKIAGSHRIISAARVTADDVAAMGATLNDPVLVINQISY
FT                   MDDGQPFEVSESHFPYETSTVVADVQIH"
FT   gene            133133..133462
FT                   /locus_tag="LPST_C0123"
FT   CDS_pept        133133..133462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97347"
FT                   /protein_id="ADN97347.1"
FT                   /translation="MPANFYQRLIDKYEPMTEAAFLVLVSVRQPITSEAIPAKIAEMTN
FT                   NQLQLGLGTLFTNLHAMTKDYLMTERVDENDVHTYEITGSGESVLAAERKRLQLLNQIC
FT                   EQAGL"
FT   gene            133491..134276
FT                   /locus_tag="LPST_C0124"
FT   CDS_pept        133491..134276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97348"
FT                   /protein_id="ADN97348.1"
FT                   /translation="MWRYQMAVKGSEQELRWLNQQAQRGQLLRRIRGNWYQFQKTATRY
FT                   QVFSEYVSGNVATEIDDQHTPFKLLARLQLTKPAVQVIYTGTAQTELQGARVDRQDAPL
FT                   QLKIALAQRGHLLNVMNIRLVVGLILAVIVISLNVSDNVASWGMLAWLLFTFYPAWQAS
FT                   RLHKQANTLRVITQQYDDAWRPTMHVFLKNMSTELDTEKVAGLGAWAYVGQDHHGMYWY
FT                   DLKTLASATEIKQSLQPIVGDSVSVSIVSWLGLAPIGFV"
FT   gene            134286..135113
FT                   /locus_tag="LPST_C0125"
FT   CDS_pept        134286..135113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97349"
FT                   /protein_id="ADN97349.1"
FT                   /translation="MEVVGMWRHRFLIKGSEQELAWLNAQAQRRYLLMAIHGNWYQFKK
FT                   VPTIYRVFSEYVPQAVAADMSNSNSAFQVLAQVQVQQPDVQIVYTGSDQPALQQTTMAP
FT                   TDPKVRLQVALQLRDRAMNTINLSLYAGVVVWGLFLILILHRGDTDLIGVWMLMLLVGL
FT                   LAVLGLYRTAHRLQNQISQLRRDTEQYDGAWMPTMHVFVSALTADLDTEEPALKSLGRW
FT                   TLVGHSKKGQYWYDLQTLANAAEIKQTLRPFIATDTNVNVLSWLGLAPLGWFV"
FT   gene            135436..135936
FT                   /locus_tag="LPST_C0126"
FT   CDS_pept        135436..135936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97350"
FT                   /protein_id="ADN97350.1"
FT                   /translation="MILMRLKDLTGETFSRLTVIERAESAPNGNARWLCQCSCGRQVVV
FT                   DSYRLRKGITKSCGCLRADVSRKNIFENPQTRKNMGRSDNLPLYQGTSVDRLKPNSRNR
FT                   SGVIGVSFDRCSQKWVARLMYRGRLVLNQQFADMDDAIMARKQAEQRYVMPVLEEYAKS
FT                   SAD"
FT   gene            136105..136899
FT                   /locus_tag="LPST_C0127"
FT   CDS_pept        136105..136899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0127"
FT                   /product="short-chain dehydrogenase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97351"
FT                   /protein_id="ADN97351.1"
FT                   /translation="MEMGLAGKRVLVTGSTKGIGRAIAVAFAKEGADVVINGRRADTVA
FT                   AVVDELAAAYPTTHPVAAPYDISDPQQADKMFQQIPTVDVLVNNMGIFGPMAYDEIDDA
FT                   TWERFFKVNVLSGNRLAKHYLPAMLAQDFGRIIFIASEEAVMPSGEMPQYSMTKSMNLS
FT                   LAKSLSKLTVGSHVTVNTVMPGSTLTEGVQKMLDDMYADSDLPKDQWEHDFMINHRPLS
FT                   QIQRLIRPEEIGRLAVFVASPFASSFSGEALQADGGLVPTIF"
FT   gene            137162..138079
FT                   /locus_tag="LPST_C0128"
FT   CDS_pept        137162..138079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0128"
FT                   /product="ABC superfamily ATP binding cassette transporter,
FT                   ABC protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97352"
FT                   /protein_id="ADN97352.1"
FT                   /translation="MDKEPLLRISHLQKHFGKFQALKDINFEINAGEVFGFIGPNGAGK
FT                   STTIRVLLGILKASGGQATIFGRDVWRDSVAIHKRIAYVPGDVYLWPNLSGGEIIDLFL
FT                   KLNGGQHTAKTDALIKQFELDPRKKARTYSKGNRQKVALIAALSTDADLYIFDEPTSGL
FT                   DPLNEQTFQNEVLALKRREKSVLLSSHILSEVEKMCDRIGIIREGQIVETGSLAEMRHL
FT                   TRTTVDVQTRLPLTDLTTLAGVHGVTARHGDNHVSLAVDADQLTPVVQYLASRKLISLT
FT                   TTPPTLEDLFMRYYTTEQQPVKGK"
FT   gene            138085..139701
FT                   /locus_tag="LPST_C0129"
FT   CDS_pept        138085..139701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0129"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97353"
FT                   /protein_id="ADN97353.1"
FT                   /translation="MATQLFARTGLLIRFNLRRDWKKLLIWVVVLTGLFTAIAAKFDGI
FT                   YGTQMALNEIVKTLKTPAMISLFGAFSAKSPYTTAKVFATEMVVFMAIVMIVMNIMVAV
FT                   VTTRGDEDDGLLELVRAHAVGRLAPLFAGAAELTALNGLIGFLFALGLTVAKLPGATTP
FT                   GNWLIGLGLGGLGWAFGMLTLLLAQVMTSASGTTMLSYLLLGVMYVARMGTDVNRPDLT
FT                   WWIPFGWIEKLDAYQTNDWLPIGLYVLLGLGCSSLAAALNAYRDLGAGLVEPRRGRRQA
FT                   SGLLRGPVTLLWRQAHGLIIAWLLGNFILGAAYASVFNTIGDLAKSNPMIKQLLGASAL
FT                   AAANRLIVKNFIAVLAIVMVIVALVPAVQLMLKLVNDEQKGYLHQVYATATSRWHVWAS
FT                   YTGWAIVTGLLVLLAGLSGMYLMGLTSMVKPISWVTYWHVFAAYAPAMLVMVAVTSALA
FT                   GWRPKWRYAAWIWVFYAFFSLYLGNLIDLPKWARRLTPLGFVNKVPIKPLDGTTSSWCL
FT                   LLTVLILVVAALSYRRRDLAQ"
FT   gene            139720..140382
FT                   /locus_tag="LPST_C0130"
FT   CDS_pept        139720..140382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0130"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97354"
FT                   /protein_id="ADN97354.1"
FT                   /translation="MAVKQPVPKDPAKVERIMHAAMHTFAVSGYRDAKTDVIASAATVS
FT                   KGLLFHYYGSKQRLYLATVQLATDTIIATINQQVFDVPDDLVTLMVRSARYKAAFGKDH
FT                   PDEMKVLIDAYGALERLPVKIQAQMKILYTKSMTISREMISQVLDKMTLRADVDRDATI
FT                   ALIMGVYNQIFMEFQTYMRENHQVESMADIEWVVSRAKTYMGILEHGFMAADLDDQQ"
FT   gene            140550..142091
FT                   /locus_tag="LPST_C0131"
FT   CDS_pept        140550..142091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97355"
FT                   /protein_id="ADN97355.1"
FT                   /translation="MELHLTARQTGLWQRLMALAREQLMGLAMQMESTGKVDRPTLTTL
FT                   AQQLALDDPLPDDRLSQRVLSTLALAQSSAGLAMSFASSWQVEDAILTFGTPQQRQRYC
FT                   AQSGVFGLAALPEQVMASSTVKATPVTAGWQLSGAVKTVLNVTQATEYLVLAQTPPNAT
FT                   GAFVISADQPGVTVSQPITPLGLHGLTIADVQLTDVPVTAADQIGQLGQGQRVMQRAQS
FT                   LGQLFAGAITAGIWQHATDQARQLALTEQPPLTALAPAMAITAALQTSVYNAAQQADDE
FT                   RPFTDAAQLAAMFASQNALAPFKILMPLIGDLAYTQHSPLSALQNDVATLPLIVGTDTQ
FT                   LALTFATTSLNDEVADVPTTGPHTAPEHLVVADLHRVVKRLNLTRDVPVNVGSIATAKR
FT                   VVALGRGAMEPAVLLQAQQLAKWIGAALAVTQPLTAMEQFSIEQQIGASAVTVAPEVLI
FT                   NIGVAGDDDYLAGMAGAQHVLSVNTDEQAPIFKHSQQIFVGGAAEFLAGMVAALN"
FT   gene            complement(142264..142776)
FT                   /locus_tag="LPST_C0132"
FT   CDS_pept        complement(142264..142776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0132"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97356"
FT                   /protein_id="ADN97356.1"
FT                   /translation="MTSSLTVRRIPLLGALIAMQLILGSLLSIQLLLTKISFAFIIIGL
FT                   TARLFSPLVTAGSSAISSLLGMLLFPKFTFFPGFILTAFLTGLVFGYAFQHQTSLTRVL
FT                   VANFIVVFILNLFLNSLWLHLMYLTPWSVLLTTRMIQEVITYVCYSVILIALFKIPILN
FT                   QLTARFK"
FT   gene            143006..143524
FT                   /locus_tag="LPST_C0133"
FT   CDS_pept        143006..143524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0133"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97357"
FT                   /protein_id="ADN97357.1"
FT                   /translation="MAYITKKKIAQAFHDVVLVRGFSRTSVTAIMSTADFRRQTFYDYF
FT                   QDKYELLTWFIDDTLTETVEHNLNYLPWIDIIKLVCYELDANRQFYAECINTQHEIDVT
FT                   ALVGNHLATLLTELTHANTTETAALIWLLCLGIAQSLTHNIVANHPEDYEVLSQHAIAA
FT                   IEMTLEILN"
FT   gene            complement(143521..144510)
FT                   /gene="dak1A"
FT                   /locus_tag="LPST_C0134"
FT   CDS_pept        complement(143521..144510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dak1A"
FT                   /locus_tag="LPST_C0134"
FT                   /product="glycerone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97358"
FT                   /protein_id="ADN97358.1"
FT                   /translation="MQIINEPQNALSQATQGIQWAYPNLTWVPNTFGCYDSNFQDDQIP
FT                   LIAGGGSGHDPAHWGYVGPGMLTAAIMGTVFQPPTSQEIVKVTKQVTRQRRVFFIVKNF
FT                   PADVSAFTAAQQQLQKEHWQTGLCIVADDISVDHESLKQRRRGVAGTILVHKILGAAAA
FT                   QGASIAELTHIAAALVPNIHTIGVAASGARIPGQSTASFNLNPGEIYYGIGIHGEPGYR
FT                   REPFQSSERLAQELISKLRLNFKWHADDHYAVFVNSLGGTTPMELMVFNNDVHELLTLA
FT                   ALTIDFNKVGTFLTANGMHGLSLTLLSLADPDWLTALNRPVKTAAWPN"
FT   gene            144672..145670
FT                   /gene="dak1B"
FT                   /locus_tag="LPST_C0135"
FT   CDS_pept        144672..145670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dak1B"
FT                   /locus_tag="LPST_C0135"
FT                   /product="glycerone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97359"
FT                   /protein_id="ADN97359.1"
FT                   /translation="MKKIINDPKNVVDEMVDGLVRAYPQYLTKLPDTEAMVRSDQDSMQ
FT                   GKVGIVSGGGSGHEPAHAGFVGPGMLSAAVAGQVFTSPTPDQIYAAIKAVDQGKGVFLV
FT                   VKNYSGDVMNFDMAKDMAELDDIQVKSIVVDDDIAVKDSLYTQGRRGVAGTIFMHKILG
FT                   AAADQGVDLDDLESLATHVLPRIKTIAVALSAATVPEVGKPGFELADDEIEFGVGIHSE
FT                   PGYRREKIKPSKQLVQELLGKLDDELHLQSDHQYAFLVNGMGATPLMDQYVFCHDLLDE
FT                   LATRHIQPAFMKVGNYMTSIDMAGISLTIFDVAESQWLDYLQYPVKTIAWS"
FT   gene            145684..146265
FT                   /gene="dak2"
FT                   /locus_tag="LPST_C0136"
FT   CDS_pept        145684..146265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dak2"
FT                   /locus_tag="LPST_C0136"
FT                   /product="dihydroxyacetone kinase phosphatase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97360"
FT                   /protein_id="ADN97360.1"
FT                   /translation="MLTVENTTVWLNKFADQIEQHQSYLSELDTPIGDGDHGGNMARGL
FT                   AAVKAALATQPADITKLFQATAMALISKVGGASGPLYGTAFLEMAKQSKIDSDLGGLLA
FT                   AALAGIEKRGGATTGDKTLIDVWAPVVQAVQAGELTQDVIDDAVASTEPMVAKKGRASY
FT                   LGERSVGHLDPGAVSSGYLFTTLLDTEGIL"
FT   gene            146262..146630
FT                   /locus_tag="LPST_C0137"
FT   CDS_pept        146262..146630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97361"
FT                   /protein_id="ADN97361.1"
FT                   /translation="MSLGIVVVSHVPEIAAGIQRLLGQVAQDVSITIAGGTDDNQVGTS
FT                   LTKITQAFDANHADELLAFYDLGSAKMNLEMAIEMSDKTVHLYDTALIESAYTAASLLQ
FT                   AAVPLADVEAQLAPLKIK"
FT   gene            146645..147352
FT                   /gene="gplF2"
FT                   /locus_tag="LPST_C0138"
FT   CDS_pept        146645..147352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gplF2"
FT                   /locus_tag="LPST_C0138"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97362"
FT                   /protein_id="ADN97362.1"
FT                   /translation="MHGFLGEFLGTMVLIVFGVGSGAAMNLKGNYARHQNWTFICLAWG
FT                   LAVTFGVYVAGQFGSDGHLNPAVTVGFALFGYLPMANVWPYLLGQFLGAFIGAVIVIIQ
FT                   YYPHFQAAKTAADGNQVGIFATGPAISNPVFNFLSETIATFFFIFVLLNLGNFTQGLKP
FT                   LMVGLLIVVVGQTLGGTTGFAINPARDWAPRLAYTILPVPNKGLANWGYAWVPMFGPLL
FT                   GGILAAGLETIIS"
FT   gene            147503..148522
FT                   /locus_tag="LPST_C0139"
FT   CDS_pept        147503..148522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0139"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97363"
FT                   /protein_id="ADN97363.1"
FT                   /translation="MATIKDVAQRAGVSPSTASRAMHGSKIISKPTRDKVIKAARELNY
FT                   APDFNAQNLATKASNTIGVVLPVDHHEIFSNPFFLEMIRGINEVCSKNGAMTTLATGIS
FT                   SDELVHNIDVMIAQGHIKTFILLYSEKNDPVVERLKQFDVQYVVIGKPYQDVNKTSYVD
FT                   NDNIQAGTDAAQYLIDHGHRRIGFLYSDLSRMVQSDRMLGYQRVMMQNQLPNIMLEERF
FT                   ETHAAGVKTLHKFFEQYPDVTGFVAVDDMLALKLQQVLHNDPNWKVKQFSLIGFNNSIF
FT                   SDLAHPMLTSIAVFPQRLGEEAAKIAMADHPADELSTAVIVPHQIVKRHSVHQIKSLQ"
FT   gene            148547..149509
FT                   /locus_tag="LPST_C0140"
FT   CDS_pept        148547..149509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0140"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97364"
FT                   /protein_id="ADN97364.1"
FT                   /translation="MITLNDVAKKANVSKMTVSRVINHPEQVRPELREMILNVMTQLDY
FT                   HPNAAARALVGRRTRVVKLTIFEDMDTTEPYYMMLLAGIANELNQHQYALQIATRNSYE
FT                   VGECDGYILTGIRQADYAWVERLNQPVVFVGSNRQGYDYVDTNNYQAVWESTRYAAEQG
FT                   YTHLVFIGIAIAEPFELDRERGFREYVTTHHISAQIIRLANHSHVATAYVKSHWSGFPR
FT                   NTAFICASDRLAIGVETAIINQGGRVPIEYGIIGFDGVLLNQIAAKRLTTMKQPLEAMG
FT                   RAAARLLLANINHTDRSRGRHDQEKIIINSRLSVAESTR"
FT   gene            149526..151199
FT                   /gene="agl1"
FT                   /locus_tag="LPST_C0141"
FT   CDS_pept        149526..151199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agl1"
FT                   /locus_tag="LPST_C0141"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97365"
FT                   /protein_id="ADN97365.1"
FT                   /translation="MSKHWYDQQTIYQIYPKSFNDSNHDGIGDIPGITAKIPYLKQLGI
FT                   TTIWLNPIYQSPQVDNGYDVSDYYQVDSSLGTMTDVETLIKTVHEHGMYLIFDFVLNHT
FT                   SDQHPWFKQALADPQSKYRDYYLWQDPAADGGRPNNWGSFFGGSVWAKDPAGGSQYYFH
FT                   LFDKRMPDLNWKNPAVQQAMRDVAEFWVEKGIDGLRLDAFIHLAKADFRQTYPNRTGDS
FT                   TPIISDMFYAHLPKVHQYLHDFVAVIKAKHPDTYVVGEASSADPHLMVDYTTPGTDECD
FT                   QVITFRTFADDNTQDDPSFSDTFQPRPMDVTAYKQNTVGIQAALADTSLPTLYWNNHDM
FT                   ARVATRYGDPDYPQASAKALATALYLQRGIPIIYYGEELGLTNIRYHDIADFEDQTVPT
FT                   FVASAQAAGKSKVEIMRMLNQTHKMAGRGPMQWDNTVYHGFSDHLPWKHGDTDDMNAQA
FT                   EIADPDSIYHYYQQLLQLKQCAPFTNGQFIMLGSAEQLFTYLIDDGQKQAAIVCNLSAQ
FT                   AQTYLLPFVGGKVLLVQGGATYRGRQVTLPAWSSLVVKSA"
FT   gene            151455..152708
FT                   /gene="malE"
FT                   /locus_tag="LPST_C0142"
FT   CDS_pept        151455..152708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malE"
FT                   /locus_tag="LPST_C0142"
FT                   /product="maltose/maltodextrin ABC transporter, substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97366"
FT                   /protein_id="ADN97366.1"
FT                   /translation="MSTWKKLGMGALATGLALTLVGCGNSKSSSSSSKMDKTLKVSADP
FT                   SYKSYMKSVIPKFEKKYNVKVKVSYKAMLDEDDALKLDGPSGKGPDVLMAPYDRVGQMA
FT                   SQGQLSTVKLTSGRYNATGKKSVTYKNKVYAAPVTIESDVLYYNKKLIKTAPKNFKELE
FT                   KLASDKKYAYANDKTKSVAFLTQWTNFYNAFGVIKGYGGYVFADGNTNAKKMGLNNSGA
FT                   VEGLTYMTKWFTKYWPSGMQNVTSNENFVTSQFTSNKTAAVIDGPWMAATYKKSNIDYG
FT                   VAVLPKLNNGKDYQAFAGGKAWAISNYSKHKTAAQAWLDFISNKTNQNKLYKSASEIPA
FT                   NTAARKEAVSTGDDMATAVSKQYDKDVPLINLPQMSEVWTPAQTMVTNAASGKMTPKQA
FT                   ANKAQKTILTNISQKYDK"
FT   gene            152818..154107
FT                   /gene="malF"
FT                   /locus_tag="LPST_C0143"
FT   CDS_pept        152818..154107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malF"
FT                   /locus_tag="LPST_C0143"
FT                   /product="maltose/maltodextrin ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97367"
FT                   /protein_id="ADN97367.1"
FT                   /translation="MQVKDVKKAQRLSIIPGLGQLYNGQTIKGVGFIIILLAFIAEFIF
FT                   GGFSAFANLVTLGSVSMEDNSLFIMIYGTLQILLTIVFIVFYIANLYDAKHVAQLINNG
FT                   KKVSHTFKELGASLVDGGFAYLLTTPAYILMVFTIVFPVLVTLLMAFTNYDFAHIPPAM
FT                   LLDWIGFKNFTSMFFLSSYRATFNAVFGWTVIWTVCATTLQIIIGIATAVIANQNFIKG
FT                   KRFFGVIFLLPWAIPAFVSIMSFSNIFNDSAGAINVQAIGLWNTLVPFAHIAPIHWMTD
FT                   TFWTKVAIIMIQGWLGFPYIYVMITGILQAIPEDLYEAATLDGATVMQKFNKITLPTIF
FT                   AIAAPIFVTQYTFNFNNFSMIYLFNQGGPGDVGANAGGTDILISWIYKLTTGTSPQYSL
FT                   AAAVTLIISVLVIGISLIVFKKTHAFEMGD"
FT   gene            154112..154996
FT                   /gene="malG"
FT                   /locus_tag="LPST_C0144"
FT   CDS_pept        154112..154996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malG"
FT                   /locus_tag="LPST_C0144"
FT                   /product="maltose/maltodextrin ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97368"
FT                   /protein_id="ADN97368.1"
FT                   /translation="MDNAQAVAPKNANSKQNSARRHRFWKEFFTYLYMVILGIIIIYPV
FT                   LITFITAFKDANVQAFVLDFGGKWTLVNFKNLFTQTLYGSWYLNTMIISVSCMVIQVIV
FT                   VTLAGYVYSRYRFAGKKFSLTFFIVIQMVPTMAALTAYYVLANMLNALDHYWFLTAIYI
FT                   GGGIPQNTWLMKGYFDNVPYDLDESAKLDGAGNFKIFWSIVLPLVKPMIAVQALWAFMS
FT                   PVQDYLMAKFLLTSESHYTVAVGLQTFINNAQNQQVVLFSAGAILVALPIAALFFYLQR
FT                   FFVSGLLAGGSKG"
FT   gene            155024..155854
FT                   /gene="malA"
FT                   /locus_tag="LPST_C0145"
FT   CDS_pept        155024..155854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malA"
FT                   /locus_tag="LPST_C0145"
FT                   /product="maltodextrose utilization protein MalA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97369"
FT                   /protein_id="ADN97369.1"
FT                   /translation="MQSTKNKTTAFPVRFFGSLFSPRRMFANRDQFNWLQIIVLFIFLT
FT                   AVMVMPIPFYYNHQTNFNLSPFLPHIDKMMVSDQMQTAMKTANYRDQRFKDVKHQIIIK
FT                   TKDNVAGFDLTNDDMAGRKNVINLHASTFQVKSVGSEFKAKYVPGHNLKTNAHAFLVNS
FT                   WYQSNKVMIGLFMLMALGLIIVGVNLILVNGAAFFLFLSRHNKITHIRNFREGVNLTLM
FT                   MMGIGSLLAMVIGLIHFDVTIELTVQSLSLAFVVLWVYLKTKFKDPEVDQTMLL"
FT   gene            155888..157210
FT                   /gene="amy2"
FT                   /locus_tag="LPST_C0146"
FT   CDS_pept        155888..157210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amy2"
FT                   /locus_tag="LPST_C0146"
FT                   /product="alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97370"
FT                   /protein_id="ADN97370.1"
FT                   /translation="MARDTQTQLRNEMIYSVFVRNYSEAGNFAGVTADLQRIKDLGTDI
FT                   LWLLPINPIGEVNRKGTLGSPYAIKDYRGINPEYGTLADFKALTDRAHELGMKVMLDIV
FT                   YNHTSPDSVLATEHPEWFYHDADGQLTNKVGDWSDVKDLDYGHHELWQYQIDTLLYWSQ
FT                   FVDGYRCDVAPLVPLDFWLEARKQVNAKYPETLWLAESAGSGFIEELRSQGYTGLSDSE
FT                   LYQAFDMTYDYDVFGDFKDYWQGRSTVERYVDLLQRQDATFPGNYVKMRFLENHDNARM
FT                   MSLMHSKAEAVNNLTWIFMQRGIPLIYNGQEFLAEHQPSLFDRDTMVADRHGDVTPLIQ
FT                   KLVTIKQLPLLRAADYQLAVVEEGIVKITYRAAGEALTAWIPLKGQVTAVATKLAAGSY
FT                   QNLLTDGPTEVVDGKLTVDGQPVLIKYVTNTAVTKVADQSN"
FT   gene            157312..158418
FT                   /gene="msmK1"
FT                   /locus_tag="LPST_C0147"
FT   CDS_pept        157312..158418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msmK1"
FT                   /locus_tag="LPST_C0147"
FT                   /product="multiple sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97371"
FT                   /protein_id="ADN97371.1"
FT                   /translation="MVEMNLDHIYKKYEGNDKYSVTDMNLDIKDGEFIFFIGPSGCGKS
FT                   TTLRMIAGLEDITKGDFKMNGQVMNDVEPKNRDIAMVFQTYALYPNMSVFDNMAFGLKI
FT                   RKTYSNTEIKKRVDNAAEQLGLTDYLQRKPANLSGGQRQRVALGRAIVRDAGTFLLDEP
FT                   LSNLDAKLRVDMRTTIAQMHQRLKTNMIYVTHDQIEAMTMADRIVIMNDGKIMQVGTPH
FT                   ELYNEPVNQFVAGFMGSPSMNFFNATLHDGRVTDGEGLDVAVPEGQLKVLKAQGYDQKK
FT                   MIVGIRPEDIHAEQIALEAMSDSIVKTKVVVSEFLGAESMLYCTAGKSKFTAQVDARDY
FT                   HNPGENVEVAFEMSKAHFFDSETKDVIR"
FT   gene            158445..160715
FT                   /gene="map2"
FT                   /locus_tag="LPST_C0148"
FT   CDS_pept        158445..160715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map2"
FT                   /locus_tag="LPST_C0148"
FT                   /product="maltose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97372"
FT                   /protein_id="ADN97372.1"
FT                   /translation="MKRIFEVDPWHVISHELVPTDKRLQESMTSIGNGYMGMRGMFEEH
FT                   YSNDTLKGIYIGGVWYPDKTRVGWWKNGYPDYFGKVINSVNFIKVNITIDGDQVDLAKD
FT                   TVSDFTLDLDMHTGILRRSFIITKGEKRVQFMIDRFVSVAQKELFDVHYSVHNLGAEPV
FT                   QIGFISQIDADVFNEDANYDEQFWQVLDKSHAITGGSMFAETKPNNFGTPRFTLGMQML
FT                   HETAFRGINAPETEKAVTNIFRGTLAPDETKNFEKRVLVVTSRDYADMAAMRTGLAELS
FT                   ETVSTQSYEDLRQAHVDGWAKRWQLSDVLIDGDDAAQQGIRFNLFQLFSTYYGEDKRLN
FT                   LGPKGFTGEKYGGATYWDTEAFGVPFYLSLAKPEVTENLLEYRYNQLAGAFHNAKMQGL
FT                   AGALYPMVTFNGIECHNEWEITFEEIHRNGSIAYAIFNYTRYTGDEIYLKTKGIDVLTG
FT                   ISRFWADRVHFSERKQQYMIHGVTGPNEYENNVNNNWYTNFMARWTLEYTLASLKKVDA
FT                   AKRAALQITDAELAKWQDIVDRMYFPYDEKLGIFVQQDGFLDKDVKPVSSIPADQRPIN
FT                   QHWSWDHILRSPYIKQADVLQGIYYFMDKFTAEQKKRNFDFYEPLTVHESSLSPAVHAI
FT                   LAADLHYEDKAVEMYERTARLDLDNYNNDTVDGLHITSMTGSWLAIVQGFAGMRVKDDT
FT                   LAFAPFVPKAWTHYQFHVNFRGRLIKVDVDQQGTTVELVSGEPLTIELNGQAIEVASTV
FT                   TTK"
FT   gene            complement(160929..163775)
FT                   /locus_tag="LPST_C0149"
FT   CDS_pept        complement(160929..163775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0149"
FT                   /product="mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97373"
FT                   /protein_id="ADN97373.1"
FT                   /translation="MRHGQYRYIVGTLALITTAVGLVACSKQSANQQISYRQTAEATLD
FT                   KGMDNQPEAPYWFPKQLLKWQLSKDKAAKYNTASVPLAKRIDKWQLPTVNKTQDPKMKV
FT                   VALSIMNSSTSGNAPRGINTFDANVFSNWQYIDQLVYWGGSAGEGLIVPPTADVIDSAH
FT                   KNGVPVLGTVFFPQVVSGGKLKWLNDFLKQDADGHFPMADKLVAVAKAYGFDGWFINQE
FT                   TDPEVKSFDSASTGKTATSSTSNGLSKKHAQLMQQLIKEYKQKAGSKLDLMWYDSMTKD
FT                   GKMDWQNALTKENQSYLVDANMKPVADSMFLNFWWTKKRLASQELLKKSHERAEKLGIS
FT                   PYNLFAGIDVQADGTATPVRWNLFANKQHVPYTSLGLYAPDWTHASSDTVDEFQAKEGA
FT                   LWVNDQNDPSRSIPSTTSTHWPGVSTYAVEQSAITKQPFVTNFSLGNGYNYFIKGKNVS
FT                   LRDWNNRSLQAVNPTYRWLINNGNGNALKASFDYTDAYEGGNDIKLAGKMRKDTASTIK
FT                   LYTTDLDVTADTQVSLTAKASGKSTAKLVVTLKDGRTKTIAGDRTLSKHWTTVSYDVSQ
FT                   LTKKTIKGLSLKISAAETDASYSVQLGRLAITGKQQAAPKKVNQVTIDNRTFDEEGKYA
FT                   GVNLSWQATTKNKLDHYEIYQVNNDGSRSFLGATNTTNFYLNALKRNGQHNETNLMVVP
FT                   VDIWNQRGDASDQVTLKWPDNRKPKAAFTVNRTLAAPGNTIKFTNASSKNATSYKWEFD
FT                   GATKTTSTAKNPTVTYRKAGTYNVTLTAKNKDGQRHVTMKKLITITPKAQGALTLLSKN
FT                   AKTSASGYTNSSEAPKMAVDGKLDTKWCATGKAPHTLTLDLGRQTTVSAVKLAHAKAGG
FT                   EGADMNTRAWTIQVSTDGKRYTDVAWTYNNTQATSLNTFAATSARYVRLVVDKPTQVAD
FT                   TAVRIYEMDVLGLTQTLK"
FT   gene            164362..164634
FT                   /locus_tag="LPST_C0150"
FT   CDS_pept        164362..164634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0150"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97374"
FT                   /protein_id="ADN97374.1"
FT                   /translation="MDPKRVKYLKLISKLATFTCIAMYVSYIPQIISNFSGDPVSPLQP
FT                   LVAMINGILWTGYGWFKTYKDWPVIISNVPGVIFGFITVLTVYIH"
FT   gene            complement(164712..165578)
FT                   /gene="sacK1"
FT                   /locus_tag="LPST_C0151"
FT   CDS_pept        complement(164712..165578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sacK1"
FT                   /locus_tag="LPST_C0151"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97375"
FT                   /protein_id="ADN97375.1"
FT                   /translation="MLLGAIEAGGTKFVCATGAENGQVSDRISIPTTTPAETMTAVDDY
FT                   FTTHPVDAIGIGSFGPIGVNPDDPKYGYITTTPKPGWGDFDFLGHLKSRFNIPLYWTTD
FT                   VNEAAYGESMIGIAKDVPNSIYMTIGTGVGAGVISQNHIFNGRTHTELGHMRLNRLPGD
FT                   DFKSNCPYHDICLEGLAAGPAVGKRTGKAGKDIPVDDPVWPIIADYIAQACVNLTVAFA
FT                   PDKIILNGGVMNQRQLFPMIREKFAAYLNGYEEVPPLDDYIVPAGLGNNSGIAGGLLLA
FT                   QAALKNA"
FT   gene            complement(165712..167667)
FT                   /locus_tag="LPST_C0152"
FT   CDS_pept        complement(165712..167667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0152"
FT                   /product="sucrose PTS, EIIBCA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97376"
FT                   /protein_id="ADN97376.1"
FT                   /translation="MNHQEVADRVLNAIGKNNIQAAAHCATRLRLVIKDESKIDQQALD
FT                   DDADVKGTFETNGQYQIIIGPGDVDKVYDALIAKTGLKEATPDDIKAVAAAGQKKNPLM
FT                   DFLKVLSDIFIPIVPALVAGGLLMALNNVLTAEHLFMAKSVVEVYPGLKGIAEMINAMA
FT                   SAPFTFLPILLGFSATKRFGGNPYLGATMGMIMVLPSLVNGYSVATTMAAGKMVYWNVF
FT                   GLHVAQAGYQGQVLPVLAVAYILATLEKFFHKHIKGAFDFTFTPMFAIVITGFLTFTIV
FT                   GPVLRTVSDTLTNGLVGLYNTTGWIGMGIFGLLYSAIVITGLHQTFPAIETQLLANVAK
FT                   TGGSFIFPVASMANIGQGAATLAIFFATKSQKQKALTSSAGVSALLGITEPAIFGVNLK
FT                   MKFPFVFAAIASGIASAFLGLFHVLSVAMGPASVIGFISIASKSIPAFMLSAVISFVVA
FT                   FIPTFIYAKRTLGDDRDQVKSPAPTSTVINVNDEIISAPVTGTSESLKQVNDQVFSAEI
FT                   MGKGAAIVPSADQVVAPADGVITVTYDSHHAYGIKTTAGAEILIHLGLDTVNLNGEHFT
FT                   TNVQKGDTVHQGDLLGTFDVAALKAANYDPTVMLVVTNTANYANVERLKVTNVQAGEQL
FT                   VALTEPTASSVAATAI"
FT   gene            167923..169428
FT                   /gene="sacA"
FT                   /locus_tag="LPST_C0153"
FT   CDS_pept        167923..169428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sacA"
FT                   /locus_tag="LPST_C0153"
FT                   /product="beta-fructofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97377"
FT                   /protein_id="ADN97377.1"
FT                   /translation="MIWNRKTRYTPYEQWPATKLPQLVAQARQSKWRMQHHIQPTSGLL
FT                   NDPNGFSYFDGQWHLFYQVFPFGPVHGLKSWQHVTSKNLVDWHDEGLAIRPDTPYDSHG
FT                   AYTGTALPIDDQLFIMYTGNVRTADWQRESYQLGAWMDTDNHIKKLSRPLIAHAPAGYT
FT                   SSFRDPDLIRTDHGYYALIGAQTTTEIGAILVYFSKDLTTWTCQGELNVPANARGYMIE
FT                   CPNLVWIDQQPVLLFCPQGLSQTTTPYQNIYPNMYLVADQLDLAQAQFTEPHALTQLDD
FT                   GFDVYATQAINAPDGRALAVSWIGLPEISYPTDRENWAHCLSLVKELTLKDGHLYQNPV
FT                   AAVDDLRTTAHDLVFEQQRATVAALNGSFELLLTVPADKTVTVNIADQQESGQLQVTVD
FT                   ANHGQVMIDRRHTGNSFAEDYGQTRQVELTAHKTIKIRLIIDVSVFECYIDNGYSVMTG
FT                   RFFLNATPSRLNVQGDTTAVTGKVWEWRQSEHTGVDNNETKIK"
FT   gene            169409..170389
FT                   /gene="sacR"
FT                   /locus_tag="LPST_C0154"
FT   CDS_pept        169409..170389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sacR"
FT                   /locus_tag="LPST_C0154"
FT                   /product="sucrose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97378"
FT                   /protein_id="ADN97378.1"
FT                   /translation="MKPKLNDVAKLAGVSATTVSRVINNHGYLSSQTKEKVFAAMRELH
FT                   YQPNNMARSLQGKNTRLIGVIFSDISNPFFGELVSRIEKILFAKNYKVILCNSADDPQK
FT                   ERDYLQMLMANQVDGIIAGAHNLGIEEYQQYGLPIISFDRYLSDNIPIVSSDNYQGGWL
FT                   ATQTLHQAGATNVAIFTGKSHAGSPTNGRREGYEAYLTAQQLTPHVHELPFELTPALKM
FT                   MEIKTIMTQHQYDGIFCSDDLTALLVLNVARQLSLTVPEQLRVVGYDGTALIRDYHSEL
FT                   TTVEQPLADISTLLVSLLLQRIEDANCTLESKYTLPVKLIKGLTA"
FT   gene            170410..172086
FT                   /gene="agl2"
FT                   /locus_tag="LPST_C0155"
FT   CDS_pept        170410..172086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agl2"
FT                   /locus_tag="LPST_C0155"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97379"
FT                   /protein_id="ADN97379.1"
FT                   /translation="MAATIKWWQQAVVYQVYPRSFQDTNHDGIGDLKGITAHLDYLKQL
FT                   GIDVIWLNPIYRSPNDDNGYDISDYQQIAADFGTMADFDELLQAAHDRGLKIIMDLVVN
FT                   HTSDEHPWFKRSRQDRTNQYRDFYFWRSGNGKKAPNNWDAAFGGSAWQYDEQTQQYYLH
FT                   TFSTKQPDLNWENPTLRESVYTMMTWWLNKGVDGFRMDVINQISKLPGLPDGPLKPHSQ
FT                   FGDARVTNGPRVHEFLQEMNQEVLSQFDIMTVGETHGVTPADALKYAGADRHELDMVFE
FT                   FQHLRLDNSQHGLGKWSTRKTPLVALKKVISDWQVGLEGRAWNSLFWNNHDTPRAVSRF
FT                   GDDRPAYRVRSAKMLATCLHILQGTPYIYQGEELGMTDAHFTELTSYRDIESLNAYRDL
FT                   VTERQLLSPADMMARLAARSRDNSRTPMQWDTEVNAGFSDAAPWLTVNPNYRQINAAAA
FT                   LADPDSVWYYYQHLIQLRHQYPLVTLGSFELLWADDPQVFLYARQWEGRTWLVCCNFTA
FT                   ETLSRPLDQYLTPTAKCLISNYGEQQPNKLRPYEAWVYQLA"
FT   gene            complement(172243..173157)
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0005"
FT                   /note="oxidoreductase"
FT   gene            complement(173378..174778)
FT                   /gene="nha1"
FT                   /locus_tag="LPST_C0156"
FT   CDS_pept        complement(173378..174778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nha1"
FT                   /locus_tag="LPST_C0156"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97380"
FT                   /protein_id="ADN97380.1"
FT                   /translation="MPNSKKWRSVQLPEALLVLLIMLAIMGLGVIKFGLSPQTPVILVI
FT                   ALIILWARIRGAHWDDIHGGIIDGIKTGIIPIFIFLLIGALISVWIAAGIIPSMMVFGF
FT                   HLISAQWFVPSVFLVCAIIGTSIGSAFTIISTIGIALFGIGTTMGINPALIAGAIISGA
FT                   IFGDKTSPLSDSTNLAAAIAEADLFDHIRNLMWSTIPAFVVSLVLYAVLGAGAATQSHL
FT                   GKIQTTLTVLNNNFTISWWAALPLVVMFACALLKIPAIATLLMNIGLAIVMIFIEQPHI
FT                   ALTKIATMIETGFVAKTGNAGVDALLSRGGISAMMSTVSLILLTLSLGGLLMKFNLIQT
FT                   AMVPLTKRLKGAGATVTAAILAGIGVNIFVGEQYLSVILPGKAFKTTFNQRGLANLALS
FT                   RVLEDGGTVINYLIPWGVAGAFAANTLGVSTLAYLPFCFFSLLSPVFSIISGFTGWGLK
FT                   HQPANEAG"
FT   gene            175324..176997
FT                   /gene="agl3"
FT                   /locus_tag="LPST_C0157"
FT   CDS_pept        175324..176997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agl3"
FT                   /locus_tag="LPST_C0157"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97381"
FT                   /protein_id="ADN97381.1"
FT                   /translation="MANQWWQSAVVYQVYPRSFQDSNGDGIGDLPGITQRLDYIKQLGA
FT                   DVIWLNPIYRSPGVDNGYDISDYYDINPEFGTMADFDQLLTTAHAKGLKIMMDIVVNHS
FT                   SDQNKWFTTSAQSKDNPYADYYIWRDPVDGHEPNNWGGFFGGSAWKYVASRDQYYLHSF
FT                   AVEQPDLNWDNPQLRQAVYDMMNFWVNKGVDGFRLDVINLISKPDSFADGQPEAGEPYA
FT                   AIGGIIANGPHLHEYLQEMNQQVFAGHQLMTVGETPGATVADAKQLASGQGQELNMVFE
FT                   FEHMGLDGNPDPALGKWNDQPVRLVDLKQSLSKWQMGLQGTAWNSLYWNNHDQPRIVSR
FT                   FGDERPAYRERSAKMLATLLHFLQGTPYIYEGEELGMTNAHFTKLTDYQDLESLNAYHH
FT                   FVDDEQVVQPEQMLGYLAHMSRDNARTPMQWDDSQNAGFSTATPWLAVNANYPRINAQL
FT                   AQRTPGSVLSYYQRLIKLRHHLPVITTGTYHLLSPDDAAVYAYVRHMGSQHLLVICNFT
FT                   AATQTRHFAELPADAHLLISNYDEDHQDVLRAYEAKVYQF"
FT   gene            complement(177197..178111)
FT                   /locus_tag="LPST_C0158"
FT   CDS_pept        complement(177197..178111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0158"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97382"
FT                   /protein_id="ADN97382.1"
FT                   /translation="MNIKDLYYFQRLISTQSYTQTAADFHVSQPTISQAIKRLERHFQV
FT                   TLFFRQAKTKALVLTPSGQQLLLAANDIINNWQHVNESISHLRQHTLRFGIEPSVSEHY
FT                   LPALTKPIIEQDLLSSVHTVEMGANQLVKQVLAGQLDLAISGNLDQTLDERLAVTPLRP
FT                   FKFRILANVAHPLAKAEHPTFAEALKSPFVLLNATYLNKLVFRQLAEQLSIEPQVLFES
FT                   DSSTLIKGLVKENLALGFISDITTPNDGEDDGLVEIPFDDVQVPSVHINLIRRAHQFPI
FT                   GLVKQVIDIIEKTFAADNAEQKS"
FT   gene            179602..181968
FT                   /locus_tag="LPST_C0159"
FT   CDS_pept        179602..181968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0159"
FT                   /product="cell surface protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97383"
FT                   /protein_id="ADN97383.1"
FT                   /translation="MYSGVVTSQKDSARTATTTDQATASVATLSRMSRASLRSLAQRAT
FT                   VAVQGLDATDATVTDDDGVTYSATDVLSLYANYIAKYHWSIADDVSVTAGSTATVTLPD
FT                   NVVFTNGTQHIDVQKSDGTVVGTFTAETGSQTGTLTFNDYYATSDRYNRQGDLTFYVTG
FT                   TSATTGSSTTGINKVGWADSNSLDPDGNPAKMIWQVVANINSEKWQQVAIVDQLGLYQT
FT                   HEGTMTLETGHYTDGAFVKDAALGTYDFATQQFTYADGVSTPQVTVTVVGQQMTINIDQ
FT                   LDVAVNIFYEVGLTVGHTYTNNAGVTYAPVIGDATDPNEGSSTGEPKSEQSNVAVRFGG
FT                   SGTASDDIQSYSLVINKTDGDGQSVAGATYQLEDSTGTVLRTDLVTDSVGQLRIGNLSA
FT                   GTYMLVETAAPSGYQIDTAKHVFTVSAAQATANVVTGSVVDKRIAKTALTVNKVWADVP
FT                   AGVQTPTVEVTLQRNGQAYQTLQLTSANGYTGTFSDLDVTDVYGNAYTYTVIETAIAGY
FT                   ISSQTTSGETVTLTNTYQTGKLTVIKTDSSGANRLAGAVFAVKNAAGTLVAQLTTDATG
FT                   QAQLTGLTQGAYTVSEIQAPDGYLINTQAQVLVLNEQSAYQGQLVFADEVEPSEPSEPS
FT                   EPSEPSEPSEPSEPSEPSEPSEPSEPSEPSEPSEPSEPSEPSEPSEPSEPSEPVLPGHA
FT                   DEDSDSDQVVTTKTETAKLVKQTNLVTTTQPTKLLGQPIKLVATSKPVVKVTKATNRKS
FT                   AQQLPQTSEQSMDWLMILGWFLLGLTVVSRQRRFN"
FT   gene            complement(182035..182166)
FT                   /locus_tag="LPST_C0160"
FT   CDS_pept        complement(182035..182166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97384"
FT                   /protein_id="ADN97384.1"
FT                   /translation="MLLAGLLAAAGLAAVAGVVAGARVPAAQPVRIKHDQRTSQNRR"
FT   gene            complement(182259..183101)
FT                   /locus_tag="LPST_C0161"
FT   CDS_pept        complement(182259..183101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97385"
FT                   /protein_id="ADN97385.1"
FT                   /translation="MNIELFIARRKALGLSQKALADGICTQATLSKFENNGKAPAIRIV
FT                   AQLCQRLNLQLEDVFPTERVADAAVLKILEQVEFDLITTEYQDAEVQLEKAADMPRHDR
FT                   ETKLQYCYLKGYVAALNHHPISDVIFNFDQIITDLDEAHITIYTQLAYCGIGIAYQQNQ
FT                   DNDKAQYYFEKVRHALPNLPLETTASVWRVINLAYYTGAFYANINDTPRSLQLLNYGIE
FT                   ICARFHVTYYAARIKFLQAQLSDEPDQIHEYLNDAAALARMNNNRQLLKNISSYSDSH"
FT   gene            complement(183289..184950)
FT                   /locus_tag="LPST_C0162"
FT   CDS_pept        complement(183289..184950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0162"
FT                   /product="oligopeptide ABC superfamily ATP binding cassette
FT                   transporter, binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97386"
FT                   /protein_id="ADN97386.1"
FT                   /translation="MKWKVMLTTATAAASTGLLLAACSQGQSKSDNAGNLRAGMAQKQV
FT                   LNWSENGSELTTLDTSLVTDSISANMINNTMEGLYRIGNNNKITPGIATHTVISKDKKT
FT                   YTFTLRKDAKWSNGDPVTAQDFVYSWRRTIDPKTASQYAYLYSGIKNADQITNGKAKAN
FT                   SLGIKADGKYKLTVTLDKPMAYFKLLMGFAIFFPQNQHAVQKYGKDYGTTATKMVYDGP
FT                   FTMKGWKGTNTTWSLNRNPKYWDKKHVYLEKINDQVVKSTTTGFNLFQSNKLDMATLSG
FT                   EQVKNEKNNPKLVLRKTSRLNYLEFNQKKVPALANAKLRQAMSLTIDRHQLVTDVLADG
FT                   SAVPKGFVTTGLATDPTTGEDFATENAVSAATTQDTAKAKKLWAEGLKETGKKSLTLTL
FT                   THDNIDQTKETAEYVQGQLEKELPGLKITDITLPFKNRLARETSGDFQLAISGWQADFA
FT                   DPISDLGILTSTNDYNFGKWKNADYDAAVKQAEQATDPTVRWTALGKAEKIIGTDEGVA
FT                   PLTQTTLAQMVNPKLKGLIYNTSGTNYNFKDAYMAK"
FT   gene            complement(185156..186817)
FT                   /locus_tag="LPST_C0163"
FT   CDS_pept        complement(185156..186817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0163"
FT                   /product="lipoprotein precursor, peptide binding protein
FT                   OppA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97387"
FT                   /protein_id="ADN97387.1"
FT                   /translation="MQWKLFATVATLTATTGVLLVGCGQSSSSSSNAGNTTAKMAKTQV
FT                   LNWSENGQDLTTLDPSLATDVISGTMISNSQEGLYRLGKNSKVTPGIATKTTVSKDKKT
FT                   YTFTLRKNAKWSNGDQVTAQDFVYGWRRTVNPKTASQYAYLYSGIKNADKIVSGKAKTS
FT                   TLGIKADGKYKLTVKLEKPMQYFKLLMGFVVFFPQNQHAVEKYGKDYGTSSSKMVYNGP
FT                   FKMTGWKGTNSTWTLKRNPNYWDKKHVYLTKIKDQVVKSTTTAFNLFQSNKLDMATLSG
FT                   QQVKNEKNNNKLVIRKSSRLNYLEFNQKKVKLLANKKIRQAMSLTLNRKQLVNDVLGDG
FT                   SVTPKGFVTTGLATDPTTGKDFATENTGKSAVTQDTTKAKKLWKQGLKETGKKSVTLTL
FT                   THDDTDQMKALAEYVQGQLEKELPGLKVQSVTVPYKTRISREIAGNFQLVISAWQADFA
FT                   DPVSDLGIMTSTNDYNFGKWTNKTFDSAINTANSTTSTTKRWQALATAEKTMATDQGVA
FT                   PLSQNVIAQMVNPKLKGLVYNTAGINYNFKSAYMDK"
FT   gene            complement(186970..187413)
FT                   /locus_tag="LPST_C0164"
FT   CDS_pept        complement(186970..187413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0164"
FT                   /product="possible acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97388"
FT                   /protein_id="ADN97388.1"
FT                   /translation="MKIEHLQHPTTHQLDQLMTIWLSGNLTAHDFVSADYWRQQAPLVR
FT                   EALQSAELIVGLTDGPEAYILGFIGLQNDYIAGIFICNDAQHQGLGTALLATAQADHHQ
FT                   LQLNVYVANRPAIAFYHYHGFRVIDQASDQATQQPEYTLQWQR"
FT   gene            complement(187410..188588)
FT                   /gene="serA1"
FT                   /locus_tag="LPST_C0165"
FT   CDS_pept        complement(187410..188588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA1"
FT                   /locus_tag="LPST_C0165"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97389"
FT                   /protein_id="ADN97389.1"
FT                   /translation="MYQVKTYNAIAPAGLNTFTADYTLNQSEHPDAYLIRSVNLHTETL
FT                   PSSLKVIVRAGAGVNNIPIDQATANGTAVFNTPGSNANAVKELIIGLLIMASRNLIAAT
FT                   TYSAQHTEADISQRTEHDKTQFNGIELTGKTLAVIGLGHVGALVANAALSLGMNVIGYD
FT                   PYLSADAAWNIAKQVQRAATLPDAVKQADFVTVHVPKNADTLHLINKDALAAMPRGVQL
FT                   FNYSRLGIVDNTAVMNALATGQVAHYYTDFGEPQLANQSAVTVTPHIGGSTIEAEINGA
FT                   TQAARTIMTYLETGNVHAAINLPDLNVPFNAAYRFTVIHENVPNMVSQITAKLAAANLN
FT                   ITTMANAAKHQIAYTIIDVDDLQQPQQADLIAELSKIPAVSRVRLLKRGSVE"
FT   gene            complement(188604..189677)
FT                   /gene="serC"
FT                   /locus_tag="LPST_C0166"
FT   CDS_pept        complement(188604..189677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="LPST_C0166"
FT                   /product="phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97390"
FT                   /protein_id="ADN97390.1"
FT                   /translation="MPIYNFSAGPAVLPQPVITQIQAELPSFRDSGMSILEISHRSDLF
FT                   AQVLQDAEQDLRDLMAIPDNYHVLFFQGGGTLQFTAAPLNLAPHHRIGLLDSGHWAQRA
FT                   ADEAKRVGTKVTILGSSAANHFNQLPTVVQPIDQSLDYIHLTTNNTIEGTMMTRLPVTG
FT                   QVPLVADMSSNFLGEPYQVSDFGLIFAGAQKNLGPAGLTIVIVRDDLIGQVANLPSMLD
FT                   YQLFAAKDSMFNTPPVFAIYAAGLVLKWLKAQGGLSTMTARNHAKAALLYDFLDQSQLF
FT                   TNPVKTSDRSTMNVPFVTGQADLDAAVIQGAREHGLLNLKGHRLVGGMRASLYNAMPLA
FT                   GVQALVDYLAAFEAHHR"
FT   gene            190061..190684
FT                   /gene="pgm1"
FT                   /locus_tag="LPST_C0167"
FT   CDS_pept        190061..190684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm1"
FT                   /locus_tag="LPST_C0167"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97391"
FT                   /protein_id="ADN97391.1"
FT                   /translation="MTTFYVVRHGQTAANAQNLKQGTINTAVTHLNSVGKQQAQTLHDT
FT                   FDISFADRLICSPLDRTQATAAILNQGRQLPVSQDERLLEISYGQWDGQDNDQLLAAYP
FT                   QYFDPLLQDVLPSYVEVATDGETFEHVQQRVAAFLKTTAQAHPDEQIIVVTHGFTVKAM
FT                   ALAILKPTDPMSLPEPANTSVTKVMVDAVHGRQYLAYYNRLPQF"
FT   gene            190942..191934
FT                   /locus_tag="LPST_C0168"
FT   CDS_pept        190942..191934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0168"
FT                   /product="Aryl-alcohol dehydrogenase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97392"
FT                   /protein_id="ADN97392.1"
FT                   /translation="MMTYSAASTRYDELPIRRVGKTGLQLPVVSLGLWRNFGDEAPFAN
FT                   SRKVVLDAFDHGVFSFDLANNYGPSKGSAERTFGQIMQRDLKPYRDELVITTKAGYPAW
FT                   SGPYGAFGSRKTLISSLDRSLKQMHLDYVDIFYSHRPDPNIDLYETAAALDQLVRQGKA
FT                   LYVGISNYDRDQTATMIKYFNEMHTPFTVNQYSYNMLNQQAQTAGLIDYLGQHNAGLVA
FT                   YGPLAEGLLTQRYLQGIPADFPIHRTNKYLFDQGTAAVVNQLNALNRIAEQRGQTLAQM
FT                   ALAWLLRSQVVTSVIIGTTNVDHLHANLEATHNLTFSDDEVKAITAILK"
FT   gene            192436..192657
FT                   /locus_tag="LPST_C0169"
FT   CDS_pept        192436..192657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97393"
FT                   /protein_id="ADN97393.1"
FT                   /translation="MEQLKPIEASLLQAYELNCVVRLTLSDGHQPSGLIAAVDDQQLFL
FT                   NQQAGVVKPIALSDVTAIDFLKQSWWQR"
FT   gene            complement(192660..193010)
FT                   /locus_tag="LPST_C0170"
FT   CDS_pept        complement(192660..193010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97394"
FT                   /protein_id="ADN97394.1"
FT                   /translation="MTPIETYIANTPQAYQSQLIALQQTIATVLPEAQEQLKYQMPTFY
FT                   WHENVIHFALFKHHFGLYPTPSAIETFHDQLITYKTSKGAIQFPLDQPLPLELITAITE
FT                   FRRHEIIAKYDL"
FT   gene            complement(192997..193869)
FT                   /locus_tag="LPST_C0171"
FT   CDS_pept        complement(192997..193869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0171"
FT                   /product="adherence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97395"
FT                   /protein_id="ADN97395.1"
FT                   /translation="MTTTTDVDLVQTGLAHLIHHTRKQIESLTKALDHLPDVSDLQLKG
FT                   TLLKTYASQIEGHHHFVELPDYQGHQLSIKLDIKKSIIENAEDYFHRYHKSKRGQATVQ
FT                   QNLATAKTELYQQLATQAAFDPNDPQAVAALKQTLIAAGAIHTHVLHSSKAPTPAHPRR
FT                   FYTHDHVLVEVGKNSRQNDHLTLTARKDYYWMHAGGEIPGSHVVIHSNHPSEQTLQEAA
FT                   VLTAYYSKGRQMNRVPVDVLTVGQMRKPKGAKAGLVTFSGPARTITVVPDATLATELRD
FT                   QEDIHHDAD"
FT   gene            194046..195233
FT                   /gene="ack1"
FT                   /locus_tag="LPST_C0172"
FT   CDS_pept        194046..195233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ack1"
FT                   /locus_tag="LPST_C0172"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97396"
FT                   /protein_id="ADN97396.1"
FT                   /translation="MQKTLIINAGSSSLKWQLFAMPAETVVASGLVERISMPGSIFTIK
FT                   YGDHQKFETTVDNLDQNHAAEMLLAELQRLAIIDSLTEITAVAHRVVAGGETFKQAVEV
FT                   TPAVLEAIKGLSDFAPLHNPMEARGIETMAQALPTVKQYAVFDSQFFTDLPEMNAIYSL
FT                   PYELTQKYHIRRYGEHGISHGYLTGRAAELLAKPKDDLNLVTLHLGSGASLAAVKNGRA
FT                   FDTSMGFTPLTGVTMGTRAGDVDPAVLPFLMKALKIDDPNEIMMMLNNQSGLLGISGIS
FT                   PDMREIRAQEATNPQAQLAVEIFVNRIVKYAGSYLTELKRADALIFAGGIGEHNATLRQ
FT                   QIIDELSIFGVTLDPKLNEAGQEGLISGADSKIKVMLIPTNEELAMVRQVAALQN"
FT   gene            complement(195288..195539)
FT                   /locus_tag="LPST_C0173"
FT   CDS_pept        complement(195288..195539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97397"
FT                   /protein_id="ADN97397.1"
FT                   /translation="MVAFPNNATPAIATTIRPNHNAILNKNNPITIMNTQPIILKPILK
FT                   ITLSNHKPITKAINKPIIYALCEESFPPYKSHHGYLAS"
FT   gene            complement(195682..195966)
FT                   /locus_tag="LPST_C0174"
FT   CDS_pept        complement(195682..195966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0174"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97398"
FT                   /protein_id="ADN97398.1"
FT                   /translation="MRLALPLNRWPLPIATLFINLTGALLLGWILTSSLPPNWQIFLGT
FT                   GIMGGYTTFSTMINELVLLGRNHHQRVAWEYFGLSLVGGLVMVYLGTLI"
FT   gene            complement(196032..196415)
FT                   /locus_tag="LPST_C0175"
FT   CDS_pept        complement(196032..196415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0175"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97399"
FT                   /protein_id="ADN97399.1"
FT                   /translation="MKKIIAITGFAMLGGGLREGLSLLVTWPQHFWITCLINIVGAFVL
FT                   SLITNLLPARLPVSEDIVIGMSVGFVGSFTTFSTFTFETLQSFQSGHSVLALSYVAASL
FT                   GLGLLAGLAGNFLSTYWLPKEEF"
FT   gene            196716..198236
FT                   /locus_tag="LPST_C0176"
FT   CDS_pept        196716..198236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0176"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97400"
FT                   /protein_id="ADN97400.1"
FT                   /translation="MTMINLKNIQKDMAGRPLFTIDRLVANAGDKIGVVGRNGAGKSTL
FT                   AHLLTGTDRDYTGQIMVDEPVSYVAQIAPTFDQSGGQAMLTRIRQALSARPTILILDEP
FT                   SSNLDKTHQQWLINQLQRFRGLLLLISHDRQLLNAVTTQTWAVEHQKFTAYAGNYAYYQ
FT                   TVKAQQLATQEAAYQRQNTHQRELLAAQRQRNEKAQRIRKGNRRMSQVERAKTKATREA
FT                   TAAKMERTAKRMVARGQREPQVAKPFTTSGFKLVATDFPTFTGKTVVTGLNVTLAEYGK
FT                   TLLAHADFQIRPHDRVAIVGPNGSGKTTLLRAILGGRVSGLRLAPAARVGVFNQDMTVL
FT                   DGKQSVWQTVRQVSQLPDQTIRNVMGALGLPARFYPQLVSALSGGELVKLQLICILVGQ
FT                   YNVLMLDEPTNYLDVDALDALADYLQNYPGTVIFVSHDEPFRQAVATRVLQFETHQLVD
FT                   PDKVVKAPQPVEADLAVLQFKYDQLMADPTSSTAAIQALRQQIDRLKA"
FT   gene            complement(198357..198791)
FT                   /locus_tag="LPST_C0177"
FT   CDS_pept        complement(198357..198791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0177"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97401"
FT                   /protein_id="ADN97401.1"
FT                   /translation="MAWVLFTRIYAFVFTGATFTLTTDVLQLTDSLEQNWHLPAKFSYG
FT                   VLAAYNLVPRIQHEVQVIRAAGLMRGQVLSFWSPQLYFKAILVSINWSQNLARAMRSHG
FT                   FVEDAPRTHYRQIPLTKLDWTIVISGGLLLQVGAFVIPWR"
FT   gene            complement(199013..200419)
FT                   /locus_tag="LPST_C0178"
FT   CDS_pept        complement(199013..200419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0178"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97402"
FT                   /protein_id="ADN97402.1"
FT                   /translation="MASIALNNLTYTYPQASTPILDRVNLTLPRQSFILLTGPSGTGKS
FT                   TLLKLIAGLLPLTPDYGTITFDGQSLTASTANQRAQHVAMMFQNPNQQFAMDTVENELI
FT                   FALENLQVPRDQIPARLLSALDFVGIRNLQSRLLNHLSGGEKQKVALAIIVAMDSDVIL
FT                   LDEPFASVDPTARAVLLDRLVELRNQHGKTIILADHDLTGYEQLVDQVVQIKDQHLQLI
FT                   DRTTWSELFAAFTEQPQRSWSAPQRVERPCFQLDHVTLQAGDRQLLVPTTRQLLAQHNT
FT                   LITGPNGSGKSTLFEALVRLHPYTGEIRYEGTPIDKLKRKRYARHVALLFQDAETQFLN
FT                   ITVAEELAQSKRYAYGDYFTADRIQTALVQLNLSGRDEQVIYTLSEGQKKKLQILLMLI
FT                   MQSPVLLMDEPLKGLDLHSINALVALLQTTQAATKQTLIIISHQLTGLMPLIDYQLHFE
FT                   NHHLDWVVRS"
FT   gene            complement(200449..201018)
FT                   /locus_tag="LPST_C0179"
FT   CDS_pept        complement(200449..201018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0179"
FT                   /product="ABC transporter subunit (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97403"
FT                   /protein_id="ADN97403.1"
FT                   /translation="MKWVKSWYLNDIILLALIGIFFGAIFMGTNFVYNILSAALTPFGL
FT                   SGLANELLLGLWCMPGMLAGYLIRLKGSATLGELLAATVEMFFGGQWGITTLISGVVQG
FT                   FGAELGYIVTGYKHYDWLGLTAAAATTTVVTFGWDLARNGYYKLQLWLLILYVVVRFIS
FT                   MFVFGGLLTKTITDLLDRSHVLKSTH"
FT   gene            201359..201844
FT                   /gene="gpo"
FT                   /locus_tag="LPST_C0180"
FT   CDS_pept        201359..201844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpo"
FT                   /locus_tag="LPST_C0180"
FT                   /product="glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97404"
FT                   /protein_id="ADN97404.1"
FT                   /translation="MAESVYDFTETEMSGAPLDLSQYRGQVLLIVNTASNCGLAPQFKG
FT                   LEELYQKYQQEGLVVLGLPSNQFHQEKADDDETHDYCQRHYGVTFPMTKRVMVNGDDAD
FT                   PLFTYLKQAAGHGRIKWNFTKFLIGRDGRVLERYAPTTRPATFEAAIRDALADRSED"
FT   gene            201895..202725
FT                   /locus_tag="LPST_C0181"
FT   CDS_pept        201895..202725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0181"
FT                   /product="2,5-diketo-D-gluconate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97405"
FT                   /protein_id="ADN97405.1"
FT                   /translation="METYTLRDGLTVPKIGFGTYKLNGAHGVQVIDSAIDRGYRLLDTA
FT                   FNYENEGAVGEAVRRSSVPRSELLISSKLPGRHHTYTEAINTIQESLYRAGLDYYDLYL
FT                   IHWPNPKEDHYVEAWQALIDAQKLGLIRSIGVSNFLPEHLERLNKETGVLPVINQVELH
FT                   PYFNQQAQRDYDQAHGILTQDWSPLGRASEMLQNETLKEIAVHYHKNVGQLILRWELQL
FT                   GTLPIPKSSTPSRQAGNMDVFDFEISAADMATINGLSQVDGRLNNQDPAVYQEF"
FT   gene            complement(203229..203699)
FT                   /gene="greA"
FT                   /locus_tag="LPST_C0182"
FT   CDS_pept        complement(203229..203699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="LPST_C0182"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97406"
FT                   /protein_id="ADN97406.1"
FT                   /translation="MEPTFNKMTATGYHAIEQEIEDLKQQRPERIRILAAAAALGDRSE
FT                   NAEYSSAKRDLGRLESRLRYLNKQLQYAQIVQPADNNQLDIGKFVTIEFLDDHDQITYQ
FT                   LVGKQEANLEQQKISFTSPIGQALANHTVDDVVTVNAPNGAYQVKVIAVKRA"
FT   gene            complement(203785..204198)
FT                   /locus_tag="LPST_C0183"
FT   CDS_pept        complement(203785..204198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0183"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97407"
FT                   /protein_id="ADN97407.1"
FT                   /translation="MKKIRDERLILQNFKNIRTTLLIENSAILLILFWQGWQKNNLQKA
FT                   FTYDNPLYIVLMIAVFTMIILSVNVSTPIEDKPKRSWRYLGLWALIELIGFTALFYFLI
FT                   AINQPFISLIAGIALTTVTSGIMLYSNHLRDRD"
FT   gene            complement(204211..204414)
FT                   /locus_tag="LPST_C0184"
FT   CDS_pept        complement(204211..204414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0184"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97408"
FT                   /protein_id="ADN97408.1"
FT                   /translation="MLTANHVKQYRLMAGFSQKELASKTGITRQTLSLIEKGTYNPSLK
FT                   LCLNLCHVLNQTLDTVFWVEPS"
FT   gene            204794..205507
FT                   /gene="gnp"
FT                   /locus_tag="LPST_C0185"
FT   CDS_pept        204794..205507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnp"
FT                   /locus_tag="LPST_C0185"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97409"
FT                   /protein_id="ADN97409.1"
FT                   /translation="MKVIVVKDQAAGGKEGFKVFKNALDNGAKVFGLATGSTPVTTYKE
FT                   IVNSDLDFSDCTSVNLDEYVGIAPDNDQSYKYFMQTHLFNDKPFKESFLPNGLASDPEA
FT                   EVKRYDKVIDEHPIDLQILGIGRNGHIGFNEPGTPRDITTHVVDLTESTIEANARFFAS
FT                   ENDVPKQAFSMGLASIMKSKHLLLEAFGENKADAVKGMIEGPDTPELPASILQNHPDVT
FT                   VIIDEAAASKLSKKY"
FT   gene            complement(205650..207065)
FT                   /gene="pepD1"
FT                   /locus_tag="LPST_C0186"
FT   CDS_pept        complement(205650..207065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD1"
FT                   /locus_tag="LPST_C0186"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97410"
FT                   /protein_id="ADN97410.1"
FT                   /translation="MKKDTDCTEILVGKAASMDGSTIVARNEDGYGPINPIKFIVHEAH
FT                   DQTNASYTSVTTGVTVPLPDHAYRYTATPQADQSDGQYEEAGINELNVGMSATETTATN
FT                   ARVLGYDPLVHDGVDEEAMVTLVLPYIKSAKEGVQRLGALIEKYGTGESNSIAFNDHDD
FT                   IWLFETAGGHHWGAVRMPEDTYAIVPNQTVVQEMDLNDTDNFLGASDLVDFVEKYHLNP
FT                   TPGHFNFREIFGTQSEADAYYNTPRTWYGQKLFNPEIEQNPTDQNMPLFRQPSKKLAIE
FT                   DVQFFLSSHYNGTPYDPFGTFASGNAREQTRYRSIAMDRNQCSSILQIRNDVPAKQAAI
FT                   QWIALGFFAYAPYVPFFTNINDTPIDYRNTTSTVSVDNVYWLSKTLSVLIEPHWHEFAE
FT                   TVNAYRDGCQSYARGRVAATDAAIAGNPTDFLTKANSETAAEISNRTHALFDTLVKQGL
FT                   LLSKTTWEKGQNL"
FT   gene            207427..209265
FT                   /locus_tag="LPST_C0187"
FT   CDS_pept        207427..209265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0187"
FT                   /product="PTS family porter, enzyme I"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97411"
FT                   /protein_id="ADN97411.1"
FT                   /translation="MSENVNTNATQSAPVAKKKLGVKARVQKFGSALSNMVMPNIGAFI
FT                   AWGLITAIFMAGGWWPNAGLAKMIQPMVHYLLPLLIAFTGGTLFAGHRGGVVGAIATMG
FT                   VIVGSSIPMFIGAMIMGPLGGWCIKKWDDAISDKIKSGFEMLVNNFSAGIIGMLLAILG
FT                   YFAIGPLVAGASAAMAAGVDWIIKMKLLPLANVFIEPAKILFLNNAINQGILTPLGIQA
FT                   ASSAGKSILFLLEPDPGPGLGVLLAFALFGKGTAKASAPSAIIIHFLGGIHEIYFPYVL
FT                   MKPALFLAVIAGGVTGTATFSLLNVGLRSTPSPGSIISLLLMSPKSISNYIGLIIGVTL
FT                   ATLASFIVAAIVLKRDKSTGDDDLAAAQGKMSDMKSGNAEAASATDAEPADVIASYKDV
FT                   DHIIFACDAGMGSSAMGASLLRDKVKKAGISMSVTNTAISNLKDEPGLLVITQNELADR
FT                   AAQKAPHALRLAVDNFLSSPKYDQVVVNLKARDQVSDAAPASAAPQATTAAPDDLPANL
FT                   DLSVVDEIVFVHHDGHLGTATMATSLMKDRVKKANKHVSVKNLGIDELADNNSLLVVSS
FT                   AEAAKNLKTRYTQVQVLITDDLLSSPKYDKMVSELK"
FT   gene            209302..211377
FT                   /gene="mtlR"
FT                   /locus_tag="LPST_C0188"
FT   CDS_pept        209302..211377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlR"
FT                   /locus_tag="LPST_C0188"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97412"
FT                   /protein_id="ADN97412.1"
FT                   /translation="MVKFTQRQDELLQLLLANPAGLSMSQIETGLNSSRRTIYREFSNL
FT                   ELVLANADLKIVNEKHHFQLSGSQTALAKFQSQLTAERKIAPAFDSQTRQNALACRLLM
FT                   TGHSVKLKELALDFDVSVATISNDLTALATPFADYDLSIERLKSRGIQVAGTEGSIRNL
FT                   FATILNNEINDYEFFKTIGKLNQGLAISASDEQSYFLNLLDAQTLIICYQAVRSLKKKY
FT                   FSSVPDGQLQQLIITLTTGVMRLQHERRVTYLRGINRDDFLKYQRIALAIMTQLPAEIK
FT                   TVVTGAEIDFLAQQIKGLTFRIDQDASLSNYDLQLTYRVKKFIDAVATNFNWSFGTDDR
FT                   LLNNLTAHMQIALQRNGVNGPVPPTAELQEVREQYPKLYSAVVRGFATIFKDQDFTTDE
FT                   LTYLLIHFASTYEQQLSHQALKVLVLCPNGMTTARILKTRLMRLVPEITAIEVARIGNL
FT                   GQVNLQDFDMILSTTTLPGFKLNYRVVSPLLLENEVTALREYIHQYFPSTKVIDSPVDE
FT                   PTKINLDFDTVYQQMTIAKQILDRFTITPIRNDDETVAEMLVKITRHIDSNLIHDPLEV
FT                   AGRLLHRLGLAPVGIPNTNLALVHTLSQEVTAPYCAIFELDQPLPFKSMDNQSIRLQRI
FT                   VLMLGPANISDFENRLMGKLSALVIESQANTQTFMTGDRQQLYQLISKAFLNELTK"
FT   gene            211392..211841
FT                   /gene="pts2A"
FT                   /locus_tag="LPST_C0189"
FT   CDS_pept        211392..211841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts2A"
FT                   /locus_tag="LPST_C0189"
FT                   /product="mannitol PTS, EIIA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97413"
FT                   /protein_id="ADN97413.1"
FT                   /translation="MEALDKKMIALNQQVATQEEGIRLAGQLLVDGGCVEPEYIDAMQA
FT                   RNQDVSVYMGNFIAIPHGTEDGMKYIKKTGISVVQVPMGVSWGNPDDNDDDKTVTVIFG
FT                   IAGLNGEHLNLLSQIAIYCSDVANVAKLADAQSEDEIINLLKEVD"
FT   gene            211843..213000
FT                   /gene="mtlD"
FT                   /locus_tag="LPST_C0190"
FT   CDS_pept        211843..213000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="LPST_C0190"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97414"
FT                   /protein_id="ADN97414.1"
FT                   /translation="MLDVHFGAGNIGRGFIGETLADNGFKITFVDVNDTLIDELNKRNG
FT                   YTIELAAEGQKHIEVHDVKGINNGKDPKAVAEEIAQADMVTTAIGPKILKFIAPLIADG
FT                   LKLRQANNNTTPIDIIACENMIGGSQSLKKSVYESLNEDEQAWADQNAGFPNAAVDRIV
FT                   PLQKHDDPLFVSVEPFKEWVIDKSQMKNPKIQLKGVDYADDLEPYIERKLFSVNTGHAT
FT                   VAYTGNMKGYKTIGEAVKDDSVVDQAKHVLGETGDLLIQKWGFDPEVHHAYQKKILSRF
FT                   ENPYISDDIERVGRTPIRKLGFNERFIRPIRELKERGRDYSALVDTVGEMFFFNYPNDS
FT                   ESVKLQQLLKDEPIEQVIRETTDLKDEDLVNEIKAAYEKHLAAAK"
FT   gene            complement(213255..213806)
FT                   /locus_tag="LPST_C0191"
FT   CDS_pept        complement(213255..213806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97415"
FT                   /protein_id="ADN97415.1"
FT                   /translation="MSTQTISPEQDSELVASVAAEQLGIKAVTLRKYSTMVEKQLNDEN
FT                   RFRPADNSHRLYTAADLKTFQAAIELAEQGTTLATALGRAFGAKVPTSKQPAATTTQSE
FT                   KSAPATTTKSPLITTTTVDPSKMAPAAKPDGPTNAELYKQQEMIIRRLDSLSDRLNQVL
FT                   DQLDQQASQAAKPWWHFWEK"
FT   gene            213987..214319
FT                   /gene="trxA1"
FT                   /locus_tag="LPST_C0192"
FT   CDS_pept        213987..214319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA1"
FT                   /locus_tag="LPST_C0192"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97416"
FT                   /protein_id="ADN97416.1"
FT                   /translation="MIEPVDKTTFATVADGTALTVVDFWADWCGPCKMQEPVLEALDEL
FT                   YDGQVKFASLDVDQHQKIAQQFEIMSIPALVIFKNGQPAEKVVGFHPQAALKKYLDQKL
FT                   AEVKPA"
FT   gene            complement(214413..214739)
FT                   /locus_tag="LPST_C0193"
FT   CDS_pept        complement(214413..214739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0193"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97417"
FT                   /protein_id="ADN97417.1"
FT                   /translation="MNSFKNPLMTTPYLLAIIATLTMLVSPLTTVVISVLIWLSGITLV
FT                   WLHRQQRWLRFFYAPVFLYTFLLEQRYFSPSTQPLTETILINLAILGIAIFSTWAAYQL
FT                   RHNA"
FT   gene            215030..215584
FT                   /locus_tag="LPST_C0194"
FT   CDS_pept        215030..215584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97418"
FT                   /protein_id="ADN97418.1"
FT                   /translation="MKKLIWALRVGIVLFGACLVWEQVQLERHTSQRRTYHQRRLQRST
FT                   AATFKAIRQPQLSDFPAAKVEAAQVWLHLKGTRVINEATPLHIRKIAAGQRIQPDDPHS
FT                   AVYHHQMTQIYSDDLQDATNSVIYARNADNTVLVAHSRSGQRSQVGPVAQNVHTAMPAV
FT                   QKMKIPAKPSATLLKVVQLII"
FT   gene            complement(215649..216050)
FT                   /locus_tag="LPST_C0195"
FT   CDS_pept        complement(215649..216050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97419"
FT                   /protein_id="ADN97419.1"
FT                   /translation="MNIVVGPYVRRPRAVKSDPRNTSKFSMFNSLRRIDECLVLIKRTG
FT                   TPGLIDSTATLGLNLTHLMGLNVIVTSRGRSFTIIVQGRQRSFTLTGCLIEDTLYNAVH
FT                   PAQPDYLISLNRQLITNSDDLIEQLYDHY"
FT   gene            complement(216292..216756)
FT                   /gene="ndk"
FT                   /locus_tag="LPST_C0196"
FT   CDS_pept        complement(216292..216756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="LPST_C0196"
FT                   /product="nucleoside-diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97420"
FT                   /protein_id="ADN97420.1"
FT                   /translation="MANSEKTLVLVKPDGVSEGHIGEVITRLERKGYQIAALKVIKATA
FT                   EQLQQHYSEKVGKPYFKEIETYMMEGPLVAIIVSGTGVVKAVHRLAGSTRPAEAQPGTI
FT                   RGDFSHEYPDGILRNIIHTSDSRENAHHEIAIWFPELAVKARKADNKVKA"
FT   gene            216991..218337
FT                   /locus_tag="LPST_C0197"
FT   CDS_pept        216991..218337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97421"
FT                   /protein_id="ADN97421.1"
FT                   /translation="MPPLDLTHIRQHHTVAELIALGKARRQVTPFEKLGTFTPVKRNAS
FT                   DYLKHVREMLVPELLPLRRERMSASAFAFFRGSVELMDYDLDYQSSTEIPAVVCGDAHI
FT                   GNFGFYASPERRLVFDLNDFDEAGVHPWEWDLRRLLVSVLLAARDSNFKPKKVEKLIQA
FT                   ASASYREALKRMFDQTTLDRFYRDNEVQAVLNFGGAPEDTADLIASLVKKAQKRNSEQV
FT                   VRKFTVTNSRGERQFKENAPRSVHIDRQTYQGLKAGISEYLLNVRTDVALLLSQYEVTD
FT                   IIRHSVGVGSFGSLCYLVLLTSTDGSHMVLQIKEALPTRKVGSQSRPALTAAMELTEGQ
FT                   RIVSSQRILQATSDAFLGYFQMENKSFYVRQFRDMKESIDIPTLDWGQFQAYANTCAMI
FT                   LAKAHAQSPTAAMIRGYVGNSAKFDEAMAKWATAYVEQVDNDYQDFLDV"
FT   gene            218530..219186
FT                   /locus_tag="LPST_C0198"
FT   CDS_pept        218530..219186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0198"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97422"
FT                   /protein_id="ADN97422.1"
FT                   /translation="MILKIDRLKWLHFFNNLIYLLLVSETKKLVLKGLFDMTKYGVIVG
FT                   SIRKNSYSKGVAEAIVAGLPDDAEVTYLNIAKLPLYNQDYDADSPVEYTEFRQAVAAQD
FT                   AFIFVTPEHNRSIPAALKNALDVASRPWGQSVWGGKPALVASQSISGISGVLAHHVLRQ
FT                   SLVFLDMPTMQQPELYIGNTDKLADENGHITNEGTQSFLAGAGKQFSEFAAKFIG"
FT   gene            219464..220159
FT                   /locus_tag="LPST_C0199"
FT   CDS_pept        219464..220159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0199"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97423"
FT                   /protein_id="ADN97423.1"
FT                   /translation="MGTKILYQKVAADLKRRILDGDYEVGGLIPSEGELERYYQVSKIT
FT                   IRKAVEVLVSEGYLEKKSGIGTRVISNDLFNKLTQTQSFTATVGQQGKLTKELIKIERV
FT                   PAVPALLPSESQGTMLRIKRRYLLDGKPFAVVDHYLPNTLVPTKLTALRHRSLYKILQE
FT                   NGQTITHFQDKFRAVTLADSERALLESQTPLAIRRERKGYDGHQRLVEFSIATYQTDVV
FT                   PYQINYDVL"
FT   gene            220737..222014
FT                   /gene="pts3C"
FT                   /locus_tag="LPST_C0200"
FT   CDS_pept        220737..222014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts3C"
FT                   /locus_tag="LPST_C0200"
FT                   /product="cellobiose PTS, EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97424"
FT                   /protein_id="ADN97424.1"
FT                   /translation="MDNFINMLNAKVLPVANKVGTQRHMTAIRKGIISTLPLTIVGSFF
FT                   TILNNMPIEAVANFLAPYAEILDVPFRYTVGILALYATFGIASSLAESYQLDKLTNGVL
FT                   AVLAFLVSTAVPVHVTKNVSGVISSGRYINIANLSASSLFGSIITGLLTVEIFRYLKNR
FT                   NITIKMPEGVPPEVSNSFVALVPAAVILVLFWGIRYLLDFNISSFLSTLLMPLKGVLVG
FT                   NSLFGGLLTIFLITGFWTLGIHGAAIMDPVIRPFWEMSIAQNMSEFTSGTSAHNLSTIF
FT                   TEQFLQWFIWIGGAGGTLALVVLFMFSKSTYLRDLGKLSLLPGLFNINEPIIFGAPIVM
FT                   NPILGIPFIIGPLITGSLAYVLTITGVVPMMMARLPFTVPGPLGAFISTNWSVPALILS
FT                   CVNFVIDLVIYYPFFKVFEKQQLSKE"
FT   gene            222024..222290
FT                   /locus_tag="LPST_C0201"
FT   CDS_pept        222024..222290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97425"
FT                   /protein_id="ADN97425.1"
FT                   /translation="MFGILILAAFVIGSEWLVSRGVMPAYLIKARTGQTLWRALLSILV
FT                   TVGLVGWLHLPAVIAIVVTIYFATIIANRYLQVFEAMERGKRG"
FT   gene            222287..223381
FT                   /locus_tag="LPST_C0202"
FT   CDS_pept        222287..223381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97426"
FT                   /protein_id="ADN97426.1"
FT                   /translation="MTKRTLGISLYPDHSVFERDQAYLKVAASYGFTRLFVSMLEVQDG
FT                   KERVTEKYQRIIQSAHQLGFTTTLDVSPNIFDQLGVSYQDLSYFASLGADAIRLDAGFD
FT                   GHQEAWLSYNSQGLNLELNMSNDVEYLSNILSYSANRPFLYGCHNFYPQRGTGLPFDFF
FT                   VACSRRFKRAGIETAAFVTAPGATIGPWDINDGLPTLEMHRDWPLQVQVQHLFSTGLID
FT                   SVLIGNAYAKPEDLQKLGALNRYQITFAVTPSADIQPVERQILLDNLHERRGDINDITI
FT                   RSTEVRKRYHDFNRVNDDRHTFQRGDVVIGNEQFGKYQHELQIVQQPHTDTRKNLVATI
FT                   NPDQLVLLDAIGPWAKFSFEVAHD"
FT   gene            223374..224492
FT                   /locus_tag="LPST_C0203"
FT   CDS_pept        223374..224492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0203"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97427"
FT                   /protein_id="ADN97427.1"
FT                   /translation="MTELYIHNGRDVSGAPVAVLITDGVIAEVGTELTVPVGCPTLDAQ
FT                   GCYITAGWIDDHTHCNAHAALYYDDADAIGYRTGVTTVIDAGSTGADNVADLYQQAHRA
FT                   ATNVYALLNIARTGIVAQDELADLNQLSFSALRTAIQRYPDFIVGLKVRVSKSVVGDNG
FT                   VEPLRVAKQYQADLTAQLPLMVHIGSNPPELAAIIALMRPGDVLTHCFNGKPNGIVNST
FT                   GEVAQYVRKAYQKGLIFDVGHGTDSFSFRTAALARTAHLFPQTLSSDIYYRNRLNGPVY
FT                   SLAVCVEKLLLLGYRLEEIIPMITTNPARIFKLTHKGQLCRGYDADLTIFQTVTAPQIV
FT                   VDSTGEERIAPTQVIPTYSVIAGRVYTCGVDK"
FT   gene            224562..225662
FT                   /gene="selA"
FT                   /locus_tag="LPST_C0204"
FT   CDS_pept        224562..225662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="LPST_C0204"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97428"
FT                   /protein_id="ADN97428.1"
FT                   /translation="MDIYEKYGLKPVINADGKMTILGVSQVSDQVAAAQKQGAQNFFEM
FT                   AELTVQTGRYLADLIGSEDALIVNSASAGIAQVLAGIIGRGNAYHVTHPYTTQITQREV
FT                   IMPLGHDVDYGAPVDVMLAVAGAQPVLAGYANRCTAEQLAMQITPQTVAILYIKSHHTV
FT                   QKSMLTIADALQVAHDHHLPLVLDAAAEGDLRRYLQLGVDVVIYSGAKAISGPASGLVL
FT                   GRQTYVEWARQQNYGIGRAMKIGKENILGLVAAVEQYLTTGPESGASMKARLAPFIAEL
FT                   QTLPNVQVEMVQDGAGRDIFRASVRIAEAAKICQALRQGRPAIYPREYRVNEGLIEFDI
FT                   RALTSAEMTQIVERLRTIIEEESTCN"
FT   gene            225653..226387
FT                   /locus_tag="LPST_C0205"
FT   CDS_pept        225653..226387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97429"
FT                   /protein_id="ADN97429.1"
FT                   /translation="MQLTPNYLPNGICLNVLANSVTNAEACYAAAEGHVVLGVLTKNYL
FT                   SDESAITDMRRYQAAVNNAVSVGLGAGSPQQSAMVARVAAEIQPQHVNQVFTGVATSRA
FT                   LLGQADTVINGLVAPSGEVGLVNVATGPLSSQSAKANIPVATAITMLKDMGGTSLKYFP
FT                   MQGTAHLEEFKAVAAACADNEFGLEPTGGLDLTNFQQIVQIAVAAGVRQIIPHVYSSII
FT                   DATTGETQPEAVAQLLTIMKQF"
FT   gene            226401..227423
FT                   /gene="kdgK"
FT                   /locus_tag="LPST_C0206"
FT   CDS_pept        226401..227423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK"
FT                   /locus_tag="LPST_C0206"
FT                   /product="2-keto-3-deoxygluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97430"
FT                   /protein_id="ADN97430.1"
FT                   /translation="MKILAFGEVLLRMTVPEHLMLTQTDELRMSTVGTGVNLLSSLTHF
FT                   GYRTRLLSRLPDNALGQRAAGELRRYGIQDDYVTFGGQHMGAYFVELGYGSRPERVTYQ
FT                   DRLSSAFCQQPPDDQEIAAALVGCQFVHICGITLSLTAPVRQAALRLAQQAHANGQRVC
FT                   FDFNYRQQLNTGVAHETLKARYQEILPYVDIVFGSKRDLTALLDYPDDEDRTQSANRES
FT                   EAALYEQFVRDYHIDYFAGSYRYQIGQQKWFAGFSYQHQQLVVGKARPLMILDRIGSGD
FT                   AFASGIITGLIEGWSLQKTTDFAIATAILAQATVNDAPEFTKEMVLADMASDGQLELIR
FT                   "
FT   gene            complement(227587..228129)
FT                   /gene="cysE"
FT                   /locus_tag="LPST_C0207"
FT   CDS_pept        complement(227587..228129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="LPST_C0207"
FT                   /product="serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97431"
FT                   /protein_id="ADN97431.1"
FT                   /translation="MFQTARAILNRDPAAINLRTVMLTYPGIHALAWYRVAHYFETHRL
FT                   PLLAALLSQHAARRTGILIHPAAQIGHRVFFDHGIGTVIGATAVIEDDVTILHGVTLGA
FT                   RKTEQAGRRHPYVCRGAFIGAHAQLLGPITIGANSKIGAGAIVLDSVPTHVTAVGNPAH
FT                   LVATQLHAYHEATSNQA"
FT   gene            complement(228134..229279)
FT                   /gene="metC1"
FT                   /locus_tag="LPST_C0208"
FT   CDS_pept        complement(228134..229279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC1"
FT                   /locus_tag="LPST_C0208"
FT                   /product="cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97432"
FT                   /protein_id="ADN97432.1"
FT                   /translation="MKFETQLIHGGISEDATTGATSVPIYMASTFRQTKIGQNQYEYSR
FT                   TGNPTRAAVEALIATLEHGSAGFAFASGSAAINTVFSLFSAGDHIIVGNDVYGGTFRLI
FT                   DAVLKHFGMTFTAVDTRDLAAVEAAITPTTKAIYLETPTNPLLHITDIAAIAKLAQAHD
FT                   LLSIIDNTFASPYVQKPLDLGVDIVLHSASKYLGGHSDVIGGLVVTKTPALGEKIGYLQ
FT                   NAIGSILAPQESWLLQRGMKTLALRMQAHLNNAAKIFTYLKSHPAVAKIYYPGDPDNPD
FT                   FSIAKQQMNGFGAMISFELQPGMNPQTFVEHLQVITLAESLGALESLIEIPALMTHGAI
FT                   PRTIRLQNGIKDELIRLSVGVEASDDLLADLERGFASIQAD"
FT   gene            complement(229291..230202)
FT                   /gene="cysK"
FT                   /locus_tag="LPST_C0209"
FT   CDS_pept        complement(229291..230202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="LPST_C0209"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97433"
FT                   /protein_id="ADN97433.1"
FT                   /translation="MLIQHVQELIGHTPLMALPIEVPNHSHIYAKLEMFNPGGSIKDRL
FT                   GAYLIEDGLQRGRVNAKTTIIEPTAGNTGIGLALATQAHHLRTILVVPEKFSMEKQVLM
FT                   QALGAEIVHTPSEEGIKGAIRKAEALAATISNSYVPMQFKNPANPAAYYHTLAPEILAD
FT                   MPAPITAFVAGAGSGGTFAGVAAYLQAQDSATKAVVVEPEGSILNGGPAHAHRTEGIGV
FT                   EFIPPFFDQVRIDQTLTIADNDAFAQVRHLARDHGLLIGSSSGAALAASLQLATNLPAN
FT                   SHIVTIFPDSSERYLSQKIYTK"
FT   gene            complement(230815..231606)
FT                   /gene="pepM"
FT                   /locus_tag="LPST_C0210"
FT   CDS_pept        complement(230815..231606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepM"
FT                   /locus_tag="LPST_C0210"
FT                   /product="methionyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97434"
FT                   /protein_id="ADN97434.1"
FT                   /translation="MITLKSDREIKGMQAAGDIMVGLFHALEDYIKPGITTWDVDHFAY
FT                   EYIVAHDATPGELNFEGYKYSTCVSVNDMICHGCPSKDILVKDGDLLKVDTVINYHGYL
FT                   SDSCHAFVAGTPSPEVKKLMEVTHKALYLGIDQAVVGNRIGDIGWAIQNYAENEMGYGV
FT                   VREYIGHGIGPTMHEKPDVPHYGEAGHGTRLKAGMTITIEPMVNIGDWRSGETADDGWT
FT                   VRTLDGSLSCQYEHTLVVTDDGPKILSSFDNDFDAKYLWNK"
FT   gene            complement(231642..231935)
FT                   /locus_tag="LPST_C0211"
FT   CDS_pept        complement(231642..231935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97435"
FT                   /protein_id="ADN97435.1"
FT                   /translation="MSSWPTSHVTLLHVVFPFKTTQYIVSLSWPMKRVKFQIYIELFTI
FT                   NPTAPRQFGIFGVLIFLYFFDFGLLIALSISGQNNAFCRNTMLAVYWRGTNF"
FT   gene            231968..232756
FT                   /locus_tag="LPST_C0212"
FT   CDS_pept        231968..232756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0212"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97436"
FT                   /protein_id="ADN97436.1"
FT                   /translation="MILSNYFKFLSHQLKGWPQQNYYLFYFSLGCQVMTLVSAPITALS
FT                   ILTFIGTTLGVLCVLAINAAKSVNGLLGVISAACFIVVGFSAKNYLSIGEQLAYVVTLD
FT                   IPVLLSANWNVNMVSKIRKFTGKTWIVAIVATLVVYAISGYLIGALTDDPRPWVDAISF
FT                   AICLTAGVICFLRYNNQYFWWIASGLAQMVLWFISFRQGSATLAMFINSSVYLMNDVLA
FT                   FTVSPWYNKHERARLMAEEQAASDAASADASDNQAFGLNH"
FT   gene            232955..233233
FT                   /locus_tag="LPST_C0213"
FT   CDS_pept        232955..233233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97437"
FT                   /protein_id="ADN97437.1"
FT                   /translation="MDWFVNLEREDQEFVKQLVIASGSLKQLAKIYQVSYPTVRMRLNT
FT                   IIQKINFIEDNGANTFETKVMKLVIDEKLSLEVAKQIITDFREEQHE"
FT   gene            233226..233513
FT                   /locus_tag="LPST_C0214"
FT   CDS_pept        233226..233513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0214"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97438"
FT                   /protein_id="ADN97438.1"
FT                   /translation="MSDFKGILIGMLVVAVLYMLDRYLPRWFGAIPGAGFLGFIIYIVF
FT                   TKEVSLLSIVTVLLVGEAVLNGIWIDALVNRKRKMKKEVATMKAKDLLRK"
FT   gene            233829..234548
FT                   /gene="treR"
FT                   /locus_tag="LPST_C0215"
FT   CDS_pept        233829..234548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="LPST_C0215"
FT                   /product="trehalose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97439"
FT                   /protein_id="ADN97439.1"
FT                   /translation="MNKAALVYQDLLQKIDAEVYPIGSYLPSEHQLCELYGISRETGRK
FT                   ALATLAEDGYIQKIRGKGSIVIEHRQYEFPVSGIVSYKELAEKLHIKTQNIVYDYQPDA
FT                   TLPVADFTSLGTELTEAPVTAIKRVRVIDGEPAIIDKDYILKSIVPKVPKQAAEDSLYA
FT                   YFENQLGLTIGYATKEITMAPATDEDREHLAISKGAYVAVVRSVTSLTDARAFQYTESR
FT                   HRADRFSFRDFARRTKK"
FT   gene            234573..236216
FT                   /gene="treA"
FT                   /locus_tag="LPST_C0216"
FT   CDS_pept        234573..236216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treA"
FT                   /locus_tag="LPST_C0216"
FT                   /product="alpha, alpha-phosphotrehalase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97440"
FT                   /protein_id="ADN97440.1"
FT                   /translation="MKLSEQVIYQIYPKSFYDSNGDGVGDLRGVIEKIDYLKKLNIDMI
FT                   WFNPFFVSPQNDNGYDIADYYHIDPMFGTMADFEELVAKLKANGIGVMLDMVLNHTSTE
FT                   HEWFQKALAGDEKYQKFYYLRPPKADGSLPTNWESKFGGPAWAPFGDTGLYYLHLYDPT
FT                   QADLDWHNPAVRQACAAVVNFWRQKGVQGFRFDVINVTGKAEKLVDAPKGVPSKTLYTD
FT                   TPVVHDYLKELNAASFGQDVDSVTVGEMSSTTVANSVGYTNPANHELSMVFNFHHLKTD
FT                   YVDGRKWSRMAFDFPRLKQLLDSWAGGMAAGGGWQALFWNNHDQPRALNRFGDAGRYRV
FT                   KSAEMLATVIHLLRGTPFIYMGEELGMTDPDYDNMADYVDIEALNAYRALIRSGYSHHD
FT                   AFTIVKTKARDNSRTPMQWDDSAKAGFTTGKPWLTPTNQATINVAHELASGEIFDYYQR
FT                   LIKLRKTMPIVADGGYQSWRLDDPQVFGYWRTYHQQKLLVLNNFYGQSTMVTLPEEMVG
FT                   AQVLLSNYQDVNVTAQLTMQPYQAVALLLG"
FT   gene            236227..238230
FT                   /locus_tag="LPST_C0217"
FT   CDS_pept        236227..238230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0217"
FT                   /product="beta-glucosides PTS, EIIABC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97441"
FT                   /protein_id="ADN97441.1"
FT                   /translation="MGMAKAQTVTILSPVNGDVIALNKVKDPVFSAGMMGLGFGVQPSS
FT                   GEVVAPVSGQVTMVAETKHAIGFTTPDDHLEVLVHLGIDTVDLKGAPFTVKVAAGDDVQ
FT                   AGDVIATMDLAAIQAANRQTTVILAVTNTSDKLESLDVVTGAKAAGDVTATGRLNANTF
FT                   NAKRQNRLPKAGKYDQLAADIVANVGGVENVSSLIHCITRLRFYLKDESKANDDVVRDL
FT                   KGVIDVAKAGGQYQVVIGPAVTDVYDAIIKQIGPGFSNDSETAKAVAETAAAAQRPTTP
FT                   WGKVKWGISNLIGVITGSMIPVIGLLAASGILKGILALLTTFNLVSPTAPTYVIINAMG
FT                   DSVFYFLPIFVGFTAGKKLGADPVIMGIIGGVLTYPAIVTMASGKATSTLLGMGINANF
FT                   FGLPVHVASYTYSIFPMIAGAWLASKLEPWLKRVIPTVLRMIFVPLFEVVIVSGAILLF
FT                   LGPIITVLSTGLANIIVWVYNLSPAISGLIIGGFYQVLVIFGLHWAVIPIVANDIATTG
FT                   HSYLNAIVSATMVAQGGAVFAIALKSKLANIQELAWPATISAFCGVTEPAMYGINLKYG
FT                   RAFVTASIGAAVGGFLTGLMNVNMWGFTGSLIGFTSFVNPKGLDFSFYGFLIASAATIV
FT                   VSFALTWMFGFKDEDANAVKVAPKKRHLGATA"
FT   gene            238450..240420
FT                   /locus_tag="LPST_C0218"
FT   CDS_pept        238450..240420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0218"
FT                   /product="beta-glucosides PTS, EIIABC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97442"
FT                   /protein_id="ADN97442.1"
FT                   /translation="MTIMGKIDEVSILAPVTGQVLSLATVPDPVFAAGRVGPGFGVQPT
FT                   AGHILAPVSGRITVVTTTKHAIGMVTTTGLEVLVHLGVDTVALNGAPFEVHVKVGDEVT
FT                   AGTLLVDMDLAAIEQAHKPTTVIIVVTNAQRVLTDLTLAPLPQAVAAGAVVATAHLITV
FT                   TTTASPVVAAVPQSTTRYSALATAIVANVGGQQNINSVIHCITRLRFYLKDEALAHDAV
FT                   IANLDGVIDVAKAGGQYQVVIGPAVNDVFDAVIAQLGPEFADGVPVPPVQEASSDVNWL
FT                   SHVRNGISGVIGVMTAAMIPVIGILAGSGILKGILAALTGFKVLAVTSGTYMVLNAVAD
FT                   ATFYFLPVVLGFTAAKKLGSDPIVLAIVGAILIYPSLITAASKGATSQITFLGVPTHLM
FT                   SYSASVFPMIVAAWLGVYVERGLKRVVPLYLRSVFIPIIEALILAIVVLVVVGPLITII
FT                   SKGLANGLVAVYNFSPALSGLVIGGLYQTMVIFGLHWGIIPIVINDIATNGHSYLNAIL
FT                   SITMVAQGGAVLAVFLKSKDKHLKEISLAAAISAFCGVTEPALYGVNLKYKRVFVVASI
FT                   ASGLGGLLTGLLRVNNYALSGSLIGFPAFITPGVGIGSNFYGYLISHYGTLVIATMLVY
FT                   VFGFSDKLLGPKENLKATNSQ"
FT   gene            complement(240462..241244)
FT                   /locus_tag="LPST_C0219"
FT   CDS_pept        complement(240462..241244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97443"
FT                   /protein_id="ADN97443.1"
FT                   /translation="MAKRRITHDPHQFVNTATDRRRLQLAVQLALPTCAHVLARNFARS
FT                   SASSYWLLMLKTPGTAAPRFLTLRIADHLLWLTNHDQLTISWEAGNFDAVQRTLRQELT
FT                   PATLQQYSYQLTTTDIMTLRLILHLEQHQLIWLVQLAPEIAKAYKNQHFDLRDDFGQAK
FT                   LLLGNMNNSSLQLVPVKQPAFQNHLGQYFGRNLLFSQFTSHHLLRLLPTNQWIRPLLKV
FT                   LPPTPNLEQQLAVLYGTDFVRIYVEAIRQQARLQAISS"
FT   gene            241491..242054
FT                   /gene="vdcB"
FT                   /locus_tag="LPST_C0220"
FT   CDS_pept        241491..242054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vdcB"
FT                   /locus_tag="LPST_C0220"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97444"
FT                   /protein_id="ADN97444.1"
FT                   /translation="MKRIVVGITGASGTIYAVDLLEKLHQRPDVEVHLVMSAWAKKNLE
FT                   LETDYSLAQLTALADATYRANDQGAAIASGSFLNDGMVIVPASMKTVAGIAYGFGDNLI
FT                   SRAADVTIKEQRKLVIVPRETPLSVIHLENLTKLAKLGAQIIPPIPAFYNHPQSIQDLV
FT                   NHQTMKILDAFHIHNETDRRWEGD"
FT   gene            242057..242467
FT                   /locus_tag="LPST_C0221"
FT   CDS_pept        242057..242467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97445"
FT                   /protein_id="ADN97445.1"
FT                   /translation="MATFTTEQAGYQMQATLQVIGYDLLIVVTGGTNPHIGDVTILTAS
FT                   TVPETVKFPSHDGRFHKDNFISERMAKRIQRYLAGSCTITAGIHVNQITKAQIAAAAPM
FT                   TDDLSRQIISWLQAHPVQAEKPEYYGQDEQPR"
FT   gene            complement(242758..243198)
FT                   /locus_tag="LPST_C0222"
FT   CDS_pept        complement(242758..243198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0222"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97446"
FT                   /protein_id="ADN97446.1"
FT                   /translation="MRVSTRFSDSIHLLAYIKIYADTKLTSDAIARSIETSPVVVRRLM
FT                   SKLRQAGLITTTPGTAQPALAKPLSQISLLSVFYAIEGDKPLLAVDPKTNPDCIVGGNI
FT                   QTVLKQYYQDAQTAAEARLAKTSLQDVVDNILVEQAKKDAHK"
FT   gene            243383..244072
FT                   /locus_tag="LPST_C0223"
FT   CDS_pept        243383..244072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0223"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97447"
FT                   /protein_id="ADN97447.1"
FT                   /translation="MSEIETIQAYYAASLGKDGRITRTQRQILAAALDLFAEKGYEEVG
FT                   TREIAERAGVAEGTLFHNFVNKNGILDAIMQPIVQNILPTMLNTLDQAVLDSPNQTLQA
FT                   FVVALVRDRVAFVTRNRASLAVILSQFFNNAQDRAAVLGMVSPSILAQANEAMDRLKAA
FT                   RELVDWPNRMILQLVFSTIGGYLVEQVLYPQLDDLSDEQLIHYLSDFLVNGLSPRRIPL
FT                   QDDNTAS"
FT   gene            244243..245637
FT                   /gene="mntH1"
FT                   /locus_tag="LPST_C0224"
FT   CDS_pept        244243..245637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH1"
FT                   /locus_tag="LPST_C0224"
FT                   /product="manganese transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97448"
FT                   /protein_id="ADN97448.1"
FT                   /translation="MKSAKTKDHAKMKAAEEKAIHSTGADSKSLDEVNGSVRVPKDASF
FT                   WRTLIAYTGPGALVAVGYMDPGNWITSIAGGSQYKYALLSVILLSSLIAMLLQAMAARL
FT                   GIVTGKDLAQLTRERTSKGMGIFLWIITELAIMATDVAEIIGSGIALKLLFGFPLIVGI
FT                   LITTADVLILLLLMKLGFRKIEAIVATLVAVILFVFLYEVIISQPNIPEMLKGYVPTSR
FT                   IVSNRSMLFLALGIVGATVMPHNLYLGSSISQTRQVDRSDEKEVAKAVKFTTIDSNIQL
FT                   SVAFVVNSLLLILGAALFFGTKGDLGRFVDLYNALGDSKVVGSIASPLLSMLFAIALLS
FT                   SGQSSTITGTLSGQIIMEGFIRLKMPLWAQRLLTRLISVTPVLAFAIYYHGNEAKIEDL
FT                   LTMSQVFLSIALPFAMIPLVMFTSNRALMGNFTNRVWVKWTAWIVTVILIILNIYLILQ
FT                   TVGLVK"
FT   gene            complement(245761..246408)
FT                   /locus_tag="LPST_C0225"
FT   CDS_pept        complement(245761..246408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97449"
FT                   /protein_id="ADN97449.1"
FT                   /translation="MSQLTKAITRQLQRQYAEPVLKDLNGNWYTGADVLEDLALCETSL
FT                   QQQNVHAGQAILLSPAQVVTIPGLLLASWQLGLTVTLTPPSRQLPELAPQIYAAMVYSP
FT                   RQTNQLATKLDPHEISVLTLILNTAPNFAYLVHDHAQPLTRRSQPDLILPASQLQFTQS
FT                   QLLKMAEHGQTSAHVHDLYNLETGLLPCLTDLITATPFTIIPTKQDWPSKVS"
FT   gene            complement(246464..246769)
FT                   /locus_tag="LPST_C0226"
FT   CDS_pept        complement(246464..246769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0226"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97450"
FT                   /protein_id="ADN97450.1"
FT                   /translation="MKNTFKKLTLTLMAAGTLFATSVSASADTTTTNPEVTSTTLVNKV
FT                   TRDTKLATGATTSQPKHDLTPQPTKLVVKSTQNQVLATIDASSQSITKMKYLTNAK"
FT   gene            complement(246810..247061)
FT                   /locus_tag="LPST_C0227"
FT   CDS_pept        complement(246810..247061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97451"
FT                   /protein_id="ADN97451.1"
FT                   /translation="MLLDTDPKIKNITAVQLVKVTYPLVIAKTEEGEFVKVKLSDEQLQ
FT                   DPLFWDTLKNIRRSQLWVPLGRHFHQLLSNDWLMPAAQ"
FT   gene            complement(247362..248762)
FT                   /locus_tag="LPST_C0228"
FT   CDS_pept        complement(247362..248762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0228"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97452"
FT                   /protein_id="ADN97452.1"
FT                   /translation="MKTTTRSWLAMIVIGIFTIMANLDASIINIALPIMSKSLAVPISQ
FT                   ITYTVMGYMVILSGLLVTFGKLGDIWGKGRIFTLGMYSFTIGSLMASVNFGFEFLLLAR
FT                   FVQAVGAAATLSNSYGLISELFDNHTRGTAMGINTMFISAGFVAGPALGGFLLQQFAWN
FT                   AIFMINIPLGIIAIILGHLFLPKNHGRQQATKLDGWGAGILFIIITLFFVVLEAGQTIG
FT                   FRQPLIIIGFIITLALTLYFIYLEKHRKNALLPLSIFKNRTFSLALLVGMLIPLINALF
FT                   SFIFPLYLQDYLNWSVGTTGILMLIFPLIMAIAAPLGGWLSDLFSQQLVLLTGLVLIII
FT                   TQIGFLFLDSHTSLTLIISLLISNGIGTGFFIAPNNTLLMSVVPQNQLGVAGSLQSLGN
FT                   NIGNILGVALGSLALFTTMSIDAGYRVSTYLPAHPAWFAHGLTWSFSVSLICALLGFAI
FT                   SIINRPAH"
FT   gene            248854..249246
FT                   /locus_tag="LPST_C0229"
FT   CDS_pept        248854..249246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0229"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97453"
FT                   /protein_id="ADN97453.1"
FT                   /translation="MFTITATAQKYGVSNNALRYYESVGLIGPIKRDQNGIRQFSASDQ
FT                   EMVNRIVHLRQLGASIKEIQQYSFRPEEVTLERTVALKKFLLRLNGDLEAQEAQIKIEK
FT                   QYLKAKIEHLDGDILSMKSHKTTQMG"
FT   gene            complement(249398..250774)
FT                   /gene="hpk2"
FT                   /locus_tag="LPST_C0230"
FT   CDS_pept        complement(249398..250774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpk2"
FT                   /locus_tag="LPST_C0230"
FT                   /product="histidine protein kinase; sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97454"
FT                   /protein_id="ADN97454.1"
FT                   /translation="MPKNNTTPTYEQLINKAIRRLMLTITLLVSLITLLMVGTQQTINT
FT                   TREARDLMSSLNQANIKDVPSFIQWNNTTTRNTKQPAFIRVTTKKATLTTATKTKRTII
FT                   TTPSSKSFFTKQQTKLVGPLVYVRGFGFFLSYSEKDGHNTYQLWVSLRRLFNSLLILIL
FT                   LMLAVTCAALALGTWWAHRLALRLSDPTIKLLHATKYTSNNPDSDQPTLDVPASPREIN
FT                   DLGRAFNELLVTQNQRLQHERQFISDASHELRTPIAAIRGNLSLIKRRGDAHPEVIPES
FT                   LQFIDEESLRMQHLIENLLHLSRADRAKLVLTDQDLSLLMLSLAEHYQPSIDQPLTLAI
FT                   DPNIHVQGNAEMLQQIVVALLDNAHKYSPHDQPITLSLYQTDQAVELAVADHGEGIPDD
FT                   QKQAVFQRFYRVDQSRSQAIEGSGLGLAIVQQLVTLNQATIKITDNQPSGSVFAVSWQL
FT                   "
FT   gene            complement(250761..251465)
FT                   /gene="rrp2"
FT                   /locus_tag="LPST_C0231"
FT   CDS_pept        complement(250761..251465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrp2"
FT                   /locus_tag="LPST_C0231"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97455"
FT                   /protein_id="ADN97455.1"
FT                   /translation="MKNTILIVEDEGSLSGYLTKELQFEDFNVLVAANGLAAMETYQAH
FT                   QNELLLILLDWMLPKLDGMEVLRRIRKHDQVPVIIMTARDYVGDKVAGLDNGADDYITK
FT                   PFEIEELLARIRVIQRRIENQVEPNQVYQLDDIQLDTKAHRVTNGQEEVTLTHREYDLL
FT                   QFFLAHPDEVFTRDDLLDQVWGADFLGQQNVVDVYVGYLRNKITTTGASPLIQTVRGVG
FT                   YKLREPMSDAQK"
FT   gene            251622..251918
FT                   /locus_tag="LPST_C0232"
FT   CDS_pept        251622..251918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97456"
FT                   /protein_id="ADN97456.1"
FT                   /translation="MSDMGLFRDAMQALYHSGHYGYNINVKKSAPAVDPKEVPAIAALG
FT                   RINRTPNFKTWSVDSPYKTAEFTAKLTDAVATCDLVMQDLEIKPQIDGRWGDQ"
FT   gene            251999..252730
FT                   /locus_tag="LPST_C0233"
FT   CDS_pept        251999..252730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0233"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97457"
FT                   /protein_id="ADN97457.1"
FT                   /translation="MFSYDQVQQLNRLEIEIYKYIVGHPAEVSTMTIRQLADHSHVSAT
FT                   TILRFLKHMGYDGYAEFKFTLKEQLRQDATQPLAQTVVPMRTFFDRMNLPDITAKLHRV
FT                   AELVHQARMVVLIGSGTSAGLAAYGSHLFANFGLYSLMISDTSQPHPVQQQDLSDTVFF
FT                   ALSVSGESEDIIEQSVYYRQSGAKVVAITASSHSTLAGIADVVLTYDTPEVQAISGGST
FT                   LSQLPVVYYLEQLAMIIQPLT"
FT   gene            253032..254357
FT                   /gene="pts6C"
FT                   /locus_tag="LPST_C0234"
FT   CDS_pept        253032..254357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts6C"
FT                   /locus_tag="LPST_C0234"
FT                   /product="cellobiose PTS, EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97458"
FT                   /protein_id="ADN97458.1"
FT                   /translation="MSENNNKSSFVNDRLVPFFGKIAGSRHLIALRDGMTLAVPMIIIG
FT                   SVFMIIAQFPIKGYQTFMADTFGSNWATIVQYPTNASFHIMGLIAVIGISYNLAKSYKV
FT                   DPISASIVSLGAWFLTIPLNTDKAGALWVPLTQLDSAGLFTALLIGLFITDFYVFMVHR
FT                   NWTIKMPDSVPPAVSNSFAALVPGFVILFLMWLLRLAVEASPMQSIPNVISFVLAKPLG
FT                   LLSNTLPGALVAEFVVCILWIFGIHGANVVSGVMQPIWLAAMSQNAEALKAGKALPNVV
FT                   TQQFFDNFVHMGGSGATLGLAFMIAFVAKSAEFKTLGKLVIGPALFNINEPIVFGLPIV
FT                   MNYRIAVPFILAPLVNVTTTYIAMSTGLVAKTVGVMVPWTTPPIISGYLATMHISGAVL
FT                   QIVNIVLDGAIYYFFFKALDRDKVKEEKTFAAKEAAGETVEA"
FT   gene            complement(254510..254821)
FT                   /locus_tag="LPST_C0235"
FT   CDS_pept        complement(254510..254821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97459"
FT                   /protein_id="ADN97459.1"
FT                   /translation="MSQPNTLHPQAYCYYIELTGSERPDLLTALTTSEQELGDWEPVQA
FT                   AKLPTWRLWTDANADTIRYTVAHVIARSALPQNAYWLLQYKGTDHGHPRMLHPQFHTR"
FT   gene            255050..255304
FT                   /locus_tag="LPST_C0236"
FT   CDS_pept        255050..255304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97460"
FT                   /protein_id="ADN97460.1"
FT                   /translation="METGILKQIDLTTTTERYFFVQVQRLADYVWIRSVQNFKPLELTV
FT                   RVSDLQVNKHQAVADRGNIKYEFNDDTGGLVTQLAGWVH"
FT   gene            complement(255459..256490)
FT                   /locus_tag="LPST_C0237"
FT   CDS_pept        complement(255459..256490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0237"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97461"
FT                   /protein_id="ADN97461.1"
FT                   /translation="MRHSASSKLRPVLIAVGIIIVIAFVAIGLIIRQAQARYQSTIYTG
FT                   NSSTKIDTTKPLSILLLGVDTGADGRIDKGNSDTIMVVTINPQTKKTLITSIPRDSLAE
FT                   MVGDQDTNVQKLNAAYNIGGSKMAKASVSKLFNVPIDYYATINMGGLKQIVDAVGGVTI
FT                   TSPLNVSFDHITVTKGKHHLNGKQALSYTRMRYQDPRGDYGRQLRQQQVMRAVLAKLAE
FT                   TKTYSRYNQLLTSLKGNLQTDLSFNDLVGLATHDRANMKHIQSTQVIGSPAWINTSSYQ
FT                   ILSTKTLQQTSDRLRTQLGLSTETLTNMETKLNAKNTVYDGKTNLNYDTQGLDKITYSD
FT                   NTK"
FT   gene            256763..258157
FT                   /locus_tag="LPST_C0238"
FT   CDS_pept        256763..258157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0238"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97462"
FT                   /protein_id="ADN97462.1"
FT                   /translation="MTVFRAFSNQEVLDYLATQVTDGQVFTDEETLKKYSFSPRLTDDD
FT                   SGLALAYVEAHTTKDIQGTLKTARKYHIAVIPQDQTTSTVIGADGLTDSLILSTAKMNR
FT                   IIEISKADSIAVVEPGVVNGDLDKEARKQGMFYAPDPGSKPISGIGGNVATNAGGMSTV
FT                   KYGATKDNVLGVKVVLADGREVKLGGRTLKQAFGYDLTQLMIGSEGTLGIITEVIVKLL
FT                   PIPLGTPVMGVAFFDNMTVLAKAVTAIRISGVYPTMLEALDGNTVAALDRYEKTHYAKN
FT                   SAAMLIFKLDNGGQDSMAVVKKILAEQQANDVKITTEPKEQAALEQLRRDMLPAVFAGQ
FT                   NHIMEDMAVPLSQLAPLMDYIQELSKRLDVEIYTAGHAGDGNVHPTLVWPTSVTEVPEK
FT                   IIIALQEMFKKTLALGGTISGEHAVGMLKNQWNNAELGEDVDMLQHQIKALFDPMNILN
FT                   PKRKIS"
FT   gene            258304..258609
FT                   /locus_tag="LPST_C0239"
FT   CDS_pept        258304..258609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97463"
FT                   /protein_id="ADN97463.1"
FT                   /translation="MRRRPQVIPKSARIRIEFDAEVLRNEIFDVHDFASFQSFWQRFEN
FT                   FLADRMVVGHLNVLEGRGLIPSDFADVDGHLAYQVGEDAHQIAYDQIAREWTITIR"
FT   gene            258654..259346
FT                   /locus_tag="LPST_C0240"
FT   CDS_pept        258654..259346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0240"
FT                   /product="GTP pyrophosphokinase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97464"
FT                   /protein_id="ADN97464.1"
FT                   /translation="MSTTNSQASADNDQLLPAPPELLQAVDQLKAYSLRYEVAMKLVLD
FT                   KLDYISREYELRYGYALIDSKQSRIKSPESIVGKMQRKHLPLTLNAVFNNLHDIAGIRL
FT                   IVRFLSDVKTVENLLATQADIKVLRVKDYIHHPKANGYQSLHLILGVPVYTVDGPSIIE
FT                   VELQVRTIAMNFWASLEHELNYKKNVPHQDALRASLTKKAQLITELDQEMDDIKQRMYE
FT                   PKTPPKEV"
FT   gene            complement(259602..260174)
FT                   /locus_tag="LPST_C0241"
FT   CDS_pept        complement(259602..260174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0241"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97465"
FT                   /protein_id="ADN97465.1"
FT                   /translation="MVGTKNNRRSQMTERLIQDSLINLLQHQSLDEITVTAVCKAADIN
FT                   RGTFYAHYEDVKDCMQKMEQDATEELLAVIDKHLNPDSLQAILTGIFEVVKKRHAVTSF
FT                   ILTTDQDFLMSFIATTKREILAHNQAEITGIGNREKEYMFEYYLNGIVGVVRYWLKTGL
FT                   HESPEELASFINDWWYRGKPVKNLAEH"
FT   gene            260355..264308
FT                   /locus_tag="LPST_C0242"
FT   CDS_pept        260355..264308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0242"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97466"
FT                   /protein_id="ADN97466.1"
FT                   /translation="MKGSRRRFTIQAIVWLVVMVAAIIFLPNISSLVRDKGQTKLPSSA
FT                   KSQVAQVIQNHWGRNQNNTRQVVVVFNNGDSPLTSDQKQAIDGTIQRFKVQKSKYHVKS
FT                   MTAASDNAAAKKQLISKDKSTQLLQLMVGKNQTVANMTKNITAGAKTAGVKTYVTGSDI
FT                   LNDDFTQETEAGIQKTEIITVIFIFIVLTLVFRSPITPLVSLLSVGVSFIISLSVVMNL
FT                   VNKFNFPLSNFTQVFMVVVLFGIGTDYNILLFDQFKEELSHGDSPVAATGRALKIAGRT
FT                   ILYSGSSLLIGFSALGLANFSIYKSAVGVAIAVAILLLVLLTLNPFFMALLGPRLFWPT
FT                   KKFAGGSTSKMWHGIAASSVRYPIIALVVVLGVSLPFILTYNNELNYDTLAELNDTIPA
FT                   KKGFQVVQDHFSKGTAEPSTLYIKTDHALNNEKDLKVIDSLTKQLQKVKGVKTVASVTQ
FT                   PGGSQIDQLYVGNQLGTVTSGMKSASKGLTKIGSGLDSANSKLKSANMSDSAKSAKKLA
FT                   DGADEVSSGLNTLNGKTGTLSSGASQLASGSSSLASGLVTYTNGVYTVNNGLNQLNSKT
FT                   GTLASGVNQLTTGANSLFSGTSTLSSGLDTLNGYKTKISSGTGTLTSGVSQLQTGATAL
FT                   TAGLQKMQTSVNSSVSDATSTANTQKLIALQKGLKELNEAMTPLLSYDPSSLPDVSGIT
FT                   TTATTLEKNSTVVQNDASNLQTALTNLEKVASSNGNVSLSEADIQTVVNAVNKNGGTAL
FT                   TTQQTAALTAALTVVGKQITQKVDSASSSMSSSISSTQTSAQRLKADLATMSETGTALT
FT                   ADLKQLSTLSSELKQLSNLKQLATKSIEANNGSLEAISKLQSAISGMQQIQSGLNGTNG
FT                   LVDGSQQITTGLNQLQSGASSLASQLNTYTNGVSTAATGATKVNSGASQVSTGLTSLQG
FT                   QIPTLTSAISALDSGTNQLAANSSTLNSGASQLASGTASLNSQVPTLVSGVSKLNSGAS
FT                   QVASGNEQMYTSIQSLVGQMQTLQDGLKTASDGTKTINTGVGSANSYLTGLKDSAAAKT
FT                   YYVPKSTLKGKTYKSALKAYMSGNNHATKLTIVLNENPSSKSAMDKVTAIQKQATNSLK
FT                   GTALDGATIAIGGQTSETNDTQAIASSDFVRTAAIMLVGILIALMVITRSVLQPFYILG
FT                   TLLLAYIMSLSITRILSNWFLGQSMLTWNTPFFGFIMLIALGVDYSIFLMMKYREFDNS
FT                   AATPSTRIVRASAVIGAVVLSAALILSGTFAALMPSGVLTLIQVAMVVIIGLIILVFAI
FT                   PTIIPSLIRLTYPLTDRMEDETTAEKQTKRNRQ"
FT   gene            264488..265051
FT                   /gene="tag1"
FT                   /locus_tag="LPST_C0243"
FT   CDS_pept        264488..265051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag1"
FT                   /locus_tag="LPST_C0243"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97467"
FT                   /protein_id="ADN97467.1"
FT                   /translation="MQRCAWADSSPAMQAYHDNEWGRPQHNQQRLFELLCLETYQAGLS
FT                   WQTVLNKRAAFNEDFADYDVDQVAAMTTADVERLLTDARIIRHRQKLMATINNARVIRD
FT                   WPAGEDFATWLWAFVDNQPIRQAWASIDEVPATNDLAQQVSKEMKRRGFKFVGPTTIYS
FT                   YLQATGLINDHVVDCPFAPENLPA"
FT   gene            265293..267233
FT                   /locus_tag="LPST_C0244"
FT   CDS_pept        265293..267233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0244"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97468"
FT                   /protein_id="ADN97468.1"
FT                   /translation="MKEVRFWGLLLGLFVCLGAVIPLVSKDDVLDTAPAGLNLEGLFEP
FT                   GKFDRNSATMQTVSKNGHSQHVIELTNDDNQVGAMWSTPVNRFNMRVDNQVSMWVNFGD
FT                   KAVGEGLAVVLQNDPRKMSAISRYGKKSIIGENLGVYGTDTYTRRTAPATIAKTAIQKS
FT                   WALELDTKVNDGGFWGLYPRGNSFDEKPKKMHMAASYPASPDTYTQRGGLTSSYRFEQN
FT                   HGSIADKLPLADGNWHHLVLKWVASKQIMSYTLDQGPTRMTTIDTTVFGKDIRNVTWGL
FT                   TSTATTANARTLVVFDRLPQPIEIESDLNVTNLTQERTVHEGDWVHGGDELEYEYVLSY
FT                   LNGDNEWQQVKASLPLPEQVHFSHAKIRYADGTEEEINLPADDNESSVARLQHDLQRTL
FT                   SMKNPHAYITLIGEAAKGDRDTFVDDDMSYFEGHEMKTATATPHFTITTNKTVNLTIEP
FT                   LTQVKKGEPVIIKGQIKLNDGLDFDNDGMRIEYRVNGEAGEDYQLSMDDPVGYVEFEVD
FT                   AEELQIGENQITLRAHSKDNAYSEPVTVTVTVIGGELQLKKVSTESVFAPIKLTGTAQV
FT                   SRPEGLEVVVNDDTGSKAAWRLEATATPLVTNQGRTLAGNLYYQDGGQADNVGKGCRGN
FT                   RAPKDGPGDRL"
FT   gene            267674..269152
FT                   /locus_tag="LPST_C0245"
FT   CDS_pept        267674..269152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0245"
FT                   /product="ABC superfamily ATP binding cassette transporter,
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97469"
FT                   /protein_id="ADN97469.1"
FT                   /translation="MNFFKRAWLNLTAKKGRSILLVLVTSAIMLFVLAGLLIRNAADTA
FT                   TSNAKKSVGATVTLSANREAAFKKMRSATSTSKSSRPKLTTSPVKLSDAKKIAKLSNVS
FT                   SYNATVSTSANAKGFDTISTSGSSTGGGMKGMGGSSSSGTGDISITGVTNTNSVSTFES
FT                   SSSKITKGRGITASDEGTNNVVIESELAKEDSLSVGDTIKLKATTGDKKTYTMKIVGIY
FT                   KASSSASTQQGPGSTDVSNSIYTSYTFANTVKGSKYKNTADSVTFAISDPAKVSSVKTS
FT                   GKQLINTSKYSLSTDDSSYQTVKSSMNNVKSFADKIVWLVAIAGTIILALIVILMIRER
FT                   RYEIGVLLSLGESRWKIVAQFFAEMVMVLIVSVVLAGFGGKFVGNKLGDQLVSQQTTTA
FT                   TTTTSSTSQQGQPGVGGGAPSGNTGGSKPSGNMPSGGGQTGNASATTDTNLDINVTVMD
FT                   LVELGGFGLAIMFLSIMLASGGILRLQPKKVLID"
FT   gene            269164..269823
FT                   /locus_tag="LPST_C0246"
FT   CDS_pept        269164..269823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0246"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97470"
FT                   /protein_id="ADN97470.1"
FT                   /translation="MLKVNDLGYWYDRQENSLFENVNLEFKSGTSYAIVGQSGSGKTTF
FT                   LSLLAGLDKPRAGQIELNGEPINKIGLTNYRKSKVAIVFQSYNLLTYMSPLNNLMTAMA
FT                   ITNSEHRGDKDYAMKMLRRLGITDDQMKKNVQRLSGGQQQRVAIARTMVCDAKLVVADE
FT                   PTGNLDEENTKYVIDQFQKIAHEQKKCVIIVTHEPDVADVCDHSYRLEKHKFVAET"
FT   gene            complement(269952..270713)
FT                   /locus_tag="LPST_C0247"
FT   CDS_pept        complement(269952..270713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0247"
FT                   /product="CAAX family protease"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97471"
FT                   /protein_id="ADN97471.1"
FT                   /translation="MSSTKRGWGAAISIFILVPILFKLIAWLPVPTLYSGLVQDLLVLL
FT                   IFLLLNHFWFKISIQWWQSQSLVRQCLQLIPGIIILLLPMTSNFIKLCHLAWTPTLILY
FT                   IGYALVIGITEEYIYRGMLLPLLRQCFPHRLMLAICIDSLLFGLTHLLINSSQLTLSYV
FT                   IPQVFYAAAGGLIFCGLYLRTNNLVWPIFLHALSDVSVVVSLATHTHTAAKLSIPVAYA
FT                   IGISVLYLVLFIIIAFIVRWQVRPQKRLLSR"
FT   gene            complement(270809..271528)
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0006"
FT                   /note="CAAX family protease"
FT   gene            complement(271650..272453)
FT                   /locus_tag="LPST_C0248"
FT   CDS_pept        complement(271650..272453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0248"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97472"
FT                   /protein_id="ADN97472.1"
FT                   /translation="MKIKNLVLSSTAALALFAISTTVANADTYTVKAGDTVSAIAQAHN
FT                   TSVSAIEKANKLANVNLIFIGDKLEVNGTTTTTTTSAATSAAPQSATSQATSSAASTAT
FT                   SASATSASSQSVASQATSSATTSSAASQATSSVATSAASSASSTQSAASQASSSAATTS
FT                   QASSSATSSAASSTASTTSTTSSYTGSNLKSYVLSQMQSRTGVSASTWNTIITRESNWN
FT                   STVKNSTSGAYGLFQNMHISSGSVEDQVNAAVSLYNAQGMAAWAL"
FT   gene            complement(273510..274145)
FT                   /locus_tag="LPST_C0249"
FT   CDS_pept        complement(273510..274145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0249"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97473"
FT                   /protein_id="ADN97473.1"
FT                   /translation="MKIKNALLSTAAATASLFAIGATAQAATVTVKAGDTVSAIAADHN
FT                   TTIDAIQQANHLKDVNLILVGQQLEVNGDSTTTTSTQTTQQTTTTQSSAQTSQTQAQPS
FT                   QASQTQSSQTQTSKPAAQTTTQTSSSTSNYSNNGSDSAAKAWIAGKESGGSYSARNGQY
FT                   IGKYQLSASYLNGDYSAANQERVANSYVASRYGSWSNAKSHWLANGWY"
FT   gene            complement(274550..274849)
FT                   /gene="gcsH1"
FT                   /locus_tag="LPST_C0250"
FT   CDS_pept        complement(274550..274849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcsH1"
FT                   /locus_tag="LPST_C0250"
FT                   /product="glycine cleavage system"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97474"
FT                   /protein_id="ADN97474.1"
FT                   /translation="MLYGDIWLKTKSHDRLLLGLSDQGQHNLGVVHQLDLPTKGQHLVA
FT                   GDPLVTITDDQGAHLVSTPFSGTVQKLNKDLQAAPQSLINNKQTDNWLVQLKAD"
FT   gene            complement(274934..275851)
FT                   /locus_tag="LPST_C0251"
FT   CDS_pept        complement(274934..275851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97475"
FT                   /protein_id="ADN97475.1"
FT                   /translation="MSTYYPYLRGRMYDLLALKTLCEQHQLGPHIIPVIEPVRDSKELQ
FT                   QTVTTFIEAQQPFSIIANPQVSVYGLNTVKLHPLPDLRPYPFYRPGAILAADFSRDFLT
FT                   TSPGQTSLLIAPNYPLLKAYQHTTTLQHAGHVLIPDEARLHQLLPQHAVLLTDPVATPA
FT                   HVADYQEITDAYFAPANWYQTPVGFDGFGDYSLMGRPYFDHGMPSRAIALHLIYVTVNG
FT                   DLRIHHFVSDSNANMRGQKQKFFEALTKLTDWAPAHLTGLNRTPALATLLAYAEGDKFP
FT                   GLGIIKKLAIMHHFQLMHRLLALN"
FT   gene            complement(275848..276564)
FT                   /locus_tag="LPST_C0252"
FT   CDS_pept        complement(275848..276564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97476"
FT                   /protein_id="ADN97476.1"
FT                   /translation="MKTKLTKQLESTLYQYCLEQGAYVVEEVAMPADKGIVDTLSYQQL
FT                   PDGQIEWRCYELKVTKADFHSKAKLSFIGHYNYFVLPQQLYLEVQSEIPDHIGVLIYRA
FT                   FDQRALELAPQPLRTPGFLTVAKKAQRQDLQVEQTPLISHFITSLFREVDKAKRVKKGL
FT                   QLYSDDQLFKELRKRARTGYDVYDPEQNLYDRFIDDTQNDAVTALQTELDARNAEYQAL
FT                   KLKYQALTAPDLRDQL"
FT   gene            complement(276564..278933)
FT                   /locus_tag="LPST_C0253"
FT   CDS_pept        complement(276564..278933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0253"
FT                   /product="DNA helicase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97477"
FT                   /protein_id="ADN97477.1"
FT                   /translation="MATKIGIRQLVEFVLRQGDLNEVKNSQNTALNGAKIHRQLQSSRG
FT                   EDYDSEVYLKKIVTMNDTDYIIAGRADGIQLNDDGALIEEIKTSDQVFEDLSTNTLTLY
FT                   WGQIKVYGYLLLQEHPDLEQVTLQLTYFQVINEKITKTQQILHRAELDAFFHDLITEYE
FT                   YWLTLRADLRRQRNASIEDLPFPFPAFRPGQHELAGAVYKTIRLQKRLFVEAPTGTGKT
FT                   ISTLFPAIKAMGEDVIERLFYLTAKQSTRHVAEEAVTLMSHDGLKLKSITLTAKDQIRF
FT                   PEEQDVLPEDNPYMIGYYDRLKPALKDLLTHEDQITRSVIEQYARKHTVDPFEFSLDTS
FT                   LFCDVIICDYNYLFDPLVYLQRFFSERDDDNFFLVDEVHNLVSRSRDMYSAAVSDQPIS
FT                   ALLKLAKPDKSQPSDDLQRELKKVRRSFTRISKTLIDDQVTEQVLPDPPDKLLRTLRTF
FT                   NEFVTDWLAQQKPGPLLDAVHDYFFACLTFVKIGDLYDGSYQTRFVLDGHHLTIKELCL
FT                   DPSDFLNRSLELGSGAVLFSATLTPMAYYQRVLGGEANSLAYQLPSPFPPKHQAILVTQ
FT                   YVQTTYHEREHNVPRIIASLHAMLTAKRGNYLVFFPSYGYLLQIKTAFEAAYPDVATTA
FT                   QASTMDATARQTFLNQFQSAPSQTLLGFCVLGGIFSEGIDLRGDRLIGVAIVSVGLPGI
FT                   NPETNLIRDYYDHQNGLGFAYAYQLPGMNNVLQAAGRLIRSAKDTGIVLLLDQRFASRR
FT                   YTDLFPAHWQYYQTIQSVPQLEATIANFWHQMEVTH"
FT   gene            complement(279353..279715)
FT                   /locus_tag="LPST_C0254"
FT   CDS_pept        complement(279353..279715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0254"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97478"
FT                   /protein_id="ADN97478.1"
FT                   /translation="MKKTFTWSVSNGFAVLLLTVGTILAIITLGISFGSPISVDAMVTA
FT                   AALWLAGVVFLHPAPVRILIPVITLVSLSLGYATYFSTSGSWLLAILATIITAGIISYG
FT                   FSLRKSIRQHHSHWYD"
FT   gene            279904..281100
FT                   /gene="ack2"
FT                   /locus_tag="LPST_C0255"
FT   CDS_pept        279904..281100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ack2"
FT                   /locus_tag="LPST_C0255"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97479"
FT                   /protein_id="ADN97479.1"
FT                   /translation="MAKILAINAGSSTLKWKLFSVPEETVIASGMVDRLGLPDSVFTIK
FT                   KADGSKYSETKDRIDAKEAAAMVLTRLKSDNIVTHLSEITGVGHRVVAGGEDFKDSVVI
FT                   TSQTLKKIKDLSEYAPLHNPTQAYYIEVFRDLLPKATQVAVFDTSLYADMPKINYLYSI
FT                   PYDYYEKFGARKYGAHGTSHRYVANRTAQLLGKPLDSLKLVTLHLGSGASITAFDHGKA
FT                   VDTSMGFTPLAGITMSTRSGDIDASIIPFLMRHLGISDVEDFVDILNHKSGLLGISGLS
FT                   PDMRDLDKTQDTRERSKLAIDIFVNRVVKYVGSYIAEMNGIDALVFTAGVGENSWMIRE
FT                   RVTKALGYFGVTVDDEKNHMHGKEQIISKDDEPVTVMVVPTNEELMIVRDVERLSKAE"
FT   gene            complement(281227..281670)
FT                   /locus_tag="LPST_C0256"
FT   CDS_pept        complement(281227..281670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0256"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97480"
FT                   /protein_id="ADN97480.1"
FT                   /translation="MWSIKTFSELTTTELYAIYELRVKTFVVEQQRIYQEVDDTDLKAY
FT                   HVFKTVNQNIVAYARIFTEDDHLSFGRVVVDKNQRGQHLGADLMAHIEQFVQEHYADLP
FT                   IQIEAQVPVQGFYQHFGFTSSGTPFLFNHTPHIKMTKPARQRQ"
FT   gene            281744..282166
FT                   /locus_tag="LPST_C0257"
FT   CDS_pept        281744..282166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0257"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97481"
FT                   /protein_id="ADN97481.1"
FT                   /translation="MIPTLRLMGTLSRIVTNEGNQRFAKYGLNNNQFIYLIRICEQPGL
FT                   FFSQLADQMKMDRTTNYRAVQNLIKKGYVIKQTHPENKKVRCLYPTSAGQALYPELHAY
FT                   EQWCADLVGEQLTPGQQQVLFESLSLVTANVTQHIE"
FT   gene            282355..283557
FT                   /gene="ndh1"
FT                   /locus_tag="LPST_C0258"
FT   CDS_pept        282355..283557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh1"
FT                   /locus_tag="LPST_C0258"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97482"
FT                   /protein_id="ADN97482.1"
FT                   /translation="MATTLVLGGGYAGMRAVKFLQKSLPTEDEIILVDQTPTHTEKTNL
FT                   HEVAAGTIAPDRITYQIPDIIGKRVQFVQATVKNVDIEQKQVTFEDHPEMTYDYLVLAL
FT                   GFQSETFGVAGADENALPMDDLATSQAVYEHLEERFKAYRTSKDKNDLKIAVCGAGFTG
FT                   IELLGELTQTLPRLQAKYQTPAAKLVCLERMPSILPMFTQELRDYALKFMEKNNVEMRL
FT                   GAVIEAIKPGAVVYSDADKNEHEFTANTIIWTVGVSGSHVIADSGFDQRRNRVVVKPDL
FT                   SLEGHPEVFIVGDVAAVMDPESNRPYPTTAQIALAAGEQAAKNIGALRHNQATATFHYE
FT                   SSGTVASLSDRDGIGEIFSSNKPVHGYAASALKKIITDRSLLESAHLGTVFSKGRFDLY
FT                   H"
FT   gene            283689..284021
FT                   /locus_tag="LPST_C0259"
FT   CDS_pept        283689..284021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0259"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97483"
FT                   /protein_id="ADN97483.1"
FT                   /translation="MGLTILYGHPLQLRHDKGAVKMTTKSIRTPIQPWFTLVVAGSLLI
FT                   TLFSNALWWLASSAFCALLVLNLQFIVFPTTADCYWLNRLSLGLVLALVVIANIKFLLI
FT                   SGLTWR"
FT   gene            284645..285202
FT                   /locus_tag="LPST_C0260"
FT   CDS_pept        284645..285202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97484"
FT                   /protein_id="ADN97484.1"
FT                   /translation="MTKKTFYNEELNTTEEYSEVWKYELMRVKDISDLIVHNHYWKDSR
FT                   GELWLDFDDPNENFRKAFNAYRNRKGFMQPNEIKKLRENLHLSQRVFSERLGISYAKVS
FT                   QIENNKRVQTLSQEVSFRKAQQDYEKQGFLTSYDSDTSDSAELTKVLTETEYVDTAKYF
FT                   YKTNDSSETTIFKVQEFVGGVA"
FT   gene            285202..285630
FT                   /locus_tag="LPST_C0261"
FT   CDS_pept        285202..285630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97485"
FT                   /protein_id="ADN97485.1"
FT                   /translation="MAVLEFKSYTVNELSYRKNDLYKETNQNISINPKIEIKNTPKQDK
FT                   IIVTVDVHIGSLAEKKNPFIVTASVSGEFVYHEKEDHNQVGIDTLIKKNAVAILYPYVR
FT                   SLVSGITNASNQFPALILPTINVAQLLDEQSNRQEAAD"
FT   gene            complement(286123..286977)
FT                   /gene="potD"
FT                   /locus_tag="LPST_C0262"
FT   CDS_pept        complement(286123..286977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="LPST_C0262"
FT                   /product="spermidine/putrescine ABC transporter, substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97486"
FT                   /protein_id="ADN97486.1"
FT                   /translation="MYTKIKQGGTSYDLTVPSDYMIEKMKKAHLLLPLDKSKLTGMKNY
FT                   DPRFMNLAFDQHNRYSVPYFWGTLGIIYNDKYVQPGSIQHWNDLWQRKYHNKIMLIDSA
FT                   RDVMGFALASMNQSMNTTDPATLLAARNKLNRLSPNVKAVVADEIKMYMIQNEAAIAVD
FT                   WSGEASEMLAGNSHLHYVVPSEGSNLWFDNLVIPKTAKHFKAIYAFLNFMSEPKNAAQN
FT                   AEYIGYATPNRKAKALLPKAIRNDRQFYPDNNTIKHLQIYQDLSPAKVGLYNDRYLEFK
FT                   MHH"
FT   gene            complement(287190..288005)
FT                   /gene="potC"
FT                   /locus_tag="LPST_C0263"
FT   CDS_pept        complement(287190..288005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="LPST_C0263"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97487"
FT                   /protein_id="ADN97487.1"
FT                   /translation="MTLRNFKWRNLYLWLVFIVLYAPIIFLVVYSFSQGTTMNNFHGFT
FT                   WQHYQDLFADSRLIAIFLDTILIALLSSLLATVIGTLGALGINSMTKPITRNTLLSLNN
FT                   ILMVSPDVIIGASFLIFFTALKIPLGFGSVLLSHIAFSIPIVVLMVLPKIQEMSTSLLD
FT                   AAADLGANNWQLLSQVIVPYIMPGIFSGFFMALTYSLDDFAVTFFVTGNGFSTLSVEIY
FT                   SRARQGINLEINALSGLMFLMALVLVIGYYFINQYSSRHRRPAVRGRRK"
FT   gene            complement(288005..288838)
FT                   /gene="potB"
FT                   /locus_tag="LPST_C0264"
FT   CDS_pept        complement(288005..288838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="LPST_C0264"
FT                   /product="spermidine/putrescine ABC superfamily ATP binding
FT                   cassette transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97488"
FT                   /protein_id="ADN97488.1"
FT                   /translation="MQPKQRLSRNTAYFIPYMLWIILFVIAPVLLLIYQSFFNINGQFT
FT                   LGNYQTYFSSNTYLMMTLNSVWYAFLITLATLLISYPTAYLLNETKHPQLWLLLIIMPT
FT                   WINLLLKAYAFIGIFSQAGIANQFLSFIGIGPKQLLFTNFSFIFVAAYIQIPFMVLPIY
FT                   NSISELNPSYVNASRDLGATNWQTFNRVIFPLTLPGVKAGIQAIFIPSLSLFMLTRLIG
FT                   GNKVITLGTAIEEHFLTTMNWGMGSTIGVVLIIAMVIIMWLTGSSKKRARKGLTK"
FT   gene            complement(288850..289947)
FT                   /gene="potA"
FT                   /locus_tag="LPST_C0265"
FT   CDS_pept        complement(288850..289947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="LPST_C0265"
FT                   /product="spermidine/putrescine ABC superfamily ATP binding
FT                   cassette transporter, ABC protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97489"
FT                   /protein_id="ADN97489.1"
FT                   /translation="MAVNTQPIIRLTNVTKSYGEHQVLKNINLDLEAGKFYTLLGPSGC
FT                   GKTTILRTIAGFTDATSGQVYFDGQVINTLPANQRQVNTVFQDYALFPHMNVAENVAFG
FT                   LKLHKVPKDEIETRVQKALAMVQLADLGEREISEISGGQQQRVAIARALVMQPKVLLLD
FT                   EPLSALDAKLRKDMQYELRDLQQRLGITFLFVTHDQEEALAMSDEIFVMNAGEILQGGS
FT                   PVDIYDEPINHFVANFIGESNIIPGKMLKDFEVEFVGKQFECADAGMQPNEVVEVVLRP
FT                   EDLDIVAADQGKLVVTVDSQLFRGNYFEIVAYDTDHNEWLVHSTNPAAEGEPIGLTFDP
FT                   QDIHVMRLNESEAAFDARLEQYEDD"
FT   gene            complement(290018..290560)
FT                   /locus_tag="LPST_C0266"
FT   CDS_pept        complement(290018..290560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0266"
FT                   /product="cro/CI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97490"
FT                   /protein_id="ADN97490.1"
FT                   /translation="MDIGQRIRNLRIQKQLTQEELGERTDLSKGYISQLEHNQSSPSME
FT                   TFFAILEVLGCAPADFFAAEQPTHKVVYHPADQTTYDDEALGYRVKWLVPASNENQLEP
FT                   VTVTLAPSGRFKSFEPSPAETFIMVQTGTLSLQLGAQQYAATAGDTLYFHATKTHQIRN
FT                   LGTTSCTFTLVTTASYL"
FT   gene            complement(290901..291377)
FT                   /locus_tag="LPST_C0267"
FT   CDS_pept        complement(290901..291377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97491"
FT                   /protein_id="ADN97491.1"
FT                   /translation="MTFMPAQSAEQLWHAYNESTDTNGASYQTRWFGQQNNPAEVTALA
FT                   DAILAGTKTATTTPLDSYTAEQIAIPQVGDYNVLLNGDMKPVAILKTVVSELIPFYRIS
FT                   AEHAYHEGDGDRTIGDWRKRKTAEFTPTLEEHGKNLSSDTPMVSEVFEVVYRAD"
FT   gene            291554..292039
FT                   /locus_tag="LPST_C0268"
FT   CDS_pept        291554..292039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0268"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97492"
FT                   /protein_id="ADN97492.1"
FT                   /translation="MEITPVKMLDLPQIMAIEKSGFSEAEAGSEAAYRERIEKLADTFL
FT                   VARDGAVVLGFIVGPAVGARYIEDEMFVETPTNLPRGGHQLVFTLAVSPLARHQQIGSQ
FT                   LLTALAEKAQADGRTSMALTCLERLIPFYERNGFINQGVANSEHAGETWYNLEKVWD"
FT   gene            292043..292570
FT                   /locus_tag="LPST_C0269"
FT   CDS_pept        292043..292570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0269"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97493"
FT                   /protein_id="ADN97493.1"
FT                   /translation="MKLATLQAQLPDFEIRLLTLADQEALLELEQSNPRYHQYFSPETL
FT                   TMTEVQHDLTAHPDELAAAQKQVFGFYLAHRLVAVLDVLNQYPQEQFLFVGLLMVNKAY
FT                   QRKSVGRVIVTGLMQAALQANITAIQLTRVTADEGVARFWQKLGFEDGNQLFLPLKAGG
FT                   RLAVTTMTRLLQ"
FT   gene            292664..292849
FT                   /locus_tag="LPST_C0270"
FT   CDS_pept        292664..292849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97494"
FT                   /protein_id="ADN97494.1"
FT                   /translation="MIKHWGKAETGMLIAAVLLLMVIFTFFEITASLTVSVIAFPISLI
FT                   VLMAIMEFAATELRRK"
FT   gene            293110..293463
FT                   /locus_tag="LPST_C0271"
FT   CDS_pept        293110..293463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0271"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97495"
FT                   /protein_id="ADN97495.1"
FT                   /translation="MQIDHGSRQPYYAQIVTGIEQDIAHGVLQSGEQLPSVREMARQHL
FT                   LNPNTVSKAYKRLETQQIIETVPGKGTYVKVVDSTLFRQELREQFTQIVRLAGQRGVSI
FT                   AELHGWLDQMGEK"
FT   gene            293463..294356
FT                   /locus_tag="LPST_C0272"
FT   CDS_pept        293463..294356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0272"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97496"
FT                   /protein_id="ADN97496.1"
FT                   /translation="MSLVINQLSKRIDHHQTLDGISFEIGLGQIVGVVGRNGVGKTTLF
FT                   RTINGQYLTDHGQVLVDGQEVVDQPEMRTQLCFIDPLANFFKGATIAQIQWYYQAAYPD
FT                   FDNAKFAQLLDRYHLTSKQKLRHFSKGMFGLFTIILSVATQAPYLFLDEPLDGLDVLIR
FT                   KNILGILIDEVATGNRSIVIASHNLAELEGVIDRALMLKHGRIVNDYQLEAMRRSARKV
FT                   QLVYRDKQIPAVVKQLGHIVHVSGRVIVVVFEDYNAEVQAQLATTNPVFQEDLPLSLAD
FT                   LFMANLTDEADFELLS"
FT   gene            294369..295382
FT                   /locus_tag="LPST_C0273"
FT   CDS_pept        294369..295382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97497"
FT                   /protein_id="ADN97497.1"
FT                   /translation="MTKRKLWQLLWRHYRTLLLTAGGVLLLVGIKEGYSIAHNPSRYVA
FT                   QNVSSFALMEATHLRMETVVAIIVSLVLGVALFLSDNFTNFNQYLFSLPVARKQIYRRK
FT                   IGLLIGMLVSAYMLAEAVFGLIAWRVLAKQQVRIDWLTTLYEELGILAVMLVFGLLAAT
FT                   FGLWVGHIFASALATFVFVCSLPFAYDGLINLAAGLTKLKYEQVDVLGQLPSWKPGGLL
FT                   TTWVICGVIGGGLYLLNRWAFEHLSLENSGDFFRFPQWRGAVLGFSIIYLIVAICCSQF
FT                   GNGVLGLLTDNYHAYMPLSTGIIMALVVAYLTWSLGRWFLYRPDRFRDAWTVKKLA"
FT   gene            complement(295488..296855)
FT                   /gene="acdH"
FT                   /locus_tag="LPST_C0274"
FT   CDS_pept        complement(295488..296855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdH"
FT                   /locus_tag="LPST_C0274"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97498"
FT                   /protein_id="ADN97498.1"
FT                   /translation="MLKEMEETTVSRSIDRLVLNASLAANRLEVMDQSQVDQAVAAMAR
FT                   AAHAARGMLAAMAVEETGRGNYRDKVAKNDFAAKNVYNYIKDDKTVGIINDDPVSGVMK
FT                   VAEPVGIIAGVTPVTNPTSTVIFNAMLALKTRNPIIFGFHPFAQKSCVETGRIIRDAAI
FT                   AAGAPKDWIQWIKTPSLEATNTLMNHPGVATIIATGGAGMVKTAYSTGKPALGVGPGNV
FT                   PCFIEQTADIQQAVSDVVTSKSFDNGMICASESNLIVADQIYDQVKRELSHNGVYFVGT
FT                   ENFKALEATVMNLDKQAVDPKVAGQTPWQIAQWAGFDVPSDTKVLAVELPSIGGDQVLS
FT                   REKLSPVLAVVHAKDTEAGFNLMKRSLALGGLGHTAALHTTDEAVMNKFALEMTACRAL
FT                   INVPSSQGAIGYKYDNVAPSLTLGCGTWGHNSISHNLEDWDLLNIKTVAKRLTKIR"
FT   gene            297281..298144
FT                   /gene="fba"
FT                   /locus_tag="LPST_C0275"
FT   CDS_pept        297281..298144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="LPST_C0275"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97499"
FT                   /protein_id="ADN97499.1"
FT                   /translation="MSFVNAVDMTQDAYKNHYAIGAFNTNNLEWTRCILKGAQDTNTPV
FT                   IIQVSMGAAKYMGGYKLVMDLVADEMESMNITVPVVMHLDHGNYEAAKECIEVGYSSVM
FT                   FDGHDLPFAENLEKTKEIVKLAHAKGISVEAEVGSIGGEEDGIIGEGELADVEEAKTLA
FT                   ATGIDILAAGIGNIHGKYPENWTGLHFDRLQEISEAVKMPLVLHGGSGIPKDQIVKAVE
FT                   LGISKVNVNTENQVAFANATRAYIESGADQIGKGYDPRKLLAPGKKAIVDVVTSRIGWF
FT                   KTPAVK"
FT   gene            298331..299593
FT                   /locus_tag="LPST_C0276"
FT   CDS_pept        298331..299593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0276"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97500"
FT                   /protein_id="ADN97500.1"
FT                   /translation="MSQDHSTKVLLQIKDPNITDLVVQEATNGSLQVLAKLTYPVTVCA
FT                   RCGKRSMVKNGFKTVHIRIPRISERVTILNLKKQRFICKNCGKSSLTTTTLVKKHHQIS
FT                   ENSLHAIDLSLTEDRTMASIAAQYNVSTNTISRRIKLLGQGTQPAFNGLPTMLCIDEFR
FT                   STGKQMSFIAVDAQTHDIITILPGRKNADIKDFFLNHYSKRHRDCVTRVVMDFNSQYQP
FT                   AIRTLFPHAKLVADNFHLVQMALRSLNQTRVQLMKRFNPKSREYRVLKYYWRLYLKDYD
FT                   SLEKRKPQWFAHLKDRMTPEQLVVAGLNLDQQFRQTYQAAHALVKAFQKRDYRSFKAAL
FT                   GHVENVSPQLMTNIKSFIKNRQLIKNMTTGRLSNGPVEGVNRKIKQIKRTAYGYKNWQN
FT                   FIYRIQIEFKIKIEKKNPIRK"
FT   gene            complement(299878..301194)
FT                   /locus_tag="LPST_C0277"
FT   CDS_pept        complement(299878..301194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0277"
FT                   /product="sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97501"
FT                   /protein_id="ADN97501.1"
FT                   /translation="MKQPWQTAWPERISYGLSDAADNLVFQMMTTYLLFFYTDVYGLST
FT                   SAAAILFVVARLADVVESLIIGVMIDHTHSRFGKSRPFFLWYALPYVLFAVLTFVTPNF
FT                   GATGKLVWAYVTYLGLGFFYTAVNLPITSILPALSQNERELTLLGVIRQFFGSSVQIIV
FT                   AVFTLPLVALFGQGDQQRGFLLTIVLFGIISLVLILNTFFQVKERFSQPERPHQSLSAV
FT                   WGMLKQNQPWFILSSVILLYWLTTAIKNQTTIYYFKYLIQREDLVPVVNGFTFASLIGV
FT                   ILIVRLANHHGKKNTMLAGIAIAAVGQLILGLGTAINQLAFVFGGTLINAVGNGLIIGL
FT                   VSIMIADTIRYGTALGIQAEGILASTDDFGVNVGLGLGGLVTAGLFHLSGYTANHAQNI
FT                   ATQHMITLNYAWLPLLLYVVMFIVLIFYNEQQLQDAINV"
FT   gene            complement(301364..301942)
FT                   /locus_tag="LPST_C0278"
FT   CDS_pept        complement(301364..301942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97502"
FT                   /protein_id="ADN97502.1"
FT                   /translation="MIQDTRAALRGIIGNKELNEVLNGTQEINAALFKEISSVTAGYGL
FT                   NVDRVNIDSVNPSADIQASMNKLLQATRERDATIATAEGKSKSITLENEANNRALLATN
FT                   KAQNEALVNSAKAKATAVQTEADADAYRTRILNEALAQSSENYFIFQNTEAVKALADGN
FT                   ANTVVLPNQTLDSLGLIPALTKVSKLTTK"
FT   gene            complement(302279..302479)
FT                   /locus_tag="LPST_C0279"
FT   CDS_pept        complement(302279..302479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97503"
FT                   /protein_id="ADN97503.1"
FT                   /translation="MQEGYLDQRLIGQRLIIKPTDLTDGVAFYGILYHLHAATPLHTGD
FT                   TVEITAVSAHGLTVTIIAPQQ"
FT   gene            303162..304574
FT                   /gene="pepD2"
FT                   /locus_tag="LPST_C0280"
FT   CDS_pept        303162..304574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD2"
FT                   /locus_tag="LPST_C0280"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97504"
FT                   /protein_id="ADN97504.1"
FT                   /translation="MYEQACTTILVGKKATVDGSTMIARNDDTFMPITPQKFIVHPAVH
FT                   GRNETLTSGKNGFTAPLPADGYRYQAVPNIEVAEKGVFEENGFNEKNVGVSSTESVYGN
FT                   EHTLTFDPFVPNGLAEDSLPTMLTPFIDSARGGVKYLGQLIAKYGSPEGNGVLFNDKDD
FT                   VWYMEIVTGHHWVAQRIPDDAYAVAANQVAIQWVDFDDPDNFMWSDGIQEFVAEHHLNP
FT                   DKEGFNFRHIFGTDNEKDRHYNTPRVWYGQRYFNPEIEQDPQSSELPFICHAAKKISVA
FT                   DVEFVLGSHYNETKYDPFLNTPEAKKFRPISMNRTQNSHVMQVRNDVPAEQSAIMWMTF
FT                   GVPAFAPYLPFHANVSETDPSFANTPLKHDMNSAYWLYRTLSMIVESHYADFVQDDIDY
FT                   LKECRIELGQFVAATDEQAAKLSGDELTAFLTEQDKVMVAKMRDKAQALIGQLVTKGLT
FT                   LSKLTYNVDINL"
FT   gene            304640..304885
FT                   /locus_tag="LPST_C0281"
FT   CDS_pept        304640..304885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97505"
FT                   /protein_id="ADN97505.1"
FT                   /translation="MDENVLFNPGDAISESHDYNEALRSADIYNARHGRKRGLMIARPL
FT                   EQDHGYSVFYADDLLTADTPRPEARQYHVEKRIPKE"
FT   gene            305014..305577
FT                   /locus_tag="LPST_C0282"
FT   CDS_pept        305014..305577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0282"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97506"
FT                   /protein_id="ADN97506.1"
FT                   /translation="MTNRQTIKHLTQTAMVTALIIVLGFFPGIPVGFIPVPIVLQNMGI
FT                   FLAAELLGRKYGTIAVGLFLGLVALGLPLLSGGRGGAAIFLGPTGGYLVAWLLAPMLIG
FT                   TLIKITRAMTSGYWWLEVGIVWLAGILFVDVIGASWLAVQSHMTLTAALLSNVAFLPGD
FT                   IIKGTLAVFIARRVRAIVDFGLPA"
FT   gene            305615..306586
FT                   /gene="birA1"
FT                   /locus_tag="LPST_C0283"
FT   CDS_pept        305615..306586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA1"
FT                   /locus_tag="LPST_C0283"
FT                   /product="biotin--[acetyl-CoA-carboxylase] ligase and
FT                   biotin operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97507"
FT                   /protein_id="ADN97507.1"
FT                   /translation="MTTKEQVLTILLRHHGEWQSGDQLAQSVGCSRESIWKAINALRKQ
FT                   GHQIESRKNRGYCYLGSRNLDAKAIQIYGQRQFTGPLEVVAQTPSTQILAKSFLSHHQP
FT                   QFAAFFADEQTAGYGRLGRDFYSPAKTGLYFSLVVPNPTNALVNVGLLTTGVAVSVLNV
FT                   LQQFYPNKNFGLKWVNDIYLDQYKVGGIITEASLELESTSAAAFIVGVGLNLTTTDFPR
FT                   ELQARAQAVDPSMSVDRNRLAAALLSALVALSKRYATADFLPAYRAKSLVLGQQVTLQV
FT                   GDSVVNGVAEDIDEHGGLVVRMLTGERRTFTSGEVIRVGLPV"
FT   gene            complement(306575..306850)
FT                   /locus_tag="LPST_C0284"
FT   CDS_pept        complement(306575..306850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97508"
FT                   /protein_id="ADN97508.1"
FT                   /translation="MAGDSAGIAPHDTDQPAFDNDKHHTSRLNPSERWPQKYAGTTYHG
FT                   TGNTRNSFDIADTTMPQYQFQGDNVGTDRQRLNRCRKSLVPTQSYW"
FT   gene            307058..308233
FT                   /locus_tag="LPST_C0285"
FT   CDS_pept        307058..308233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0285"
FT                   /product="penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97509"
FT                   /protein_id="ADN97509.1"
FT                   /translation="MKFEESKILQQLPKQFFANLVKKVNAKAAAGADVINLGQGNPDQP
FT                   TPEFVVKAMQTATANPADHKYSLFRGLPRFKQAAADFYEREYGVKLDPETEIAVLGGSK
FT                   IGLVELPFALLNPGDTMILPDPGYPDYLSGITLAQVKLALLRLTADNHFLPDYQQVDPQ
FT                   VAAAAKLLYLNYPNNPTGAVATSQFFQDTVDFANEHQIGIVHDFAYGAIGFDGQRPVSF
FT                   LQTSGAKDVGIEMYTLSKSFNMAGWRVGFAAGNADMIEALNLIQDHLFVSVFPAIQDAA
FT                   IAALNSDQQTVHELVRLYERRRNQFFTAARKIGWEPYPSGGSFYAWMPVPEGYTSEAFA
FT                   DLLLDKAAVAVAPGNGFGAGGEGYVRVGLLIDEPRFTEACQRIAKLHLFDR"
FT   gene            complement(308409..309575)
FT                   /locus_tag="LPST_C0286"
FT   CDS_pept        complement(308409..309575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97510"
FT                   /protein_id="ADN97510.1"
FT                   /translation="MSSIIENLQLAAQQVHLINLYQANSEVVYTGYIDRLAPDGVVVNT
FT                   YDDAGLQDGAVFMRYDVIDEVEMMSEDLDNMAFRLENATTEGLNSVPQPTVALDDQRPV
FT                   LTQLVTQAQTDHQVVLLVLEDNENYLEGQVQQVTDQTITFKTFDKFNFKNNGQQEIPLA
FT                   AIQILEFCGNELLLESAFVKTIHTHRATIKVSEFDDVDHTLNNALNEHQLIAIRSADGS
FT                   DMFFVGFINALNADSVLLNLIDMTGQFGGYTLCRRSLIESVTTQSDYLQTMRGFIELNR
FT                   QYELNVQPVLNDERLFDATTDLFDSILRQAATFNNLVHITTENPMLPAMTGYPGTLTNG
FT                   HFIFYNVDDDNQINHVGTMIELDQVVELSFGYMDAYLLEKRLKSTGNL"
FT   gene            complement(309842..309955)
FT                   /locus_tag="LPST_C0287"
FT   CDS_pept        complement(309842..309955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97511"
FT                   /protein_id="ADN97511.1"
FT                   /translation="MCFKKTVCVYFGNHHLNIELHFKITSRERIIGTLFFT"
FT   gene            310170..310985
FT                   /gene="tagG"
FT                   /locus_tag="LPST_C0288"
FT   CDS_pept        310170..310985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagG"
FT                   /locus_tag="LPST_C0288"
FT                   /product="teichoic acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97512"
FT                   /protein_id="ADN97512.1"
FT                   /translation="MFTMFKTIGDQFANFKIIRRMAKYDDRATYQSHYLGLAWEFLNPL
FT                   IQIGIYYLVFGVALKRGDPMPGIPYLPWMVVGIAPWLYMNKTTLDASSSIYRQVGLVSK
FT                   MKFPVNVLPSIKIYGNLYSFWTMIAFGIFLMFVNGIWPSVSWIQFIYYFGCMIVLMYSL
FT                   GIFNATVSVLIRDWHITLQSVLRMLFYMSGVLFNFTTSNFPAVFVRLLELNPFYYVLNG
FT                   MRESLLNRGWIWQQPNITLTIVFWLFNLVVILTGTYLYNKFRSNFVDLI"
FT   gene            310998..312089
FT                   /gene="tagH"
FT                   /locus_tag="LPST_C0289"
FT   CDS_pept        310998..312089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagH"
FT                   /locus_tag="LPST_C0289"
FT                   /product="teichoic acid ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97513"
FT                   /protein_id="ADN97513.1"
FT                   /translation="MENQYKVELHNVTKEYDLYRSNNDKLKHFFNIGNVDVPRFWSLKG
FT                   VSLNVKPGEALGIIGINGSGKSTISNIISGIIPQTTGTVDVHGDTSIISIGAGLKWNLT
FT                   GDENIRLKGLMQGLSIKEIQAVRDDIVDFADIGDFIGQPVKDYSTGMRSRLGFAIAVHI
FT                   NPDIMIIDEALSVGDDTFYQKCVDKIMEFKKQGKTIIFVSHNLRQVELLCDRVAWMHFG
FT                   DLLEVGETKETVDHYRKFSKDFKAQTAAYRKKYQVGKKKEQADFDIVAYERQLVEEKAK
FT                   DSDKSKQAVSRQVHRTLYKQILPEKMTIATKLVMLVAIVLFVFFALVNVSGHSVTSAIE
FT                   NPTVLLHPVNHYIKSQSVLFNSK"
FT   gene            312132..312272
FT                   /locus_tag="LPST_C0290"
FT   CDS_pept        312132..312272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97514"
FT                   /protein_id="ADN97514.1"
FT                   /translation="MGDCDGNHPFFVCIQDGFGWNKVQYNVAHYSDWGPLMLLFEGTSL
FT                   G"
FT   gene            312468..312740
FT                   /locus_tag="LPST_C0291"
FT   CDS_pept        312468..312740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0291"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97515"
FT                   /protein_id="ADN97515.1"
FT                   /translation="MDTPLFLNVVAYVLLILVLQYIKFKFPDSTFIRFFQKYGWWLIGL
FT                   CFVAILVILAAPQFQNPFNALDVPAIGVMLVFGYFFIKDKKSKHK"
FT   gene            312967..313509
FT                   /locus_tag="LPST_C0292"
FT   CDS_pept        312967..313509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0292"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97516"
FT                   /protein_id="ADN97516.1"
FT                   /translation="MYELFILGQLMDHPMTGYQLRKALVNVVGSELTISFGALYPLLDK
FT                   LAAAEELTLAFKRTTNKRPQKLATITAAGRTQFWQLVMTPVALNKQTQLTFQIKLNFLH
FT                   LLSCDQQQVILLDFQQFAQGQVARLTAQHKRVMTNTHMLAADIQDALMVNELQRVRAQA
FT                   QLDWLDRQLRNGGEVKG"
FT   gene            313506..314951
FT                   /locus_tag="LPST_C0293"
FT   CDS_pept        313506..314951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0293"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97517"
FT                   /protein_id="ADN97517.1"
FT                   /translation="MKTMSFATDPQIQKHRWWILVAVCLFTFMSTLDGSIVNIALPVMS
FT                   KDLAIPMNQAEWVVSIYLIVICALLLLFGKLGDIYGKIRVFKIGSLLFIIGSLLSGFSV
FT                   GLPFLLIARSIQAVGAAMTMSTNNGIITEVFPFKERGRALGMIGSFVALGSIAGPGIGG
FT                   LILAHLSWGYIFWINVPVGILAMILGAMILPKDVTTTQQPLDKTGAGLFAVLMVALFAG
FT                   VFIGQQIGFLQPVILALFAVAIVTLIIFVRVELRHENPLLALQLFKNARFSISILCALL
FT                   IFIANFFFNVIAPFYLENARGLAANYAGYALMVFPIVQVVVAPIAGTISDKIGPELLTF
FT                   VGLVLISISQVGYMVVGLATPLWFFLLFVGLVGFGNGIFMAPNNSIVMSSVAVKDLGVA
FT                   GGINALARELGMIVGISVATTVLYSAMSQSAGYKVTSYLPAHPEIFIDGMHIAFVVSLG
FT                   ICLVATVITGGRLLKHRRTAPAK"
FT   gene            complement(315281..316597)
FT                   /gene="amtB"
FT                   /locus_tag="LPST_C0294"
FT   CDS_pept        complement(315281..316597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="LPST_C0294"
FT                   /product="ammonium transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97518"
FT                   /protein_id="ADN97518.1"
FT                   /translation="MNAANSTFLVLSSILVLFMTPGLAFFYGGLVSKRNVVNTMLSVFM
FT                   ICGLAILLWLAFGYSLSFSGDLGGFVGNLKATWLHGVDLTALTATKIPNGLYLIFQMMF
FT                   AIITPALFVGAVVGRIRFKFLLTFIIFWSLLIYYPMVHMVWDNGLLAKLGVIDFAGGTV
FT                   VHINAGITALVLSAFLGARHKYGKDMTQHYNILWVLLGTAILWIGWYGFNAGSALAMND
FT                   IAIQAFLTTTVATATSMMTWMVVDMLTKGKPTLVGVCTGTLCGLVAITPACGYVTISGA
FT                   FWIGLIATLTSYGFITFIKPRLGIDDALDAFGCHGVSGMVGSIMTGLFASKAVNRTISL
FT                   NGLFYGGGFKLFGLQLLATIFTIGFTTIVCIVIIVLLKRVIRMRVDEREEELGLDQGEH
FT                   GEVADYTVQMSHDLTNIQHHSDEFRGQLAQLLDKQQRFR"
FT   gene            317092..318051
FT                   /gene="hicD1"
FT                   /locus_tag="LPST_C0295"
FT   CDS_pept        317092..318051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hicD1"
FT                   /locus_tag="LPST_C0295"
FT                   /product="L-2-hydroxyisocaproate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97519"
FT                   /protein_id="ADN97519.1"
FT                   /translation="MRKYAIIGVGHVGATIAYTLVCKGIADELVLIDTNAAKARAEQLD
FT                   LQDAQARLDSRTIIKINDYHELDDTDILFVTSGNIHALDHASGNRWAEFEYTKQIVQDI
FT                   APKVKATKFNGVVIDTMNPCDAITHYFQRATGLSRQQVFGTGTFLDTARMQKVVAEAFD
FT                   CDPKNISGYVYGEHGESQFSAWSTVQVNGIPITSLVDKYHLDLDALEAAARHGGWAVHS
FT                   GKGYTSFAIATCAVKLSEAVFANARLACPVSAYSETFETYVGQPAIIGKDGVESVTTLA
FT                   LTADEQAKFRNSADTIIEKFHAFDDVLSDQSVKKRQQA"
FT   gene            318154..318423
FT                   /locus_tag="LPST_C0296"
FT   CDS_pept        318154..318423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0296"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97520"
FT                   /protein_id="ADN97520.1"
FT                   /translation="MRRQLTNRQRWFVIVIATILGVGCALLGQWGQFFGVIAATFALML
FT                   LTSGCLTFCHRRGWQPGSGMLLALVTATGYVLVILGSYGYLLHS"
FT   gene            complement(318654..319217)
FT                   /gene="zmp1"
FT                   /locus_tag="LPST_C0297"
FT   CDS_pept        complement(318654..319217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmp1"
FT                   /locus_tag="LPST_C0297"
FT                   /product="extracellular zinc metalloproteinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97521"
FT                   /protein_id="ADN97521.1"
FT                   /translation="MKNKYSAKLGLTTLTVIFGLGLTPIANAKSIATPYSRSRWPHAQV
FT                   TYVIQASSYERHVYQAAIQAWNATGHFKFVPGTTAHHQITLGTSNATSGQYYRLAGITF
FT                   STGYTNGYYTKAQVYLLTRNFVRYHYSYTDQVHVAEHELGHTIGLEHSRDRHSVMLADN
FT                   RYNGISAADSAAVRLRYRLPVGRL"
FT   gene            319411..320079
FT                   /gene="rpiA2"
FT                   /locus_tag="LPST_C0298"
FT   CDS_pept        319411..320079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA2"
FT                   /locus_tag="LPST_C0298"
FT                   /product="ribose 5-phosphate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97522"
FT                   /protein_id="ADN97522.1"
FT                   /translation="MTIKQAIVQQALTLIKPQMVVGFGGGSTVGELVKEAANHVNDITV
FT                   VTPSPTTCQLATVLGYTVVDTAYCDRVDIAFDGCDQLDHHGNALKSGGGIHANEKIIAS
FT                   LADEYWLLTMQDRLVDQFDIKTPLVLEVLPAALSLVMRTVSDLGGQATIRTANNRDGFT
FT                   LTDSGNLLIDCHFPTYAKLTDLNVELATLAGVVETSYFDHLVTNAWLGDAATNTVKALF
FT                   "
FT   gene            320237..321742
FT                   /gene="sufI"
FT                   /locus_tag="LPST_C0299"
FT   CDS_pept        320237..321742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufI"
FT                   /locus_tag="LPST_C0299"
FT                   /product="cell division protein SufI"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97523"
FT                   /protein_id="ADN97523.1"
FT                   /translation="MAKKVYTDYFFDEPAYNTHDGGYIPLVTPKVDPQPLAIPPLLKPD
FT                   RQTDTDDYYTVTAQESETQFLPGKKTKTWGYNAGFLGQTIVFRNGKQTHIDLENKLPEL
FT                   TTFHWHGLNVPGPITDGGCHAPVYPGETNHIDFKVHQPAATTWLHAHPCPSTATQVWKG
FT                   LATMVIIKDDVEDQLPLPRNYGVDDIPLVLQDREFHDDNQFDYRADYDPDGVQGHTALV
FT                   NGTVNPYFDVTTQRVRLRILDGSNRREWRLHFNDDLEFAQVASDGGILPAPVYMTKVMM
FT                   TCAERDEIVVDFGQYQPGDEVTLMTDDTPLCRFRIKSFVPDDTKLPEHLVDIPDETPTP
FT                   DLPVRTITMDGMDDEVALDGKKFDMSRIDARQKVGDVAIWEIRNTNSTENGMVHPFHVH
FT                   GTQFRVLARNDGPVYPNEHGLKDTVGVNPGETVRIKVKFELTGVYMYHCHIIEHEDGGM
FT                   MAQIESYDPQHPQTYHLMDMDTLRNAFAKEQGIKPEDVWMPGM"
FT   gene            322007..322375
FT                   /locus_tag="LPST_C0300"
FT   CDS_pept        322007..322375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0300"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97524"
FT                   /protein_id="ADN97524.1"
FT                   /translation="MHVAAMIMAILVAVEHLFILWLEMFNADSEMAAKAFGIPRQTLQS
FT                   PSVQLLFKNQGLYNGFLAVGILYSLFVIPAVASVGATLFFLACVMVAAVYGSITVSRAI
FT                   VVIQGLPALIAFILMYFA"
FT   gene            complement(322488..322997)
FT                   /locus_tag="LPST_C0301"
FT   CDS_pept        complement(322488..322997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97525"
FT                   /protein_id="ADN97525.1"
FT                   /translation="MQLSIPTINGALAATYSKQAAVAQTYKGHPIISFPVDISDVPAGT
FT                   HSLAFTFVDHDAIPVGGFTWIHWIAANLPATTTHIPENASQTGAIPMVQGNNSTAGAYV
FT                   HETDPKVSQHYVGPYPPDKDHRYSFKLFALDTELDLQPGYWLNEFHDAIAGHVLATAKT
FT                   TVIGKV"
FT   gene            complement(323028..324224)
FT                   /locus_tag="LPST_C0302"
FT   CDS_pept        complement(323028..324224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97526"
FT                   /protein_id="ADN97526.1"
FT                   /translation="MSSTISAATFKLNDQAALSPAQQSLEHQLLTFIRTHRQQKQPSLF
FT                   VIHGDAGTGKSAVLAAAFARLQALNRSLTPNDLQATDNYLVVNHNEMLKIYKRLAGEDP
FT                   VLRKKDFQKPTPLINRLAKDHRQADVVFIDEAHLLLTQPDRYNRFTGHNQLTELINHSR
FT                   VVVLVFDTRQVLKLKSYWHSNDLKPFLDQYPHANYNLDEQFRVTGGADVVDWIDGFTRG
FT                   QLQPKPVSDNFDLRFFDDGQPLYDLIKQRDQQYGLARMVATADFPYVVNHGTWYVTAGQ
FT                   LKLPWDKVNLTDDPWALRPETLNEVGSIYTIQGFDLNYAGVILGPSVGYDEDHDQIVVR
FT                   PERYEDQEAFKNRTDLGDLRPLKQQIIFNSINVLMKRGRYGLYIYAVDPALRQRLLAL"
FT   gene            324319..324804
FT                   /locus_tag="LPST_C0303"
FT   CDS_pept        324319..324804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0303"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97527"
FT                   /protein_id="ADN97527.1"
FT                   /translation="MGGSNMKLDFSVAVHSILYLDAHRDSKVASRELAQSLHLNPVMIR
FT                   NILSVLHKHGYLTGTVGKNGGYQLDLALADMNLGDLYDLTIPPTISYARFITGPSKTDE
FT                   QADQSPIAANISETLTDLFTVADRQYRAYYHQFTMADLQADLNHHGTFLQHEQDSES"
FT   gene            324823..325278
FT                   /locus_tag="LPST_C0304"
FT   CDS_pept        324823..325278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97528"
FT                   /protein_id="ADN97528.1"
FT                   /translation="MKNKAIFVNNLNLKRVCHSGLSGLIIGAILDVIMKVALRLKGALA
FT                   MTARLVLIHEVGRYRELSEQRYWLESADFWGVDGRGATVNEAVGNFLTNLVQYCRDYYQ
FT                   RGLWQLDDRLLQLDHVDTVLAYAQAGKSPAPLFLFKLVPADHELASA"
FT   gene            325382..325954
FT                   /gene="accB3"
FT                   /locus_tag="LPST_C0305"
FT   CDS_pept        325382..325954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB3"
FT                   /locus_tag="LPST_C0305"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97529"
FT                   /protein_id="ADN97529.1"
FT                   /translation="MELDKIYQLMDKFEQSSLTSFEYRDQDFEIQMGKKGHGKTTVTPQ
FT                   PAPLPNQPVIDPTPVTPTPVSTVSTPVVAEAEPTPVATSMASNPTSVVTPDPEPEPAPI
FT                   DPKECVTAPVVGIYYPAHSSEEAPYVKLGDHVSVGQQVGLIQAMQMMRPVVAKQAGTVK
FT                   AFLVKNGEEVNFGQPLIQLIPDTPDDI"
FT   gene            complement(326120..327040)
FT                   /locus_tag="LPST_C0306"
FT   CDS_pept        complement(326120..327040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0306"
FT                   /product="ribonucleoside hydrolase RihC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97530"
FT                   /protein_id="ADN97530.1"
FT                   /translation="MSTKIIMDTDPGIDDAAAITFALNHPDLDLQLITTVAGNVTVDKT
FT                   TLNALKLTRFFNSDVPVAGGAAQPLIKPFEDAVRIHGVSGMPGYDFPTDLAKPLPETAV
FT                   EALRDYIMAAEQPITLVPTGAYTNIALLFKTYPEVMPHIKEIVAMGGALGKGNMTSAAE
FT                   FNVFTDPHAAEIMYQSGVPITMVGLDVTMKALLTRESIEQLPTLGKTGEMLHALFGHYN
FT                   DRNQTGVAMHDVNTLFYLLHPEAFTTEKMWIDVQTEGPANGETVGDIRGAYHDGKTNAT
FT                   VCVDIDAAAFNKWFLETVAAIDQPK"
FT   gene            327177..328088
FT                   /locus_tag="LPST_C0307"
FT   CDS_pept        327177..328088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0307"
FT                   /product="short chain dehydrogenase/reductase family
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97531"
FT                   /protein_id="ADN97531.1"
FT                   /translation="MSQPRVILITGASSGIGKATALKLQAQGNIVYGAARRIEKMTDLA
FT                   AAGVHVLKVDVTDEATLIAAVKTIQVEQGRIDVLINNAGYGSYGSLEDVPVAEGEYQFK
FT                   VNVFGVMRLTQLVLPLMRAQHRGRIINVSSIGGKIYQPLSAWYMGTKHAIEGMSDSLRM
FT                   EVAPFGIDVVIVEPGGIKTEWAGIAEKKLLAVSGETAYHEQAVKVGAMLSLFDQFASNP
FT                   GVIAKLMVHAVNDVKPKTRYHAGMGAGVSLTARQWLSDRQFDRMMNSAVNGAAKLSKVT
FT                   RRKDRRTGSRHYRHGKIPANNN"
FT   gene            complement(328835..329125)
FT                   /locus_tag="LPST_C0308"
FT   CDS_pept        complement(328835..329125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97532"
FT                   /protein_id="ADN97532.1"
FT                   /translation="MSALTTALATLKRHDLPVHVHTTTEQVAAVISEQRYLSWRQNNWD
FT                   VPEADQPDLPQWQTLIPIIEEFPNLTITYHPVDDPAMTTATTTLTAVMTKL"
FT   gene            329519..331045
FT                   /gene="choS"
FT                   /locus_tag="LPST_C0309"
FT   CDS_pept        329519..331045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="choS"
FT                   /locus_tag="LPST_C0309"
FT                   /product="glycine betaine/carnitine/choline ABC
FT                   transporter, substrate binding and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97533"
FT                   /protein_id="ADN97533.1"
FT                   /translation="MQTLIQTFMDRRGDLLTALWQHLGISLASLVIAMVIAIPLAIWVV
FT                   RRPRWAEGLLQLTSVLQTIPSLALLGLLIPLVGIGTVPAVIALVIYALLPIFQNTYLGI
FT                   SEIDASIEEAADAFGMSRMRKLFKVELPIALPQIIAGIRTALVLIIGTATLAALIGAGG
FT                   LGTFIMLGIDRNDTSLLLIGAISSALLAILLSALVRWFQTAKPRHALIVFVGILALLGG
FT                   GGAYSVYANRVETITIAGKLGSEPEILINMYKQLIEAEDEHVHVTLKPNFGKTTFLFSA
FT                   LKNNQVDIYPEFTGSVLETLVKGNNPAGQTANQTYQLAKQRLAKQEQMTYLKPMQYNNT
FT                   YALAVTKKFQQEHHLKTISDLTQVESILKPGMTLEFIDRNDGLKGIKKTYGLDVTAKSM
FT                   EPALRYEAISKGKINLVDAYATDSELRQYHLALLKDNKHFFPTYQGAPLMKTSFANKHP
FT                   KVVKALNKLAGKISETDMQEMNYEVNVKKQSASTVAHRYLVKHGLLKEGR"
FT   gene            331046..332017
FT                   /gene="choQ"
FT                   /locus_tag="LPST_C0310"
FT   CDS_pept        331046..332017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="choQ"
FT                   /locus_tag="LPST_C0310"
FT                   /product="glycine betaine/carnitine/choline ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97534"
FT                   /protein_id="ADN97534.1"
FT                   /translation="MTTAIEFQHVQKDFNGQTVIPDLNLTIDQGELFVLVGTSGSGKTT
FT                   SLKMINCLEPLTAGKILVNGTDTTTIPVRSLRWQMGYVLQQIALFPTMTVAQNIAVIPE
FT                   MKGTAKKEINQTIDELLAEVGLDPKEYRDRMPSELSGGEQQRIGILRAIAAQPDIVLMD
FT                   EPFSALDPISRQQLQDLVLRLHARYHNTIVFVTHDMNEALKLGDRIGVMQHGQLIQVDT
FT                   PAALAQHPVNDFVRNFFGASRAKNVYDVYVGRVGLIQGYLTEEPSVASGRIQSLDVQAT
FT                   LRTAFTALTDHDYVAVTEENRVVGYLDRQRIVAYLSQHEEVS"
FT   gene            332095..333426
FT                   /gene="gshR1"
FT                   /locus_tag="LPST_C0311"
FT   CDS_pept        332095..333426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshR1"
FT                   /locus_tag="LPST_C0311"
FT                   /product="glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97535"
FT                   /protein_id="ADN97535.1"
FT                   /translation="MAEQYDVVVIGGGPAGNAMASGLKAQGKTVLIVEADLWGGTCPNR
FT                   GCDPKKILLSAVEARQAAQHLQGQGLIGAPKIDWPALMAHKRGYTDGINDGTLNGLTGQ
FT                   DIATLHGQAHFQSDNQLAVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLDLDQ
FT                   MPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLMAAMTADGIT
FT                   FDLNTDVQAITKTATGLQLTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQ
FT                   VNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVGELTHPGAAIKYPVVPTQVFA
FT                   APKLAQVGISAAVATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGAT
FT                   LLSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY"
FT   gene            333892..335409
FT                   /gene="glpK"
FT                   /locus_tag="LPST_C0312"
FT   CDS_pept        333892..335409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="LPST_C0312"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97536"
FT                   /protein_id="ADN97536.1"
FT                   /translation="MTDKYIMAIDEGTTSTRAIIFDHAGHKVADSQREFPQYFPQPGWV
FT                   EHNANEIWNAVLSTIANAFIESGIKPAQISGIGITNQRETTIVWDKQTGLPIYNAIVWQ
FT                   SRQTAPIAEKLVKDGYGDLIHQHTGLVTDAYFSATKIRWILDHVKGAQERAEKGELLFG
FT                   TIDTWLLWKLTGGATHVTDYSNASRTMLFNIHDLKWDDQILQLLNIPAAMLPEVRTNSE
FT                   VYGKTKDYHFFGSEVPISGMAGDQQAALFGQLAFEPGTVKNTYGTGAFIVMNTGEKPQL
FT                   SDNNLLTTIGYGINGKVYYALEGSIFVAGSAIQWLRDGIRLVESAPDSERAARESHNEN
FT                   EVYVVPAFTGLGAPYWDSEARGSVFGLTRGTTREDFIKATLQALAYQTRDVVETMKKDS
FT                   GIEIPVLKVDGGAARNDWLMQFQADILDTQIMRAANLETTALGAAFLAGLSVGYWQDLE
FT                   ELKASYKPGTSFDPEMGPAERTNLYEGWQAAVKATQVFKHTPYHAGK"
FT   gene            335424..337253
FT                   /gene="glpD"
FT                   /locus_tag="LPST_C0313"
FT   CDS_pept        335424..337253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="LPST_C0313"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97537"
FT                   /protein_id="ADN97537.1"
FT                   /translation="MAFSATTRQQNIERLQNETLDLLVIGGGITGAGVAIQSTAMNMKT
FT                   GLIDMQDFAEGTSSRSTKLVHGGIRYLKTFDVGVVADTVKERAVVQGIAPHIPKPDPML
FT                   LPIYDETGATFDLFSVKVAMDLYDKLAEVKDPKFTNYTLSREEVLQREPQLNPKHLVGG
FT                   GVYLDFRNNDARLVIENIKKAHENGGIMASHVKATGLLHDDDGRINGITAEDLLTGASF
FT                   EIHARIVINTTGPWSDTIRKMDHTEKYQSQMRPTKGVHLVVDAEKLPVPQPTYFDSGDQ
FT                   DGRMIFVVPRENKTYFGTTDTDYHGDLKHPTVTQEDVDYLLEIVNRRFPTAKITLDDIE
FT                   ASWAGLRPLIAANGSSDYNGGNSGKISDKSFKEVIKVVDQFESQEASREDVESVLNDLE
FT                   TSLAEDKLSPSAVSRGSSLTSSPDGLLTLAGGKITDYRKMAAGAMALIAKILADKYDAH
FT                   FNEINSKNLPVSGGDIDPHNVDATIAFYAKQGTDNGLTNDEALRIANMYGSNAARVFSL
FT                   IGKVEPTHGLSLAETISLRYALDEEMTLTPVDYLLRRTNHLLFMRDTLDSLKDGVIATM
FT                   ADYLGWDTATVKAQTELLNQTIAESDLTALKQG"
FT   gene            337268..337990
FT                   /gene="glpF3"
FT                   /locus_tag="LPST_C0314"
FT   CDS_pept        337268..337990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF3"
FT                   /locus_tag="LPST_C0314"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97538"
FT                   /protein_id="ADN97538.1"
FT                   /translation="MMKDPLALQLLGEFLGTFILILLGDGVVAGVTLNKSKAQNAGWVA
FT                   ITLGWGFAVTMGVYASSFMSPAHLNPAVSLGMAVAGKFPWAYVIPYSAAQIAGGVIGGL
FT                   VVWLHYYPHWQATKDAGAILGIFATGPGIRRYFWNFISEVIGTFVLVFGLLAFTKGQFT
FT                   AGLNPIVVGILIIAIGLSLGGTTGYAINPARDLGPRIAHAVLPIANKGTSDWAYSWVPI
FT                   AGPLVGGALGALLFNVLP"
FT   gene            338573..342256
FT                   /locus_tag="LPST_C0315"
FT   CDS_pept        338573..342256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0315"
FT                   /product="cell surface protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97539"
FT                   /protein_id="ADN97539.1"
FT                   /translation="MYTENTGKHHRNGLPVWLLPLLVVISFWGVSQNIMVVDASSSVTV
FT                   LPGNGGTLPLVNQLVIKQNDTALQGITNNAGDRGSLTPKNGAQRVLIHKVKDSDTITST
FT                   YGTVGTFHGQEVTAKVTISHIKVHDDSHKAPSGMKQTDGAFQIGPGFSSDTTMSNVAQF
FT                   NVSYEFYYADTHAAVNIQNAFITLSSLDGPVAGTSTGFEYTAYLGAGKIYTVENSIVKQ
FT                   IANPLGGGQLVMAGQTARDASWPYTSSTAATFGVSGTKLEFIYGTTRVNSGNSWLQPVY
FT                   NVSTITLGTPAIATPTLSATQSATDKQNRTLTYDLQQKVNVLDQDLMTKYKDWSENITI
FT                   PANAKYAKGEVVNDAGQALPSTAYQVSYDEKTHQVKWHLTDAGIKSLPFKGETYHFKAQ
FT                   VQFSDDVDDQAKVTATGQTAIDKQIKTSNTVTNTIDNQATITVHHYMTDSTDKVAPDET
FT                   VKVGYGKAYDVTKQVKTITGYKRNATLDKHTRGTASKTTKEAVMYYDPLPYNIHVNYLL
FT                   TDGQKLDELDVTGLYGDTYTTEATDFEDLYTVDTDRLPTNAQGTVTEKPTTVNYYYQPT
FT                   TGQWVDVGNQSSVLVRQDTKHNVRSVSQIYANDSGFTVKYNQDAAQVAIAASDTNGTQD
FT                   NSLVFDYNSKYTFELSKNETVTFKVDDQGQVTATRVLGAEQTVTTFDKSGQLKTVTTVT
FT                   NANGTKSQQTNTVDGLKSMVTGEQYDLGLLNGLKVTAQKEINPSQAATTESKTTTDTSQ
FT                   SGSNQSTSTTATDQTGTNESTAGSSTNATNASSSVDASSANSQGDTEATSQSGTSASAD
FT                   SKTDSSVASSTSQTTDGETTNTGDTTTGTTTGSGLGFKSPFTEDQNTSSALGSAQTSSS
FT                   LNSDTSAAVQALIAEPNSTPVVLDEDASFEEGVPVNDPVFSNDEGVSPNNNPSSAATPL
FT                   AQATNTRARLTQNGKLLYEGTLKADQGEQNLYVSPDTTVEVDGGADGDGFYLDTYDGDK
FT                   GMAYTLGSGYAWAAENNDVTAAPASSATTSSESAASEPSVNSSDSSRTASSAVDHSTSS
FT                   ASTSDASQSSHSTSSGESSHPESSSGSSTTSDSADVDKQAAARSSQTQSNSVNGSSQAV
FT                   SSSTVTSQSSVPTKANTKQASSTPTTKANRATVAAATSSTAPRQSRATTASASVPSVTS
FT                   ASAAAASRDKQRSAFKKQHPILNQILPKTNSAVATWLVWLGVGLLLLTVAITMVIKKRG
FT                   RD"
FT   gene            344054..344971
FT                   /locus_tag="LPST_C0316"
FT   CDS_pept        344054..344971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97540"
FT                   /protein_id="ADN97540.1"
FT                   /translation="MTKRLSEQESYFSMSEFLDSYYWASKDDDLGSLLGSVTLWSDDGE
FT                   LFDQAIAEDWHAFFSDVSNENHTVFESFQAVKQFVNEYLPDIAATTPVSGSLTYNIRII
FT                   CEMTESQRNQEPVWQNWVAAVNWITNPNVVPVNESPFLKTGQSLPNPKEKGFRQNQFPI
FT                   AKVLPAPRPEIPMGPSLEKVDLTQSYYAFVKFLQHYYQVSDDSELGNFLQQNRAISENN
FT                   EEYRYWKGKFLRCSGNKKLLDILKAFLMVRDYFEIEFPDNALHTHPVRKLSCNLWKAAY
FT                   LPHSQRVQTEVWQNWLTAVHQVME"
FT   gene            345015..345278
FT                   /locus_tag="LPST_C0317"
FT   CDS_pept        345015..345278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0317"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97541"
FT                   /protein_id="ADN97541.1"
FT                   /translation="MLVIVVIGLFLLAVTLGLGYWSYLLGKRNQSNLVGTIIPVAYFVV
FT                   RAILAWMTQTTTHGLVSSLVGSLLFSLIYYGLFVWGKHRANK"
FT   gene            345390..345668
FT                   /locus_tag="LPST_C0318"
FT   CDS_pept        345390..345668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0318"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97542"
FT                   /protein_id="ADN97542.1"
FT                   /translation="MLVFIVIGLITAVITIGLGYWSYILGKRNKSNLVGSVIPVGYFIV
FT                   RLVFVLVLGEGVRELITSLVGNLVITVIYVLLFVWGRQRLNRQKQTK"
FT   gene            345756..345962
FT                   /locus_tag="LPST_C0319"
FT   CDS_pept        345756..345962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97543"
FT                   /protein_id="ADN97543.1"
FT                   /translation="MTNLVRYNDIYTMITGKVAVTGKKCLCLAGVAWTSLNSVPVSGKQ
FT                   RSEVEHMDVDENWWYESVLNKVQ"
FT   gene            346048..346434
FT                   /locus_tag="LPST_C0320"
FT   CDS_pept        346048..346434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97544"
FT                   /protein_id="ADN97544.1"
FT                   /translation="MNIEEINSEILKVNNYLKKCLWMDFEFASVDGGDIVVAGRIDTSY
FT                   DEFAINIDFGKTYYLSSLLYWNLNNSKPFIELAAGKEMWEIIDKYQVEGGNYIFKINAE
FT                   DFDTAPIIIASKGLKVEIINKDPF"
FT   gene            346696..346815
FT                   /locus_tag="LPST_C0321"
FT   CDS_pept        346696..346815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97545"
FT                   /protein_id="ADN97545.1"
FT                   /translation="MQLLNVLDHIHDLLDKTVMGMAMEKVMLDLVKVFENSKK"
FT   gene            346884..347075
FT                   /locus_tag="LPST_C0322"
FT   CDS_pept        346884..347075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97546"
FT                   /protein_id="ADN97546.1"
FT                   /translation="MRKRTQTNLVDVIIPVAYFAVRAILAVMIQTTTHGLVSSLVGSLL
FT                   FSLAYYGLSAWGKCLANK"
FT   gene            347501..347908
FT                   /locus_tag="LPST_C0323"
FT   CDS_pept        347501..347908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97547"
FT                   /protein_id="ADN97547.1"
FT                   /translation="MFKLSTEDLKIYILERVSRLGNINIKEYNFLENKHGSEDGFYIYS
FT                   DGQRYHFVYSERGTENKHNVTDNLFEITYWVISSITDTLAIRYMRTHILPNQSQRKIIF
FT                   DKKLSLLSIVGENYKKAGEIEISEILKTSPL"
FT   gene            348451..348588
FT                   /locus_tag="LPST_C0324"
FT   CDS_pept        348451..348588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97548"
FT                   /protein_id="ADN97548.1"
FT                   /translation="MSPENQIKQLKGFSVADELASDFSDITLNYAKKLFENAWITTKQY
FT                   "
FT   gene            complement(348760..348903)
FT                   /locus_tag="LPST_C0325"
FT   CDS_pept        complement(348760..348903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97549"
FT                   /protein_id="ADN97549.1"
FT                   /translation="MFLLTELILISIKRLFLINKSIQDALNHQPQQISGYQAGIDILPS
FT                   LD"
FT   gene            349179..349454
FT                   /locus_tag="LPST_C0326"
FT   CDS_pept        349179..349454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0326"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97550"
FT                   /protein_id="ADN97550.1"
FT                   /translation="MLVFIVIGLITAVITIGLGYWSYILGKRNKSNIVGSVIPVGYFIV
FT                   RLVFVLVLGEGVRELITSLVGNLVITVIYVLLFVWGRQRFNRQKTK"
FT   gene            complement(349836..350453)
FT                   /gene="thgA1"
FT                   /locus_tag="LPST_C0327"
FT   CDS_pept        complement(349836..350453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thgA1"
FT                   /locus_tag="LPST_C0327"
FT                   /product="galactoside O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97551"
FT                   /protein_id="ADN97551.1"
FT                   /translation="MTNNNDRLHTGELYLPNDPELEKRQFGYLDQLYDFNQTRPSELTK
FT                   RQILLSKMFAEIGPKCYIEPPFHSNFGGHHVHFGKGVYANFNLTLVDDTHIYVGDYTMF
FT                   GPNVTIATAGHPILPSLREQAYQYNMPVHIGRNCWFGAGAIVLPGITIGDNVVVGAGSI
FT                   VTKDLPDNVVAVGNPAHILRHINDHDRLYYFKDRQIDPSLLN"
FT   gene            complement(350457..351611)
FT                   /locus_tag="LPST_C0328"
FT   CDS_pept        complement(350457..351611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0328"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97552"
FT                   /protein_id="ADN97552.1"
FT                   /translation="MQPRLTTTISILSLSTVTGITTVITGIIPQLKRTFPTVPTTLIEW
FT                   LVTIANCSALITLLLNPRLTSRWGLRPIVISGLLISAIMGLIPAITTNFTVIMVSRLGL
FT                   GLGVGLFSPHAISLLTHSFTGDLRARLLGYQTGLSALGNAILLGLAGLLISLSWHAVFW
FT                   LYGLLVIVAGGVAWFVPEPTVPSTTTNHARTEKTQLPRHQWTLLGLTFITYLLIWGVQL
FT                   KLPSYFSARHFGNAATINLTLAAMNIGGLLAGLTFGYLYRYLHRFTLTLGYAGAAISVL
FT                   VLWLASNATVAIGAAVFFNFIYSYTGPYLVFTSNTGLDTIQVNVLSSYLTIATIISAFF
FT                   APLVWNSLGQLGPQTLTANVLIWIMLILGGLALITGSHHPRKEV"
FT   gene            complement(351615..352406)
FT                   /locus_tag="LPST_C0329"
FT   CDS_pept        complement(351615..352406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0329"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97553"
FT                   /protein_id="ADN97553.1"
FT                   /translation="MIKLMATDMDGSFLRDDMTYDEAQFALLYQQLQLRGVRFVIASGN
FT                   QYFQLKSFFKDYPEMIYLAENGAYIRDADHVYALNAFQPDAIQTILNKIQTIPDLKLLV
FT                   CGAKSAYTLTTTNPEHVAQMRHYYHHLAVVESYDQLDDDIMKFAITCPPERTTAIVTQL
FT                   RELLTGIAEPTSSGHGDIDIIQPGMNKAAGLAQLGQVLGIDLADMAAFGDGGNDLEMLR
FT                   EVGCGVAMANAQPAVTAVANATTGTNQEQGVLQWIKNWLEA"
FT   gene            complement(352477..353349)
FT                   /locus_tag="LPST_C0330"
FT   CDS_pept        complement(352477..353349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0330"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97554"
FT                   /protein_id="ADN97554.1"
FT                   /translation="MKILHETVQTIPRLPFKYYEHDPLTDINVAPHWHQGIELNYLVSG
FT                   TTLKFVTDGQTNEYRPGDLWTTNRRVVHSASGPTEVDWVEFGIIIDDDFLQTQIPASAN
FT                   WQLTLNGAASSKTHPQAYADVRQQLVTIHDLLTTPTTDLLRLQILSHFYQLLVTLGQTF
FT                   TVPLTATTVSPNLTLTDTVMTAINQHYAEPIDGNTLAEQFHVSLTTLNQQFNANVQLSV
FT                   NRYLRLIRLMNARRLLLETDHKIEYIAMQCGFPNSKTFNRNFKSWKGMTPTDYRQAYAR
FT                   YHRIDTSCL"
FT   gene            353623..354324
FT                   /locus_tag="LPST_C0331"
FT   CDS_pept        353623..354324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0331"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97555"
FT                   /protein_id="ADN97555.1"
FT                   /translation="MVLCTGRPLAGAQHYLDALGLAGDDQYVITYNGAVIESIAGRIVA
FT                   KHLVDNAHYRQLTAFGKQHHVPFNVLDADSTIYTADRDVNWVTVVQAWENKAGLLIRDP
FT                   DDLPADFQIAKGVFVGEGPQLDAVEAQVKTTFGRDLYVVRAATNFLELMHTGVNKGQAV
FT                   QDLAAALEIQPDEVMALGDEQNDLPMFAFAGTAVAMGNGSDIAKAHADHVTATNDANGV
FT                   AAAIRQWALSD"
FT   gene            354850..356226
FT                   /gene="brnQ1"
FT                   /locus_tag="LPST_C0332"
FT   CDS_pept        354850..356226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ1"
FT                   /locus_tag="LPST_C0332"
FT                   /product="LIVCS family branched chain amino acid:cation
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97556"
FT                   /protein_id="ADN97556.1"
FT                   /translation="MQITRKLTIKHYIIIGSMLFGMFFGAGNLIFPIHLGQLAGANWLT
FT                   AGWGFLLTGTLLPLLGIIAISVTHSSGIYELARPIGKRYATIFMVLTCATLGPLFATPR
FT                   TATTPFQIGIASHVSSAQAQWYLLAYSLIFFSITYWAARRPTRIVDTIGKLLNPAFLIL
FT                   LALIFGIAFSRPLGTTNATPTAAYQHGAFLNGFLQGYNTMDALAALLFGIAVVTTIRGL
FT                   GQRDAGAIAKTAAKSSLLSISLEAVIYLGLIWIGATSLSQFKLSADGGIAFGQIANAFM
FT                   GTPGAIVLAIMATLTCLTTAVGLATSFAEALHAKFPKISYRAWNRLACGASFLIANIGL
FT                   DQIIAWSTPMLMFLYPLAITLIILAIASPLFHRDPLVYRWTTALTLIPAFIDGLGAAPA
FT                   LITRLGWVQTILAWDQRYLPLAKLGFDWALPAIIGLLIGLGWHYARRFQNAHAYKMSQD
FT                   "
FT   gene            356271..357455
FT                   /gene="napA1"
FT                   /locus_tag="LPST_C0333"
FT   CDS_pept        356271..357455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA1"
FT                   /locus_tag="LPST_C0333"
FT                   /product="periplasmic nitrate reductase NapA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97557"
FT                   /protein_id="ADN97557.1"
FT                   /translation="MDFLGILCLLILATTLAGHFAHRAGIPAVIGEILVGVILGPALLN
FT                   WVHLTTLVQTFSDIGVVVLMFIGGLESNLALLRKYLRPAIIVAIIGVIFPVVIMGLASR
FT                   FFQFSWFESLFIGVIFSATSVSISVEVLKEFKVLDTKEGATILGAAVADDIIGVILLSI
FT                   MIAMMGGQSGVAQTNLGIVLLEQVGFFIGVFIVIKWVAPYLMRLSDHLLMAASPTIMAI
FT                   IICLALAWLAELVGLSGAIGAFFAGVAIAQTDYQHVVDVSIEPVGYTTFIPLFFVSVGL
FT                   NMTFKGVWQSLPFIVVMTVLGVLTKLWGCGLGAKLNGFSRHSNYLVGAGMISRGEMALI
FT                   TAQIGFSAHLLSNDYYSDIILVIIVVTMIAPFVLKNAIHRAGQVTATHSIIEEH"
FT   gene            357840..358043
FT                   /locus_tag="LPST_C0334"
FT   CDS_pept        357840..358043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97558"
FT                   /protein_id="ADN97558.1"
FT                   /translation="MEEIISFEFSNGSKLLDSNVYEYKVGKEGTIKIDFPDSNGFVAVH
FT                   KNNTETAYIKAPYMKFCTGRHA"
FT   gene            complement(358278..358430)
FT                   /gene="plnR"
FT                   /locus_tag="LPST_C0335"
FT   CDS_pept        complement(358278..358430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnR"
FT                   /locus_tag="LPST_C0335"
FT                   /product="plantaricin biosynthesis protein PlnR"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97559"
FT                   /protein_id="ADN97559.1"
FT                   /translation="MLNKTINIIKKYPVRSLLVALIVVFAIYVISDPSIISSFNQGLSD
FT                   GAAGR"
FT   gene            complement(358455..359123)
FT                   /gene="plnL"
FT                   /locus_tag="LPST_C0336"
FT   CDS_pept        complement(358455..359123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnL"
FT                   /locus_tag="LPST_C0336"
FT                   /product="immunity protein PlnL"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97560"
FT                   /protein_id="ADN97560.1"
FT                   /translation="MIEIDFKEKYYPLVLVLFVAGYMGAIFLNIYFDWLAMLTAGIISL
FT                   VMLYGFSNLKLFFQPLPSPKWRIVVKYVLLLLVLEVTAIVVIAIINSHALLSFHNTTLT
FT                   TSSTGRDYPLIERVWIAFTLLVSLVGEEVGMASISLPLIRLLSQTQLKKYAWPIINVLG
FT                   CIVFACLHLPHYHFNWIYPLIVGITRYPITASWRSANTLRSGIYVHWISDAVLIIGTLI
FT                   "
FT   gene            complement(359120..359293)
FT                   /gene="plnK"
FT                   /locus_tag="LPST_C0337"
FT   CDS_pept        complement(359120..359293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnK"
FT                   /locus_tag="LPST_C0337"
FT                   /product="plantaricin JK family bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97561"
FT                   /protein_id="ADN97561.1"
FT                   /translation="MKIKLTVLNEFEELTADAEKNISGGRRSRKNGIGYAIGYAFGAVE
FT                   RAVLGGSRDYNK"
FT   gene            complement(359324..359491)
FT                   /gene="plnJ"
FT                   /locus_tag="LPST_C0338"
FT   CDS_pept        complement(359324..359491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnJ"
FT                   /locus_tag="LPST_C0338"
FT                   /product="bacteriocin precursor peptide PlnJ (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97562"
FT                   /protein_id="ADN97562.1"
FT                   /translation="MTVNKMIKDLDVVDAFAPISNNKLNGVVGGGAWKNFWSSLRKGFY
FT                   DGEAGRAIRR"
FT   gene            360353..360553
FT                   /gene="plnM"
FT                   /locus_tag="LPST_C0339"
FT   CDS_pept        360353..360553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnM"
FT                   /locus_tag="LPST_C0339"
FT                   /product="immunity protein PlnM"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97563"
FT                   /protein_id="ADN97563.1"
FT                   /translation="MLERITGFIIICFAIWQIYTAYLAFKQVKQVGNKSTSPFIALGVW
FT                   SGLSFGILMVAFGIALAFNAI"
FT   gene            360681..360848
FT                   /gene="plnN"
FT                   /locus_tag="LPST_C0340"
FT   CDS_pept        360681..360848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnN"
FT                   /locus_tag="LPST_C0340"
FT                   /product="bacteriocin precursor peptide PlnN (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97564"
FT                   /protein_id="ADN97564.1"
FT                   /translation="MKSLDKIAGLGIEMAEKDLTTVEGGKNYSKTWWYKSLTLLGKVAE
FT                   GTSSAWHGLG"
FT   gene            360966..362165
FT                   /gene="plnO"
FT                   /locus_tag="LPST_C0341"
FT   CDS_pept        360966..362165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnO"
FT                   /locus_tag="LPST_C0341"
FT                   /product="plantaricin biosynthesis protein PlnO"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97565"
FT                   /protein_id="ADN97565.1"
FT                   /translation="MIKFKERGNVSFSNFRLKEHQCDYEPIIGLIMVKNQERRILQTLE
FT                   SIVNICDQIIMVDTGSSDNTVAIVESNYNSVLIKHVDWKEDYAAMRNKCLTFVPNDTWV
FT                   LFVDSDEIFSKEYNSEEIKSFLYEVDKRFPNQDKICTVKQMQPDRPTYVRPERFVKKTE
FT                   TLYYFGYVHEEPRTKRTEKLVKIDTDLELMNNGLTKGEYAKFNKQQRYAMLLKKNIALE
FT                   PDNPRWTSLISPIDIQLGLFEHDKYVEKLKKEILKDIHGDITENNVKQGEYLNYLLERY
FT                   CIELVHSENMELASKYIKFSKKKFPYDVTFIVLEMTIFFTSLEQASLRELKKIIDFTNN
FT                   TDFNIIDSESEGSEDALSAVVIKLLLLVEKFDQAKAVYKTISDPIAKELLNDEKKILES
FT                   "
FT   gene            362196..362942
FT                   /gene="plnP"
FT                   /locus_tag="LPST_C0342"
FT   CDS_pept        362196..362942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnP"
FT                   /locus_tag="LPST_C0342"
FT                   /product="immunity protein PlnP"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97566"
FT                   /protein_id="ADN97566.1"
FT                   /translation="MKNNDIITKIAICFVLVPIVLIVLPYLISPIISEKYGQMTVDLII
FT                   FLVAIVLSQNIWHIKISFLSLKKPLSQLCQLIPSILFLLFTRFSTLSSMSFRLIDARII
FT                   LTVLFIALAEESVYRGLLIPLSLVFTKNKQYTAIVISGVGFALAHLVNIVNSPWSIVML
FT                   QMLIVFASGLLWGTLYLKTNNLSLTIMLHFLDDLPLFLMKETSELVTPTRPQLISAIMA
FT                   YLIVVGIIGIITFLQVEGLHLWKLKK"
FT   gene            363296..363484
FT                   /gene="plnQ"
FT                   /locus_tag="LPST_C0343"
FT   CDS_pept        363296..363484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnQ"
FT                   /locus_tag="LPST_C0343"
FT                   /product="plantaricin biosynthesis protein PlnQ"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97567"
FT                   /protein_id="ADN97567.1"
FT                   /translation="MKSYNMKLNRDFYKAYSFWLGVLAVIGLVGDVLLKYNTAVSPWIM
FT                   ILIAIYLFLRAFTSKRK"
FT   gene            363820..363966
FT                   /gene="plnA"
FT                   /locus_tag="LPST_C0344"
FT   CDS_pept        363820..363966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnA"
FT                   /locus_tag="LPST_C0344"
FT                   /product="plantaricin A precursor peptide, induction
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97568"
FT                   /protein_id="ADN97568.1"
FT                   /translation="MKIQIKGMKQLSNKEMQKIVGGKSSAYSLQMGATAIKQVKKLFKK
FT                   WGW"
FT   gene            364157..365485
FT                   /gene="plnB"
FT                   /locus_tag="LPST_C0345"
FT   CDS_pept        364157..365485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnB"
FT                   /locus_tag="LPST_C0345"
FT                   /product="histidine protein kinase PlnB; sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97569"
FT                   /protein_id="ADN97569.1"
FT                   /translation="MVEISIFDSVIQSFFIYLGIILVYNFIFSNTNIKRIIYSLILLLV
FT                   LSLVGAILDDTTSLILVLGAIIKEKCQPKINYYHLNVFLMLISSQIVILALASYLSRGF
FT                   LYIYLDADKISGLSEYGDLFIGIEIIVMYIIGFLVFNLVYKMVRRYTGSFDISDDERIN
FT                   RHLFIILLAFFGSIEMLLFISNFQGVTATIQLTLLLTFVLMLGLISWQTLETIRVYAWQ
FT                   KKIAAEKLQNKQLNDYLKSVEHQYLELRKFKHDYKNLIASLNTQDNISEIKDYLTDYTQ
FT                   SGEFRASLNDGSIASVQHLKNEILRGLVVQKFFYAKQCGVKLTIEIANTDFILSHGVTV
FT                   AVRIIGNLLDNAIEQAQKMTDKIVTVAFNEIDNTAEIAISNPIDSDFNQHQIFETGYST
FT                   KGSNRGLGLTNVRDLVEQQKGFYMDIETKKNYVTMTLIVTEDK"
FT   gene            365486..366229
FT                   /gene="plnC"
FT                   /locus_tag="LPST_C0346"
FT   CDS_pept        365486..366229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnC"
FT                   /locus_tag="LPST_C0346"
FT                   /product="response regulator PlnC, activator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97570"
FT                   /protein_id="ADN97570.1"
FT                   /translation="MFPIYLLEDNEAQRVEYISIIKNIIMIKEYDMQLVVATGDLQELM
FT                   NNVMNSKEGLFFLDMEIGEQTQAGLNLADEIRQQLPCAQIVFITTHEELSFLTLERRIA
FT                   PLDYILKEQGLDDIKQKIVKDIDATQTILKTETVQHKDILGYKIGTRFFSVPINDVIML
FT                   STNKERPGSIRLTAKNKVADFPGNLNSFENKYSQFFRCDKSSLVNIDYVDSYDYQKKEL
FT                   TMIDNIKCSVSYRKSRELNKILKKK"
FT   gene            366348..367091
FT                   /gene="plnD"
FT                   /locus_tag="LPST_C0347"
FT   CDS_pept        366348..367091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnD"
FT                   /locus_tag="LPST_C0347"
FT                   /product="response regulator PlnD, repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97571"
FT                   /protein_id="ADN97571.1"
FT                   /translation="MFPIYLYEDNAEQRDNYCKTVNNTIMINEFAMELRVATDDQKIIL
FT                   ADLNQQQDGLFFLDMEIGEDKQTGLELASRIRATIPLAKIVFITTHDELSFVTLERRIA
FT                   PLDYILKDQSADLITQRIIKDINVVQNELKKTNSQRKDVFNYKLGTRYFSLALDDVILL
FT                   STSKLRPGSVQLHAINKVAEFPGNLNALEEKYPQFFRCDKSSLVNLNHLRSFDYKEKEL
FT                   LLDGEIRCKASFRKSRELNKLLRDN"
FT   gene            complement(367396..368169)
FT                   /gene="plnI"
FT                   /locus_tag="LPST_C0348"
FT   CDS_pept        complement(367396..368169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnI"
FT                   /locus_tag="LPST_C0348"
FT                   /product="membrane-bound protease CAAX family immunity
FT                   protein PlnI"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97572"
FT                   /protein_id="ADN97572.1"
FT                   /translation="MPLIKVIITAIYYLIVLFLMNPLTDIMGIKDGPFQFILTESIILI
FT                   AIIILNRRYVKQPIHWLPVNIMSILKKNSLPLSLAIIFLLIFFRNHMYQFLISLLLSLI
FT                   VAITEEYAFRGMIFRTLLALNLKKFATLQATIASMMTASLIFAAMHLVNLLSQPVWSVL
FT                   CQVLYVIGLGILLAAIYLKTGSLLAAISVHWLIDFSSFYSQGIDPTQSPINGPMEALLK
FT                   GLFLNILFIGIATFILSSKHWKLLSILNIEDKIDE"
FT   gene            complement(368268..368426)
FT                   /gene="plnF"
FT                   /locus_tag="LPST_C0349"
FT   CDS_pept        complement(368268..368426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnF"
FT                   /locus_tag="LPST_C0349"
FT                   /product="plantaricin F"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97573"
FT                   /protein_id="ADN97573.1"
FT                   /translation="MKKFLVLRDRELNAISGGVFHAYSARGVRNNYKSAVGPADWVISA
FT                   VRGFIHG"
FT   gene            complement(368451..368621)
FT                   /gene="plnE"
FT                   /locus_tag="LPST_C0350"
FT   CDS_pept        complement(368451..368621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnE"
FT                   /locus_tag="LPST_C0350"
FT                   /product="bacteriocin precursor peptide PlnE (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97574"
FT                   /protein_id="ADN97574.1"
FT                   /translation="MLQFEKLQYSRLPQKKLAKISGGFNRGGYNFGKSVRHVVDAIGSV
FT                   AGIRGILKSIR"
FT   gene            368888..371038
FT                   /gene="plnG"
FT                   /locus_tag="LPST_C0351"
FT   CDS_pept        368888..371038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnG"
FT                   /locus_tag="LPST_C0351"
FT                   /product="bacteriocin ABC-transporter, ATP-binding and
FT                   permease protein PlnG"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97575"
FT                   /protein_id="ADN97575.1"
FT                   /translation="MHWRNYVAQVDEMDCGVAALAMILKNYGSTTSLAYLRNIAKTSLE
FT                   GTTALGLVKTAEKLGFETKAIQADMSLFEVQDLPLPFIVHVTKNGDLQHFYVVVKTSKT
FT                   HVVIADPDPTVAVISMSKERFESEWSGVALFFAPKSEYKPVKQDKGSLWGFIPSLLKQR
FT                   RLVINIVLAAVLITIISICGSYFLQAVIDTYIPNNMHSTLAVVAIGLIVFYTFQAIFTY
FT                   AQNFLLAVLGQRLSIEIILGYIRHVFELPMSFFATRRTGEIVSRFTDASKIIDALASTI
FT                   VSLFLDVSIVIIMGAILVIQNMTLFWITLLSLPIYAVVILAFNKSFERLNQKEMESNAI
FT                   LSSAIIEDLHGIETVKALNGETERYQKIDSEFVDYLRKSLAYLKADTLQQALKLFIQLV
FT                   LEVVVLWVGANLVIHNQLSVGGLMTYNALLAYFVNPLQNIINLQTKLQSAKVANNRLNE
FT                   VYLVASEFEASRPIHNESQLNGDIKLQGVSYRYGYGENVLDDVNLTIRQHDKVAIVGMS
FT                   GSGKSTLVKLLIDFYQPNSGDAILNGFNVKNIDKHTLRTHINYIPQEPYIFSATIEENL
FT                   RLGNRSGITEKDIAKACQLALIDTDINKMAMQYQTKLDENGNTLSGGQRQRLTIARALL
FT                   SPAQVLIFDESTSGLDAITEKQLIDNLVAMTDKTIIFIAHRLSIAKRTNHIIVLHDGRV
FT                   AEEGTHAALLNEHGYYYDLINS"
FT   gene            371054..372430
FT                   /gene="plnH"
FT                   /locus_tag="LPST_C0352"
FT   CDS_pept        371054..372430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnH"
FT                   /locus_tag="LPST_C0352"
FT                   /product="bacteriocin ABC transporter, accessory factor
FT                   PlnH"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97576"
FT                   /protein_id="ADN97576.1"
FT                   /translation="MRKDLLESGEFYGIRFQNFSTLLIIPVTLLLIGTILFSLVAKREI
FT                   VINGTGTVQPTGTVPVIQATVNSAIKKNYLVEGARVKKGQKLLVYTNVFNRNKLREDNV
FT                   SKRQLQRQVTALDHFKDGINTDSDVFPTTDEFGYRELLQSYLKQRQIYLTENQMLAAKS
FT                   SAASTKKATLTKTAQQVVSNTKTNLDAYQALYNAVANGSKYANSAKYGSVFNEYVAKSK
FT                   EANNANDKKEVKSATLADIQQQIDTLQDSLSSAKVQLEELQDFDDTKYSVETNNTKLAM
FT                   LKNDQLSEVAEKRMKAEQDLRTVKADIDSLTTQSKSYTIKATKAGVLHVADNYRGAKYV
FT                   SSGAEIAKILPIIKQQRRVNVKLYISTADISSVKVKQAIRFKVTRNVPKPIILDGVVTK
FT                   IGVSPVEESKATFYEVTAAVPITADQAQLLRYGMIGQTAIITGKVTWFDYYKDKVLDNN
FT                   "
FT   gene            372665..373210
FT                   /gene="plnT"
FT                   /locus_tag="LPST_C0354"
FT   CDS_pept        372665..373210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnT"
FT                   /locus_tag="LPST_C0354"
FT                   /product="integral membrane protein PlnT"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97577"
FT                   /protein_id="ADN97577.1"
FT                   /translation="MPWKLGGYIGFIGIQHELGNYQVATLKSRVNIAQLGTVIIAMLTM
FT                   VVLIIVDLKLGAMLNIPETSNSRSLAWMLGEAPLPMIVSVVIFSPICEELIFRGIFFSY
FT                   ALTNQYNHRNYQMIAVVINSLIFASFHVDANWEPWIYYTLMGSILGTTYLLAKRDIRMN
FT                   ILVHMGTNLAVFALAAMS"
FT   gene            373277..373945
FT                   /gene="plnU"
FT                   /locus_tag="LPST_C0355"
FT   CDS_pept        373277..373945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnU"
FT                   /locus_tag="LPST_C0355"
FT                   /product="integral membrane protein PlnU"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97578"
FT                   /protein_id="ADN97578.1"
FT                   /translation="MVARLIRVFGYVLAGLGLFIFIQLPVLADGYWNWWGERPQQINIG
FT                   YHWVALVVLTVGVAVVLVRCYHHYFEMPVLLGPFSWSMMGLTALVAVVVVVIQMGISGL
FT                   LVSPTETQNDEIMALIHSPLGLLTLVCTNIVSPVLEELLFRGIVQNTLRRYLPVLGAII
FT                   LTNAVFALGHGYQLASTVGIFITGCGFSWLVLKTKQLSTAMGCHILVNWLVTLINMMWG
FT                   "
FT   gene            374032..374712
FT                   /gene="plnV"
FT                   /locus_tag="LPST_C0356"
FT   CDS_pept        374032..374712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnV"
FT                   /locus_tag="LPST_C0356"
FT                   /product="integral membrane protein plnV"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97579"
FT                   /protein_id="ADN97579.1"
FT                   /translation="MVHQNVKFISRLLLASLLAAIVMGLSTAPIDILTLKYNWITVAIF
FT                   LVVYLFAIYLFYRIYLESVTNNHFKITKIAAKPSARQLVITVLAMVVMLILAAVQVKFV
FT                   SDAVYSIAENVADLQALSQRSPILMALALGVFAPICEELIIRGNFFSYALAERFDQPRY
FT                   QLVTVIVNGVLFGLLRGGFSWVQLSYYTVMGLVLAATYILSGRDIRVNSVVHVTANLGL
FT                   MLMA"
FT   gene            374806..375492
FT                   /gene="plnW"
FT                   /locus_tag="LPST_C0357"
FT   CDS_pept        374806..375492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnW"
FT                   /locus_tag="LPST_C0357"
FT                   /product="integral membrane protein PlnW"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97580"
FT                   /protein_id="ADN97580.1"
FT                   /translation="MLQKNLRFIGNLLIVSVLSVIIVNISSLPVYIYLITANWFTLLVS
FT                   FSLYAVIIVFLYNIYKTTAELRQFDFRPWRTRLNKRALLLMVIGAVIIVALAFGYAKLT
FT                   AVWHITESGNERALDLLLRKNPVAMTLDAVIFGPIAEELSFRGFFFSYVLSDQYLDREY
FT                   QAATIVINGLLFGYLHSGNSLVPLAYYTLFGMVLGTIYLLSKHDIRVNSVTHMLANLGI
FT                   LWLVPS"
FT   gene            375630..375833
FT                   /locus_tag="LPST_C0358"
FT   CDS_pept        375630..375833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97581"
FT                   /protein_id="ADN97581.1"
FT                   /translation="MDEIISFEFSNGSKILDSNIYEYKVGKESVTKIDLPDSNGFVAVH
FT                   KDNNKTEYIKALYMKFCTDSHV"
FT   gene            complement(375928..378018)
FT                   /locus_tag="LPST_C0359"
FT   CDS_pept        complement(375928..378018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0359"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97582"
FT                   /protein_id="ADN97582.1"
FT                   /translation="MVERAVESEAILKRQVGVLKDLSNSPYFGRIDIQDSPDEEAERLY
FT                   IGTASFVDAEQNFLVYDWRAPISSVYYNGTLGQVQYQTPAGQQTTELIKKRQFQINHGQ
FT                   IKNMFDTNETVGDEILQAVLGEQNDAYMQNIVATIQKEQNDIIRDTTSDLLVVQGVAGS
FT                   GKTSAILQRIAFLLYHSRASLEADQMVLFSPNRLFSHYISEVLPSLGERNMRQVTLAEF
FT                   LSARFQGLTVESLFERYESDRQREQLTPAIRDFQESADFMRQVDQYCHQLPADQLRFTN
FT                   IVFNGEIFFAKEVITKIATALPAAMQPADRFLAIKNTLIKRLKHRIDDEAQADWVNDII
FT                   DQLSDEAYHDLLGSKRRGDFQSLDDEVFYIGKQIVTKRLRQVYDAIYNGYFLDTYEQYN
FT                   DFLAQVDWPTTVTSDQWQQRIAAYQAAVEYHRIALVDCAPLLLLRDVLTGSGQNRRMQY
FT                   IFVDEMQDYSLAQLLYIKHAFPLAKFTLLGDSEQALFKEIELPQQLLERLKDAFNVRRA
FT                   NLITLNKSYRSTEQITNFAKALLPDGDQIQAFTRKGDLPKVMIRYGEDAALSSLRSEVE
FT                   HQLKATNTVAVLTKDLAESKQVYQYLKRYTVTTLMADSDRTMPQGVIVMPIYLAKGLEF
FT                   DAVVAYDVSATNYPDADSVGILYTIASRAMHHLTLLSIGDVSPLIAQLDPTLFTIEHQV
FT                   RV"
FT   gene            378496..379272
FT                   /locus_tag="LPST_C0360"
FT   CDS_pept        378496..379272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0360"
FT                   /product="carbon-nitrogen family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97583"
FT                   /protein_id="ADN97583.1"
FT                   /translation="MRVALAQLNIQFGDPDANYEQIEVAIQRAAEQTVDVIVLPEMWNT
FT                   GYALTRLNVLADDDGQRTLQLLSKLARQCRVNIVGGSVAVARDGHYYNEMLVVDRQGQL
FT                   LSRYDKVHRFGLMAEDRYITAGETENVFELDGTVAMGAVCYDIRFPEWLRKQAARGPQV
FT                   IFVSAEWPTVRQMQWRLLLQARAIENQAFVVAVNRVGSDPDNQFGGQSLVIDPLGQIVA
FT                   IGGAHAQLITAELDLTQVDQVRGQIPVFEDRRPELY"
FT   gene            379711..380727
FT                   /gene="trpS"
FT                   /locus_tag="LPST_C0361"
FT   CDS_pept        379711..380727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="LPST_C0361"
FT                   /product="tryptophanyl-tRNA synthetase II"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97584"
FT                   /protein_id="ADN97584.1"
FT                   /translation="MTKKVILTGDRPTGKLHIGHYVGSLRNRVALQDSGDYDSYIMIAD
FT                   NQALTDNAHDPEKIRKSLLQVAMDYLAVGIDPQKSTILVQSQIPALTDMMNQYLNLVTV
FT                   ARLNRNPTVKTEIKQKAFGESVPAGFFVYPVSQAADITAFKATTVPVGDDQEPMLEQTR
FT                   EIVRSFNKTYQTDTLVEPEGYFPPKGLGRIPGLDGNAKMSKSLGNAIYLSDDADTLKKK
FT                   VMSMYTDPDHIHIEDPGKVEGNVVFTYLDIFDEDKAKVADLKAAYQHGGLGDVKIKRYL
FT                   MDVLDGVLRPIRERRAIYEADPAQVLQILKDGTAKANVVADQTWREMQDAIGINYFK"
FT   gene            381135..381845
FT                   /locus_tag="LPST_C0362"
FT   CDS_pept        381135..381845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0362"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97585"
FT                   /protein_id="ADN97585.1"
FT                   /translation="MYQAIAQAIIKSIMADEYPTKLPTEKVLMAQYNASRNTIRKAIDV
FT                   VFRHGLLRRVQGSGNFIIKQPQNTKKVLNLSIGFDQSAMVEGGPLVSKVVTFDKVTADE
FT                   TLAQQGNIALGDEVYRVVRLRYLNDILYDLEESYFPRTVVPFLSSESVQHSIFAFLREA
FT                   YGITGSTTENYVHQVRVDAQRAELIGCPDGDKTLCLEAINYLANGTVFNFSRTFFVYPD
FT                   LELYYHTENIDLQN"
FT   gene            381918..383279
FT                   /gene="pts7C"
FT                   /locus_tag="LPST_C0363"
FT   CDS_pept        381918..383279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts7C"
FT                   /locus_tag="LPST_C0363"
FT                   /product="cellobiose PTS, EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97586"
FT                   /protein_id="ADN97586.1"
FT                   /translation="MNSFIEWLNKHLVPVAAKIGAVRWLIALRDAFIAIMPAMMAGSIA
FT                   TVLNALVRDIPTKFGWMGIVNSMQWLIGINAMVWTGTLAILGLIFSFTFGYQLAIQYKV
FT                   EPVTGGIVTLGTFIMSLPQNFTGTLTSTLSKGATKILTDSGMAVAGKKVTAWGYFNFNT
FT                   YFGSYGFFTVMILGAIASAVYIALMKKHITIKMPDSVPPAVANAFTGVIPAAAAFYVVG
FT                   IINWIFSKFNTTVIEWIAKIIQEPLLNMSQGYGAVLLMTLLVQVFWFFGIHGSNVLAPI
FT                   LDGIWLTAQLANVNAYQAGKALPYVWTRNCFDLYAWIGGAGSTLLLLVAILVFSKRDDQ
FT                   RSVAKLAIGPGFFNINEPVMFGMPIVLDPIYFIPFVLAPVVTVSIAYAALSAGWVAPIT
FT                   NNIVWSMPPIMNALVATMDWRSVVLQLFNAAVAFAIYVPFVKAANKIKPAAIGE"
FT   gene            383286..383474
FT                   /locus_tag="LPST_C0364"
FT   CDS_pept        383286..383474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97587"
FT                   /protein_id="ADN97587.1"
FT                   /translation="MKSLKQCLLIGMNLGLLAVILSPLAGTTGQWVTLGLGLAVSAALF
FT                   VVYRRVGQIERSHQNAD"
FT   gene            383464..383886
FT                   /locus_tag="LPST_C0365"
FT   CDS_pept        383464..383886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97588"
FT                   /protein_id="ADN97588.1"
FT                   /translation="MQIKLTLNAPVDYLYQQLIDSARADIQQQTGRPAPRQSLQGYEYA
FT                   KQWSNGLTGNLKITHAQPGVRYAYELETPRDHYGVDYQFAPDTDGHQTVLEYAETFLGK
FT                   DKKTNANNKLGVLFLGWFRKRRFKKMMNQMAASYNQ"
FT   gene            384109..385464
FT                   /gene="pts8C"
FT                   /locus_tag="LPST_C0366"
FT   CDS_pept        384109..385464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts8C"
FT                   /locus_tag="LPST_C0366"
FT                   /product="cellobiose PTS, EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97589"
FT                   /protein_id="ADN97589.1"
FT                   /translation="MNGFNVFMEKHIVPFAVKLNEQRHVAAIRDAFMYTFPITMAASLV
FT                   ILINNLVFSKTGFIAQILFLPKFFPHLENAQKLLTSVTNGTMNILSIFIAYLVARNLAK
FT                   YFKADDMLVGMTGIACFMILYSPSIIKDGVTYLPTTYLGAQGLFVAMIVGGLVGEFLPR
FT                   LTRIKKMQIKMPEMVPPAVARSFNGLIPIVIMIMLFSMLNYGLSLISPQGINDIIYKSI
FT                   QTPLTHIGVNLFGVIIIAIVQNLLWLVGIHGPNTLNALRSIIFTEADLKNQTFINAHGT
FT                   AWGVPNRATWSVLNDVFANMGGSGMTLGLIIAIFLVSRRKDYREIAKLALVPGLFNINE
FT                   PLMFGLPIVLNPIMAIPFVLTPVINILVGYTVTVIFNWIPTPAFGLTWTTPGPLMPFLG
FT                   TGGNWLGLIIGFVCLGISVLTYMPFVLAANKMMAADSQSKQDTDTTTETVKA"
FT   gene            385482..386918
FT                   /gene="pbg1"
FT                   /locus_tag="LPST_C0367"
FT   CDS_pept        385482..386918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbg1"
FT                   /locus_tag="LPST_C0367"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97590"
FT                   /protein_id="ADN97590.1"
FT                   /translation="MTIKGRAFPEGFLWGGAVAAHQLEGGYKEGGKGLSTADIMTLGTN
FT                   ERPREITDGVVAGKYYPNHQAIDFYHRYPEDIELFAEMGFKCFRTSIAWTRIFPNGDES
FT                   EPNEAGLQFYDDLFDECLKNGIQPVVTLAHFEMPYHLVKQYGGWRNRKLIQFYLNFAKV
FT                   CFERYRDKVTYWMTFNEINNQTNFESDGAMLTDSGIIHQPGENRERWMYQAAHYELVAS
FT                   AAAVQLGHQINPDFQIGCMIAMCPIYPLTAAPADVLFAQRAMQTRFYFADVHCNGTYPQ
FT                   WLRNRFESEHFNLDITAEDLKILQAGTVDYIGFSYYMSFTVKDTGKLAYNEEHDLVKNP
FT                   YVKASDWGWQVDPVGLRYAMNWFTDRYHLPLFIVENGLGAIDKKTADNQIHDDYRIDYL
FT                   TDHLRQIKLAVLEDGVDLIGYTPWGCIDLVAASTGQMSKRYGFIYVDENDDGSGSLKRY
FT                   KKDSFTWFQHVIATNGAEIE"
FT   gene            387039..387935
FT                   /locus_tag="LPST_C0368"
FT   CDS_pept        387039..387935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0368"
FT                   /product="sugar kinase and transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97591"
FT                   /protein_id="ADN97591.1"
FT                   /translation="MTMYIGIDIGGTSIKCGLVDAHGHISRKVTRPTATAKVDIMADLV
FT                   AMIQGLQADGQVAGIGVSMPGVVQSDGFLTTAGAVTAFEKINLQAELHAQTQLPVIIEN
FT                   DANAAAIAEQWLGVAQNVPNYLSLVLGTGVGGALVINNQIYRGAHARSGEFGWMVVDDD
FT                   EIDTEMGTLNFRGATVIGLIRRYNQFSAMPVTDAREIFDRADAGEVLAQHVFHSYYYSL
FT                   AKGIINLMVAFDPELVVIGGGISANTTFMTDLNATIADLQANHNSINHLTLASVVPAKL
FT                   RNDAGMIGAVYQLIKRG"
FT   gene            388085..388831
FT                   /locus_tag="LPST_C0369"
FT   CDS_pept        388085..388831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0369"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97592"
FT                   /protein_id="ADN97592.1"
FT                   /translation="MAFFGYKDIDKLSGVDLAIYRFIVEHDEQIPYMRVRELARGAHVS
FT                   NSSVMRFIRKIGYDSFPEFKVSLRSETPIQKPDAPGIQFVQPSAFPADITKIIRLAAQL
FT                   MVNADNIVFVGIGASAALGEYASRQTSSLGFNSYVVKDPFYPLLPQLRNTSNNVLVAVS
FT                   VSGQTSELVEMLNDFVNNPEVNIISITSNLESTIARMSRYALTYRATEERIHQYYDLTS
FT                   QVPCLYIIEALLRELRHQEVVQHRFE"
FT   gene            388944..389957
FT                   /locus_tag="LPST_C0370"
FT   CDS_pept        388944..389957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0370"
FT                   /product="dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97593"
FT                   /protein_id="ADN97593.1"
FT                   /translation="MTATPFWSQIAAQAKADGRPFFTMAPMEAVSNTVFRQVISHAAAP
FT                   DTFFSEFVYAKSITNPNTKFPVHGRLYVAAAESQKPVVQLWGNEAADFASATAELRDRG
FT                   FKAVDINMGCPDGTVIKNHGGSDLIRNPQWAEDVIAAAKTSGLAVSAKTRLGYSKVAEY
FT                   HDWIATLLSQHVAVLTVHLRTKQEMSKVPAHFEVIDDLIKMRDAIAPETLLQINGDVAD
FT                   YQAGVALAKAHPGLDGIMIGRGVFANPFAFESQPQSHDLHELLGLLNMQLDLFDDFATR
FT                   YDVPRFPSLKRFFKIYARPELGATDLRNTMMDAKSTDDVRKILAAYQAKMRVTNHS"
FT   gene            390411..391544
FT                   /locus_tag="LPST_C0371"
FT   CDS_pept        390411..391544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97594"
FT                   /protein_id="ADN97594.1"
FT                   /translation="MEGAKNVIKLVNQLEHISQSTGIPVTIGESVSTSTLSLSRSDQNN
FT                   TVVVQGTILDKPVLFMSYGGQRDLRPLGLYARVSQVNRDPLVFIFPQLSANERHEYLKN
FT                   RMPFMTSDGEMFLPFMGTRLLPEAVNDSPGIAGNPLASAAQRLALTIVLAQLIFERHPE
FT                   KAKVCPELAAFRTTDDRFLIKSGQCFASTIGKQVSINNRVTFSRAVKPLVAHGWLKSIG
FT                   ETKERVYTCELDSRRFFDQIAPFLVSPVQSVDLVQLAKASVESASKNFLYSGLTGLSKV
FT                   TMISDNRKQQTVIMDRSRRQTLRTTVDADTDERKVACEVQVSKYQLSGFNTLFRLIANY
FT                   PKNVLDPFHLYVLFRNDMDERTQGEAEELVDQIWNGA"
FT   gene            391549..392343
FT                   /locus_tag="LPST_C0372"
FT   CDS_pept        391549..392343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97595"
FT                   /protein_id="ADN97595.1"
FT                   /translation="MLFHKFFDFFEGYEDCYVIIGGNAAAIWLAQDHQDFRATQDYDMV
FT                   VIFENSQLGFSQKFDDFIEKYGYLCAEIGGDVNKKKVYYRFALDPALAVTGVPQQIELF
FT                   SKIPLRYELRLPTETMPLHFATGPSLSAIVLNDDYYSLLKQCQQKIGHVSILSVPGLIY
FT                   FKAKAHLDIRQRLANGDKLRHRANKNKHYKDVCRLCDLIIENQTFDSKVVPRTCQNDLK
FT                   SFIQLVEAEPEQIFKKRFKSDPDFDLNRDEVVRVLRSLLPTS"
FT   gene            392512..393429
FT                   /gene="ppx1"
FT                   /locus_tag="LPST_C0373"
FT   CDS_pept        392512..393429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx1"
FT                   /locus_tag="LPST_C0373"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97596"
FT                   /protein_id="ADN97596.1"
FT                   /translation="MRNLAIVDLGSNSARMAVSRLHANGTAQEIKRVKEDTRLSEGMGT
FT                   AHVLQPAAIERTIKALLNFRRLYEKMPNTDVIGITTAAVRMAQNQAEFLNQVKQEVGLD
FT                   LRVLSGDDEAYYDYLGVANSLVIHDCLILDTGGASCELILVKNGRKQQLISIPFGAVTL
FT                   SEQFGLDDLVPSASLFRAQMFLRNRLADIWWLSEAVHFPIILLGGANRTLARINRRRQQ
FT                   KLKVEDIHGYRLKTETVFHTFLDLLSRSKKGRQEISGMEYDRADIIVGGMLPLVTLLQM
FT                   LDSDRVIFSESGVREGIISEHLNQ"
FT   gene            393475..394749
FT                   /gene="mvaA"
FT                   /locus_tag="LPST_C0374"
FT   CDS_pept        393475..394749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaA"
FT                   /locus_tag="LPST_C0374"
FT                   /product="hydroxymethylglutaryl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97597"
FT                   /protein_id="ADN97597.1"
FT                   /translation="MTADFRHFYQKNWAERTAIVAQQAHLTPAEQALFKQYYLPQHHEI
FT                   IENYLTDYPLPMGLAVNLVVDGVDHIVPMVTEEPSVIAAASNGAKIVKRAGGFTTVLNQ
FT                   REMIGQIVLEQLSDPAATAAVIEAHAAALLKVADAAHPSLKKRGGGARRLRTRVLGQGY
FT                   LSIDLFVDVQAAMGANMLNSMLEAVAKSIGVMTKQDALMSILSNYATASLVKAICDIPV
FT                   GLLQAGRYAGKLVAQKIASASTVAQLDPYRATTHNKGIMNGIDAVAIASGNDWRALESG
FT                   AHAYAVKDGQYRGMSTWTSDGRMLHGELELPLPVGIVGGSIKINELAQLNQRILGIQTA
FT                   GDLERIMVAIGLAQNLAALRALVTTGIQQGHMHLQLKSLAMAAGATPEELPVILQRLEL
FT                   ASQQDLATTQQLIAELRQTKEETDD"
FT   gene            394742..395701
FT                   /locus_tag="LPST_C0375"
FT   CDS_pept        394742..395701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97598"
FT                   /protein_id="ADN97598.1"
FT                   /translation="MTEIKLNQTVTDLLSTANSLYPGNISVRFGDTKAGYVRHDQAQQV
FT                   LDDGDLTVRVSDITAPNYTASHELLHLLLLLQGFPQITFNLTTRDQQLDEQLMAIAMEL
FT                   YDMVSHVLVVRKQREHNLIDEQIETLYMQGVAATIEPEPAGKADAMMTLRLLTLTDLLV
FT                   FFNGELPADDLQKVTTAYPQAWPAAQKLYAVISQKPVDTPFAMRRAVVKLFKAFDDQMT
FT                   AWHLPVLHGTEFVTVQSVLSERQERLEVRQLFDVYHSDLLDKNKHTRAYIGLYKSDRQN
FT                   AFVLPAPAQKKSDAFFKEVYDKTVKELFQEMNLPYTLR"
FT   gene            395723..396427
FT                   /locus_tag="LPST_C0376"
FT   CDS_pept        395723..396427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0376"
FT                   /product="NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97599"
FT                   /protein_id="ADN97599.1"
FT                   /translation="MSDITAAQTTLQQAQHIVFMTGAGVSTPSGIPDYRSKNGLYTEHH
FT                   NAEYYLSHAFLAEHPLEFYQYLQSNLYYPDAQPNVIHQKMAALTRQGRASVITQNIDNL
FT                   YGVAKTAQLVEFHGNLYQVYCTKCGQHVDWHEYLKSPYHQTDHGYLRPNVVLYDEGIAS
FT                   ANIERAVQYLQQADLVVICGTSFRVYPFAGLIDYRNPKAQVLAINAEPLQLPFAFTMVQ
FT                   QDAVDFFEGVQV"
FT   gene            396427..397269
FT                   /locus_tag="LPST_C0377"
FT   CDS_pept        396427..397269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97600"
FT                   /protein_id="ADN97600.1"
FT                   /translation="MITIGLTTWTEHPSLLGGTEKLTLTEYSGVLPVVEVDTPFYGIPK
FT                   VTTVAKWQKAVPDKFQFILKANQVMTLHDTYDEGVSMDALKTAYREYRAMLKPLTQHQQ
FT                   LKAVLFQFPPFFERSNRNFHYLQRMVEWLPGVPIAVEFRNQSWYEESVKDAVFSFLKDL
FT                   GITHVIVDEPHALNDGVSFEPVVTNSKLALLRLHGRNQQGWSAKGANWRSQRTLYRYSD
FT                   QELAEFKQTVEQLQQQADEVCVIFNNNSGGDAADNAMALKELLGVSFGDLGPHQLDLF"
FT   gene            complement(397331..397450)
FT                   /locus_tag="LPST_C0378"
FT   CDS_pept        complement(397331..397450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97601"
FT                   /protein_id="ADN97601.1"
FT                   /translation="MNVRTTATFLVVMIHQLKNIQPYDQISTVHGHSDCIEPT"
FT   gene            397827..398255
FT                   /locus_tag="LPST_C0379"
FT   CDS_pept        397827..398255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97602"
FT                   /protein_id="ADN97602.1"
FT                   /translation="MLGHNNIDWGGLGMQPDIICANGVFCADGKVLLTRESKNTAYYFP
FT                   GGKVGVGETLTQTLQRELKEELSLVVSPDRFKWAFTHRGTAYNQPGKIVELNCFLVAGS
FT                   GALKVDSEVYDYKWCRPDDSRIAEVVREALARYSWVVE"
FT   gene            398577..400628
FT                   /gene="metS"
FT                   /locus_tag="LPST_C0380"
FT   CDS_pept        398577..400628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="LPST_C0380"
FT                   /product="methionine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97603"
FT                   /protein_id="ADN97603.1"
FT                   /translation="MAETKPTYYITTPIYYPSGKLHIGNSYTTIACDTLARYKRAMGYD
FT                   VYFLTGTDEHGLKIEEKAEKLNTDPKSYVDGMAKQIKDLWQLLEISNDKFIRTTDDYHE
FT                   RAVQEIFDRLLKNGDIYLGEYEGWYSVDDEEYFTETQLAEVFRDDNGKVIGGKAPSGHE
FT                   VELVKEQSYFFKMSKYADWLLDYYQSHPDFIEPANRMTEMINNFIKPGLEDLAVSRTSF
FT                   TWGVPVKSDPKHVVYVWIDALTNYITALGYATGDSEDLFNKFWPADVQMVGKEIVRFHT
FT                   IYWPIILHALGLPLPKKVFGHGWLLMKDGKMSKSKGNVIYPETLVERYGLDALRYYLVK
FT                   AMPYGNDGLFTPEDFVARVNYDLANDLGNLLNRTIAMINKYEDGQLPAFKAGVTEFDAD
FT                   LEATAATTIKNFNACMDSLHLSDALAEVWKLVSRTNKYIDETAPWQLAKSDDANDADKL
FT                   ASVMAHLAASLRVIASLISPVMTHAPKEIFTQLGLDPATLAIADLQLADLPAGAQVVAK
FT                   GTPIFPRVDMDAEVEFLKGKMTKSDKQKGRKAMENAKHEAEVEQGWNPAETNLNLTKPA
FT                   ITIDDFDKVELKVAEVITVQKLKGADKLLQFRLDAGDADHRQILSGIAKWYPEPEELIG
FT                   KKVIIVGNLKPRKLRGEMSQGMLLSAEHDGQVQLITVPDNMVNGSLIS"
FT   gene            400861..402045
FT                   /locus_tag="LPST_C0381"
FT   CDS_pept        400861..402045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0381"
FT                   /product="drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97604"
FT                   /protein_id="ADN97604.1"
FT                   /translation="MKNVQKQVPSLLLLITLVGFPQISESIFTPILPALSQAMHVSASH
FT                   SQLTMSSYFVAFAVGVLFWGQYADYRGRRDAMLGGLAFYLIGNLGLYLSPGFTWLLVCR
FT                   LIQAFGASAGSVVTQTIMRESFTGVTGAKIFAKVSAAMALSPALGPLIGGGVQTVFGYQ
FT                   HVFSVLIMIAVVILLYAGCCLPETRPETVKVASWRQQSVVVSRLLHDPVVWCYGLLISG
FT                   INGILFSYYAEAPFIFETHFGFSAVQYGSLGLVLAAASLLGALLVNWLVNYWSPMQVAL
FT                   SGLGLSLVAAVGLVMTAVGNHVIGMLIGIFLAFLGLNITLPNALNRALIGYETVMGSAS
FT                   GWFSLGYYLLVSVLTYLMSLLHHGSVVTLPVYMLGVVTVMTVVYAGLYWQRVRH"
FT   gene            402168..402944
FT                   /locus_tag="LPST_C0382"
FT   CDS_pept        402168..402944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0382"
FT                   /product="DNAse (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97605"
FT                   /protein_id="ADN97605.1"
FT                   /translation="MRIFDSHTHLNSEEFIQEVPRYLQQAADLDVTRMAIVGSNTQLNA
FT                   DAIKLAETYPQLVAIVGWHPEDAKNYDQAAEKLLIEQVQHPKVVALGEIGLDYHWDTSP
FT                   QDVQRQVFARQVAIAKEMQLPISVHNRDAFEDTYKILKAADIRDTGGVMHSFNGDPEWL
FT                   KRFLDLGMHISYSGVASFKNAREVHESVKQTPLTQMLVETDAPYLTPEPYRGKQNEPGY
FT                   TRYVVEAIAKLRETTPEIIAAQTYQNAEEFFKIEKD"
FT   gene            403066..403494
FT                   /locus_tag="LPST_C0383"
FT   CDS_pept        403066..403494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0383"
FT                   /product="primase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97606"
FT                   /protein_id="ADN97606.1"
FT                   /translation="MQASRGVIVFTDPDFSGERIRKTISAAVPGVKHAFLPRKAGVPTK
FT                   AGGSLGVEHASPAAIQAALAHLYTEQIDEPQQLISHHDLIAAGLLAGPTARQRREQLGE
FT                   RLGIGYVNGKQLSKRLQLFQIQPADFWAAVDQLTTEEK"
FT   gene            403491..404381
FT                   /gene="ksgA"
FT                   /locus_tag="LPST_C0384"
FT   CDS_pept        403491..404381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="LPST_C0384"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97607"
FT                   /protein_id="ADN97607.1"
FT                   /translation="MMSRDLDIASPARTRAIMHTYGLQVKKSLGQNFLTDQNVLHNIVA
FT                   TADIGTNDNVIEIGPGIGALTEYLARAAHHVLAFEIDDRLLPILDETLADYDNVTVVNQ
FT                   DILKADLAAMISEHLDNERPLKLVANLPYYITTPILMNILAGDVAFENIVVMMQKEVAD
FT                   RLAAEPGTKAYGALTIAVQYRMAAEMAMVVPRTVFVPSPNVDSAIVKLTALPPRTHVPF
FT                   DEAAFFKVVKAGFAHRRKNLWNNLQSLFGKQPETKTAIQQALDIATIDPKIRAERLTVD
FT                   EFITLTDALHQADLL"
FT   gene            404486..404737
FT                   /locus_tag="LPST_C0385"
FT   CDS_pept        404486..404737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97608"
FT                   /protein_id="ADN97608.1"
FT                   /translation="MPISLAAIKDKLDSRIGQRMKVVAQAGRKKTTERHGILKETYRSV
FT                   FVVDLDQQENAFERVSYSYTDVLTKNVQIAFDDETTEA"
FT   gene            404870..405736
FT                   /gene="ipk"
FT                   /locus_tag="LPST_C0386"
FT   CDS_pept        404870..405736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipk"
FT                   /locus_tag="LPST_C0386"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97609"
FT                   /protein_id="ADN97609.1"
FT                   /translation="MQIVEKAPAKINLGLDTLFEHPNGDKEWDMVMTSVDLADYVMLES
FT                   LHTNRIEVVTDSGFLPNDRRNLAFQAVSVLKRYCHVDRGVRIKIRKAIPVAAGLGGGSS
FT                   DAAAVLRGLNRMWNLHLDLATLARLGLQVDSDVPYCVYSQTAHVTGKGDVVTPLPKLPP
FT                   MWIILAKPKVSVSTPNILRQVNYERIDQHPNIEALLAGIQQQDFAEIFANMGNVLEPIT
FT                   AKRYPEILQIKRQLLTFGADAAQMSGTGPTVFGVCRKQSRAQRVYNSLKGFCREVYLVR
FT                   PVNLNEH"
FT   gene            complement(405818..405955)
FT                   /locus_tag="LPST_C0387"
FT   CDS_pept        complement(405818..405955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97610"
FT                   /protein_id="ADN97610.1"
FT                   /translation="MKATTIFVCQPASKAAATRIPVPIALLHHLWLDTGRDDKWLSATV
FT                   "
FT   gene            406046..406990
FT                   /locus_tag="LPST_C0388"
FT   CDS_pept        406046..406990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0388"
FT                   /product="cell surface hydrolase, membrane-bound
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97611"
FT                   /protein_id="ADN97611.1"
FT                   /translation="MKQSTKFGLKLAGVIGAATYAGTLLGGLAAYQVAMHVSDAQKQQG
FT                   RERSRAENTEIENFWYFKQPKQQWMIQSFDGLNLVATYIPNPKTIGRLAILAHGLGHSR
FT                   EQMIPYARIFMSLGYDVLMPDARSFGDSQGHTIGYGWLDRLDYERWITMALSQLGLDID
FT                   IVLMGISMGAATVMATSGEPLPENVKAIVEDSGYADLYDEAKFRLTHKFHLPAYPIMPV
FT                   ANRLAHVRAGYGFKDGRILQRVIDGGLPILMIHGSKDQTVPVRNAHTLYDQLPQQKGLY
FT                   IDPDAGHVEAIRTHPDRYQEVLDEFLHEQAGLA"
FT   gene            407257..407955
FT                   /locus_tag="LPST_C0389"
FT   CDS_pept        407257..407955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0389"
FT                   /product="zinc/iron ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97612"
FT                   /protein_id="ADN97612.1"
FT                   /translation="MTEPLIAVQHLGIGFPNNQVFKDLNFNIEQGDFLTVIGENGVGKT
FT                   TLIRALLGMLKPTAGQIKYYPNKKAIKIGYVPQFRNLDQEYPLTIEDFVGLNLKGWQPW
FT                   LSRAEHRQVATALAVTNLKKLRQRPLGMASGGEKQRAYLAQAIVQQPQLLILDESTASL
FT                   DNEMKYELLDLVQNLNQTSNITVFFVTHDLPLAKQYAKHYLALKPGHQQFGNIADMSVE
FT                   QLKEATNVNV"
FT   gene            407942..408745
FT                   /locus_tag="LPST_C0390"
FT   CDS_pept        407942..408745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0390"
FT                   /product="zinc/iron ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97613"
FT                   /protein_id="ADN97613.1"
FT                   /translation="MSMFSLVFMRNAYLAGTFIAIICGTIGVFVIARNLSFLTHTLSEI
FT                   GFAGAAFGIFMGWTALSGMLIFTVISSVIVGQMSVKQSRREASISAISALFIGLGILFL
FT                   SLSNQTSSYATSILFGSVIGIASADVIRVAILSAIVLLVMLGLYRPLKFDSFDAIGARV
FT                   SGLWTTGISVVFLVLVAMSVSVAAQIVGSLLIFILLTLPAAAARYFVHTVSKMIFLAIG
FT                   FALIGVWLGLYLSYVTNLPVSFFIAAIECIFYFAALGYQRLRVGS"
FT   gene            409114..409275
FT                   /locus_tag="LPST_C0391"
FT   CDS_pept        409114..409275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97614"
FT                   /protein_id="ADN97614.1"
FT                   /translation="MDSLELCAGRATKQAMKRAAEELAKRKPARKTTKKAATKSHKTTK
FT                   TKHGTSKV"
FT   gene            409824..410366
FT                   /locus_tag="LPST_C0392"
FT   CDS_pept        409824..410366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0392"
FT                   /product="ankyrin repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97615"
FT                   /protein_id="ADN97615.1"
FT                   /translation="MLVYNAFSAVRDGTFDQFKNYYSGNVDETDKFEGLNLLCMAMTND
FT                   DNPEEKLKIVHFLLQAGIDVNFVTKSEHRNALHYFYNCVWRPNPKFAMEITKLLVENGI
FT                   DVNSVDKYGHVPLFYAVFDNDLDTKENEELYFYLLKAGSDYRLRDPFGKSIIDYARETN
FT                   ERTGFLDIVKEYENGKK"
FT   gene            410381..410644
FT                   /locus_tag="LPST_C0393"
FT   CDS_pept        410381..410644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0393"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97616"
FT                   /protein_id="ADN97616.1"
FT                   /translation="MATIIIIGVVIIGITLGLGYWSYLLGKRNQSNFVGPIIPVAYFAV
FT                   RAILAVMTQTTTHGLVSSLLGSLLFSLIYYGLFVGGKHRANK"
FT   gene            411137..411973
FT                   /gene="purR"
FT                   /locus_tag="LPST_C0394"
FT   CDS_pept        411137..411973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="LPST_C0394"
FT                   /product="purine operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97617"
FT                   /protein_id="ADN97617.1"
FT                   /translation="MKVRRSERLIDMTRYLLERPHTLVSLTYFAERYASAKSSISEDLT
FT                   ILKKVFQARGTGILETIPGAAGGARFIPYILKEEAQEFIDEMTTKVADKSRVLPGGYVY
FT                   LSDILGQPDILRQVGRVIATQYLNQKIDAVMTVATKGIPIAQSVATYLNVPFVIVRNDS
FT                   KITEGSTVSVNYVSGSSERIKKMELSKRSLTEGANVLIVDDFMKGGGTINGMKTLIEEF
FT                   DANLIGITVFAEASFVGNRLIDDYTSLLRVTNVSDSDKAIKVVAGNYLEKVFGAEV"
FT   gene            412042..413424
FT                   /gene="glmU"
FT                   /locus_tag="LPST_C0395"
FT   CDS_pept        412042..413424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="LPST_C0395"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97618"
FT                   /protein_id="ADN97618.1"
FT                   /translation="MTTKNAIIMAAGKGTRMKSKLVKVLHQVCGKSMVDHVLTQVEATH
FT                   MANIVTIVGHGAKDVEAALGDRTEYAVQTEQLGTGHAVLQAESLLKDADGMTLIVSGDT
FT                   PLFKAETFEELFEYHQAKGAAGTILTSKAPNPQGYGRVVRNRLGIVEKIVEQKDATKEE
FT                   QEIHEINTGVYCFDNQKLFAALHEVTNDNAQGEYYLTDVIQIMKNQGDVVAAYQMDDFD
FT                   ESMGVNTRAALAQATKVMQQRINAQHMENGVSIINPDDTYIDAGVKIGADTIIEPGVLI
FT                   KGHTTIGEDCFIGAHSEIHDMVIEDRVRVTASFLEDSIMHADSNIGPYSHLRPQAEIGE
FT                   HVHLGNFVEVKKAKIGNRTKVGHLTYVGDATLGQDINVGCGVVFVNYDGVNKHHTNVGD
FT                   SAFIGSNSNIIAPVEVADHSFIAAGSTITDDVNFHDMAIARARQTNKPDFWGRLPHEPE
FT                   NM"
FT   gene            413660..414484
FT                   /gene="bla1"
FT                   /locus_tag="LPST_C0396"
FT   CDS_pept        413660..414484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bla1"
FT                   /locus_tag="LPST_C0396"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97619"
FT                   /protein_id="ADN97619.1"
FT                   /translation="MQTKKWIRGLVCGLALLGGWSWALPVHATSVKSEQTAVKKIAQRD
FT                   LKSLGGRWSVKVTRLGRRKLTVQTGNQRMTRQRSASTIKVYVMLTIYRRVQQRKLRLTQ
FT                   QDQNDLKLMIHNSDNNAANRLIKRAGGFRGVNAAIKHYRFKQTVLQRYMLDTNALRWGR
FT                   DNYTSVADLTRFLTLTYQHKLLGKTYDKKMLTLLKGCRNHSKLPYLVKHATVYNKTGEY
FT                   PDKGVQNDAAIFKTKQGTYSIVVMAQNGKQYQQYQGMNRLGRDVVTYLNQHH"
FT   gene            414850..415830
FT                   /gene="prs1"
FT                   /locus_tag="LPST_C0397"
FT   CDS_pept        414850..415830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs1"
FT                   /locus_tag="LPST_C0397"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97620"
FT                   /protein_id="ADN97620.1"
FT                   /translation="MSEQYFDPKLKIFALNSNKPLAEKIADAVGVKLGKTSVDRFSDGE
FT                   IRINIEESIRGDQVYIIQSTSAPVNDNLMELLIMIDALRRASAKTINVVIPYYGYARQD
FT                   RKARSREPITAKLVANMLETAGATRILALDLHAAQIQGFFDIPLDHLMGAPLLADYFLN
FT                   HHLDENAVVVSPDHGGVTRARKLAEFLKAPIAIIDKRRPRANVAEVMNIIGDVKGKRAI
FT                   MIDDMIDTAGTITLGAQALVDAGATEVYASCTHPVLSGPAIERIEKSPIKKLVVTDSIE
FT                   LPAAKRIDKIEQVSVGQLMGQAIKFIHENKPVSPLFKNRFHNEEN"
FT   gene            416119..417141
FT                   /locus_tag="LPST_C0398"
FT   CDS_pept        416119..417141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0398"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97621"
FT                   /protein_id="ADN97621.1"
FT                   /translation="MTPFYWGSLALASALTLQLTDRRHWLTGHLFLIAVIGILLSAYHR
FT                   FSAQASPTWQFMLVGAKILAYTLLPIVILIVGISFVRYSYRLIRKEGWAFHYSLLAIVG
FT                   GVLVIMLVLSVINLGVWHSRRLWQLLGLALLLTAYFAFSFIAYLLACVMTRLGRHRQID
FT                   YMIVLGAGLMPNGQPTRTLAYRLQTAAKYYRVQRARYHQPITIVVSGGQGPDEVMAEST
FT                   AMRQYLVDQGVPRDAIQEENRSTSTIENLKFSHALIVRQQPFYRAVIVTSGYHVLRANI
FT                   FARQLHLNLTGIGAHTPLYYLPFAMFREYLALIVMYRWANLVVVLGLAAYYVAALVRLI
FT                   "
FT   gene            417224..418210
FT                   /locus_tag="LPST_C0399"
FT   CDS_pept        417224..418210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0399"
FT                   /product="lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97622"
FT                   /protein_id="ADN97622.1"
FT                   /translation="MDHAYRSSWPLIVIVLLGLITLSGCAKNTGGVTASSATTATGNST
FT                   TAVLTKADQQISQQKIAAAQKTLAGASESTPAIKKLALGLKYYQEAEEALDNNQLSLAK
FT                   GYFDTLSSYDGTTDASFIAARQKLVKQYQAVKLANGYYNAARDELSIHDLATAKANIDK
FT                   LDDVQATHPVIKKLQKKALAMKQAIMNYEASQSTSSGSDSSTVVSSSSAASASDSRTSS
FT                   SSTSSTSADSSTMTSSSNSSASASSSSSELTTSAIIKQFQDASGVTFTSDTEFNITKET
FT                   SAYYQITAIYATNESSSSASKTVTDTYRYYPDSGSVTKENSATGSFE"
FT   gene            complement(418380..419189)
FT                   /locus_tag="LPST_C0400"
FT   CDS_pept        complement(418380..419189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0400"
FT                   /product="cof family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97623"
FT                   /protein_id="ADN97623.1"
FT                   /translation="MSVKLIAIDMDGTLLNEHSELNPATVQAINAANAQGIKVVICTGR
FT                   PLSGVTPFLKQLGIAGEDNYVITFNGSMVQTITGKIITGLTLSHDDYIDIETLSRRLNI
FT                   HCHVESEDHIYTANRNISPYTVGESALVNMPIRFRTPEEMRPDLPIVKCMFIDHGPLLD
FT                   AAIKQLPASFSKRFTIVRSEAYFLEFMNPAASKGNALATLTDHLNLTADEVMAIGDQGN
FT                   DLSMLRYATNSVAMGNAIDEAKQIARYETKTNVEDGVAHAINTWALA"
FT   gene            complement(419209..420561)
FT                   /locus_tag="LPST_C0401"
FT   CDS_pept        complement(419209..420561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0401"
FT                   /product="hydrolase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97624"
FT                   /protein_id="ADN97624.1"
FT                   /translation="MAYRQQLLPMEKVFRDPVHDYIYIQHQVILDLINTSEFQRLRRIK
FT                   QLGTTSLTFHGAEHSRFGHCLGVYEITRRICDNFERNYPTQAPGDGGWDDHERLVALCA
FT                   ALLHDIGHGPYSHTFEHIFHTDHEALTVQILTSPETEVNQVLQQVSPDFPAQVAAVIQK
FT                   TYPNPQVVQMISSQIDADRMDYLLRDSYFTGTNYGNFDLTRILRVMKPYQGGITFAMEG
FT                   MHAVEDYIVSRFQMYMQVYFHPVSRSMEVILDRLLERANDLYQSHAVDAEATPVMLLPF
FT                   FNNNFTLHDYLRLDDGVLNTYFSHWRDSRDQILADLATRFLDRRPLKSARVDATTQPLI
FT                   PTLQKLIEQAGFDTHYYTDINDSYDLPYDAYDPKMKKPRTQIELQQKDGSLLELSTVSD
FT                   LVRAITGKVSGDQRFFFPKEMLSKNAENDLFKPIYQEFQQYILNDRLVVPH"
FT   gene            complement(420576..421508)
FT                   /locus_tag="LPST_C0402"
FT   CDS_pept        complement(420576..421508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97625"
FT                   /protein_id="ADN97625.1"
FT                   /translation="MSKPMQQYHFSSIISDDTDNGGGFIMRHPSCPIIADNGVAFLTES
FT                   TIATLSQKYEPAAMLDSFAYTNALLWLTAARQQPIVHFWQLQPTVILGLLDQRLPRLTA
FT                   GLAHLHAAGYQVMLRNSGGLAVVADPGVLNVSLFLPATRERYSITAAYQLMVDYVQAVW
FT                   PQLNITTGEITRSYCPGDYDLSIAGRKIAGMSQRRTAEALVIMLYVSVDGDQMARSQLI
FT                   QRFYQVSLAGHHDARFPDVDPQVMTTVADALAAPTDTTATQARFIAILAQHGTVDTTSL
FT                   PLVTEEPEFQAHLNQAYQQMQRRQQRLHH"
FT   gene            421550..421681
FT                   /locus_tag="LPST_C0403"
FT   CDS_pept        421550..421681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97626"
FT                   /protein_id="ADN97626.1"
FT                   /translation="MQVSWLFVRQQRAAYFDLRGWGTIVGTQPTQKVYACSNFSQQI"
FT   gene            421817..422311
FT                   /locus_tag="LPST_C0404"
FT   CDS_pept        421817..422311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97627"
FT                   /protein_id="ADN97627.1"
FT                   /translation="MIVDGRSACDFEILGGPNMDDLTTGVPVAIHLETQARQDDDTANY
FT                   ALDVDGQLVQMGDAFYLRYKEVNDDAPEPIPVTIKLAANGDVVLTRSAENRLRLHFSNG
FT                   KRVRAHYQTPMGMLPVETVTPMLRVRLRERPFSGEVNVDYDLYAGEQLLGNYKLRLQFT
FT                   A"
FT   gene            422356..422964
FT                   /gene="rpoE"
FT                   /locus_tag="LPST_C0405"
FT   CDS_pept        422356..422964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="LPST_C0405"
FT                   /product="DNA-directed RNA polymerase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97628"
FT                   /protein_id="ADN97628.1"
FT                   /translation="MELKQFDGQKKSELSLIEVAHAILSQHGDVMAFADLTNAVQSYLG
FT                   KSDEEIRERLSQFYTDLNIDGSFISLGDNMWGLRAWYPFESIDEAVIHTDDDEDEDRPK
FT                   RKKRKKVNAFLADAGDDDDVIDYDDDDPEDDDNYDDDDDQDDDTDDSASSKYDELAGVD
FT                   DTDDDVADETLPDGIEGQLSELNDDDDDDDYDDEDDESK"
FT   gene            423137..424750
FT                   /gene="pyrG"
FT                   /locus_tag="LPST_C0406"
FT   CDS_pept        423137..424750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="LPST_C0406"
FT                   /product="CTP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97629"
FT                   /protein_id="ADN97629.1"
FT                   /translation="MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYIN
FT                   VDPGTMSPYQHGEVFVTDDGTETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLQKERR
FT                   GDYLGATVQVIPHITNAIKEKIMRAGTTTDSDIVITEIGGTVGDIESLPFIEALRQMKS
FT                   DLGSDNVFYIHTTLIPYLRAAGEMKTKPTQHSVKELRSYGIQPNMLVVRTEQPITREMR
FT                   NKIASFCDVEPEAVIESLDVKTIYSIPLNVQKQNMDQIVLDHFDVQAPKADMSEWIDLE
FT                   HHVQNLSRTIKIALVGKYVALQDAYISVTEALKHAGYTDDADIDLKKISAEDVTPENVE
FT                   ELLGDADGILVPGGFGDRGIEGKITAIKYARENDVPFLGICLGMQMASVEFARNVLGLK
FT                   DANSAEIDPKTPDNIIDLMADQEDVEDMGGTQRLGAYPCKLKPGTVAAKAYHNEEVVME
FT                   RHRHRYEFNNKYREAMAAKGMVFSGTSPDNRLVEVIELPKKRFFVASQYHPEFLSRPNR
FT                   PEGLFKAFIDAANQTGKVKA"
FT   gene            complement(424767..424886)
FT                   /locus_tag="LPST_C0407"
FT   CDS_pept        complement(424767..424886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97630"
FT                   /protein_id="ADN97630.1"
FT                   /translation="MLPCIFATPVVTVNIGDLIKPVAAQQKKAHQQFAGVLYS"
FT   gene            425219..426490
FT                   /gene="serS1"
FT                   /locus_tag="LPST_C0408"
FT   CDS_pept        425219..426490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS1"
FT                   /locus_tag="LPST_C0408"
FT                   /product="serine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97631"
FT                   /protein_id="ADN97631.1"
FT                   /translation="MLNPKFVRNNSELVKAKLQTRKVDPAEVDEYLQLDQQNRDAITKV
FT                   EGLKKQKNQLTEQIGQSDPQSEAGQALIQQVKQLNGDIKSTEAAQTEVNDRLHYLAIRF
FT                   PNLPADDVPVGPDEDSNVEMRKHGDIPTFEFKPKAHWELGESLGILDFDRAAKVAGARF
FT                   VYYKDAGALLERAVYSFMLDLHIQKQGYHEIIPPYLVNAQTMYGTGQFPKFKEDVYTVE
FT                   SSGMTLIPTAEVPLTNYYANEILSEDQLPTYFTAMTPCYRSEAGSAGRDTRGLIRMHQF
FT                   HKVEMVKYCKPENSYDELEKLTDNAEEVLRELGLAYHVIKLSTGDTGFSSAKTYDVEVW
FT                   MPEQGVYREISSCSNCLDFQARRAMIRYRKADGTVDYVHTLNGSGLAVGRTVAAILENY
FT                   QQADGTVKIPKVLQPYMHGMTEIK"
FT   gene            426842..428122
FT                   /gene="sdaC"
FT                   /locus_tag="LPST_C0409"
FT   CDS_pept        426842..428122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaC"
FT                   /locus_tag="LPST_C0409"
FT                   /product="serine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97632"
FT                   /protein_id="ADN97632.1"
FT                   /translation="MTNIFKGWRKNDTFWMLSLFGTAIGAGVLFLPIGVGTAGILGIIM
FT                   ILILALPTTFFAHRGLSRFVLSAKNDGDDITDVVEQHFGFKIGLLFTIIYFFSIYPILL
FT                   VYSVSITNTVSKFISDQMHMQTPPRWLLSLVLVGILIGIARFGTSLITKVMSGLAFPFI
FT                   IVIVLFSFYLIPHWNGAILSTFSSSVSGGHLVGTLGNLWLLIPVMIFSFNHSPIISSFS
FT                   VAERKEYSGEGKDKVDKKISTILLSAETLMVIVAMFFVISCTLALTPDQILEAKNENVS
FT                   ILDYVATAFNNPIIKYVSPVIAFIAIAKSFLGHYLGTSEGLRGIIRKMEEKSNKTLSSR
FT                   TVSTIVDLVLLLSAWIVAWVNPSIMGMIETIIGPIIAFILFLMPMYAIHKSPKLQQYAG
FT                   KHSNVFVVVIGLIAVSGILFNIIKLFI"
FT   gene            428492..429145
FT                   /gene="sdhB"
FT                   /locus_tag="LPST_C0410"
FT   CDS_pept        428492..429145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="LPST_C0410"
FT                   /product="L-serine ammonia-lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97633"
FT                   /protein_id="ADN97633.1"
FT                   /translation="MTVNYKSVFDIIGPIMIGPSSSHTAGACAIGRAANSIFQEKPTDI
FT                   VIHYYESFAQTHKGHGTDYAIISGILGFDPDDSRVPYAIGLARDQGINITFIEEPGDSP
FT                   INHPNTAIIDLKNDDKQVTVAGCSIGGGTIEIREIKMDGFDVKPKGPLPILLVQGGEND
FT                   HQHVTKQLADLTKVNDQQQYKTAWGNLYEYDLDRRLKQDEIKKLAQGHANLVYL"
FT   gene            429164..430063
FT                   /gene="sdhA"
FT                   /locus_tag="LPST_C0411"
FT   CDS_pept        429164..430063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="LPST_C0411"
FT                   /product="L-serine dehydratase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97634"
FT                   /protein_id="ADN97634.1"
FT                   /translation="MYMSVAELVTAAKETKKPIYELMIEQEVETSQTSREEIWHTMGRN
FT                   LDVMEAAVNKGAAGDGVYSTTGLTGGEAVLLKKYRQKGHTLSGDTMMQAVQNAISTNEV
FT                   NASMGVVCATPTAGSTGTLPGVIFTLKDRMNLNRDQMIQFLFTAGAFGMVIANNAGIAG
FT                   ATGGCQAEVGSASAMGAAAAVEVAGGTPEQSAEALAMAISNLMGLVCDPVAGLVELPCV
FT                   KRNAIGVGNALIAADMALAGCTNKIPADEVIAAMDKVGKGLPKALRETGLGGLAATPTG
FT                   IRMKEKIFGRSTNSQVHA"
FT   gene            430214..430942
FT                   /locus_tag="LPST_C0412"
FT   CDS_pept        430214..430942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97635"
FT                   /protein_id="ADN97635.1"
FT                   /translation="MQKPLTAEQEYVREFIPFVDFLADILGPSSEVVLNDLLDLNHSVV
FT                   AIRNSHISHRQVGDPATDLALRTMKAGKAEKRDYLANYKGVSQGKHSLRSSTYFLRLDG
FT                   EIVGMICINTDDSALDDLQEQVLKVMASYKHLNSPTINQLKGTPANEKAHDTPVAPEHL
FT                   TTSITDLAREVTQAVCAKYGVSVEYLKQNEKLEIVRSLYHQGYFLLKDSVSEAAKVLKV
FT                   SDPSVYRYLQTVKDEDLQQD"
FT   gene            431524..431718
FT                   /locus_tag="LPST_C0413"
FT   CDS_pept        431524..431718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97636"
FT                   /protein_id="ADN97636.1"
FT                   /translation="MLTPNEIRRRLRRDLVTIAEAYQIGFESRLYTEAEYENLKQTLLQ
FT                   LRELNMKPQHMEQLLAING"
FT   gene            432259..433539
FT                   /gene="murA1"
FT                   /locus_tag="LPST_C0414"
FT   CDS_pept        432259..433539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA1"
FT                   /locus_tag="LPST_C0414"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97637"
FT                   /protein_id="ADN97637.1"
FT                   /translation="MKKMIIHGGKRLSGELTIGGAKNSTVALIPAAILADTPVQFDTVP
FT                   HILDVHNLRLILESMNVHSTFENDVLTIDPTNIEESELPSHAIKSLRASYYFMGALLGR
FT                   FNRATVTFPGGDNIGPRPIDQHIKGFKALGANVVEENDSVFISTGTEGLHGARIFLDVV
FT                   SVGATINIILAAVKAHGTTTIENAAKEPEIIDLATFLNNMGAKIRGAGTDVIRIEGVPA
FT                   LHSRATHTIIPDRIETGTYLSLAASIGDGILLKNVIPEHMESFTAKLVEMGVDLQINED
FT                   SIYVPRSNDLDPIRVKTMTYPGFATDLQQPITPLLLRANGSSVVIDTIYPQRTQHVEQL
FT                   RKMGADIRVQDNLIVVGHSSHLQGAHVEAGEIRSGAALMIAGLAASGVTEISRADNILR
FT                   GYDRVIDKLHTLGADVEIAADEEVPEN"
FT   gene            433569..434861
FT                   /gene="rho"
FT                   /locus_tag="LPST_C0415"
FT   CDS_pept        433569..434861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="LPST_C0415"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97638"
FT                   /protein_id="ADN97638.1"
FT                   /translation="MEKILTMHDLEQKTLKEIYNYAREYKISYYSQMNKKELSLAVLRE
FT                   QDKKRGFVQMEGVLEIISQEGYGFLRPINYGPSQEDIYISQSQIHRFGLRNGDYVAGQA
FT                   RPPRPNERYYGLMRVGTVNGKDPNEAKQRPHFPALTPLYPQKQIKLSTTAAVLATRLID
FT                   TFVPIGFGQRGLIVAPPKAGKTTLLKNIANGIVANYPDAKLIMLLIDERPEEVTDLERS
FT                   IKGEVVSSTFDQQPQNHVRVAELVLERARRLVEDKQDVIILLDSITRLTRAYNLVIPSS
FT                   GRTLSGGVDPTAFYKPKRFFGSARNIEEGGSLTILGTALVDTGSRMDDMIYEEFKGTGN
FT                   SELQLSRELAERRVFPALDLKQSSTRKEELLVSRKNLEPVWQIRRSMTGNALEYTEQLL
FT                   QFLKHTKTNTEFVRDLASLKFTGQSTRRSRR"
FT   gene            434988..435233
FT                   /gene="rpmE"
FT                   /locus_tag="LPST_C0416"
FT   CDS_pept        434988..435233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="LPST_C0416"
FT                   /product="ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97639"
FT                   /protein_id="ADN97639.1"
FT                   /translation="MQKGIHPDYHLVVFQDSTTGFKFISGSTATSAETVEWEDGNTYPL
FT                   IRVEITSDSHPFYTGKQKFTKADGAVDRFNKKYGLK"
FT   gene            complement(435366..436502)
FT                   /locus_tag="LPST_C0417"
FT   CDS_pept        complement(435366..436502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97640"
FT                   /protein_id="ADN97640.1"
FT                   /translation="METMVKNDLNQLMQQREDGPYIAIYLNTAVVLNDLNRRRLQFKQL
FT                   VNEAETQMAHHFPKTEFAPYATQLEQLINDNAFWLQHTGPQTGIITNSRDLHIFDLQYP
FT                   TDNHVSVNSMPAIRPVLADRQHQFDFDLLALNEDSMALYAQRDGSFVELDLPAEAPRTL
FT                   TEALGTEKRGGDLNFNASPVHGANYHGHNAKAEERDIDQRNYYQQVAQYVQAHSQKTRR
FT                   PLILMGLPHNQAVFRAVNKNPYLSQHLMINKSPKNLTVGAMQTATEPVQTMWHTQLADI
FT                   LLERYDQAKSRQLALTDPFDMIKPALSGRIDTLIVAADANVAGSLPAADVQLNDPIAAP
FT                   DNLIDDLVDVVIAMNGQIRIIPADRMPVETAALAIMRY"
FT   gene            436701..437405
FT                   /gene="srtA"
FT                   /locus_tag="LPST_C0418"
FT   CDS_pept        436701..437405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srtA"
FT                   /locus_tag="LPST_C0418"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97641"
FT                   /protein_id="ADN97641.1"
FT                   /translation="MKSKQHPGLKWLGRGVFVLLVLVSLALIFNEQIKSWLVSSYSPTV
FT                   TAKTVKQNTKKKSDFNFSKVKSLDFQTVAKARMNKNAINVIGSIAIPSVDLYLPIGNGV
FT                   SNETLALAAGTMKANQKMGQGNYALAGHHMIKHGALFSPLYYKSKVGQMIYVSDAKKIY
FT                   AYKTSQRTFIKATDVQVIDDVPGQKLITLITCDKTGAGRLMIRGKYEQQWSFKSAPTQV
FT                   QKAFTSHFNNKY"
FT   gene            437514..438074
FT                   /locus_tag="LPST_C0419"
FT   CDS_pept        437514..438074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97642"
FT                   /protein_id="ADN97642.1"
FT                   /translation="MIALIIVAVVLVLIAIYVVIYNGLVKSRMYTQEAWSQIDVQLKRR
FT                   TDLIPNLVNTVKGYAKHEKSTLAEVISLRNQLTQVPSGDHQQAMAVSDQLTNSLKSIFA
FT                   LAESYPDLKANQEFGKLMEELTNTENKIAYSRQLFNSSAASYNMKLQQFPSNIIAGIHH
FT                   FKNVEFLTVPEAEKAAPTVSFED"
FT   gene            438086..438985
FT                   /gene="htpX"
FT                   /locus_tag="LPST_C0420"
FT   CDS_pept        438086..438985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="LPST_C0420"
FT                   /product="heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97643"
FT                   /protein_id="ADN97643.1"
FT                   /translation="MLFEQIARNKRHTLYVMAAFVILLAVIGLAVGYVFFNSAIAGLLV
FT                   ALIAAVFYMVLMISQSTDIVMSMNHGRELHQADDDPELWHIVEDMALVAKVPMPRVFII
FT                   DDESPNAFATGNDPEHAAVAVTTGIQARLTREEMEGVIGHEMSHVRNYDIRLQTIALAL
FT                   TAAISLLVNWGMNAFWWGGGRRSRDNDRDGNGAQVLLMILAIVVIILAPLAASLVQMAL
FT                   SRNREYLADAGSVELTRNPLGLISALEKIDDSQPMQAADPSSAALYISDPFKAKKSWMH
FT                   LFDTHPPMADRITRLKNM"
FT   gene            439046..439834
FT                   /locus_tag="LPST_C0421"
FT   CDS_pept        439046..439834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97644"
FT                   /protein_id="ADN97644.1"
FT                   /translation="MRRLQRKYIYANLEKLDNLVFAYGIDQSDFVHGIKRLPANLVSLV
FT                   GVDDNEHAVNAHTGLNVINDENEIRRYLLQSHALPVKWLDYDEVGDLDFLTATEIAELL
FT                   YLGHMDRPIRSPFNYKLRNHYVFLEQRNGGIKVYFYYISAFSHILSAAIVRHTLAAYRG
FT                   RRMFMRSLSVPRVPEAILKQLVQLMPDGLFIYFDQSMVRQRQLLVPVHTETTGNEIEVF
FT                   DPARGGENRRTHHVATLTFNLNSGVWDLQVQDQAAFEEHL"
FT   gene            440056..441444
FT                   /gene="murF"
FT                   /locus_tag="LPST_C0422"
FT   CDS_pept        440056..441444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="LPST_C0422"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diamino pimelate--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97645"
FT                   /protein_id="ADN97645.1"
FT                   /translation="MKMQVAEIAKAVQAVNAEQAWPDVNVTGVAFDSRKLQAGDLFIPL
FT                   MGANDGHQYIQSAIEHGAVATLWASDHADDVPEDLPVIMVADTLTALQQLGQYYLQKIN
FT                   PKVVAVTGSNGKTTTKDMIASVLGTQFNVTKTHANFNNQIGVPVTLLSMEPNTEVVVVE
FT                   MGMDHFGELDFLSRLVQPDVAVITMIGEAHIEFFGTRDRIADAKMEIVHGLKEDGTFIF
FT                   NGDEPLLQERAKEVSQHQRTFGLDDTNTLAGSDITTSRAQTQFKTSLWPDNTYTIPMMG
FT                   AYNVNNALAALLVADTFHIRPAAAQQAIASFVPTENRTEWLTGYRGEAILSDVYNSNPT
FT                   AARRVLAAFAAVPTKGQRIAVLGDMLELGDQSDALHMSLASELDPATIASVYLNGEHMR
FT                   ALAEVLQEKYPAGAVHYYQTDQQPQLIADLTATVSADDQVLLKGSHGIHLEKVLTALEA
FT                   APEK"
FT   gene            441699..443285
FT                   /gene="rhe1"
FT                   /locus_tag="LPST_C0423"
FT   CDS_pept        441699..443285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhe1"
FT                   /locus_tag="LPST_C0423"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97646"
FT                   /protein_id="ADN97646.1"
FT                   /translation="MKFTELGLSDSLLKAVNRAGYEEATPIQAETIPMVLEGKDVIGQA
FT                   QTGTGKTAAFALPILQRLDFDNHNIQALVVSPTRELAIQTQEEIFRLGKDERAKVQVVY
FT                   GGADIRRQIRNLKQNPQVIVGTPGRLLDHIRRGTVKLDHVKMLVLDEADEMLNMGFLED
FT                   IESIIKQVPDERQTMLFSATMPPEIKRIGVQFMKEPHHVKIKSKEMTADTVDQYYVKAK
FT                   EFEKFDIMTRLFDVQAPELTIVFGRTKRRVDELSKGLEARGYNAAGIHGDLSQQRRTQI
FT                   MRQFKAGKLDILVATDVAARGLDVSGVTHVYNYDIPQDPDSYVHRIGRTGRAGHKGVSL
FT                   TFVTPNEMEYLRVIEKLTKKRMLPLKPPTESEAFAGQLAAAEANVDSLVAKTSTEKYAD
FT                   QAAELLQKYDATDLVAALLNDLTKDDASAVPVKITPERPLPRHKGGGGNNRRGGYRGGN
FT                   RNRNNSHGNGRGGYSHNGRNRDRDRNGGRGDRKSNGYKGRSRDDNRSSNRNHDEGRKQS
FT                   SKRSYTIRTND"
FT   gene            complement(443402..444664)
FT                   /locus_tag="LPST_C0424"
FT   CDS_pept        complement(443402..444664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0424"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97647"
FT                   /protein_id="ADN97647.1"
FT                   /translation="MSQDHSTKVLLQIKDPNITDLVVQEATNGSLQVLAKLTYPVTVCA
FT                   RCGKRSMVKNGFKTVHIRIPRISERVTILNLKKQRFICKNCGKSSLTTTTLVKKHHQIS
FT                   ENSLHAIDLSLTEDRTMASIAAQYNVSTNTISRRIKLLGQGTQPAFNGLPTMLCIDEFR
FT                   STGKQMSFIAVDAQTHDIITILPGRKNADIKDFFLNHYSKRHRDRVTRVVMDFNSQYQP
FT                   AIRTLFPHAKLVADNFHLVQMALRSLNQTRVQLMKRFNPKSREYRVLKYYWRLYLKDYD
FT                   SLEKRKPQWFAHLKDRMTPEQLVVAGLNLDQQFRQTYQAAHALVKAFQKRDYRSFKAAL
FT                   GHVENVSPQLMTNIKSFIKNRQLIKNMTTGRLSNGPVEGVNRKIKQIKRTAYGYKNWQN
FT                   FIYRIQIEFKIKIEKKNPIRK"
FT   gene            445839..446201
FT                   /gene="acpS"
FT                   /locus_tag="LPST_C0425"
FT   CDS_pept        445839..446201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="LPST_C0425"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97648"
FT                   /protein_id="ADN97648.1"
FT                   /translation="MIYGTGIDLTELSRIEAILAKGLRLPEKILTPAELAVFSRYPVKR
FT                   QIEFMAGRFSAKEAYSKAYGTGIGAAVGFQDIEILDNAQGKPEVTRHPFDGPAWISISH
FT                   TDTLVMTQVILERGNL"
FT   gene            446201..447328
FT                   /gene="alr"
FT                   /locus_tag="LPST_C0426"
FT   CDS_pept        446201..447328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="LPST_C0426"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97649"
FT                   /protein_id="ADN97649.1"
FT                   /translation="MVVIGEHRHTQVTVDLQAIKTNISNEMAQKDELTELWAVVKANGY
FT                   GHGIIQVAQAAKEAGATGFCVAILDEALALRAAGFAEPILVLGITEPEYAPLVAEKDIS
FT                   LAVGTQDWLTTAAAILAANQVTTPLHVHLALDTGMGRIGFQTPEELATAVTTLRQPQSP
FT                   FDFEGIFTHFATADQADDTYFTHQLNNWKHLIAVVDELPRYVHVSNSATSLWHQACNGN
FT                   MVRFGVALYGLNPSGRELSAPYPLQPALSLTARLTFVKRLARGKSVSYGATYTAAQDEW
FT                   IGTVPIGYADGYERRLQGFHVLVDGEFCEIVGRVCMDQLMVRLPHEVPVGAKVTLVGTD
FT                   GARTISLQDIADYCGTIHYEIACGLAPRVPRVYID"
FT   gene            447737..448129
FT                   /locus_tag="LPST_C0427"
FT   CDS_pept        447737..448129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97650"
FT                   /protein_id="ADN97650.1"
FT                   /translation="MAAADIKRGDIFYADLSPVVGSEQGGMRPVLIVQNNVGNHYSPTV
FT                   IVAAITAKVQKAKMPTHVNINAAHTGIEKNSVVLLEQIRTIDKQRLKDRVTHLDDQTMR
FT                   RVDNALQISIGLADRTRRRPQRTFQS"
FT   gene            448421..450400
FT                   /gene="kup1"
FT                   /locus_tag="LPST_C0428"
FT   CDS_pept        448421..450400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup1"
FT                   /locus_tag="LPST_C0428"
FT                   /product="potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97651"
FT                   /protein_id="ADN97651.1"
FT                   /translation="MSKQAQFNKHRVAGLLVAMGVVYGDIGTSPLYVMKAIITGQGGMQ
FT                   AVDEKFMLGAVSLVFWTMTLLTTVKYVLIALNADNHGEGGIFSLFALVRHRARWLVIPA
FT                   MIGGAALLADGALTPAVTVTTAIEGLRDVPAYVQLFGAGQNTIILITLGIITLLFMLQR
FT                   FGTNTIGKLFGPIMLGWFTFLGVSGFVNLVKDWTILRALNPYYAWLLLISPANKVGILI
FT                   LGSVFLATTGAEALYSDLGHVGKTNIRLSWPYVKVCLLLSYFGQAAWILGPGQAIQGHV
FT                   NPFFAMLPASLMMAAVIFATLAAIIASQSLISGSFTLVSEAIRLKLFPRLLTTYPGKAV
FT                   GQMYLPVVNWGLWGVTSMLVIFFQTSERMEAAYGLAITLTMLMTTTLIYAFLRQKRLPL
FT                   IGAGLLTGFFATIEVIFLIASAAKFWHGGYVAVGLALLIFLVMAVWYRGEQIVRQHNHP
FT                   LSLRQYQDQLAKLRNDQTVDKFQTNVVFLTSRMDGDQVERKVLYSILDKWPKRADVYWF
FT                   VNVTITDEPYTAEYTVDTLATDYLVTVKLYLGFRVRQDINRYLRTIVRDLMATGRLAAQ
FT                   KQTYSVTSGRDVGDFRFVIIEEKLENGSRLSRLDRLVIETKLMIKKYATTPAKWFGLEF
FT                   SEVTLETVPILFNEIPALPITERQ"
FT   gene            complement(450533..450658)
FT                   /locus_tag="LPST_C0429"
FT   CDS_pept        complement(450533..450658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97652"
FT                   /protein_id="ADN97652.1"
FT                   /translation="MKLVLSYQLLKQKLKLDELLSKPTVSFLFFSTCSSYSGFRG"
FT   gene            451096..452148
FT                   /gene="ssuA"
FT                   /locus_tag="LPST_C0430"
FT   CDS_pept        451096..452148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuA"
FT                   /locus_tag="LPST_C0430"
FT                   /product="Putative aliphatic sulfonates-binding protein
FT                   ssuA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97653"
FT                   /protein_id="ADN97653.1"
FT                   /translation="MRKKEIIFGLLSFIALGTVLAGCGSSSASSKDTSKTYKYGEVTIP
FT                   AKDGSICNAPNYIAYEKGFFKKNGIKAKLVANPRDISDLEAGFASGKYDAQNGDFQYLP
FT                   AIQNGAQIKAVGGIHQGCIKLLVPKNSSIKSVKDLKGKTIGIPAQGSTPQYVTSIALQH
FT                   AGIDPKTGVTWKVYSTDLLAKAAEKGQVDAIGTVDPYAYQAQKESGFKTIIDNNNNSGN
FT                   AKMAAMGMKSKGACCYLYVSSKLVKENPAKAKAIVRSYKQAAAWINNHPEETAKIELNK
FT                   GYVSKTKFINVKNVTQILKDEHFELNLKTGKEDLSYYIKQLKQAGYLKKNTNNKQLLKQ
FT                   AYWYPDLSKN"
FT   gene            452169..453182
FT                   /gene="ssuC"
FT                   /locus_tag="LPST_C0431"
FT   CDS_pept        452169..453182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="LPST_C0431"
FT                   /product="Putative aliphatic sulfonates transport permease
FT                   protein ssuC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97654"
FT                   /protein_id="ADN97654.1"
FT                   /translation="MQITAVQLSRKKAVQAAKTTGRYWKPWHLTWNIVSLVVLAIAYFE
FT                   NQLVVSQETVNNQTYHWFLGGYFAYLLIVTLIGAVTNGRIRRYNGHFAQLNVSLVGLLI
FT                   VQDLLTEKFAVLEQPFFVSFAQILDQMRENAGLLWASTLSSLALWLISFVIGTILGILL
FT                   GLGMGRYREFNYWAFPYLKVIGIIPAAAWMPLTMVIFPTSYMAEVFLIAFSVWFPVAFM
FT                   TIGGVQGISKEYFESAKTLGFSEWQIIRKIVLPGALPSIFTGVYTAMGLSFTMLVISEM
FT                   IGAKVGLGWFINWAKGTGNYTQVYAAIVIMAILFSVLFAVFTKIQDYCLRWRDGAH"
FT   gene            453198..453968
FT                   /gene="ssuB"
FT                   /locus_tag="LPST_C0432"
FT   CDS_pept        453198..453968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="LPST_C0432"
FT                   /product="Aliphatic sulfonates import ATP-binding protein
FT                   ssuB"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97655"
FT                   /protein_id="ADN97655.1"
FT                   /translation="MGLLAVQHVNQRLQDNDGHQIDVLDDIDFTVNPGEFVAIIGPSGC
FT                   GKTTLLRLISGLDHPASGQLTIDNQQIKRPDNSRGYVFQHGSLFPWSTIKENISVGLKV
FT                   TRGRHYDHQLVDHYIELMGLKGFENAYPHQVSGGMAQRAALARSIIMNPQLLLLDEPMG
FT                   ALDAFTRADIQNVIEQVWQQTQTTMILVTHDIDEAVYLSDRIIVMTPRPGRIKEIVTNP
FT                   LPHPRSRLSVDFAEFRHRIQDKLNFGAHDGQVAG"
FT   gene            complement(454115..457177)
FT                   /gene="carB"
FT                   /locus_tag="LPST_C0433"
FT   CDS_pept        complement(454115..457177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="LPST_C0433"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97656"
FT                   /protein_id="ADN97656.1"
FT                   /translation="MPKNNAIHSIAVIGSGPIKIGQAAEFDYAGTQACLSLKAAGYHVI
FT                   LINSNPATIMTDTATADEVYLEPLTLTSVTKILRAAHPDALLPTLGGQTGLNLAMALDQ
FT                   AGVLNELKIQLLGTSLATINQAEDRAAFKTLMKRLHQPIPASTTVHHVTSALSFAEKIG
FT                   YPVIVRPAFTLGGSGGGIANNAAELTQTLQRGLTMSPVTECLIEQSIAGFKEIEFEVMR
FT                   DNQGTKIIVCSMENFDPVGIHTGDSIVYAPVQTLTDTEYQQLRTAALTIVEALDIRGGC
FT                   NVQLAQDPNSRQYYVIEVNPRVSRSSALASKATGYPIAKIAADIAIGLNLSEIKNPVTQ
FT                   TTYAAFEPALDYVVAKIPRFAFDKFPTADAHLGTQMKATGEVMAIGSTLEEATLKAIAS
FT                   LEIDPKTQASLTPDHHVTTTEYIDQLTHPTDQRLFYLLAALQAGWPLAKLATLTQITPF
FT                   FLSKLQHIAQLIRNIKQVPTSQHLLSAKKYGVSLATMAHYAQTSVATIAAMTADLPFVY
FT                   KMVDTCAGEFASVTPYFYSTAFGQTNESHPLGHSILVLGSGPIRIGQGIEFDYTTVHCV
FT                   KAIQQAGYHAIIVNNNPETVSTDFSTSDKLYFEPLTIERLMPIIALEQPAGVIVQFGGQ
FT                   TAINLAYQLTKLGVTVLGTSVSATDLTEDRQSFADCLRLLKIAQAAGTTVTELSGARQA
FT                   AHAIGYPLLVRPSFVLGGRAMAIVHNDHELTPVIKSAVAAGHGAPILMDQYLAGTECEV
FT                   DVLSDGTSCFIPGIMEHIEGAGVHSGDSITVYPPQHLSPAVQDKIVTIATKLAQHLHCV
FT                   GMMNIQFVVTDDVYVIDVNPRASRTVPYMSKVTHLPLAQLATRLILGQSLATLGLVPGL
FT                   LTPAPQQIAIKAPVFSFNKLPQSPVVLSPEMKSTGETLGIGPTFTTAWHAAMADSYHLE
FT                   TWQTVDGLITDIATVAQPAVQELFAANHLTVTTIANTTDWPAKTKAVGFTLNDQPDNPV
FT                   AIAALNHGQPLITAIDTLKTLLASTTTMVSE"
FT   gene            complement(457170..458237)
FT                   /gene="carA"
FT                   /locus_tag="LPST_C0434"
FT   CDS_pept        complement(457170..458237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="LPST_C0434"
FT                   /product="carbamoyl phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97657"
FT                   /protein_id="ADN97657.1"
FT                   /translation="MNKYLTLADGTQWIGTAIGDCQLEAAGRIVFNTGMTGYQETLTDP
FT                   SYLNQMIAFTYPLIGNYGIDPTVAQAPTIGAQAIIVHELATFNDHYTSRQSLASFLTIH
FT                   HVAGIEGVDTRDLTIHIRQTGAQMAILSNHPITDFEAQLATFAPQVLTATPLPVATTTI
FT                   RPRVAILNFGEKAAITAELQARGADVVVLPPTASLKAVAAYHPDGILLSNGPGDPTDYH
FT                   TYLATIRQLAQRYPLAGICLGHQLIALAYGARTYQLSFGHHGLNHPVQACADGRIIMTS
FT                   QNHDYAVDPASIKGTPLIVTHTELNDGSIEGLRLPHQAVMSVQFHPEAHPGPQEAGQFF
FT                   DDFLLTIQKEAVVNA"
FT   gene            458506..459531
FT                   /gene="argC"
FT                   /locus_tag="LPST_C0435"
FT   CDS_pept        458506..459531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="LPST_C0435"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97658"
FT                   /protein_id="ADN97658.1"
FT                   /translation="MQVALVGVTGYSGMVLYRLLKQHPEIDRIQLYGHVGATTVALKTV
FT                   AAMYQKETAVIRPFDATAIMRDNAIVFFATSAGITRQLALPFIAAHFPVIDLSGDFRLH
FT                   DPEQYQRWYQRDPAAATALAQASYGLADMPAPLSTYIANPGCYATATLLGLAPLAQQQL
FT                   VEPTSIVVDAKSGLSGAGKRATAASHYVAVNDNLSLYKLNQHQHIPEMMQQLQQWWSAI
FT                   SAIEFTTTLIPVTRGIMTTIYAKAKSALTTTQVRAAFTATYHEQPFVQVLPTGMPTLKD
FT                   VVGSNNCALGVDYNPVTNTIVVVSVIDNLMKGAAGQAVQNFNRYFDFAVTAGLPTLPVF
FT                   P"
FT   gene            459556..460770
FT                   /gene="argJ"
FT                   /locus_tag="LPST_C0436"
FT   CDS_pept        459556..460770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="LPST_C0436"
FT                   /product="bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97659"
FT                   /protein_id="ADN97659.1"
FT                   /translation="MQMQVLTNTKFETVAFQWPAGFYSDGIHIGLRRHKKDFGWLFSKV
FT                   PASAAGTYTTNQFQAAPTKLTKQIIDQGHQLQGLLLNSAIANSCTGEQGWQNALQEQAW
FT                   LANKLNVAPNLIGVASTGLIGAQLPMDKIKNGLPQLTPTKSDAVTYAVLTTDQHPKTVC
FT                   VQCELSGQLVTLTGFAKGSGMIHPKMATMLGFVTTDAQIDGPVLQDMLSTNVDQTFNQI
FT                   TVDGDTSTNDMVVTLANGLADNPSLQAGTTDYDIFNQALHYVLGQLAKQIAADGEGATK
FT                   LVECNVVHAATTFDGQQIAKAIVGSNLVKAAVFGEDPNWGRIISTIGATDADIDVATVD
FT                   IEMNGVLLVQQSLAVDFDMAAVQATLRDNQIMIDVDLHHGTASGQAWGCDLTYNYVKIN
FT                   ASYHT"
FT   gene            460786..461532
FT                   /gene="argB"
FT                   /locus_tag="LPST_C0437"
FT   CDS_pept        460786..461532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="LPST_C0437"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97660"
FT                   /protein_id="ADN97660.1"
FT                   /translation="MTKLIVIKIGGQAISQLSTTFFDQIAQWYQQHYQILIVHGGGPMI
FT                   NRLTTQLALPVHKVNGLRVTDAATLVLTKLALLGDAQPALLAKLTQHHLPVLGLNAADN
FT                   QLLTGELIDYRQLGYVGRLTAVNQVQLMQLLAHHIGILAPLALTETGQWLNVNADMAAT
FT                   VLAQQLHAEKLVLLTDVPGIIHHGNVMTSLSPQQAQQLIRTAVITAGMQPKVQAAIAAI
FT                   QTGVKQAIITNAIDQPGTAIIQEVAV"
FT   gene            461529..462698
FT                   /gene="argD"
FT                   /locus_tag="LPST_C0438"
FT   CDS_pept        461529..462698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="LPST_C0438"
FT                   /product="acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97661"
FT                   /protein_id="ADN97661.1"
FT                   /translation="MTMQHVFPTYQRFPFAITDGQGVHLTDNHGKTYLDFTAGIGVCNF
FT                   GYHQPQIQAAVTQQLTHIWHTSNLYENELQDAVAGLLANGEERLVYFANSGTEANEAAL
FT                   KLARKYTGKTGILAFQHSFHGRTYGAMSMTGNPHIQAGYAPLVPGITFATYNDDAALDK
FT                   ITPELAAVILEVVQGEGGVFAGQTAWLQAVNAKCQATGVLLIIDEVQTGIGRTGYRMAY
FT                   EGYGLDPDIYTVAKGLANGLPVGAMVGRRQLATAFGPGSHGSTFAGNAVAMAAAKRVLT
FT                   QLTPALLTTVRAHAKLVWQSLATQVEPIPVVKQITGKGLMIGIHLDEQIPVNQVITRLQ
FT                   VEGLLTLSAGDNTLRLLPPIVMQPADLLAGIALIAKVLTTLTTEVTTNE"
FT   gene            462691..463713
FT                   /gene="argF"
FT                   /locus_tag="LPST_C0439"
FT   CDS_pept        462691..463713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="LPST_C0439"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97662"
FT                   /protein_id="ADN97662.1"
FT                   /translation="MNNQFEGRSFLKEIDYTPTELAYLIDFASHLKTLKAHHIPHPYLQ
FT                   GKNIALLFEKMSTRTRSAFTVAANDLGANPEFLGKDDIQFGTKESVVDTAKVLGSMYDG
FT                   IEFRGFKQSTVEDLATYSGVPVWNGLTDEWHPTQILADFLTLKEHFGHLKGLTLAYVGD
FT                   GRNNMANSLLVAGAMLGINIAIGAPVALQPAPAVVALAQQYAQAAGSTVVITADPQQAV
FT                   TQADALYTDVWVSMGEQVDYGERIKQLLPFQINTALLAATGKSSTIVMHCLPALHDLKT
FT                   QLGAKLGEQYGMTAFEITDDVFQSKQAVVFEEAGNRMPAIKAVMAATLGNLFIPTSIFN
FT                   "
FT   gene            463822..464328
FT                   /locus_tag="LPST_C0440"
FT   CDS_pept        463822..464328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0440"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97663"
FT                   /protein_id="ADN97663.1"
FT                   /translation="MTQSKIRPWIINALVAAMYVVLCLGPAAFSLASGAIQFRVSEGLN
FT                   HLAVFNRKYIWGIVAGVILFDAFGPGASLFNVLFGGGQSLLALLVLTWLAPKLKTVWQR
FT                   MLLNIALFTVSMFMIALMITMMSSGVAFWPTYLTTALSELIIMSITAPIMYSLDRVLHF
FT                   SDRIQ"
FT   gene            complement(464528..466153)
FT                   /gene="oppA"
FT                   /locus_tag="LPST_C0441"
FT   CDS_pept        complement(464528..466153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="LPST_C0441"
FT                   /product="oligopeptide ABC superfamily ATP binding cassette
FT                   transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97664"
FT                   /protein_id="ADN97664.1"
FT                   /translation="MLMKKLTTISCLLLVLSSLTACGQAHANVTTTRKTLHLMQDSELT
FT                   SLDTSNTATLTQWNVLQQSMEGLYRMNAQNKVVGAMATKVVKPTNHGKTYTFHLRRNAK
FT                   WSNGHTVTAKDFVTAWQRSVSATSTSGYSYIYEGIKNAAQISAGHKSVKSLGVTAVNKH
FT                   TLKVTLSHAMPYLSKMLTMPAFFPQDHQVVSKYGKDYGTTSTKMAYNGPFAVKGWNGTN
FT                   DSWNLLKNTYYYDKSDIKLNKITMQVVKDSTTAHNLFSQNKLDDATVTGVTAQGVQNDS
FT                   HLKHVSKAGTYYLRLNMQKNRALNNQYLRQALNLVLNKKTLTKNILSDGSTPAYNYVTP
FT                   GLTTDPTTGKDFGTETQSTYRHNVAKAQVLWNKGLKQLDRSSVTLKLVSDDTTVAKNID
FT                   QFVQAAVAQNLKHAKMSVSAIPSKASGEAVTNGNYDLTYTLWLADYADPISFFDILTKN
FT                   NPQNYGHYDDTVFNQQITAAHNQNATNTQSYWQNMRTAAKRLNQTAAVVPLYNMTESHL
FT                   VNSNLNGVSYHAVGENDYTRAYFK"
FT   gene            complement(466170..467075)
FT                   /gene="pepL"
FT                   /locus_tag="LPST_C0442"
FT   CDS_pept        complement(466170..467075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepL"
FT                   /locus_tag="LPST_C0442"
FT                   /product="proline-specific peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97665"
FT                   /protein_id="ADN97665.1"
FT                   /translation="MLTGTHLIQLKNGFHLFTRTVGHGPVKVLCVHGGPGSNHTEFENF
FT                   ATELGEENFQISMYDQLGSFYSDQPDFSRPENQQFLSLDYYLSELEEVRQQLGLEDFYL
FT                   LGHSWGGLLAQEYALKYGQHLKGLIIMSMIDNIAEYTPHVNKLREQTLIASQVSYMQDI
FT                   ENAEAFDDPEYKSLVTTLNRHFVCRHPENAPRQLVSTLATPVYNYFQGNNEFVMVGALN
FT                   GWDQRANLHKIMTPTLLTFGEYDTMPLSVARRMQRTLPKARLTLTPDGGHCHSVDNPTA
FT                   FFHSLRRYLTDVETNQFTAY"
FT   gene            467565..467690
FT                   /locus_tag="LPST_C0443"
FT   CDS_pept        467565..467690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97666"
FT                   /protein_id="ADN97666.1"
FT                   /translation="MPIAGTQLTRTRFVNMALGSERPAFETRYFDSNLRPPRSDN"
FT   gene            complement(467840..468478)
FT                   /locus_tag="LPST_C0444"
FT   CDS_pept        complement(467840..468478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97667"
FT                   /protein_id="ADN97667.1"
FT                   /translation="MLLKTLVKPKERLVTITADATLEDALKVLEDSGFRCIPILDETGH
FT                   IFRGNIYKMHIYRHKSRGGDMSLPVTTLLKNATKTIQVDSAFYNIFFSIKDLPYIAVLD
FT                   EHGYFYGILTHTRLLDMLSQSWNVNVGSYVLTVVSVGERGDLAAMAKIITKYTSIAGCL
FT                   TLDVQNGTLGYRTLFTLPENVDSEKLKRIIDNLNRKQFKVIEVEDLQAE"
FT   gene            complement(468633..470027)
FT                   /locus_tag="LPST_C0445"
FT   CDS_pept        complement(468633..470027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97668"
FT                   /protein_id="ADN97668.1"
FT                   /translation="MKHKRGLMIGGSILGLLVIGYVATSLIWQHQQTFLSNTSVAGVDV
FT                   SGKTAAQAAPKVNRALEHRTYRIIENGQTKYSFTSKSAGITINTKKDLTKLVTKQNYWR
FT                   WPLALLQSAQADDSSAVGQLTINHTDLKTLLQKITTTANQTKRTKTENAKLVYQHNQVE
FT                   IKKEVQGTELDQAKLKTVVTKAISNGDSHITLKDAYVTPTVTSTSASLKTAKVKSAKYA
FT                   TEKATYNINGHKFTIPHDLILSWIKVDKQGKVSLDQNAVLTYVKQLNDKYHTYHTTRQF
FT                   KSTARGTVSVSGGFYGWTIKTEAEAKALATEILKDKDFTRSPITSGSGYNNKGTDIGNT
FT                   YVEVDKENQHMYVYVDGKLKVSTDIVTGKPGKHATTTGVWYIWNKEKNATLKGDNDDGS
FT                   SYSQPVSYWMPFDDTGEGIHDSSWQTQYGGTWYKKHGSHGCVNTPPSVMKKVFAAVPVG
FT                   TPVIVF"
FT   gene            complement(470246..471208)
FT                   /gene="ldhL1"
FT                   /locus_tag="LPST_C0446"
FT   CDS_pept        complement(470246..471208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldhL1"
FT                   /locus_tag="LPST_C0446"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97669"
FT                   /protein_id="ADN97669.1"
FT                   /translation="MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRT
FT                   KGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNLNILS
FT                   SIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRLRVALGKQ
FT                   FNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDEDLAKLEDGVRNKA
FT                   YDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAVIGGT
FT                   GLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELENK"
FT   gene            471540..472097
FT                   /gene="pth"
FT                   /locus_tag="LPST_C0447"
FT   CDS_pept        471540..472097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="LPST_C0447"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97670"
FT                   /protein_id="ADN97670.1"
FT                   /translation="MKMIVGLGNIGRQYAQTRHNVGFMIVDELASKLNVTFQTSKFEAQ
FT                   VATAFQDGEKILLVKPATYMNDSGRAVGPLMSYYNVDPADLLVIHDDLDLPLGKVRLKQ
FT                   KGSAGGHNGIKSIISHVGDQHFKRVKVGIDHPQKMSVVDYVLGKFTPAEVAKFDDAKIT
FT                   ALAAVEAWLANDDFAAVMNQYN"
FT   gene            472117..475644
FT                   /gene="mfd"
FT                   /locus_tag="LPST_C0448"
FT   CDS_pept        472117..475644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="LPST_C0448"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97671"
FT                   /protein_id="ADN97671.1"
FT                   /translation="MDIETIVEQTPDFQTILAGISPRSRQLITGLNGSARTVYLSALFH
FT                   QLTHSLLIVTDNGFHASQLVDDLTSLLDEDQVFLFPAEEMIATEVATSSPESRAQRVQA
FT                   LNALLRDSPAVVVTSVAGARRFLPPVAQFQAATLPVAVGQDIDLEDLQRQLHDMGYVKE
FT                   KLVARPGDFAVRGSIVDIYPLDADYPLRLDFFDTEVDTLKYFDPETQRSVENLDEYTIL
FT                   PATDFILTSAMLQAGAQRLKTAIAAENKKLKPAERQTLADNLAQPLADMEKGIIGNDLL
FT                   LYGDYLYDRKTSIFDYVAADGLVIFEEYSRLLDSEQQLLTQEADWVTDQLAHHRVLATA
FT                   SYGNDIRDLLRDDQHAQLLISLFQKGIGNVKLAQVTNVRTRPMQEFFGQLPALKTELDR
FT                   WHKLKQTVVLMVSEAERLTKVSDTLDDFEIEAVMTKATNLQPGAVQIVQGSLQNGFEFP
FT                   DGKLVIVTEQEMFKKVAKKCPRRQTLANAERLKSYTDLKPGDYVVHVNHGIGKYVGMET
FT                   LEVDGVHQDYITIAYQNNAKIFIPVTQLNLVQKYVSSESKTPRINKLGGTEWTKAKRKV
FT                   AAKIEDIADELVDLYAKREAEKGYAFPPDDSYQDDFDNDFPYPETPDQIRSINEIKHDM
FT                   ERPKPMDRLLVGDVGYGKTEVALRAAFKAIEAGKQVAFLVPTTILAQQHYETMLNRFEG
FT                   YPINVGMLSRFRTTKEMKETVQQLKSGEIDIVVGTHRLLSKDVAFADLGLLIIDEEQRF
FT                   GVKHKERLKALKASVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPTNRYPIQTYVMEQ
FT                   NFGVIKEGIEREMQRNGQVFYLHNRVHDIDKVVAQIKDLVPDAAVAHIDGQMPESQLEG
FT                   ILYDFIRGEYDVLVTTTIIETGVDIPNVNTLFVENADRMGLSQLYQLRGRIGRSSRVAY
FT                   AYFTYQQNKVLTEVGEKRLQAIKDFTELGSGFKIAMRDLSIRGAGNLLGKQQHGFIDSV
FT                   GYDLYTQMLSEAVAKKRGQAAKVKTDATVELGIEAYLPTSYIEDERQKIEIYKRIRQLE
FT                   NNDQYMEVQDDLMDRFGDYPVEVAGLLAVGKLKLLADDALIEKIQRDDSELHLTLSKQG
FT                   TAKLDTKDIFKALAKTKLKATVGIDDDKMKVKLVIQPKMQQDEWLAQLTQFVEQLSLIL
FT                   AEDDVASAS"
FT   gene            475819..477423
FT                   /locus_tag="LPST_C0449"
FT   CDS_pept        475819..477423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0449"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97672"
FT                   /protein_id="ADN97672.1"
FT                   /translation="MPKDHLNTVFKGALILSISSLVAKILSAVYRIPLQNMVGNTGFYV
FT                   YQQIYPLYGIGMTFALNGFPNFISKLVAEQPDETSKSLIARRAFHILSGLSLVVFFGLQ
FT                   LGATWIAAHMGDVNLAPIISAVAWMFVFMPWLATGRGYYQGKFLMGPTAVSQLIEQVVR
FT                   VAIIIMAAYFSVRLGWDNYRMGTWAMSSAPLAAICSSLIFTVFGLRYLLAPAPAPTHPL
FT                   PSYRKLTKRFVIEGGTLCLVAAVVILLQLVDSFTVMRGLVHQGQLPEVAKALKGVYDRG
FT                   QPLVQLGLVVATAFSATLLPALTDALAKRQPIEFKRQTQAMVHVSLALSMAATVGLVAL
FT                   MPQINRLLFGSLEGTTALRIYIISILFAALITTYTSVLQSLNEYTAMIIGIIAGLATKV
FT                   LANYIFVVHYGINGASAVTVLSLAVMFAVMWLGSPEDLQQVLLESGYLIKLLALSAVMG
FT                   IVVILSCHQITALVGPILANTRGMAGIITVIGVLIGVLVFVAGAVYARLFTIREWLVLP
FT                   YGKRLIKAVAKGKEHHS"
FT   gene            477420..477707
FT                   /locus_tag="LPST_C0450"
FT   CDS_pept        477420..477707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97673"
FT                   /protein_id="ADN97673.1"
FT                   /translation="MSMRLDKFLKVSRIIKRRSVAKEIADKGRIQINGKVAKSSSNVSV
FT                   DDELIISFGNKTLTVKVTQLLETTKKNDAELMYDIISEDYKTDYRQPFSD"
FT   gene            477828..478226
FT                   /locus_tag="LPST_C0451"
FT   CDS_pept        477828..478226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97674"
FT                   /protein_id="ADN97674.1"
FT                   /translation="MTNGSRNKIKQLDNDYIRQVATDEHGQAQRVAQVRRRRFILIVAV
FT                   FGALILFFGFQLINTRSNLHQVNRQVATSQVKLKKVQQKNNQLESQIKQLNNKDYLQKL
FT                   LRSKYDYTKSGETVYSLPNDNAADVTAN"
FT   gene            478351..478890
FT                   /locus_tag="LPST_C0452"
FT   CDS_pept        478351..478890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97675"
FT                   /protein_id="ADN97675.1"
FT                   /translation="MAIEVGTKVTGKVSGITNFGAFVNLGNNQTGLVHISEVSDGFVKD
FT                   IHDVLSVGDDVTVKVLSVGDDGKIGLSIRKAVDKPQGEHEHHGNHQGGNRPNNHQGNNH
FT                   GHGERQSNGNHHDRSNNFHSRGGNGGGRYQSRQHEPKKQDFDSLMSGFLKDSEDRLATL
FT                   KRNTEGKRGGRGGRRS"
FT   gene            479174..480520
FT                   /gene="mesJ"
FT                   /locus_tag="LPST_C0453"
FT   CDS_pept        479174..480520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="LPST_C0453"
FT                   /product="cell cycle protein MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97676"
FT                   /protein_id="ADN97676.1"
FT                   /translation="MTPIQKFNRQLAAAKLLSPQQTVVVAVSTGVDSMVLLHLLQRLPA
FT                   AERPRVVVAHVNHHLREQSQMEADYLRQYCQQQNLKLVMADWLPAAHPKSGIEAAGRQF
FT                   RYHVFAKVMRENRATAVLTAHHANDQVETYLMKLARGGDISQLTGIATSRPFATGRLIR
FT                   PLLTWSKDQLRNYAAEQHVVYFEDVTNQDVALTRNRIRHRVVPELMTVNPQLLKHVADY
FT                   QQQLTTLLMAKKQMVTVLLSQVVTATGALVVDQWGALPSQWQLAVFATWLEQQTQQLFT
FT                   ESKLQPLVSWGQRTRPATSRLTVNAAWELYRNAGIIEALPIKKRGKKLMPREKIMVDLN
FT                   QWQKITATQTVGIFTRVPNVVSQPFWLTEADWPLVWRPWQAGDRIVLKGGGHQLVRRLL
FT                   IDRKVPAERREQVQVLVNAQGNVLWVVGHKFSYRTTGTQTVFLALKHES"
FT   gene            480540..481082
FT                   /gene="hprT"
FT                   /locus_tag="LPST_C0454"
FT   CDS_pept        480540..481082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="LPST_C0454"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97677"
FT                   /protein_id="ADN97677.1"
FT                   /translation="MNNDIERVLYSREDIHQVAQKLGKELTTAYAGKNPLIICVLKGAV
FT                   LFTTDIIREMDIYADLDFINLSSYGNETISSGEVQLTKDLDADVTGRDVLVIEDIIDTG
FT                   RTLKFLIDLLKRRDVNSVKVCTLLDKPAGRLVDIKADYIGFEVPNEFVVGYGLDYAERY
FT                   RNLPYVGILKPAIYEHK"
FT   gene            481162..483399
FT                   /gene="ftsH"
FT                   /locus_tag="LPST_C0455"
FT   CDS_pept        481162..483399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="LPST_C0455"
FT                   /product="cell division protein FtsH, ATP-dependent zinc
FT                   metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97678"
FT                   /protein_id="ADN97678.1"
FT                   /translation="MNNRRNGLFRNSLFYILMFLSLMGIIYFFFGGNSGSQTQNIRYSE
FT                   FVKQLDKNNVKNVSIQPSGGVYKVTGSYRKARTTSSANALGIKSASTKTTSFSTTMLEN
FT                   NSTVDQVSKLAAKHDVKVTAKAEESSGIWVTLLMYIAPVILMLFLFYMMMGQAGQGGGN
FT                   NRVMNFGKTKAKPADSKQNKVRFSDVAGEEEEKQELVEVVEFLKDPRKFVSLGARIPSG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKKNAPS
FT                   IIFIDEIDAVGRQRGNGMGGGHDEREQTLNQLLVEMDGFTGNEGVIVMAATNRSDVLDP
FT                   ALLRPGRFDRKILVGRPDVKGREAILKVHAKNKPLAADVDLKEIAKQTPGFVGADLENL
FT                   LNEAALLAARRNKKQVDAADLDEAEDRVIAGPAKHDRVVNKHERETVAYHEAGHTIVGL
FT                   VLNDARVVHKVTIVPRGRAGGYAIMLPREDQMLMSKRDAKEQMAGLMGGRAAEEIIFGA
FT                   QSSGASNDFEQATQIARAMVTQYGMSEKLGPVELENANQQAAYQQGMGASAFSQHTAQL
FT                   IDDEVRRLSQEAHQTATDIIESHREQHKLIAEALLKYETLDEKQILSLFKTGKMPEKDS
FT                   NEFPSEKAATFEESKRELERREAEKHAQNQSADDKQADSADTTTNVSVAEPSFPSESDA
FT                   SSEVSADSSVNSTANSATESATDSDVATSATGLPNAESATPSSQDDTNSQA"
FT   gene            483548..484435
FT                   /gene="hslO"
FT                   /locus_tag="LPST_C0456"
FT   CDS_pept        483548..484435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="LPST_C0456"
FT                   /product="heat shock protein HSP33"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97679"
FT                   /protein_id="ADN97679.1"
FT                   /translation="MADYLVKSVAGNEMFRAYAVSATGVVAEAQRRHDTWSAASAALGR
FT                   SLVGTLLLASSVLKGEEQMTVKINGNGPVGGIVVDGNAKGTVKGYLQHPHVHLPLNDKH
FT                   KIDVKAAVGTDGFLSVTKDQGVGDPFTGTVALVSGELGEDFTYYLAQSEQIPSAVGLSV
FT                   FVNDDNSIGVAGGFLVQVLPNATDEAISSLENKLKDMPLVSQLMRDGKSPEDILDLLFD
FT                   GDVKVLDKMPVKFECDCSKERFAEALMALPKHEVQAMIDEDHGATAVCHFCGDQYQFSE
FT                   RELEAVLSRSKGDA"
FT   gene            484435..485442
FT                   /locus_tag="LPST_C0457"
FT   CDS_pept        484435..485442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0457"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97680"
FT                   /protein_id="ADN97680.1"
FT                   /translation="MNQEWQIGDVTIPNRVVVAPMAGVTNAAFRVICKDFGAGLVVCEM
FT                   ISDRGIMYHNRKTLEMMFVDPKEHPMSIQIFGGSKATLVQAAQFVDQQTNADIIDINMG
FT                   CPVNKVVKTDAGAKWLLSPDKVYEMVAAVTAAVNKPVTVKMRTGWDAEHVYAVENARAA
FT                   ERAGAAAVAMHGRTRKQMYQGHADWDVLKRVADALTIPLMGNGDVQTPQDAARMLDEVG
FT                   ADAVMIGRAVEGNPWMLTQTVHYLATGELLTPPTPMAKMQTAMEHLQRLVVLKGERGGC
FT                   HEFREQAPYYLKGIPRSARTKVALMEASSLAEMMRILTQFQEQTATYLASHAVK"
FT   gene            485546..487045
FT                   /gene="lysS"
FT                   /locus_tag="LPST_C0458"
FT   CDS_pept        485546..487045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="LPST_C0458"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97681"
FT                   /protein_id="ADN97681.1"
FT                   /translation="MARQEQTMNDQLKVRREKMDELREEGIDPFGHRFERTDLAQDLQD
FT                   KYGDMDKDELDAKQVVATIAGRMLAKRGKGKVGFADIWDRSGKMQLYIRKDVVGEDTYH
FT                   IFKRSDIGDFLGITGQVFKTDFGELTIKVTGLTFLSKALRPLPDKFHGLQNVEQIYRQR
FT                   YLDLISNRDSFDRFLKRTKIISAIRHHLDDQGFTEVETPMLHNQAGGAAARPFVTHHNA
FT                   LNIDLYLRIALELHLKRLIVGGMEKVYEIGRVFRNEGMDREHNPEFTMMETYVAYFDFH
FT                   DVMAETEGIFKAAAQAVTDDGIVTYHDQKVDFNQPFKQIHMVDAIKEKTGIDFWQPMSI
FT                   EDAQKLADEHHVKYEPYWKVGHIINAFFEEFVEDTLNEPTFVYGHPVEISPLAKKNEED
FT                   PRFTDRFELFILGNEYANAFSELNDPIDQRQRFEAQAAERTAGNDEAEHIDEDFVEALE
FT                   YGMPPTGGLGIGIDRLVMLMTDADSIRDVLLFPTMRPEEDK"
FT   gene            487643..489213
FT                   /locus_tag="LPST_Cr0001"
FT   rRNA            487643..489213
FT                   /locus_tag="LPST_Cr0001"
FT                   /product="16S ribosomal RNA"
FT   gene            489298..489372
FT                   /locus_tag="LPST_Ct0002"
FT   tRNA            489298..489372
FT                   /locus_tag="LPST_Ct0002"
FT                   /product="tRNA-Ile"
FT   gene            489414..489486
FT                   /locus_tag="LPST_Ct0003"
FT   tRNA            489414..489486
FT                   /locus_tag="LPST_Ct0003"
FT                   /product="tRNA-Ala"
FT   gene            489648..492567
FT                   /locus_tag="LPST_Cr0002"
FT   rRNA            489648..492567
FT                   /locus_tag="LPST_Cr0002"
FT                   /product="23S ribosomal RNA"
FT   gene            492638..492756
FT                   /locus_tag="LPST_Cr0003"
FT   rRNA            492638..492756
FT                   /locus_tag="LPST_Cr0003"
FT                   /product="5S ribosomal RNA"
FT   gene            492761..492833
FT                   /locus_tag="LPST_Ct0004"
FT   tRNA            492761..492833
FT                   /locus_tag="LPST_Ct0004"
FT                   /product="tRNA-Asn"
FT   gene            492879..492951
FT                   /locus_tag="LPST_Ct0005"
FT   tRNA            492879..492951
FT                   /locus_tag="LPST_Ct0005"
FT                   /product="tRNA-Thr"
FT   gene            493593..495065
FT                   /gene="dtpT"
FT                   /locus_tag="LPST_C0459"
FT   CDS_pept        493593..495065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtpT"
FT                   /locus_tag="LPST_C0459"
FT                   /product="di-/tripeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97682"
FT                   /protein_id="ADN97682.1"
FT                   /translation="MDKEQKLDRSFFGQPRGLRTLFFTEMWERFSYYGMRALLIYYMYY
FT                   SVAKGGLGFDQVTAASIMSIYSALVYVSSVLGGFLSDRVWGSRKTVFIGGVFIMLGHIV
FT                   LSTPFGVGALFVSIALIVIGTGLLKPNVSDMVGQLYTVEDTRRDAGFSIFVFGINLGSL
FT                   VAPALVGRIGLNVNFHLGFSLAAIGMFFGLLQYYFDGKKNLSSASLYPTDPLEPGDLKK
FT                   IMRWTILGIVGIGLILLLMQLMNALTLANVISLISTLVILTPIVYFILMLTSDKTNATE
FT                   RSRVRAYIPLFIAAALFWAIEEQGSSVLALFAANRVNLDLGFTHLAASDFQMLNPLFIM
FT                   IYTTPFVWLWTKWGKKQPSSPTKFAIGLLFAGASYLVMAVPGALFGTAGKVSPWWLVAS
FT                   WAVVEIAEMLISPIGLSVTTKLAPKAFASQMMSMWFLTDSVGSALNAQIVRFYSTQTEV
FT                   PYFAITGIVSVVLGIILFMMVPMIKRSMQGIR"
FT   gene            495120..495962
FT                   /locus_tag="LPST_C0460"
FT   CDS_pept        495120..495962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97683"
FT                   /protein_id="ADN97683.1"
FT                   /translation="MEGLTIVRIAFSSDNHFDVNRVDATAMMRSQATYLLQNGVQIYLI
FT                   AGDLFNDFQRSQQFVVDLQALLGAQTRVYWIAGNHDMVHGISFDELETGHFDGYLHNRY
FT                   IDISGTDWRVIGHNGWYDYQYAAQVPDTTAADFLHWKNAFWIDRAIKQPMSDQERTDLM
FT                   LNQVKAQLNLAAVDHKQVIFMTHFVPRIDYLRFSDDNRFWNMANALMGTPRLGQLLEQF
FT                   NVAHVLFGHLHVHPQPRVFGQTTYYDQAVGYGLKRINEWQANNFMAEWYQDTQILDLK"
FT   gene            496038..496120
FT                   /locus_tag="LPST_Ct0006"
FT   tRNA            496038..496120
FT                   /locus_tag="LPST_Ct0006"
FT                   /product="tRNA-Tyr"
FT   gene            496130..496201
FT                   /locus_tag="LPST_Ct0007"
FT   tRNA            496130..496201
FT                   /locus_tag="LPST_Ct0007"
FT                   /product="tRNA-Gln"
FT   gene            496522..496980
FT                   /locus_tag="LPST_C0461"
FT   CDS_pept        496522..496980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97684"
FT                   /protein_id="ADN97684.1"
FT                   /translation="MTAITIIMSRSYKSTPIFKAHMGYGKKRANRAVRNRMNRGEFDVL
FT                   PANSHAWYKRCYEQYDVVDYCSRETYSQVQLELETMRLEITRNGGIIRRIPQHLVVTYT
FT                   FDPVISDIVHMQRTEELIPAQDVQMFVGTFEQWCRERRNCWAKAYYRK"
FT   gene            497154..497678
FT                   /locus_tag="LPST_C0462"
FT   CDS_pept        497154..497678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97685"
FT                   /protein_id="ADN97685.1"
FT                   /translation="MAHIWMQRHLPARDDVVIKYMTSSQLFRIIRCLFNRTSKIEFVSV
FT                   KLNLGNHTIMNNVSDHDDDQGGFEMAVTKIDLKTTMTYREHAITSKSFARKLGIELPFA
FT                   MYAMAAGESISAEQSTLTRLFEVVDGTLTVRLATETDQEVHAGEMLVVPAHTVHTLVAE
FT                   QPCQFIQLETK"
FT   gene            497709..498044
FT                   /locus_tag="LPST_C0463"
FT   CDS_pept        497709..498044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97686"
FT                   /protein_id="ADN97686.1"
FT                   /translation="MSLINKIDHAKVLNLTEQIPLDDDQVNSRTLVQRDDLSMTLFSVA
FT                   TDQEIGGHSAQGDAMVNILSGEAEITVEGTIYHLTAGQSIVIPKDARHALYAVQGFQML
FT                   LVVVKPD"
FT   gene            498079..498921
FT                   /locus_tag="LPST_C0464"
FT   CDS_pept        498079..498921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97687"
FT                   /protein_id="ADN97687.1"
FT                   /translation="MPLYTFIGDIHSAADDLAVLLADPEVTATRLIFLGDYIDGTAARY
FT                   FGHATESAPLAPLKVLTMVRKRVREYGDVALLGNHDEFWLRTAHGDDNATATWVLNGGH
FT                   RTWRKLGIYSSNPNHVRRALNGALLKPDTDFLAHLPLMWQHGRLLAMHAGVNWQYPLTQ
FT                   QTTTDLLWIRDDYYDDFTTGSHRWHRNLFNKVIITGHTPVQTLTGSHTGYLKMQADAQD
FT                   VPRYLIDAGSRSGLFDGGICALTLTVDGEFVRAKRVIKGHRYDGQQIVTPAMLVDQAH"
FT   gene            complement(499080..500186)
FT                   /locus_tag="LPST_C0465"
FT   CDS_pept        complement(499080..500186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0465"
FT                   /product="cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97688"
FT                   /protein_id="ADN97688.1"
FT                   /translation="MVTVVRRTLHDKIFIIALICAGLSLFIGTPQLTAINWATIGTLFA
FT                   LMISVQLLRAMHLLDTLRDWLLVKSHDTRQMCQLFILLAFGGSMILTNDVAILTLIPIF
FT                   LTLARRQHLAIAYPATLIIMAANLGSAFTPIGNPQNLFLVTFYHVNLFTFFKLSTPLML
FT                   ASLALLVALSWRLPRLPLTVTPTKSTPISRSQIGLAGGLLSFIMLGIFNLVPISLVIIG
FT                   TIVVGLMINRRVFQYVDYALLLTFICFFIFVSAISHNPAITHWLNQLTQTAPSVYITGL
FT                   ITSQVISNVPAAILLANFTPHLSALFLGVNIGGLGSLVASLANLLALKQLLPFNDEQPL
FT                   HHFLIVFTALNGLGLFILGLGGWFYLQL"
FT   gene            complement(500379..501200)
FT                   /locus_tag="LPST_C0466"
FT   CDS_pept        complement(500379..501200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0466"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97689"
FT                   /protein_id="ADN97689.1"
FT                   /translation="MNQNNHFRLTLSTLLQQCQQDITSLPTAMRAVFSWQRGLNELKTL
FT                   RRTTKLMMSTMLIVTIIGFILGRDYSLHGWIGLLTGIMVVINLILVDQGRLTNYSWGII
FT                   ACAAWLTTAITNRLIGDIASQSFYLIMQFVGITVWHRKMAAQPDASELTGRKLSKLAGC
FT                   SWFALAILVYAIVLHFSKQLNGNQIYLDATLLPLGIVGSVLMVNGYRSQWVAWITLDVI
FT                   NVIIWFNQLKGFSPAAASMLALQLVMLANALYGAYLWFFGQNTQQDKLDTH"
FT   gene            501561..502352
FT                   /gene="proC"
FT                   /locus_tag="LPST_C0467"
FT   CDS_pept        501561..502352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="LPST_C0467"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97690"
FT                   /protein_id="ADN97690.1"
FT                   /translation="MKIGFIGAGNMGRAIIDGWLKQQAVVPADIYIHSAHAASYQPYAQ
FT                   KNGLQACDTNLAVAQAADVIVLAVKPNIALAALKEVQAALTGKWVITMVSGLSLADYAT
FT                   VVPDLPVLRIMPNVNVAIGAGMTALVGNDALTPEQYAAGQQLFDAIGATSAIAEKDFPT
FT                   FSALAGSSPAYIYFFIDAMARAGVKHGLSKDAATKIAAQATLGSAQNVLASDKIPFDLI
FT                   DQVSSPGGTTVAGLLAMEEAGFMTAVVKGIDATIAKELGES"
FT   gene            502431..503567
FT                   /gene="nagA"
FT                   /locus_tag="LPST_C0468"
FT   CDS_pept        502431..503567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="LPST_C0468"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97691"
FT                   /protein_id="ADN97691.1"
FT                   /translation="MSKVLKHAIIYTGLEKIDDGYIRFGKEIEAVGPMDDYVAQPDDDI
FT                   EFVSGKTIVPGFIDVHSHGGYSFDSMDGNPAEINEMVNDMVAREGITSYFCTTMTQSNE
FT                   NLDHSMAGINKAADENPVIQGVHLEGPFISATFKGAQPEKYIKNPNVDLLDNWNKLSGG
FT                   RVKLITYAPEDPGSREFEKYCLENGIVPSVGHSNATREQLLASKATHVTHLYNAQREFK
FT                   HREPGVTGHAMLENNMYCELICDGFHIVPDMIKLAYEQKGVDRIELVTDSMRAKGEPDG
FT                   ISELGGQKVIVKDGQARLEEGNLAGSVLTFINAFKNIQKFTGCGIAEAVKMASVNQARE
FT                   FGLTKKGTLEAGKDADINILDGNQDLVATYSYGKKAAK"
FT   gene            503582..504292
FT                   /locus_tag="LPST_C0469"
FT   CDS_pept        503582..504292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0469"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97692"
FT                   /protein_id="ADN97692.1"
FT                   /translation="MSTMSSPIYIQIHNQIKQAIEAGRWAVGDRIPSERELATQFDVSR
FT                   MTLRQAIQTLVDEGILERRVGAGTFVANQKVQEKMSGVTSFTDLMLAQGKVPSSKTISY
FT                   HVTSPSLSESEKLALGANEQVLRMERIRYGDDVPICFEVATVPERLVKQFTKDEITSSL
FT                   YRTLEEKASLVPGKAQQTVSAMSASERIAEYLSVRRGDALLRLRQISYLQTGEPFEYVR
FT                   TQYVGNRFEFYLEK"
FT   gene            complement(504462..505199)
FT                   /gene="tagA"
FT                   /locus_tag="LPST_C0470"
FT   CDS_pept        complement(504462..505199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagA"
FT                   /locus_tag="LPST_C0470"
FT                   /product="teichoic acid biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97693"
FT                   /protein_id="ADN97693.1"
FT                   /translation="MSVPFDTVNILNVPFIKTTNAGFVQQLQTDILAHRNRFVVTANPE
FT                   ILMYAREHPDYQQVLTQADYITPDGIGVIQGAQILGTPLPERITGYDTLLTLLEWGSQQ
FT                   HQRIFLLGAKPAVLKQVTTIVQRAYPGIVVAGARDGYYDDEQTVVDQIVAAQPDMVFVA
FT                   TGFPKQEFFIAEHRQRLDALWMGVGGSFDVIAGAVKRAPLFWQKHHVEWLYRLIQEPSR
FT                   FKRMLVLPRYLRLVKKIARQQAH"
FT   gene            505356..506834
FT                   /gene="nadC1"
FT                   /locus_tag="LPST_C0471"
FT   CDS_pept        505356..506834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC1"
FT                   /locus_tag="LPST_C0471"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97694"
FT                   /protein_id="ADN97694.1"
FT                   /translation="MTQIYPDDSFTLHTDAYQINMIQTYWEQGIHNKHAVFEVFFRKMP
FT                   FQNGYAVFAGLERVVNYINHLHFTATDIAYLRELGGYSDGFLDYLANFKFDATIRAVRE
FT                   GDLVFNNEPLLQVEGPLATCQLIETALLNIINYQTLIATKAARIKSVVGEDGLLEFGTR
FT                   RAQEFDAAIWGTRAAYIGGFDATSNVRAGKIFGIPISGTHAHALVQTYRNDYQAFKAYA
FT                   ETHHDCVFLVDTYDTLRSGVPSAIRVAKEMGDKINFQGVRIDSGDMAYLSKRVREQLDE
FT                   AGFPDAKIYASNDLDEKTIQNLKMQGAKISVWGVGTKLITAFDQPALGAVYKMVSIEND
FT                   HHQMVDTIKLSNNAEKVSTPGQKQVWRITKRADGKSEGDYVTLYDEDPRNEESIYMFHP
FT                   SYTYINKTVSDFDARPLLVPIYDRGQQVYTLPTLDEIKEYSFESLDALWDEYKRDLNPQ
FT                   DYPVDLSQKLYDHKMNIINTVRDHVNHKDEEEAY"
FT   gene            506834..507661
FT                   /gene="nadE"
FT                   /locus_tag="LPST_C0472"
FT   CDS_pept        506834..507661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="LPST_C0472"
FT                   /product="NAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97695"
FT                   /protein_id="ADN97695.1"
FT                   /translation="MRPLQAEIIKALHVAPTIDPEVEIRRSIDFLKAYLTKNTFLKTYV
FT                   LGISGGQDSTLAGKLTEMAITEMRQETGDDRYQFIAVRLPYGNQADEADAMAAIDFMQA
FT                   DVTDRVDIQPATDAMVTALEANQLTIHDFNKGNIKARQRMIVQYGIAGEMHGAVVGTDH
FT                   AAEAVTGFYTKYGDGGADIVPLWRLNKRQGKQMLAALDAPKHLYDKVPTADLEEDRPAL
FT                   PDEVALGVRYDDIDDYLEGRTVSDAAAEKIEAWYLKTAHKRHAAITVFDDFWK"
FT   gene            508117..510771
FT                   /gene="pacL2"
FT                   /locus_tag="LPST_C0473"
FT   CDS_pept        508117..510771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL2"
FT                   /locus_tag="LPST_C0473"
FT                   /product="cation transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97696"
FT                   /protein_id="ADN97696.1"
FT                   /translation="MSTKPKYQQALSAVYEELGTDEHGLQQSAATQRLEQYGPNALNQQ
FT                   KATSLLQKFIAQFKDFMIIVLLVAALIAAFTGEAVDAVIILLVVVLNAIFGVFQESKAE
FT                   EAINALKEMSAPDATVLRDGQLQTVKSDALVPGDVVSLEAGDIVPADLRLIESASLKVE
FT                   ESALTGESVPVEKQAEMIADGELPIGDRLNMAYMNSNVTYGRATGIVVATGMQTEVGRI
FT                   AGMIEAADETTTPLQANLTQLGKSLTILILVIAAVVFGIGMLRGQESLINMLLTAISLA
FT                   VAAIPEGLPAIVTITLALGTQRMAKRHALVRKLPAVETLGSTDIIASDKTGTLTQNKMT
FT                   VEKLVVNQELVDARATELPLDSHLAQVMILSNDTKIMPDGLAGDPTETALIQYNLDQGY
FT                   PVDQLLTDRPRVTEVPFDSERKLMSTVHPLEDGRFLVAVKGAPDELLKRVTQIESNGDV
FT                   QPLTKTSRDQILTVNHELATQALRVLAFAYKVITTVPTTVNTETLENDLVFAGMVGMID
FT                   PERPEVEQAVAEAKSAGIRPLMITGDHRDTAEAIAVRLGIINAGEDDAVITGAELDAMS
FT                   DAEFGKKVGDYSVYARVAPEHKVRIVNAWQKRGKVVAMTGDGVNDAPALKAADIGIGMG
FT                   ITGTEVSKGASDMVLADDNFATIVVAVEEGRKVFANIQKAIQYLLSANLGEVLTLFVMT
FT                   MLGWQILAPVHILWINLVTDTLPAIALGVEPTEKNIMQHKPRGRNSNFFSGGVFSSIIY
FT                   QGLLEGGITLLVYWLALTYPVHATASLAHADALTMAFATLGLIQLFHAFNSKSIHESLF
FT                   TVGLFRNKFFNWAILIAFVMLAMTIVVPGLNGLFHVSHLDAYQWGIVALASLSMVVIVE
FT                   IVKFFQRRHMRRA"
FT   gene            510826..511260
FT                   /locus_tag="LPST_C0474"
FT   CDS_pept        510826..511260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97697"
FT                   /protein_id="ADN97697.1"
FT                   /translation="MKKATIQTYMPVLSKVIESTEKMGEELNPSFEKLRQAIDNDAVAK
FT                   MVPAEFNDIQMEFSDGTEQYQQNLAQLKKVAVPARLMGRHRNLLAAYEAYTNACAAMTA
FT                   SMNIDDQTIDVAAFNQAETDQETEMGRVSNNVQRIMNTVM"
FT   gene            511555..513726
FT                   /gene="tex"
FT                   /locus_tag="LPST_C0475"
FT   CDS_pept        511555..513726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tex"
FT                   /locus_tag="LPST_C0475"
FT                   /product="transcription accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97698"
FT                   /protein_id="ADN97698.1"
FT                   /translation="MDNQILTLVNQTLTKFKPQQIKAVLGLMDEGNTVPFIARYRKERT
FT                   GNLDEVEIREIKDNYDRLASLESRKADVMKLIAEQDHLTPALKQAIEKADKLQDVEDLY
FT                   LPYKQKRRTKATIAKDAGLEPLAAWLLRFPASGIQEHAAQFVNEAQDITDANTALAGAH
FT                   EILAEAFGDNAGLRNWVRNYTRDRGLLVAKVKPKGKAADEQGVYQQYYDFNSPIKQMVP
FT                   YRVLAINRGEAEKVLKVSIDVDRAGIDRYCHFRFIGQHHGPAIELVEAAYQDAYKRFIG
FT                   PAIERELRNELSAAANEQAIKVFGDNLYHLLMQAPLKGRVVLGFDPAYRTGCKLAVMDA
FT                   NGKFLDKLVIYPHKPAPTAKREAAAGEFKAFLEKYHVEMIAIGNGTASRESEEFVAQVL
FT                   KTMTRPVYYVIVNEAGASVYSASAKARAEFPELHVEQRSAISIGRRLQDPLAELIKIDP
FT                   KSVGVGQYQHDVPQKELTTQLDTVIETAVNQVGVNLNTASSELLTHISGLSSTIAQNVI
FT                   TYRDENGEFTSRPQLKKVPRLGPKAYEQAVGFLRIIDGKNVFDNTDIHPESYPAAKALL
FT                   AAAGLKTTDVGTTKAQQLNQLDLTQLATSTGVGELTLKDIISSLQKPGRDVRDTMPAPL
FT                   LRQDVLKMSDLKPGMHLQGTVRNVVDFGAFVDIGVKQDGLVHVSKLTDKFLKDPRQAVA
FT                   VGDIVTVWVEEVDEQRQRIALTMIAPAEA"
FT   gene            513726..514172
FT                   /locus_tag="LPST_C0476"
FT   CDS_pept        513726..514172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97699"
FT                   /protein_id="ADN97699.1"
FT                   /translation="MTDLELQQLVATISMRDFHRPFQHRAYFNARLRTTGGRYQLASHD
FT                   IDINPKMLTDFDEATLIGVIKHELCHYHLHLTKRGYRHRDADFKRLLAQVDGSRYAPAP
FT                   KQATARPYRYIYECQRCGQRYYRKRRMDTRRYTCGRCQGPIKLF"
FT   gene            514238..515524
FT                   /gene="hom2"
FT                   /locus_tag="LPST_C0477"
FT   CDS_pept        514238..515524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hom2"
FT                   /locus_tag="LPST_C0477"
FT                   /product="homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97700"
FT                   /protein_id="ADN97700.1"
FT                   /translation="METIKIGVVGLGTVGTGVVKMLQAHQEKISEITGRKLELACVVVH
FT                   NLKKHEQVDLGDVQMTDQIATLLDDPSIQIMVEVMGSIHPAKEYITQALQAGKHVVTAN
FT                   KDLIAQYGRELVQIARENHRDLFYEASVAGGIPILRTIDNSFAADRIQRVMGIVNGTTN
FT                   YIMTQMLTKHWSYDQALSSAQDLGFAESDPTNDVEGLDAAFKMIILTQFAFGMSLSLDH
FT                   VQVQGITKISPEDIAEAHQLGYTIKLLGIAEEIDDRIAVSVGPVLVSDQHPLATVQNEN
FT                   NAVMVTGTAVGNTMFYGPGAGELPTANSVLSDITTVAKNIALNTTGNTFNSYRQETVLA
FT                   TPEDVVYPHFIALKMRDVPGMMMKLTAIMTRAEVSFSRIIQNQLGDGNARVVIITHAMN
FT                   DQQLADITREIGEQENMQLLASYKVLKNA"
FT   gene            515533..516408
FT                   /gene="thrB"
FT                   /locus_tag="LPST_C0478"
FT   CDS_pept        515533..516408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="LPST_C0478"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97701"
FT                   /protein_id="ADN97701.1"
FT                   /translation="MLTISVPATSANLGPGFDSIGLALDMQLTLQVLQPSDHWQIDHPF
FT                   GADVPTDERNLIIKTALHLVPDLQPQHLQMASKIPLARGLGSSSTAIVAGLVLANELTG
FT                   ATRSSAELLEVATQLEGHPDNVAPALLGGLVVATNTDERVRAVKLPLPMLFASVYVPNE
FT                   PLLTTASRQALPTELAYHQAVTGSSVANTLVAALATQNWDVALPLLEQDQFHEQYRAKL
FT                   VPALQTVRDHAHALGLTGTYLSGAGPTVITLGDYGQLATLQAQLSQDTTLTGQLFLLPM
FT                   DATGVKVQKS"
FT   gene            516464..516548
FT                   /locus_tag="LPST_Ct0008"
FT   tRNA            516464..516548
FT                   /locus_tag="LPST_Ct0008"
FT                   /product="tRNA-Leu"
FT   gene            complement(516753..516899)
FT                   /locus_tag="LPST_C0480"
FT   CDS_pept        complement(516753..516899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97702"
FT                   /protein_id="ADN97702.1"
FT                   /translation="MVAEFHSIPLPAWVTAVPADAFLTMLLIDKRRGLHDQNNLIVAKS
FT                   GES"
FT   gene            complement(517597..519798)
FT                   /gene="ybfG"
FT                   /locus_tag="LPST_C0481"
FT   CDS_pept        complement(517597..519798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfG"
FT                   /locus_tag="LPST_C0481"
FT                   /product="bacteriocin activator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97703"
FT                   /protein_id="ADN97703.1"
FT                   /translation="MADQLVLDTQQWLNSTYGDVDGFGSVPENGLTGWDTIYGLTRGLQ
FT                   HELGITDLVDNFGPTTAKLFDEIADDIVPGYSGNITYIIQGGFWCKGIDPAAFDGKFTS
FT                   DTASAVTTMKEYAGLSDTSGTLDSQFMAALLNMSAFTLVANGYEKIRTMQQQLNHDYLA
FT                   YTGILPCDGVYQRDTNTALIYALQAEEGLDTDTASGTYGPMTQELTPTVSTGDDNNFVR
FT                   ILQWGLYVNNQAYTGAFDGSYTLDVSSSVATFESDMALPETSGVSAGLDVFMSLLTSAG
FT                   NPDRDAVACDTSHQIDANEAAALNSAGYKYVGRYLTGTAGTGSSEVDKNLTTSEISILT
FT                   NAGLKIFPIYQDGASDDEDYFTQTKGSSDGRKAGLAAMQLGFPDDTIIYFAVDVDIQDG
FT                   DIAGTVEPYFTGVASGINSFGFKVGIYATRNVANTIITDGLADKAFVSDMSTGFSGNLG
FT                   FPMPSEWSFDQFNEVAFDDFYIDKVASNSSRSTAVDDFSAGSSVGGSDDLAKINEIIQN
FT                   LSETDSIFSFVKDITIEATSKTYKVETPAVDLSLTVDLEGNISDDDGDTSINYNINDGS
FT                   VHLALDDEISQIIAENTAGFTDTTVTASLDGIASVIKDGDIKTGMSVKATGTSITFKVD
FT                   STFEHESTNGKTYEIAYEITLVAEFHSIISPLPAWVTAVQADEHNTSVEDAKANAPEIT
FT                   TVLLRVGTAAVVALAITGLIMTATFLPSIIPGLITLAAA"
FT   gene            520089..520679
FT                   /locus_tag="LPST_C0482"
FT   CDS_pept        520089..520679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97704"
FT                   /protein_id="ADN97704.1"
FT                   /translation="MRYLLGVIALLAVIYLIFSLIKHRKEKLSVKKGILVVVCLLTMFW
FT                   GLADTQESKRITVGGVEITEEEREAFDSLHAFETRLFGKMSRHRDQIDKIQENAEYLRK
FT                   PAEKLSGSNKVQKALIADNIDQLKTGAVFRATHKDWMSTGSIHGILKINQRIAQKYGKT
FT                   EKQRQAIMDEMQDATGMPKYTVDGLQEIKDKNS"
FT   gene            521333..522187
FT                   /locus_tag="LPST_C0483"
FT   CDS_pept        521333..522187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97705"
FT                   /protein_id="ADN97705.1"
FT                   /translation="MIRMSRWWWRILVGGVLVSGVVYPAQAAVTTYPITGIQVVQTRVY
FT                   QTNSQNGVGYHLTVVRHQRAQLRVNLHLKYHQHTQWMRTEQADIYRNGHYQRFYYVHNG
FT                   HQQSGWIAANQLKPASTASVQLRVPLIDQLPELPTGCEMTATTMMLQYAGVNINKEQFA
FT                   SHVPRSSNPNTGFVGDPASAYGIGLYIYPQGLLPTIRHYLPSAVDLSGVGLQRLKAQLT
FT                   KRHPVVAWVQGLDGFASHTVTLTGYTTATIRYNDPWRGQSGQMDNQAFETMWQLNGRRA
FT                   LSY"
FT   gene            522478..523452
FT                   /locus_tag="LPST_C0484"
FT   CDS_pept        522478..523452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0484"
FT                   /product="mannose PTS, EIIAB"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97706"
FT                   /protein_id="ADN97706.1"
FT                   /translation="MVSIIIASHGEFAKGIYQSGSMIFGEQENVQAVTLMPSEGPDDIK
FT                   AKLEKAIASFDDQEQVLFLVDLWGGTPFNQVNGLFEAHKDKWAIVAGLNLPMLIEAYAS
FT                   RLSMDSAHEIATHIIETAKDGVKVRPEALAPKEEKAAAAATTNNNAGRPGKLEYGLARI
FT                   DSRLLHGQVATAWSKTVNPTRIIVASDNVAKDELRTNMIKQAAPSGVKAHVIPIAQMIK
FT                   IAKDDKHFGGQKALVLFETPQDALRAIEGGVPIKTLNIGSMAHSAGKVQPNKVLAFDQD
FT                   DIDTYRKLEKDGIEFDVRKVPSDGKENMDNILNKAENMLKEQK"
FT   gene            523488..524294
FT                   /gene="pts9C"
FT                   /locus_tag="LPST_C0485"
FT   CDS_pept        523488..524294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts9C"
FT                   /locus_tag="LPST_C0485"
FT                   /product="mannose PTS, EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97707"
FT                   /protein_id="ADN97707.1"
FT                   /translation="MNLNVIQVILVVLVSFLAGMEGILDEFHFHQPVVACTLIGLVTGQ
FT                   LVPCIILGGSLQMIALGWANIGAAVAPDAALASIASAIILVLGGQGRAGVTSAIAIAVP
FT                   LAVAGLLLTIIARTLATGIVHIMDRAAEEGSFSKIDFWQWVAICMQGLRIAIPAALILA
FT                   VGATPVKAMLNAMPSWLTDGLSIGGGMVVAVGYAMVINMMASREVWPFFALGFVLAAIS
FT                   EITLIGLGAIGISLALMYLALSKQGNSGNGGGSNTGDPVGDIIDKY"
FT   gene            524421..525245
FT                   /gene="pts9D"
FT                   /locus_tag="LPST_C0486"
FT   CDS_pept        524421..525245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts9D"
FT                   /locus_tag="LPST_C0486"
FT                   /product="PTS family mannose/fructose/sorbose porter
FT                   component IID"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97708"
FT                   /protein_id="ADN97708.1"
FT                   /translation="MQNGGWAYSLIPAIKKLYTTKEDRAAALKRHMEFFNTHPYVASPV
FT                   IGVTLALEEERANGAPIDDVTIQGVKVGMMGPLAGVGDPVFWYTVKPIVGALAASLAIS
FT                   GSIVGPILYFVVWNAIRMGFMWYTQEFGYKAGSKITDDLSGGILQDITRGASMLGMFIL
FT                   AALIERWVVVDFSPVKVSTIKQQAGSYIDWDKLPKGASGVKEALTQQAAGRSLDKYKVT
FT                   TLQDNLNQLIPGLMALLLTFLCMWLLKKKVSPIIIILGLFVFGVLMHVIGWM"
FT   gene            525374..525760
FT                   /locus_tag="LPST_C0487"
FT   CDS_pept        525374..525760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97709"
FT                   /protein_id="ADN97709.1"
FT                   /translation="MVQSINTKVDLVTNGNSHMGLTDYGKIMVGDNGFEFYDDRNVRNF
FT                   IQIPWTEVKYVVVSVMFGGRWIPRFSFQTKRNGMITFSAKDPKKVLRAVRQYIEPDRIV
FT                   KSLTFFQVLGRIFKGKGKKDKYLK"
FT   gene            526135..528915
FT                   /locus_tag="LPST_C0488"
FT   CDS_pept        526135..528915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0488"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97710"
FT                   /protein_id="ADN97710.1"
FT                   /translation="MVATALMIARSNVSKELNALVREGQLHKLTGRPVHYVPVNATATT
FT                   ATTTSGVANGATTERIPTAPVATSVPKPVVNDIFASMIGSHESLANQVEQAKAAILYPP
FT                   RGLNTLIIGPTGSGKTYFANAMYRFAETQQVLTNPQGLITFNCADYAHNPELLMSHLFG
FT                   YVKGAFTGANEDKDGLIQEADGGMLFLDEVHRLPPEGQEMIFYFMDHGTYSRLGETAKS
FT                   HHANVRLVCATTEDPESTLLQTFVRRIPITIQLPAFNHRSAKERLELLKALLSLEANRI
FT                   NKQIRLTEDVVQALLGSVTFGNVGQLKSNIQLVCAQGFVNSIENDSEITITMDDLPQNI
FT                   RSGLMTVASNRHELGAISELLDPVLIVKPNDGPTPLRNKNDNYELPYNLYEIIGDKAAL
FT                   LRREGLDKEHINRFITTDINVHLKSFYKQNQLEVSPENKLAEIVDQDVIDFTKTAQMTV
FT                   QDMLGYNFKDNFIYAVSLHVSSFIKRIQAGKPMRQMSSDMLAMVREYPAEIKAAEALKQ
FT                   GLEERYHLPIPKSEVYYLAILLISLKSMQLNGKVGVLVAAHGMSTASSMAQVVGQLLDD
FT                   YDVQAFDMPLDMDPSVAYDHVKRRVEKLDSGKGILLLVDMGSLTTFGERIQQETGIATR
FT                   TIDMVTTPVVLEAVRKASLVDSDLDSMYQELVGFKGYSRISRNLPTDSQRATVKPALAT
FT                   DKTAQRAIIAICATGVGTAERIKSILDSLLAQNFIEGITVFPISVVEMKTRIQQISQNY
FT                   QIIAATGITKPELDVPFISLEELLQGGGEKFIDQLATGIDSPQTMAEESQQLTPELCER
FT                   YLGDYFTFLNPKKLTGILWEYSEVIATHLDGVMTNAFRIDLIMHLAGALERTAIKDEIS
FT                   APTEEMPDIMASKWYPLVQQANQQLTDQLQLTFSDAENYYIVQLLETHQAKVAMS"
FT   gene            528986..529405
FT                   /locus_tag="LPST_C0489"
FT   CDS_pept        528986..529405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0489"
FT                   /product="mannose PTS, EIIA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97711"
FT                   /protein_id="ADN97711.1"
FT                   /translation="MLAFVVVSHGSFAQGVVDSSYMIFGKQDKVQTVTFQLDEEPNELA
FT                   DKLAAAVARFDADDQVLFLVDLWGGSPFNAASRIVAEHTERMGLITGLNLPMLIEAYTV
FT                   RDKPIDEVIAHLEETGKIGIKHLKLLQDDGEDEPL"
FT   gene            529402..529920
FT                   /locus_tag="LPST_C0490"
FT   CDS_pept        529402..529920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0490"
FT                   /product="mannose PTS, EIIB"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97712"
FT                   /protein_id="ADN97712.1"
FT                   /translation="MTMDIRLARIDSRLLHGQVATVWTKTVSPNRILVVSDEVAQDALR
FT                   KILIVQAAPPGVKANVITVDKMIEIYQDSLFDEVKPLILTDTPQNMARLVAGGLDFSKT
FT                   GIDIGSLAFSAGMVMVTNAIAIGQAEARALYALQAAGLKVFAQKVPTDKRVDVMPLLAK
FT                   NGFMAPDKY"
FT   gene            530085..531056
FT                   /gene="fabH1"
FT                   /locus_tag="LPST_C0491"
FT   CDS_pept        530085..531056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH1"
FT                   /locus_tag="LPST_C0491"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97713"
FT                   /protein_id="ADN97713.1"
FT                   /translation="MPTYTKLTAMGQYVPARVVDNDELAAIMDTSDEWIQAHTGIKTRH
FT                   YAMNDENTSDLATQVAQQLLQKSGLAASAIDLILVTTITPDALTPATACLVQANIGADN
FT                   AFAFDLSAACAGFTFGLATADKFIRSGQYQNVMVISAEVNSKMMDFQDRTAAVFFGDGA
FT                   GGALLQATDNPDENSLIAEKLESQGNATVIHSGRVRPITEVAATNYPQTDAFYQVGRDV
FT                   FQFATTVVPEQMRGLIASAQLTPSDLQYVICHQANLRIIEKIAANLALPMTKFPHNVDH
FT                   YGNTSSAGVAMALANVFDTLTGPVLLTAFGGGLAYGSVLIKK"
FT   gene            531067..531468
FT                   /gene="accB1"
FT                   /locus_tag="LPST_C0492"
FT   CDS_pept        531067..531468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB1"
FT                   /locus_tag="LPST_C0492"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97714"
FT                   /protein_id="ADN97714.1"
FT                   /translation="MELKDLDRLVEKYARQGYQQIRVKAGDLEIEVTKPALASETVTPV
FT                   AATPASTVAETEDEVVTLPSPMVGVVHLAPDLKVGQSLTAGQELGQIESMKLFNPLVSP
FT                   TDGTLTAVLVADDATVEYEQPLFTMRKDR"
FT   gene            531471..532793
FT                   /gene="accC1"
FT                   /locus_tag="LPST_C0493"
FT   CDS_pept        531471..532793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC1"
FT                   /locus_tag="LPST_C0493"
FT                   /product="acetyl-CoA carboxylase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97715"
FT                   /protein_id="ADN97715.1"
FT                   /translation="MFRKLLIANRGEIAVRIIKACQQLNIQTVAVCSTADRHAGYTQLA
FT                   DEVVCIGPAAASGSYLNAEAILMAAINTHADAIHPGYGFLAENADFAAMCAECGIAWIG
FT                   PQTEQIKLMGDKARAKDFARQQAVPVLAGQSLQGLAWPDIKHAAAKIGFPLVLKASYGG
FT                   GGKGIRVLTDVHELHQQLRATRQEAAASFLNDAMYLEQFLTTARHIEVQVLGTGTKLFI
FT                   LGDRDCSLQLHKQKVLEESPASILTETQRRTLYDLSRQLLAGTHYQSLGTIEYLFADGQ
FT                   FYFMEMNTRLQVEHGVTELTTGIDIVAEQIKQAAGVTVDFPEHVGLQPKCTAIEARLTA
FT                   TLPVKQTRIETLSWPADVRVDTDYHQGDRLVTMYDGLIAKLMVTGVNRQQAVRNLQRAL
FT                   AQVTLTGPTTNLTFLQQTVARPAYIHDQYTIHSLARWEASK"
FT   gene            532790..533593
FT                   /gene="accD1"
FT                   /locus_tag="LPST_C0494"
FT   CDS_pept        532790..533593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD1"
FT                   /locus_tag="LPST_C0494"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97716"
FT                   /protein_id="ADN97716.1"
FT                   /translation="MSHYPASGTWQACPKCGRHVHQRQWGTYQQCPYCHYWQRLTTAQR
FT                   LEQLVDEGSFQPLTMTERPVNQLGFPDYTNKLRRAQRQTGLNEAVVCGTALIEQQPCIL
FT                   AVMDSHFMMGTLNTAVTRRLLHASEQARAQRLPLIIVTASGGARMQEGVYALVGMNLIL
FT                   AELARLAATPLPLITVLTDPTMGGVSASFAFKGDLIIAEAGAKIGFAGARVIQQTLPVK
FT                   LPADFQTADQLFKNGMVDAVVERPQLRSTLGQALVNYGIGRSAHG"
FT   gene            533586..534359
FT                   /gene="accA1"
FT                   /locus_tag="LPST_C0495"
FT   CDS_pept        533586..534359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA1"
FT                   /locus_tag="LPST_C0495"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97717"
FT                   /protein_id="ADN97717.1"
FT                   /translation="MDKRLQRLRAADRISAPTIIQALLPTMTQQRGDRLLGQDAALTAG
FT                   FGRTATGRQLAVLGVDRGVDIASRRRKNGGALTVPGYRTALRVVTHAAKFGWPVVSLIN
FT                   MPGADASPQSERYGQSQAIADLIAATGQLTVPNVVVFLGEGHSGGALAFANANRIIMLD
FT                   DALFNVASPEAVTAILHGQQTSSDAIDLLPMTASALQSRGLVDLVIDHQDQTLVAAINQ
FT                   AIETQLAALEALPAPDLIEQREAKFQHFLQSWPVN"
FT   gene            complement(534427..535638)
FT                   /locus_tag="LPST_C0496"
FT   CDS_pept        complement(534427..535638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0496"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97718"
FT                   /protein_id="ADN97718.1"
FT                   /translation="MSENNNDNEMGPRQRRYREQQQRNPHLKPHKKRPWLITLLIVVVL
FT                   LIVTGGWWGYKTWNAAKDTMNTTYQSTGSTKLRNVDAVIKKGKPFSILLLGTDTGALGR
FT                   GKDFSARTDTMIVATINPKKESMTLTSIPRDTQVMIDGQSQKINAAYTIGGASGAVKSV
FT                   EKLLDVPIDFYVLLNMGGLKQIINAMGGVTVTPKLTFKYGNANVKKGVKIKLNGAAALD
FT                   YSRMRYDDPQGDYGRQKRQRQVIMAMVSQSNSLGSIANIEKITKKLAKNMRTDLTWNDM
FT                   VALDTKYKNASHHAKSYTVQGTDATIDGLSYQVASSSERYKNSKRIRKALGLSNSNLTE
FT                   SVFSETASITTGSSSSSSSSSSTTTSSDTTTYGTSTTQDTTTQDQTTTQDQTTTQDQTT
FT                   TNQY"
FT   gene            535948..536910
FT                   /gene="mleP1"
FT                   /locus_tag="LPST_C0497"
FT   CDS_pept        535948..536910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mleP1"
FT                   /locus_tag="LPST_C0497"
FT                   /product="malate permease"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97719"
FT                   /protein_id="ADN97719.1"
FT                   /translation="MQILQTFVQSIQGVMTIIVMIAVGYLLARWGWFNESATKLIARLV
FT                   TQIALPAYMIATITKQFTAHKLLSTLPGLRFPVLNMAILFGISFGVMRALNIKKSHRGL
FT                   FASMFLNSNTVFIGLPVNQALFGNSALPYVLVYYMANTTIFWTLGVYLIQRDGTGTAKF
FT                   DLKQTLTKIFSPPLLGFMIGVLLVLGNIHVPKFLMDDFSYIGGLTIPLSMIFIGISMAN
FT                   AGLSSMRFDRDSLGILLGRFILAPVLMTLMLIPMSIPLEMKQVFILQSAMPVMTNAPVV
FT                   SKLYGADADYAAVMVTETTLLSLIVIPILMVIVQANFIR"
FT   gene            537343..538368
FT                   /locus_tag="LPST_C0498"
FT   CDS_pept        537343..538368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0498"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97720"
FT                   /protein_id="ADN97720.1"
FT                   /translation="MKKAYLYIAISTLMFSSMEIALKMAGSAFNPIQLNLIRFFIGAIV
FT                   LLPFALRALKQTGRKLVSADWRLFALTGLVCVIVSMSLYQLAITVDQASTVAVLFSCNP
FT                   VFALLFSYLILRERLGRANLISVVISVIGLLIIVNPAHLTNGLGLLLAIGSAVTFGLYS
FT                   IISRYGSVKRGLNGLTMTCFTFFAGAFELLVLAWITKIPAVANGLTAIGLRQFAAIPVL
FT                   VNVNLNYFWLLFFIGVCVTGGGFAFYFLAMEQTDVSTASLVFFIKPGLAPILAALILHE
FT                   QILWTTVVGIVVILIGSVVTFVGNRFRERDTMGAIEQPTAAATDDEHVIKAAHAVSNQE
FT                   N"
FT   gene            538518..539195
FT                   /gene="pgm2"
FT                   /locus_tag="LPST_C0499"
FT   CDS_pept        538518..539195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm2"
FT                   /locus_tag="LPST_C0499"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97721"
FT                   /protein_id="ADN97721.1"
FT                   /translation="MTELVLVRHGESTANRDNTYTGWSDVPLTAVGIAQAHQAGKRLRA
FT                   TGLQFGAVHTSVLKRAIVTANIMLSEIDQLWLPEYKTWRLNERHYGALRGQNKDVTRQE
FT                   YGKAQVQQWRRSFYTVPPLLTPAELDHDRRYTKYGAAVEPRGESLKMAYDRIMPYWIDE
FT                   IAPRLLDGQNQLVVAHGSTLRAMIKYLEHISDTGIDGVEVANGVPICYHLDRQLHVIGK
FT                   EEY"
FT   gene            539615..540307
FT                   /gene="zmp2"
FT                   /locus_tag="LPST_C0500"
FT   CDS_pept        539615..540307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmp2"
FT                   /locus_tag="LPST_C0500"
FT                   /product="extracellular zinc metalloproteinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97722"
FT                   /protein_id="ADN97722.1"
FT                   /translation="MMKHKNLLLLIIMSLGFCGMLLMFAPQISTLINPNASRVEADKAS
FT                   GHDTTHDQVYYNDQMDNYQYDYINNGTKVLNYKARFKSRVITYRITSDSKVYRAIWLRA
FT                   VEHWNNTNAVRLVEAKDQAKVQITLGESEDETETTGSEIGRTWRTYYQSGSQGTTWMDS
FT                   AKCVIYTNRFPASNHSVEYKLSVATHELGHALGLEHENNKSAVMYYQSHRAAHITTREI
FT                   STLKQMYK"
FT   gene            complement(540497..541828)
FT                   /gene="pepC1"
FT                   /locus_tag="LPST_C0501"
FT   CDS_pept        complement(540497..541828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC1"
FT                   /locus_tag="LPST_C0501"
FT                   /product="cysteine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97723"
FT                   /protein_id="ADN97723.1"
FT                   /translation="MSKAISMNQIANFQADLDQRPEAKVIERSVTKNGILASSQDIQAM
FT                   SQTTPVFSIDLDTGDVANQKQSGRCWMFAALNTMRHSLAEKFNLKHFELSQNYTFFWDK
FT                   FEKANYFYENVLATADQPTSSRKVAWLMTTPQQDGGQWDMLVAIIQKYGIVPKSVMPET
FT                   YNSSKSAEINSTLNLKLRKDAVELRELVAAGTSDDAIQERKEKMLNEVYRMLAYAFGEP
FT                   VSHFDWEYRDDKKQYHIDQNLTPQSFFEKYVGWNLDDYVSIINAPTDDKPYNHTYTIEM
FT                   LGNVLGGREVKHLNVSMADFKQLAIKQLQAGQSVWFGCDVGQSSDRQKGVMATDVYSKD
FT                   ELFDVDLSMSKAERLDYGESLMTHAMVITGVDLVDGQPTKWKVENSWGDKVGTKGFFVM
FT                   SDAWMDEYCYQVVVNKEFLSDDLKAAQAEEPTVLAPWDPMGALA"
FT   gene            complement(541904..542587)
FT                   /gene="rpiA1"
FT                   /locus_tag="LPST_C0502"
FT   CDS_pept        complement(541904..542587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA1"
FT                   /locus_tag="LPST_C0502"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97724"
FT                   /protein_id="ADN97724.1"
FT                   /translation="MNQDQLKQLVGQKAVEYIQDGMQVGLGTGSTVKFMVDALGERVKN
FT                   EHLNIVGVSTSDRTAAQAKALGIPMKSVDEVDHLDLTIDGADEIADDFQGVKGGGAALL
FT                   FEKIVAINSDKVMWIVDESKMVHQLGAFGLPVEVIPYGSQHVFEKMAARGYNPVFRKVN
FT                   DELVRTDSNNIIIDLHIDPITDPHALAEDLIHMVGVVEHGLFLDMVNTVIVGHANGPEV
FT                   IEARP"
FT   gene            complement(542596..542892)
FT                   /locus_tag="LPST_C0503"
FT   CDS_pept        complement(542596..542892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0503"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97725"
FT                   /protein_id="ADN97725.1"
FT                   /translation="MEFTREAHRFYFNDDHGKLAGEITFPAINNDQTWVIEHTFVRDDF
FT                   GHQGIAGQLTKAVIDAARVEHKRIQPLCTYAKAYFDRHPEAADVLVTSSQSKE"
FT   gene            543031..543567
FT                   /gene="dut"
FT                   /locus_tag="LPST_C0504"
FT   CDS_pept        543031..543567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="LPST_C0504"
FT                   /product="trimetaphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97726"
FT                   /protein_id="ADN97726.1"
FT                   /translation="MARGFEIVSQYAQAGLHVPYRTTKQAAGYDFEAAEDFTLPSIWKM
FT                   NFIKVLWQIHHGETSSAADLDAAAKVLKPWLVPTGIKAFMNEGEYLLLANRSSNPLKRN
FT                   LILPNGIGVIDADYYNNPKNEGAIFVQLINMGIRDVHIKKGERIAQGIFTPYLTVTDET
FT                   NVTTTRSGGFGSTNK"
FT   gene            543979..544098
FT                   /locus_tag="LPST_C0505"
FT   CDS_pept        543979..544098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97727"
FT                   /protein_id="ADN97727.1"
FT                   /translation="MANKRPLNLVQLVADYFDTKTLSETSECILYFVETFNVL"
FT   gene            complement(544124..544438)
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0007"
FT                   /note="hypothetical protein"
FT   gene            544615..545994
FT                   /gene="radA"
FT                   /locus_tag="LPST_C0506"
FT   CDS_pept        544615..545994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="LPST_C0506"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97728"
FT                   /protein_id="ADN97728.1"
FT                   /translation="MAKAKTQFVCSNCGYSTPRYLGRCPNCGEWNTLTEEHFDTKPDRK
FT                   SRVSFAGKSAKPQRLKEVSLTKTPRVKTKLKEFNRVLGGGVVPGSLVLIGGDPGIGKST
FT                   LLLQVSGQLAETGGSVLYVTGEESASQVKMRADRLAVSSEDFYLYPETDMSNIRSTIES
FT                   THPEFVVIDSVQTMQEPDMDSAIGSVSQIREITAELLQIAKTNGITIFIVGHVTKGGAI
FT                   AGPKILEHMVDTVLYFEGDLHHTYRILRAVKNRFGSTNELGIFEMRTGGLYEVANPSEI
FT                   FLEERLKDATGSAIVVSMEGTRPILVEVQALVTPTVFGNAKRTASGLDHNRVSLIMAVL
FT                   EKRASLMLQNQDAYLKAAGGVKLDEPAIDLAIAVSVASSYRDQQTRPSDCFVGEVGLTG
FT                   EIRRVNRIESRVGEAAKLGFKRIFIPKNNLQGWDIPTGIEVIGVATLKEALQLALQQPN
FT                   Y"
FT   gene            546010..547185
FT                   /locus_tag="LPST_C0507"
FT   CDS_pept        546010..547185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0507"
FT                   /product="PilT family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97729"
FT                   /protein_id="ADN97729.1"
FT                   /translation="MKKLTVRLVFIVVGGTLGLTYLPFLWTTILSQPNVLLNNVFTNFL
FT                   LGALILWVLSLFLANAAVRLVDRVEKNLSKQNPMTLLFGSIGFIIGLLIAVLISQLFNR
FT                   SPLFLLNTVVPIILMLFFGYIGARVGTTRIDEWRKVFNFRRREKETSPEITDAQPDQNY
FT                   HHYKILDTNILIDGRIYDIVKTGFLEGTLLVPNFVLYELQYIADSADSIKRVRGRRGLD
FT                   ILNKLQNENIIPVEMYEGDFEDIPEVDSKLIQLAKKVNGVIVTNDYNLNKVIEFQNVQV
FT                   LNINQLAKSLKPRVIPGEEMNVMVVKNGSERQQGVGYLDDGTMVVVEDGKFYINEKVDV
FT                   VVTSALQTDAGRMIFARLAHANRGIPDHADGNNKHNNNHSNNRNNNRDNRH"
FT   gene            547511..549001
FT                   /gene="gltX"
FT                   /locus_tag="LPST_C0508"
FT   CDS_pept        547511..549001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="LPST_C0508"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97730"
FT                   /protein_id="ADN97730.1"
FT                   /translation="MAKSKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGKFILRIE
FT                   DTDLKRNVKDGEKSQMDNLTWLGIDWDEGPDKGGDFGPYRQSERKSIYDPLIQQLIDEG
FT                   KAYESYMTEDELSAQREAQKARKEMPHYVYEFAGMTEDEKQAKIAAAKAAGIQPVIRFH
FT                   VPENTTYAWDDMVKGKVSFESKTVGGDFVIKKRDGMPTYNFAVVVDDHMMEISHVFRGD
FT                   DHVANTPKQLMIYEAFGWQPPKFGHMSLIINTETGKKLSKRDETVLQFIEQYRELGYLP
FT                   EAMLNFIILLGWSPVGESELFSKREFIKMYDEKRLSKSPAAFDGKKLEWVNNQYIKKAD
FT                   ENEVFAMSIRQLIKAGRLPQRPDMSQIEWTRTLVSLFKNQMSYTGQIVDLADLFFNGPA
FT                   DINDEAKAELDNDTALPVLKEFRQRIEDIDVFEATAIQKTIKSIQKDTKIKGRALYMPI
FT                   RIAVSHEMHGPELPETIELLGRETTKKHLDAMIAELAK"
FT   gene            549279..550691
FT                   /gene="cysS"
FT                   /locus_tag="LPST_C0509"
FT   CDS_pept        549279..550691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="LPST_C0509"
FT                   /product="cysteine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97731"
FT                   /protein_id="ADN97731.1"
FT                   /translation="MLSVFNTLTRQKEPFKPITPGVVKMYVCGPTVYNYIHIGNARSAI
FT                   AFDTIRRYFEYCGYHVDYVSNFTDVDDKLIKRAAEDHTTVPAVADRFIKAFMEDTTAVN
FT                   IEPATVHPRASENIPEIIAFVQALIEKGYAYESAGDVYYRARKFKKYGQLSDQRIDDLE
FT                   VGASQHTADEETDRKEDPIDFALWKAAKPGEISWKSPWGAGRPGWHIECSVMSTKYLGD
FT                   TFDIHGGGQDLEFPHHENEIAQSEAKTGKTFANYWLHNGFVTVGDDNEKMSKSLGNFVT
FT                   VHDIIKTVDPQVLRFFMATTQYRRPIQYTQANLDEAANNLDKLRNAYRNLTFRLQDATN
FT                   GTDTAVAEQLQTLITNFGTAMDDDFNVQNGVAAVYELAKLANVYAAQATVQKETLIALQ
FT                   KALVQLTGVFGVTFETANATLADDAIQALIDEREAARKAKDFAKADQIRDDLKAQGIIL
FT                   EDTPQGVRFRKE"
FT   gene            550693..551103
FT                   /locus_tag="LPST_C0510"
FT   CDS_pept        550693..551103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97732"
FT                   /protein_id="ADN97732.1"
FT                   /translation="MQVDYQQLNGIALAYLGDAVYEPFIRQHLIESGFTKATKLHHHAT
FT                   HYVSAKAQAALIERMQAEEVLTPTEVDVFKRGRNAKSHTSAKHTDVVTYRISTGFEAVF
FT                   GYLQLTQQADRIAELAQWCIKQVDEGRVSSVK"
FT   gene            551093..551860
FT                   /gene="trmH"
FT                   /locus_tag="LPST_C0511"
FT   CDS_pept        551093..551860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmH"
FT                   /locus_tag="LPST_C0511"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97733"
FT                   /protein_id="ADN97733.1"
FT                   /translation="MSNNEQDQTAADFVIGRHPAMAAIKSDQQINKVFIQSGLQADVLN
FT                   DIAKIAKKRNLIVQYVPKQKLDRLTDNANHQGVAVGVAAFEYATIDDLFAVAKAKNEAP
FT                   FFLILDNIEDPHNLGSIMRTADAAGAHGIIIPKRRAVGLTSTVAKTSTGAIEHVKVARV
FT                   TNLVQTVKQLQEAGLWIFGTDMNGTDYRQWDASGAVGLIIGNEGKGISPLLKKSVDEML
FT                   TIPMIGHVQSLNASVAASLLIYQGYTSRHPLGK"
FT   gene            551862..552407
FT                   /locus_tag="LPST_C0512"
FT   CDS_pept        551862..552407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97734"
FT                   /protein_id="ADN97734.1"
FT                   /translation="MKQQLLIVDAYNMIGNWPELNHLKQTDRLPQARDELISMLTEYKK
FT                   ITGLNISLVFDAMYVPGNSKSYRQADLEIIWTSKDQTADSYIEKYAGEKQSRVLQVTVA
FT                   TSDQAEQWVIFSEGALRVPALELRHRVKTALKDVRHTAVRTQDLGAVRKSPWNDDQLSA
FT                   LDQYRQQLERNHVKHHHK"
FT   gene            552914..553516
FT                   /gene="sigH"
FT                   /locus_tag="LPST_C0513"
FT   CDS_pept        552914..553516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="LPST_C0513"
FT                   /product="DNA-directed RNA polymerase, sigma factor 30"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97735"
FT                   /protein_id="ADN97735.1"
FT                   /translation="MQFLKLVRSEECHVNEQQLIHLAADGDDASINALAQQYVPVVWRL
FT                   RRQYYVRNFDEDDWLQEGRIAVYRAAKKYQRLRQCSFGTYYRVLLSNQIIDHIRRTQAR
FT                   KRRPEGDILSLDVNDEDILCNIQTLRASTLDVVHVREQVRIFPAICSAFEGLVFMDLLA
FT                   GQSPERIALSRQVEVDQVVNATDRCRKKMRDFLQDAA"
FT   gene            553578..553727
FT                   /gene="rpmG"
FT                   /locus_tag="LPST_C0514"
FT   CDS_pept        553578..553727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="LPST_C0514"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97736"
FT                   /protein_id="ADN97736.1"
FT                   /translation="MAQKKVALACTVCGSRNYTIDANPNRTDRLEVKKFCKYCGKHTLH
FT                   RETR"
FT   gene            553739..553924
FT                   /gene="secE"
FT                   /locus_tag="LPST_C0515"
FT   CDS_pept        553739..553924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="LPST_C0515"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97737"
FT                   /protein_id="ADN97737.1"
FT                   /translation="MRLFKFFGQVGHEMKKVTWPTWRENRRDSWTVVSTSLFFVAFFAL
FT                   FDWIIQLLLQMLTSWH"
FT   gene            554029..554577
FT                   /gene="nusG"
FT                   /locus_tag="LPST_C0516"
FT   CDS_pept        554029..554577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="LPST_C0516"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97738"
FT                   /protein_id="ADN97738.1"
FT                   /translation="MVESVEKRWYVLHTYAGYENKVSSNLESRIQSMGMEDNIFRVVVP
FT                   EEEAHEVKNGKDKVEMKKIFPGYVLVEMVMTDQAWYIVRNTPGVTGFLGSHGQGSKPTP
FT                   LLPEETEQILHQLGMSARHTELDVEVGEQVTIIDGAFSGLSGEITEIDNEKMKLKVNIN
FT                   MFGRETSTELDFDQVDQIR"
FT   gene            554794..555492
FT                   /locus_tag="LPST_C0517"
FT   CDS_pept        554794..555492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0517"
FT                   /product="possible alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97739"
FT                   /protein_id="ADN97739.1"
FT                   /translation="MLQRFTAGGIANKSLVVMIDRHNHPHVTGELDAYRPMVQLIFATP
FT                   RVAVRQQAAGVLAVVQYLIAHEHVQTINLVAHSMGGVVLFQYLTTAAKLVNLPEVRKVV
FT                   TIGAPFNDSEVGQNTYPIENHPLTATGPTKTTPVYNYFLRTLQRLPNTISYLNIAGNIG
FT                   DAAQSDGAVALNSALSLRFLLRPTRDQYQEFVVHGKNARHSRLHENYEVDRQIVQFLYP
FT                   EATKKVAGEK"
FT   gene            555594..556019
FT                   /gene="rplK"
FT                   /locus_tag="LPST_C0518"
FT   CDS_pept        555594..556019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="LPST_C0518"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97740"
FT                   /protein_id="ADN97740.1"
FT                   /translation="MAKKVANVVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNAR
FT                   TADQAGMIIPVVITVYEDRSFDFITKTPPAAVLLKKAAGVESGSGEPNTKKVATVTKDQ
FT                   VKQIAETKMQDLNAADVEAAMRMIEGTARSMGFTVEG"
FT   gene            556120..556809
FT                   /gene="rplA"
FT                   /locus_tag="LPST_C0519"
FT   CDS_pept        556120..556809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="LPST_C0519"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97741"
FT                   /protein_id="ADN97741.1"
FT                   /translation="MAKKSKQYQDAAKLVDRDKAYDVTEAVDLVKKMDFAKFDATVEVA
FT                   FKLNVDTKQADQQLRGAVVLPNGTGKDQTVIVFAKGDKAKEAEEAGADFVGETDLVQKI
FT                   QDGWLDFDVAIATPDMMAQVGRLGRVLGPKGLMPNPKTGTVTMDVAKAVNDSKAGKVTY
FT                   RTDRDGNVHVPVGKVSFDTDKLVGNFKTIEDTIVKARPASVRGTFIQNLVVTSTFTPAV
FT                   RVDLASF"
FT   gene            557008..557511
FT                   /gene="rplJ"
FT                   /locus_tag="LPST_C0520"
FT   CDS_pept        557008..557511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="LPST_C0520"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97742"
FT                   /protein_id="ADN97742.1"
FT                   /translation="MSKETIAVKAQEVEEVAEQLKSSVSAIVVDYRGLTVEQVTDLRKQ
FT                   LREAGVKMRVIKNKIMVRAADKAGFEDLKPVFAGPTAVAFSEEDPVAPAKILANFAKTA
FT                   DALQLKGGVIEGKVADLETVQEYATMPSREELLATIANLLQAPVRNVAYAVKAVAEKGD
FT                   EDAA"
FT   gene            557573..557941
FT                   /gene="rplL"
FT                   /locus_tag="LPST_C0521"
FT   CDS_pept        557573..557941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="LPST_C0521"
FT                   /product="ribosomal protein L12/L7"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97743"
FT                   /protein_id="ADN97743.1"
FT                   /translation="MAFDKDAIIDSLKEASISDLNDLVKAIEEEFDVSASAPVAVAGAA
FT                   GGDAAAAKDSYDVELTESGDQKVKAIKAVRDITGLGLKDAKGLVDNVPSIIKEGVSEDE
FT                   ANDMKAKLEEVGGVVTLK"
FT   gene            complement(558303..559280)
FT                   /locus_tag="LPST_C0522"
FT   CDS_pept        complement(558303..559280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0522"
FT                   /product="prophage Lp1 protein 65"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97744"
FT                   /protein_id="ADN97744.1"
FT                   /translation="MALIGTILLFATLYWFWRLHRRYRGRQWWRHSWPAIIALLVSFSI
FT                   LGTSDESTQPTVKTKTVTKTHLVTANNDKQLTALQAANRASASSLKQAAKKLSSSQQHI
FT                   DKLKATNKQAGATSTTAPTKVNSDHNPSNNALASKTYNGQQTITINQNQPAFTAKELST
FT                   SQGAWQQYGNLDSLNRVTAANALLNQSLMPKAEREALNVRPTGWHNKRISSGWLYNRSH
FT                   LIGYQLTGQNNNIKNLMTGTRSLNDPEMTTYENQVAAYLKESPKNYVRYQVTPIFKGNE
FT                   LLARGVQMRGQSVGSNTVNFNVYIFNIQPGMTLNYTDGTSQVSH"
FT   gene            complement(559293..559961)
FT                   /locus_tag="LPST_C0523"
FT   CDS_pept        complement(559293..559961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0523"
FT                   /product="prophage Lp1 protein 66, lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97745"
FT                   /protein_id="ADN97745.1"
FT                   /translation="MHHAKKLVVALTSLLILTGCTTGNQQAANHTSVKTKTVRVEKRTA
FT                   ANKAAWAKARAASRANAASAKALSSNTTQLAIATSQAKRQSEQLKAKHDDAMASSKSAS
FT                   QAAAKSAASEAAAQSRSQSEAQSASAVAAASQSKQAVKASSQAAAQSQQTQTSTANTSR
FT                   QNNFSGDTDTAQTGRIVGNRNSKIYHVETGQNYRMAGKNAVYFSTEDAARAAGFRKSFR
FT                   "
FT   gene            560310..562868
FT                   /locus_tag="LPST_C0524"
FT   CDS_pept        560310..562868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0524"
FT                   /product="Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97746"
FT                   /protein_id="ADN97746.1"
FT                   /translation="MGIIKALFVFSVLLFVITEVGKIAKEVSGAQLANALASQSWWHLL
FT                   SMVVIGIIAVTPMLTYDVMITKFLPNHYSLGYILKAGWITNTFTNIGGFGGVLGASLRA
FT                   NFYNREATKKQIVFAISKIALFLVSGLSLYCMISLVLVYGFGIGNMYGSYWIWLVGGAL
FT                   YFPAIFIFTRVNDSEFFDGLTLGNVVRLLSGSFGEWTGCVLFFLLIGNFMGLPIDFAAV
FT                   VPLFVIASVVGEVSMVPGGIGSFDVFMIFGLGAVGVSRPDAVAWLLFYRLFYYIIPFAI
FT                   GLVLFIHDTGHRLNVRLAGIPKQALQRVAQMVLTVFLYFSGFLMLLMSTVPNFAYNNKL
FT                   FLQFYPYTFFFINQASSIIMAFLLIGVALGTAGRVKKAFWPTVIVLLIAILNTIRWLVV
FT                   YDAISMKFVIFLIVILALVALSRHAYYRDRLAFSWGQTLWVSCVYVVTFILYTIVGVYN
FT                   APQIHHRHAVPEALFFPSQKLWLFGVIGLVLAAMILIIMYRYFASGYNARLRQKMDAAR
FT                   VKQVIETYGGNEISHLAYLNDKLAYYYQVDGVDQLIFLYQQKADKLIIMGEPFGNQAVL
FT                   QTALEQLLDDADSDGCSLVFYEISEMLTMRLHEMGFDFIKTGEEGHVKLADFSLAGKRL
FT                   RGERALMNKFTRDHYEFAILQPPFSADVMAELRAVSDSWLAGETEKGFSLGFFDEQYLN
FT                   QAPVAVVYDPDHRIVAFANIMPQGNHQTTSIDLMRSSKSAPSGIMDTVFVHLFEQARDD
FT                   GYAYFNMGMAPLSGVGVSRYSFIQEKIAHLIYEYGYQLYGFQGLRSYKEKYVTEWEPKY
FT                   IAYRKRNSLIFTILQLLQVVNTRVHKSERHRPVWLLKRLK"
FT   gene            complement(563043..563618)
FT                   /locus_tag="LPST_C0525"
FT   CDS_pept        complement(563043..563618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0525"
FT                   /product="decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97747"
FT                   /protein_id="ADN97747.1"
FT                   /translation="MAIHNICVFCGSNSGLDPAFSDKTVALGQYLAANDYQLVYGGGDH
FT                   GLMGKVAKATMDAGGRVIGIIPHFLVARELAFKDVTTFIETRTMTERKEKMLHLADAFI
FT                   VLPGGFGTFEEFLQMLSWSQMDIHQKPIALYNIDGFYDDLVAMLQKTADLGFAPEANLD
FT                   LFINGHDLDEIFAGFHDFKHVLPPKYTN"
FT   gene            complement(563700..564710)
FT                   /gene="nrdF"
FT                   /locus_tag="LPST_C0526"
FT   CDS_pept        complement(563700..564710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="LPST_C0526"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97748"
FT                   /protein_id="ADN97748.1"
FT                   /translation="MATDLAYYQKLLSNGNYKAINWDRVSDAIDKSTWEKLTEQFWLDT
FT                   RIPVSNDMADWRELDDDHRWVVGHVFGGLTLLDTLQSQDGLQALRRNVLTSHETAVLNN
FT                   IQFMESVHAKSYSTIFETLNTPDEINEIFDWSDSEEFLQAKAQWIYKLYDNIDEDPLKQ
FT                   KVANVFLETFLFYSGFYTPLYYLGHNQLPNVAEIIKLILRDESVHGTYIGYKFQLGFKD
FT                   RSEKQQAEFKDWMFDFLYKLYENEENYIHLVYDQIGWSDEVLTFSRYNANKALMNLGQD
FT                   ALFPDTAEDVNPVVMNGISTGTSNHDFFSQVGNGYRLGQVEAMQDTDYDIGNPDD"
FT   gene            complement(564738..566903)
FT                   /gene="nrdE"
FT                   /locus_tag="LPST_C0527"
FT   CDS_pept        complement(564738..566903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="LPST_C0527"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97749"
FT                   /protein_id="ADN97749.1"
FT                   /translation="MTLKDLKDVTYYDLNNEINIPVNNQIPLNKDQEALAAFLEQNVEP
FT                   NTMKFDSLKARFDYLREHDYLETPAIDKYDFSFIEKLYDYLRSQDFHFKTFMAAYKFYA
FT                   QYALKTDDGDYYLENFIDRVAMNALYFADGNEDLAMDLADEIVHQRYQPATPSFLNAGR
FT                   ARRGELISCFLIQSTDDMNSIGRTINSALQLSRIGGGVGINLSNLRGAGDPIKHIDGAA
FT                   SGVVPVMKLLEDSFSYSNQLGQRQGAGVVYLSVFHPDIIAFLSAKKENADEKIRLKTLS
FT                   LGVTVPDKFYELIKADADMYLFSPYGVEREYGVPFSYVDITKEYDNMVKNPNIRKTKIK
FT                   ARDLENEISKLQQESGYPYVVNIDTANRENPIDGKIVMSNLCSEVMQVQTPSLIDDQQQ
FT                   YEKLGTDISCNLGSTNIVNLMTSPDFGHSVEAMVRALTFVTDHSNVDVVPSIQKGNRQA
FT                   HTIGLGAMGLHAFFAKNQMEYGSKEAVDFTNIYFLLLNYWTLKASNEIARERHETFVNF
FT                   EKSKYADGSYFDKYTTQDWQPKYDKTTALFDGIFIPTKADWEALKEAVMRDGLYHQNRM
FT                   AVAPNGSISYINDTTASLHPIINRVEERQEKKIGKIYYPAPYLSNDTINYYKSAYDTDM
FT                   RKVIDVYAAAQQHVDQGMSLTLFMRSTIPAGLYEWKDGRTDKMTTRDLNILRNYAYRKG
FT                   IKSIYYIRTFTDDDGEVGVNECESCVI"
FT   gene            complement(567042..567272)
FT                   /gene="nrdH"
FT                   /locus_tag="LPST_C0528"
FT   CDS_pept        complement(567042..567272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdH"
FT                   /locus_tag="LPST_C0528"
FT                   /product="glutaredoxin-like protein NrdH"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97750"
FT                   /protein_id="ADN97750.1"
FT                   /translation="MKKVTVFTKNNCMQCKMTKKFLTAHNIAFEEKNINTNPEYVDYLK
FT                   NQGFHAVPVVEINGEDSIAGFRPDALKQLAV"
FT   gene            567495..568103
FT                   /gene="rsmC"
FT                   /locus_tag="LPST_C0529"
FT   CDS_pept        567495..568103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="LPST_C0529"
FT                   /product="16S RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97751"
FT                   /protein_id="ADN97751.1"
FT                   /translation="MTNYYYTHNPDIVHDEKQWNFEIFNHSFKFTTDNGVFSKRTVDYG
FT                   SRTLLAAFDPTDLPAGPMLDLGTGYGPIGMALAYQSPERTVDMVDVNELALSLARKNVA
FT                   LNQITNTNIFTSDVYQQVTATNYAAIVTNPPVRAGKAVVDAMLTGAVSRLVVGGTLTVV
FT                   LQKKQGAPSAKKLMQTTFGNCQVIKKDKGYYILQSVKEG"
FT   gene            569138..570835
FT                   /gene="dnaX"
FT                   /locus_tag="LPST_C0530"
FT   CDS_pept        569138..570835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="LPST_C0530"
FT                   /product="DNA polymerase III, gamma/tau subunit DnaX"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97752"
FT                   /protein_id="ADN97752.1"
FT                   /translation="MYRALYRVWRPQRFDEIVGQQMITQTLKNAIMTHQTSHAYLFTGP
FT                   RGTGKTSAAKIFAKAINCHHLVDGEPCNECETCTAITKGQLNDVIEIDAASNNGVEEIR
FT                   DIRDKAKYAPTQADYKVYIIDEVHMLSTGAFNALLKTLEEPPANVIFILATTEPHKIPL
FT                   TIISRTQRFDFRRITAKDSYDRMVYILNEKDVTYDEKALRVIAAAAEGGMRDALSILDQ
FT                   VISFGDNTVTLDDALMVTGSVTKQLLANYVSEVTDHDTKPALETMRQILQEGKDANRFI
FT                   EDLISYTRDVLLYQQAPEMVDSVAMGEDDQQFEAFAKQIDAEVLYQMVKTLNDIQQQMR
FT                   FTTHPDVYLEVLTVKLAQLDGQAAVQPVDAATVNPEDPTVHKLAQQVEQLQSEVKTLRS
FT                   QGGSVTKPAPAKPRSSNGPVVKKVNVSQIYPILGAATKNDLIKVRDVWTDLMNILSVTQ
FT                   RALMHVAQPVAASSEGVVVAFDYAFVYQKAIDDQTLIDALGNGLDRLMGQAPKIVCVPK
FT                   EQWPQIRKDYLATHQPGGATSEQQAPAKEPVVEEAKNMFGDLVEVQPD"
FT   gene            570980..571165
FT                   /locus_tag="LPST_C0531"
FT   CDS_pept        570980..571165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97753"
FT                   /protein_id="ADN97753.1"
FT                   /translation="MVKVTFTGDKKMKDITINPDAVDPDDVDMLQDLVVAAVNDALTKV
FT                   DEQTQSTMGKYTKGLQ"
FT   gene            571181..571780
FT                   /gene="recR"
FT                   /locus_tag="LPST_C0532"
FT   CDS_pept        571181..571780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="LPST_C0532"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97754"
FT                   /protein_id="ADN97754.1"
FT                   /translation="MQYPEPIAKLIDSYMKLPGIGGKTATRLAFYTIDMNGDDVTEFAK
FT                   SLIAAKRDLHFCSICGNITEDDPCVICKDKSRDQSTVLVVEEAKDVMAMEKIKEYNGLY
FT                   HVLHGVLSPIDGKGPEDINIASLLKRLQQNEAIKEVIIATNATPEGEATAMYISRLVKP
FT                   AGIKVTRLAHGLSVGSDIQYADEMTLFKAVEGRQEM"
FT   gene            571795..572046
FT                   /locus_tag="LPST_C0533"
FT   CDS_pept        571795..572046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97755"
FT                   /protein_id="ADN97755.1"
FT                   /translation="MFKRKQKIKHPKEVFDEQLLSTLNAAKLDWDRAKQNQEAVYDNNT
FT                   SELVTQTALARAKYLYLYREARLRQVHGQTIQRSVIDK"
FT   gene            572444..573109
FT                   /gene="tmk"
FT                   /locus_tag="LPST_C0534"
FT   CDS_pept        572444..573109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="LPST_C0534"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97756"
FT                   /protein_id="ADN97756.1"
FT                   /translation="MLTGKLVTFEGPDGAGKTSALNAIVAKLQPQLGDRLVVTREPGGN
FT                   QISEAIRKIILDRHNTAMDDRTEALLYAAARRQHIVQTIQPALQNDQLVLCDRYIDSSV
FT                   AYQGAGRGIGEQAVYDMNQFATAGLTADLTLYFDVDAAVGLNRIQQHRQNEINRLDVEA
FT                   LSFHHRVQAAYLRLLADHPDRIKRVDASQPLDQVVTQALEIMASQLPTYVASKGGEDQ"
FT   gene            573106..573435
FT                   /locus_tag="LPST_C0535"
FT   CDS_pept        573106..573435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97757"
FT                   /protein_id="ADN97757.1"
FT                   /translation="MKLIIAIVQDKDSNRLSSQFIEANVRATKLSTTGGFLRSGNTTFM
FT                   IGIDDDRVDEVLAMIKETSHAREQFMTPPVNLDVTMDGAAAYPVEVQVGGATVFVLPIE
FT                   QFHQF"
FT   gene            573452..574471
FT                   /gene="holB"
FT                   /locus_tag="LPST_C0536"
FT   CDS_pept        573452..574471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="LPST_C0536"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97758"
FT                   /protein_id="ADN97758.1"
FT                   /translation="MATTESFAQTLAAKQPRLLAAFKHIIAQNHLAHAYLFAGMEGAGQ
FT                   PELAHWIAQRLFCLHINDGEPDGTCEECVRIANGSHPDIVTVAPEGQRIHVDQVRYLKA
FT                   EFSKSAVEGNRKLFIINDAEKMTASAANSLLKFIEEPSGNVTALLLTTNKQLMLPTIIS
FT                   RTQVIEFPPLNAQALQQTFEQAGIAPNQAQMLRGLTNSVTQAQALLTDDWLPQAAQALW
FT                   RWFDQAVKGDPRSFVAVQVNLVGLAKDADHQLVMLDLIAALFQDLLQLHFEVATTALTF
FT                   GQYQKELAGLTAEVSDEQLIAATELALTAKRQLASNISFQNVLEGLTLKLWPIFQTNA"
FT   gene            574496..574843
FT                   /locus_tag="LPST_C0537"
FT   CDS_pept        574496..574843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97759"
FT                   /protein_id="ADN97759.1"
FT                   /translation="MDKRDLYDSFGEMEQQMQQMLDKMAKLRADMTTVLEKNAELVIEN
FT                   EHLREHMVEIENELPKKAASTTTLSKSRQNLEKLYDEGFHVCNQFYGKRRDDDESCVFC
FT                   LEVIYGERERA"
FT   gene            574942..575838
FT                   /locus_tag="LPST_C0538"
FT   CDS_pept        574942..575838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0538"
FT                   /product="methyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97760"
FT                   /protein_id="ADN97760.1"
FT                   /translation="METQQSFADHAGIGTLYLVPTPIGNLQDMTYRAVAMLKTVDLIAA
FT                   EDTRNTQKLLNHFEITTKQISFHEHNTQERIPQLIEKLQTGVNLAQVSDAGMPSISDPG
FT                   KELVAACIAANIPVVPLPGANAGLTALIASGLVPQPFYFYGFLPRKKNEQKADLAKLAR
FT                   RHETVVLYESPFRVAKTLTLLATVCEGTRPIVACRELTKRYEEFARGTLAEMVTWAQDH
FT                   QLKGEFVLLIGGNPDKDEPETTDELAQLPVKAQVEALIAAGDKPNVAIKTIAKRRNIPR
FT                   QSVYNQFHELNTNDEES"
FT   gene            575842..576627
FT                   /gene="fat"
FT                   /locus_tag="LPST_C0539"
FT   CDS_pept        575842..576627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fat"
FT                   /locus_tag="LPST_C0539"
FT                   /product="oleoyl-[acyl-carrier protein] thioesterase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97761"
FT                   /protein_id="ADN97761.1"
FT                   /translation="MATLGANASLYSEQHRITYYECDRTGRATLTTLIDIAVLASEDQS
FT                   DALGLTTEMVQSHGVGWVVTQYAIDITRMPRQDEVVTIAVRGSAYNPYFAYREFWIRDA
FT                   DGQQLAYITSIWVMMSQTTRRIVKILPELVAPYQSEVVKRIPRLPRPISFEATDTTITK
FT                   PYHVRFFDIDPNRHVNNAHYFDWLVDTLPATFLLQHDLVHVDVRYENEVKYGQTVTAHA
FT                   NILPSEVADQVTTSHLIEVDDEKCCEVTIQWRTLPEPIQ"
FT   gene            576766..577761
FT                   /gene="galE1"
FT                   /locus_tag="LPST_C0540"
FT   CDS_pept        576766..577761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE1"
FT                   /locus_tag="LPST_C0540"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97762"
FT                   /protein_id="ADN97762.1"
FT                   /translation="MSILVLGGAGYIGSHMVDRLVEHGTDVVVVDNLVTGHRAAVNSAA
FT                   KFYQGDLRDADFLNHVFDTEDIEAVVHFAAFSIVPESMSKPLKYFDNNTGGMITLLETM
FT                   QAHNVKQIVFSSTAATYGTPKQIPIKETDPQLPINPYGASKLMMEQIMHWADVAYGIKF
FT                   VALRYFNVAGAKPDGSIGEDHGPETHLVPIILQVAQGKRDELKIFGDDYNTPDGTNVRD
FT                   YVHVVDLADAHILALKYLAAGNDSNAFNLGSSTGFSNKQMLAAAREVTGQPIPAKLAPR
FT                   RPGDPDSLVAASDKARDVLGWQPNYDNVNDIIETAWAWTQKHPNGYDDRD"
FT   gene            complement(577895..578995)
FT                   /gene="phnW"
FT                   /locus_tag="LPST_C0541"
FT   CDS_pept        complement(577895..578995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnW"
FT                   /locus_tag="LPST_C0541"
FT                   /product="2-aminoethylphosphonate--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97763"
FT                   /protein_id="ADN97763.1"
FT                   /translation="MKQPYLLLTPGPLSTTASVKDAMQIDYCTWDSDYRHVTETIRQQI
FT                   LAMAQANPENYTTVLLQGSGSFGVEATIGTAVPRTDATLMIAINGAYGHRISQIAEYYD
FT                   IPHIDVVFNEDEAVDPVRIEATLADHPEITHFATVHSETTTGILNPIEALMPIMHEHEI
FT                   VTIIDAMSSLGGVPISIDELDCDYLISSANKCVQGVPGFAFIIAKQATLAHTADNARSL
FT                   CLDLYDQWQAMTKQPGKWRFTSPTHVVHAFAQALIELQAEGGVTPRYQRYHASQQLLSD
FT                   GLQALGFELVIDPAIQGPIITSFKYPNVDFDFADFYQFIKQRGFVIYPGKVSNIPSFRI
FT                   GTIGDVDTTDIQRLLTIIGDYQQLHR"
FT   gene            complement(579017..579814)
FT                   /gene="phnX"
FT                   /locus_tag="LPST_C0542"
FT   CDS_pept        complement(579017..579814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnX"
FT                   /locus_tag="LPST_C0542"
FT                   /product="phosphonoacetaldehyde hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97764"
FT                   /protein_id="ADN97764.1"
FT                   /translation="MTIKAVIFDWAGTTIDYGSRAPIVAFQKAFANVGIQISEAEIRQD
FT                   MGLDKYTHIHKIMDLPAVQNDWQARFQVLPTEDDCNQIFSNFKAILLSSLTEFGQLKPG
FT                   MSAVIDYLTAHNISYGTTTGYDAEMLALVLPIAAKQGYRPAVNITSEQTGGVGRPAPAM
FT                   LALAAEQLTVTDPTTVMKIGDSVNDILEGNNADAVSVGIIDGSNIMGLSELAFNALSPA
FT                   EQAERRAHVTAAYQRAGADYILQSMAELPALLDQINQPVATDH"
FT   gene            complement(579839..580693)
FT                   /gene="phnE1"
FT                   /locus_tag="LPST_C0543"
FT   CDS_pept        complement(579839..580693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE1"
FT                   /locus_tag="LPST_C0543"
FT                   /product="phosphonates ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97765"
FT                   /protein_id="ADN97765.1"
FT                   /translation="MIENSQPKTQVLQPSAPPTRSISLVTRPRKILRAVMIGLTLISVY
FT                   SLVTLNNANLNIIDALHSLGLNLNAMFLHPSVGQDTLGQLLRALMTSVSLAMLTTLLGA
FT                   LIAFFIAVGAARNLAPSWLATSIKAVMAFIRAIPTILWVLIYSVVMGLGASAAVVGLTF
FT                   HSVAYLVKAYSESIEETSQDTIEALKASGVGFWPIVFQAILPSIIPALLSWTFIRFEIN
FT                   FANAVAVGAAAGADDIGYYLFMAGSFYFDFHEVGLIVYLLLGVAIVLELVSMRLRGHYL
FT                   KNN"
FT   gene            complement(580690..581478)
FT                   /gene="phnE2"
FT                   /locus_tag="LPST_C0544"
FT   CDS_pept        complement(580690..581478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE2"
FT                   /locus_tag="LPST_C0544"
FT                   /product="phosphonates ABC superfamily ATP binding cassette
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97766"
FT                   /protein_id="ADN97766.1"
FT                   /translation="MTPQRFFQQRRLRLSVVLLILIGIYVLSMALVNFQAWASISKIPA
FT                   GLMWLFTNFIPTSRSISYLGPILYQLWRTLLVAISSTMVASLFALIFAILGAKTTTPTP
FT                   VLRWIIRFGASLLRNIPVVAWAMILLFSFKQSDFTGFLALFFMTLGYLTRAFTETIEDL
FT                   DAEKLQALQAVGANYFQCVFCGVLPEAASTLTSWILYMIENNLRDATLVGLLTGTGVGF
FT                   LFDYYFKAFRYDAAGLIVLLIAILVIVLELTSNRIRRAIA"
FT   gene            complement(581483..582253)
FT                   /gene="phnC"
FT                   /locus_tag="LPST_C0545"
FT   CDS_pept        complement(581483..582253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="LPST_C0545"
FT                   /product="phosphonates ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97767"
FT                   /protein_id="ADN97767.1"
FT                   /translation="MLKVIQLDKTYGSNKHSLKAVNFTAKPGEVTAIIGPSGAGKTTIL
FT                   RSINQLIRDDSGQILLDDTDIRQANKAELRKVRHHIGMIFQNYNLISPLTALENVLHGR
FT                   LGAKSTVAGMLGLYSSAEKQEALQLLDEVGLKEYAYQRCDQLSGGQQQRVGIARALMQH
FT                   PKMILCDEPIASLDPKSTTIVMDILRRLAKEKQLIILINLHQVDIAMAYTDHIVGINSG
FT                   AIVFEGATNEVDDAVLQHIYRQPDQSTAVAANEN"
FT   gene            complement(582291..583343)
FT                   /gene="phnD"
FT                   /locus_tag="LPST_C0546"
FT   CDS_pept        complement(582291..583343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnD"
FT                   /locus_tag="LPST_C0546"
FT                   /product="phosphonate ABC superfamily ATP binding cassette
FT                   transporter, binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97768"
FT                   /protein_id="ADN97768.1"
FT                   /translation="MSKVSKSLLGLSFISVLGLGLAGCASGTSAKSGGSSTDSSKTITV
FT                   VFYPNESAKSFAGSRTAIKQAVEKATGKTVKLQTTTDYNVAIQAIASGKAQVAYMGANG
FT                   YIQAHHKSKDVVPFAAQSDAKGTLKDATYNSYLMVQQKDAKKYEENGKYSIKNVKGKKM
FT                   SYVSNSSTSGFLVPTAEISREFNIKTADQDKLTQSGSFFSKVLYGGSHQGSAVNLLKGD
FT                   ADVAAFDDADLMPYLNVTKGSWDKVGSTFTVKDNAEAPFTSLAGKSVVNIAMMPVQQGP
FT                   WVYNTKSLSKDDQKKIATEFTSKSFAQNKKIFSEPNAKTPMMFPKKSEKSKLVNVTDKW
FT                   YAPTHKLVGY"
FT   gene            583623..584348
FT                   /gene="gpp"
FT                   /locus_tag="LPST_C0547"
FT   CDS_pept        583623..584348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpp"
FT                   /locus_tag="LPST_C0547"
FT                   /product="glycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97769"
FT                   /protein_id="ADN97769.1"
FT                   /translation="MKLLAIDTSNRPLSVAVLEDTQILATTTTNVGRNHSSTLLPIIEQ
FT                   AMAQAKLAPADLDRIVVAAGPGSYTGLRIGVTTAKTLAFTLDKALVGVSSLAVLAGNIV
FT                   TEGQLVAPLFDARRDNIFAGLYRIKNQRPVAVIADQHISVTEWGQRLASYDEPITFVGA
FT                   DVDQYADALQQSLAKQFVRAAPQLDLPQAVVLGLMGRTLTPVSEIHNFVPNYLRLTQAE
FT                   RDWQAKHPEKEHAPYVEKI"
FT   gene            584428..584910
FT                   /gene="rimI1"
FT                   /locus_tag="LPST_C0548"
FT   CDS_pept        584428..584910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI1"
FT                   /locus_tag="LPST_C0548"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97770"
FT                   /protein_id="ADN97770.1"
FT                   /translation="MGEVNYYVSRALITDVPEMLAIERAVYAGQTPWDENAFKTELRRQ
FT                   SGRFYIVMRHEDRLVAFCGCVFDDRRQDAHITNIAVHPDVQGQGLGHFMMQVMMKRARK
FT                   LHYQTVTLEVRYSNTIAQQLYRDLGFEKTGIKKRYYFGDHEDAIDMTYRIPVATDD"
FT   gene            584903..585358
FT                   /gene="rimI2"
FT                   /locus_tag="LPST_C0549"
FT   CDS_pept        584903..585358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI2"
FT                   /locus_tag="LPST_C0549"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97771"
FT                   /protein_id="ADN97771.1"
FT                   /translation="MTERQLVASTQLDAGRAVQVCYQLATLAYPGGAPWRQATFAADMA
FT                   LPTVHYDLLRWQDELIGFVSHSTVLDETEITNIAIDPAYQRQGHARWLLTACLAQLSAG
FT                   SVFLEVRASNLAAQRLYQQCGFDQIATRKEYYHDPEEDAWIMRKMIN"
FT   gene            585363..586409
FT                   /gene="gcp"
FT                   /locus_tag="LPST_C0550"
FT   CDS_pept        585363..586409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="LPST_C0550"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97772"
FT                   /protein_id="ADN97772.1"
FT                   /translation="MGTVEKQNLILAFESSCDETSVAVIKDGHEILSNVIATQINSHKR
FT                   FGGVVPEVASRHHIEQITICIEAALQEAHVTYADLDAVAVTYGPGLVGALLVGVNAAKT
FT                   VAYAHQLPLIPVNHMAGHIYAARFVKPFEFPLMALLVSGGHTELVYMQADGQFEIIGET
FT                   RDDAAGEAYDKIGRVLGVPYPAGKVIDEMAHAGHDTFKFPRAMIDEDNYDFSFSGLKSA
FT                   FINTVHHADQIGATLDKNDLAASFQASVVDVLMSKTLRVLKQYPVKQLVLAGGVAANQG
FT                   LRERLQQDLPAAFPDTELILAPLKLCGDNGAMIGAAGYVQYQHHQFGDATLNADPSLEF
FT                   DWMPGMLK"
FT   gene            complement(586701..586823)
FT                   /locus_tag="LPST_C0551"
FT   CDS_pept        complement(586701..586823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97773"
FT                   /protein_id="ADN97773.1"
FT                   /translation="MIDKINVYEKQRQIQQKLSTPLSAIRTLSRLEGVSDNAQW"
FT   gene            complement(586867..586992)
FT                   /locus_tag="LPST_C0552"
FT   CDS_pept        complement(586867..586992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97774"
FT                   /protein_id="ADN97774.1"
FT                   /translation="MADERPLNSVQFVVGYFDTEPFKSNIRVPSPLFRNIQLLLR"
FT   gene            complement(587296..589278)
FT                   /locus_tag="LPST_C0553"
FT   CDS_pept        complement(587296..589278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0553"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97775"
FT                   /protein_id="ADN97775.1"
FT                   /translation="MILLQVQQVMRRFGADVLFDNVQMDIQEHARVALVGRNGAGKSTL
FT                   LKMIAGETVPDEGQISMRKGLTIGYLAQDQGLDSNNTIWEEMSSVFAELHAIEKRMHQL
FT                   ENQLSDPAIMNDEQAYQQTLKTYDQIQTGFQQKNGYGYQAEIRGVLHGFQFDADVYDKS
FT                   VTALSGGQKTQLALAKLLLEKRDLLILDEPTNHLDVETLTWLESYLQSYSGALLIVSHD
FT                   RYFLDRVVNEVYDLSHHEMVHYTGNYDQFVQEKAARIQAQWKHYEKQQAEISKLEDFVN
FT                   RNIVRASTTKRAQARRKQLAKMDRLDRPDSDEKTAHFGFHAAKQSGNIVLTVKDAAVGY
FT                   DGQILSEPDNLNIKKHEAIAIVGPNGIGKSTFLKSILGQIPFIKGQAVFGTNVVTGYYD
FT                   QEQRNLNDKKTVLSELWDEHPTTPEKDIRTILGSFLFTGEDVDKPVHALSGGERARLLL
FT                   TKLAMQNDNFLILDEPTNHLDIDSREVLEVALNDFDGTLLFVSHDRYFINQVATSVVEV
FT                   SPEGTELFLGDYDYYIDKKQEQAEIAAAAASQAAEKAAEAGAADSTSATTAAPRSKGQQ
FT                   NYQASKQQQREKRKLERSVAALEEQMTALDEQATQIQTEMAQPEVSADVGKLQDLQKEL
FT                   EAINTQQEQVETEWTEQAEALEELS"
FT   gene            589447..590124
FT                   /locus_tag="LPST_C0554"
FT   CDS_pept        589447..590124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0554"
FT                   /product="redox-sensing transcriptional repressor Rex"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97776"
FT                   /protein_id="ADN97776.1"
FT                   /translation="MAETKIPRATAKRLPIYYRYLNILLDADKKRVSSTELSEAVKVDS
FT                   ATIRRDFSYFGALGKRGYGYDVETLLAFFKKILNQDTLTNVALIGVGNLGHALLNFNFH
FT                   KNSNVRISAAFDVNEAIANTVQSGVPVYPMTELKKQLIEQQIEIAILTVPTTVVQKITD
FT                   DLVDANVKGIMNFTPLRISVPETVRVQNVDLTNELQTLIYFIEHYGQQLGDNGNDDENE
FT                   TED"
FT   gene            complement(590289..590936)
FT                   /locus_tag="LPST_C0555"
FT   CDS_pept        complement(590289..590936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0555"
FT                   /product="CAAX family protease"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97777"
FT                   /protein_id="ADN97777.1"
FT                   /translation="MMVNRRQSIFILIIYFIIYALPSVLVTAFHQLGAQVFVIQTVDYL
FT                   VGAILLIWLASRMRTKNVVEKQPSNWFMTFIWGLIGLVLVIIGQVIILKMTALLGQSTA
FT                   STNTTTLLTVGQQYPAFFLAIIVGAPIMEEIVFRKVIFGNLSAVTGQIGAALISSVLFS
FT                   FAHADGHFILYAFIGLLFCWLYQHTGRIQTSMTAHILMNASVVLPTLLGLLH"
FT   gene            591126..591410
FT                   /gene="groES"
FT                   /locus_tag="LPST_C0556"
FT   CDS_pept        591126..591410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="LPST_C0556"
FT                   /product="co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97778"
FT                   /protein_id="ADN97778.1"
FT                   /translation="MLKPLGDRVILQQQEEEEQTIGGIVIANNAKEKPQSGKVVAVNDG
FT                   RVLDNGTKVDPSVKVGDQVLFDKYAGTEVKYQGAKYLVLHEKDIVAIED"
FT   gene            591466..593091
FT                   /gene="groEL"
FT                   /locus_tag="LPST_C0557"
FT   CDS_pept        591466..593091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="LPST_C0557"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97779"
FT                   /protein_id="ADN97779.1"
FT                   /translation="MAKELKFSEDARSAMLKGVDQLADTVKSTLGPKGRNVVLEQSYGS
FT                   PTITNDGVTIAKAIELDDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQSIVNEGMK
FT                   NVTAGANPVGIRRGIEEATKTAVDSLHAMAHEVKTQEDIAQIASVSSASEETGKLIAEA
FT                   MEKVGHDGVITIEESRGVDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITD
FT                   KKISNIQDILPLLQSIVEQGKPLLIIADDISGEALPTLVLNKMRGTFNVVAVKAPGFGD
FT                   RRKEQLQDIAILTGGTVITDDLGLELKDTTIDQLGQANKVTVTKDNTTIVEGAGSKDAI
FT                   SERVEFIRNQIGETTSDFDKEKLQERLAKLAGGVAVVRVGAATETELKERKYRIEDALN
FT                   ATRAAVEEGFVAGGGTALINVIKDVAALKETGDVQTGINIVKRALEEPVRQIAENAGLE
FT                   GSVIVEKMKEQKPGVGFNAATDEWVDMIKAGIVDPTKVTRSALQNAASVSALLLTTEAV
FT                   VAEKPEENAPAAPAAPNPGMGGMM"
FT   gene            593341..595176
FT                   /locus_tag="LPST_C0558"
FT   CDS_pept        593341..595176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0558"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97780"
FT                   /protein_id="ADN97780.1"
FT                   /translation="MWRYLKRLVIGKPLKTMDEGGQALTKFKALALLSSDALSSVAYGT
FT                   EQITTVLITLSAAALMYQLYVAVLVLVLLFAITMSYRQIIRAYPSGGGAYVVASTNWGR
FT                   PAGLVAGGSLLVDYMLTVAVSVTSGTEAITSAIPALANYQVLIAVLIVIAIMALNLRGM
FT                   RESASFLTFPVYFFIIMIIGMILWGVMNIASGNLTYHASAAVGAPVQGMTLVLFLRAFS
FT                   SGSSSLTGVEAISNAVPNFKRPKRKNAANTLAIMSLVLAVFFGGITYLSYYLGVKPQVD
FT                   NTVLSQIATAVFGHGLFYYLLQLSTALILAVAANTGFSAFPILAYNLAKDKFLPHAYMD
FT                   RGDRLGYSNGIISLAVGAIALIFIFHGKTTLLIPLYAVGVFVPFTLSQSGMIIHWFRER
FT                   GQWWWMKAAVNLLGALISILLVIFLFLLHFGNVWPYLIVMPLLLYMFYRIHVHYNRVAA
FT                   QLRVVAKEKAAIHDYDGATVIVLVSNVTRVTAQAVNYARSIGDYVIAMHVSFDENPEKE
FT                   HKTAAEFKETFPDVRFVDIHSSYRSIATPTLRFCDVIAKRAAERNFSTTVLVPQFVPKK
FT                   PWQNILHNQTSLRLRAVLNSRENIIVSTYNYHLKE"
FT   gene            595392..596489
FT                   /gene="tagO"
FT                   /locus_tag="LPST_C0559"
FT   CDS_pept        595392..596489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagO"
FT                   /locus_tag="LPST_C0559"
FT                   /product="undecaprenyl-phosphate N-acetyl-glucosaminyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97781"
FT                   /protein_id="ADN97781.1"
FT                   /translation="MIRFEILVSLVATMILSAILTPFVRKLAFKIGAVDKPNVRRVNKI
FT                   PMPTMGGLAIFISYTVGTTVLYLMHQFPSRIFFALLGGELIIIATGVIDDIYELKPRQK
FT                   MLGITLAALEVYFIGGIRMTTFTFPLLGLIHFQWLSLPVTLLWILAITNAVNLIDGLDG
FT                   LATGVSIISLSTMGIIGLFFLNANMFVSLLIFTLVAAMIGFLPYNFFPARIYLGDTGSL
FT                   FIGFMTAVFSLFGLKNVTLISVGIPVMILGVPITDTVYAMIRRILNKKPISQADKHHLH
FT                   HRLMQLGLTHRQTVMVIYGIALIFSFISLLYPISSIWGSVLLTIGLLFGLELFVEAIGL
FT                   AGDNRQPLLDWIKRTVARLTSKSNH"
FT   gene            596814..597716
FT                   /gene="pstF"
FT                   /locus_tag="LPST_C0560"
FT   CDS_pept        596814..597716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstF"
FT                   /locus_tag="LPST_C0560"
FT                   /product="phosphate ABC transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97782"
FT                   /protein_id="ADN97782.1"
FT                   /translation="MKKALTLGALAVTMTILLAGCGSSSATSTKSTSSSSGSSKTTKIV
FT                   ATGSTALQPLVEQAGQAYQNEHANVTINVQGGGSGAGLSQVAKGSVNIGNSDLFAQEQK
FT                   GLDAKGLVDHKVAVVGMAPVINKDAGVTNISKEQLIKIFQGKITNWKDVGGKDEKITVV
FT                   NRAQGSGTRATFEKWGLDNAKVATSQEQDSNGTVQKIVSTTPGAISYLAFSYVKSDVQA
FT                   LSIDNVKPTEANVATNKWKIWAYEHMYTKGQPTGELKNFLTYMTSKAVQGSLVEKLGYI
FT                   PLTSMKVDRGQSGAITNLK"
FT   gene            complement(597907..598554)
FT                   /locus_tag="LPST_C0561"
FT   CDS_pept        complement(597907..598554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97783"
FT                   /protein_id="ADN97783.1"
FT                   /translation="MTKPYYTITQDTVFEQTIKKSRFIAHLYRISDEVDAQAKIAAVRA
FT                   DNPKANHNCFAYMLGDDDHIQRMSDDGEPVGTAGSPILEVLKTNELHDVLAVVTRYFGG
FT                   IKLGAGGLIRAYNGTPAQAIEVSGKVQRILQARIAITLDYRNVDALTYYLQQNKLTTLN
FT                   TDYGVQVTQIIAVTQSEIATIQQDITNLLSGQVTFSEQGEQFTEIPVTTPGN"
FT   gene            598621..599973
FT                   /gene="comFA"
FT                   /locus_tag="LPST_C0562"
FT   CDS_pept        598621..599973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comFA"
FT                   /locus_tag="LPST_C0562"
FT                   /product="ATP-dependent DNA helicase/translocase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97784"
FT                   /protein_id="ADN97784.1"
FT                   /translation="MEAQVLYGRQLALSANEAAAVPAGTQILPAMQVDEHQIICQRCGS
FT                   HLDRLRAQLPNQQYYCYQCLNLGRVSTLVKLYHMPEPNAFATVPVCTWQGTLTPQQADC
FT                   AQSIKANFMAHKRQLLWAVTGAGKTEMLFPGIAWALAHQWRVAIASPRVDVCLELAPRL
FT                   QAAFADVQIAVLHGRNPAPYQYTQLTICTTHQLLRFRQAFDVLIIDEVDAFPFAANPRL
FT                   AFAVNQAAKVEGAILYLTATPSQSLLSQVHRGELAISYLPLRFHQHLLPAIKVKLQPNW
FT                   ARLLQQGKLPRDLIRQLQQYQQQHQRFLLFVPRIQQLAPVFAVLQHYFPHMTGETVYSA
FT                   DPERLTKVQQMRNQQFQYLVTTTILERGVTFPGIDVIVLGADDEVFSTAALVQIAGRVG
FT                   RSSERPTGLVWFICHSHSRNIKRAQRQIRVINRKGRQLRASMPTVSQHYHD"
FT   gene            599933..600607
FT                   /locus_tag="LPST_C0563"
FT   CDS_pept        599933..600607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0563"
FT                   /product="late competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97785"
FT                   /protein_id="ADN97785.1"
FT                   /translation="MLACLLCHNIITTKFTLPWILSWQPVMRPVVCSVCWRQFVRIDRA
FT                   TACSKCGRAQKRPQPCTDCQRWPEIGPFHNEALFEYNDAMHDYFQRYKFQGDYQLRQVF
FT                   AKIMQQAVVQRCAEICLVVPVTPTTLQTRGFNQVAGWLAAPLAPGLMTQATAKSVPQSK
FT                   KDRQARLRTPQPFKMAPNTILAGRRVLLVDDIYTTGRTMRHAATLLLENGAKSVTGLTL
FT                   AR"
FT   gene            600741..601307
FT                   /locus_tag="LPST_C0564"
FT   CDS_pept        600741..601307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0564"
FT                   /product="ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97786"
FT                   /protein_id="ADN97786.1"
FT                   /translation="MLNFNIRGENIEVTQAIRDYVQKRVGKLQKYFDNNVDSIAHVNLK
FT                   VHPDKTAKVEVTIPLPYLVLRAEETSPDMYASVDLVTDKLERQIRKYKTKVNRKSREKG
FT                   YKAIDFAATDETVAAADNDQDDKLDVVRTKRVALKPMDNEEAILQMDMLGHDFFIYEDA
FT                   ETDAINIVYRRNDGRYGLIETDDNH"
FT   gene            601694..604057
FT                   /locus_tag="LPST_C0565"
FT   CDS_pept        601694..604057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0565"
FT                   /product="preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97787"
FT                   /protein_id="ADN97787.1"
FT                   /translation="MANILKRWVESDKRTIRRLDKIANKVEAYADEYGKLSDADLQAKT
FT                   PEFRERYKEGESLDDLLPEAFATAREGAKRVLGLYPFHVQILGGIVLHQGDIAEMKTGE
FT                   GKTLTATMPVYLNAISGKGVHVVTVNEYLSARDATEMGELYNWLGMSVGINGAEKSPEE
FT                   KRAAYNADITYSTNGEIGFDYLRDNMVVYREDMVQRPLNFAIIDEVDSILIDEARTPLI
FT                   ISGQSEGTTGMYKRADRFAKTLTKDEDYKVDLESKTVALLDEGIRKAEKYFGLENLYDT
FT                   DNTALNHYLDEALRANYIMLKDKDYVISDGQALIVDSFTGRIMDGRRFSDGLHQAIEAK
FT                   EHVEIQEETKTMANITYQNLFRMYKKLSGMTGTAKTEQEEFREIYNMEVITIPTNRPMI
FT                   RDDRSDLLYPTLQSKFNAVVKEIKQLHEKGQPMLIGTVAVETSEYLSHRLDEENIPHVV
FT                   LNAKNHAKEADIVANAGQRGAVTIATNMAGRGTDIKLGPGVKEVGGLAVIGTERHESRR
FT                   IDNQLRGRAGRQGDPGMSQFYLSLEDDLMLRFGSERIKNFLQRMNVEDDDAVIQSRMIT
FT                   RQVESAQKRVEGNNYDSRKNVLQYDDVMRAQREVIYGERQQVIMEEKSLKPVIMPMIKR
FT                   TVERTVQLHMQGDAKDWDLDAVVDFAQAAMVKEDSISVADLKGKSPAEVEAYLMDRVDK
FT                   IYADKAKQLYDAGQMLEFEKVVILRVVDSHWTDHIDAMDQLRQSIGLRGYGQLNPLVEY
FT                   QRDGYQMFEEMVADIDYDTTRLFMKSEIRQNIQR"
FT   gene            604206..605279
FT                   /gene="prfB"
FT                   /locus_tag="LPST_C0566"
FT   CDS_pept        604206..605279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="LPST_C0566"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97788"
FT                   /protein_id="ADN97788.1"
FT                   /translation="MLSTTLGGRFDLDALNESIQENEARMAEPGFWDDQAAAQKVIDEN
FT                   NVLKGKYDTFKQLADEVGDLAVAYELLSEEPDAEMQAEFETDFQHAEHDLQQYRLNLLL
FT                   DGPYDRNNAILEIHPGAGGTESQDWGAMLLRMYTRWAASHNFKVETVDYQAGDEAGIKS
FT                   VTLLISGHNAYGYLRSEKGVHRLVRISPFDAAGRRHTSFASVDVMPELDDTVDVDIRPE
FT                   DLKIDVYRASGAGGQHVNKTSSAVRITHVPTGIVVASQAQRSQLQNRQTALNMLRAKLY
FT                   EREEEKKAKERAAIQGEQMDIGWGSQIRSYVFHPYTMVKDHRTNYESHDGQAVMDGDLD
FT                   PFMDAYLQWKLAQRNPQ"
FT   gene            605463..606638
FT                   /locus_tag="LPST_C0567"
FT   CDS_pept        605463..606638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0567"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97789"
FT                   /protein_id="ADN97789.1"
FT                   /translation="MQVLKIFELFLLQPLVWLGLLRSYLTAKRRVKSERQHFQSAINPQ
FT                   LVEVHHFLVDGCLLGVLMTIISLALGLVVAPIWVVIYEVVAAISLIIIPGALVPVTAFG
FT                   LSWLVYWIMSPELTTVGGALQRHGVAMTSMSGNLVVNGLLLLAIVLAATAVLLRHYDYE
FT                   GRSPQLQPDQRGKRLVRYQWQQLLVLPVGVLVPGDWLHATISWWPVFMVGERSFSILLL
FT                   PLLVGTSVRVYKQLPQIAWRQLAARYGWVTLASVLVAIIARFAVLSPQWLLALMGLIVV
FT                   LTWGILAQHRYHDRHQQFRYSDTEQGVRVIGLRPHTPADKLNLDLGDIILECNRQPVNT
FT                   EAEFYAALLKSPTYVHLKVRNRQQELIITETAIYNGAPHELGIVLFTDQED"
FT   gene            606638..607366
FT                   /gene="rrp3"
FT                   /locus_tag="LPST_C0568"
FT   CDS_pept        606638..607366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrp3"
FT                   /locus_tag="LPST_C0568"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97790"
FT                   /protein_id="ADN97790.1"
FT                   /translation="MTMDKILVVDDEPAIVTLLSYNLKQAGYEVVTATDGADALSLGLA
FT                   QSFTCILLDLMLPKLDGMEVTKKLRQEKVQTPIIIVTAKNDEFDKVFGLELGADDYITK
FT                   PFSPREVLARIKAVIRRTTPDEPVTPPAPMPPANRAVMLVGDLQIDQNKYRVARNGKNI
FT                   SLTPKEFELLVYFVEREGRVLSRDAILNHVWGYDYASETRIVDIHISHLREKIEADPKQ
FT                   PRLIRTVRGFGYEFVGDGHA"
FT   gene            607359..608762
FT                   /gene="hpk3"
FT                   /locus_tag="LPST_C0569"
FT   CDS_pept        607359..608762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpk3"
FT                   /locus_tag="LPST_C0569"
FT                   /product="histidine protein kinase; sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97791"
FT                   /protein_id="ADN97791.1"
FT                   /translation="MHNRWQQTTRLLLMENVLLVLIVLVVLQHFSPIKWSWRLVGCLVG
FT                   AWLVLAVIEGLIAWRQQSERQRTIDRMEAKLRQMSSQQFPPHILLPQSDPLYSLAQAVN
FT                   QLESYQKSQTRRAELQEKELMMIMRYLPVGVMVIDHRRQVQLSNPAMSELLQVSVNTVA
FT                   HIYTKDIQLYALTKLIEDTITSGKNQRATITLTPAPNTQVVEASTVYIQGNRSQFQIVL
FT                   MLYDITEVYMIEQMQDDFVSNASHELKTPITAISGFTETLLSGAKDDPDTLDQFLHIIA
FT                   DESQRLIDLIQDVLSLSRIRAQNTTMLTLAPLAVRPLIEQELAVVQQAIERQHLTINNQ
FT                   VDADLMITSDSQKLSQIIKNLLTNAIKYNRPHGSVTIATMVSHQTWSLIVKDTGIGISA
FT                   DDQQRIFERFYRASPSRSQQLVSGTGLGLAIVQELVNAMHGTIDVVSQRGVGTTMTVTL
FT                   PLAASASEQ"
FT   gene            609106..609981
FT                   /gene="pstE"
FT                   /locus_tag="LPST_C0570"
FT   CDS_pept        609106..609981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstE"
FT                   /locus_tag="LPST_C0570"
FT                   /product="phosphate ABC superfamily ATP binding cassette
FT                   transporter, binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97792"
FT                   /protein_id="ADN97792.1"
FT                   /translation="MRKSRVIQLIVLIAIIGLVGLGYTHRDRTSASESITAVGSTALQP
FT                   LVEAAGEQYSSNHTGVFINVQGGGSGTGLSQIQAGAVAIGNSDIFAEEQSGITASKLID
FT                   HRVAVVGIAPIVNKKAGITNLTQQQLIQIFTGKVTNWREVGGRNLPITLINRAQGSGTR
FT                   KTFERYALKGNQSVDSQEQDSSGLARSIVASTPGAISYVAFSYLDNSVQTVNVDGIRPT
FT                   EKNVRNNRWYIWSYEHLYTGKHPNQLTKKFIDYILSTAVQQKLVKQLGYISVHDMQVQR
FT                   NAAGKVSVMK"
FT   gene            609992..610921
FT                   /gene="pstD"
FT                   /locus_tag="LPST_C0571"
FT   CDS_pept        609992..610921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstD"
FT                   /locus_tag="LPST_C0571"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97793"
FT                   /protein_id="ADN97793.1"
FT                   /translation="MDKIRESLLKKSVASKIERRGKAISLVCLALIVGIVFLIFYFVAS
FT                   RGLATFFQNHINLWQFLSGTQWNPGTVGTNGQPAVGALPMIVGSFLITILSALIATPFA
FT                   IGTAVFMTEISPRRGAKILRPVTELLVGIPSVVYGFIGLQVVVPFVRNTFGGSGYGILS
FT                   GTFVLFVMILPTVTSMTADALNSVPRYYREASLALGATRWQTIYKVVLRAAIPGMLTAV
FT                   VFGMARAFGEALAVQMVIGNATLLPHNLVSPAATLTSILTMGIGNTVMGSLQNNALWSL
FT                   AMILLLMSLVFNLVIRYIGRKGKLNHER"
FT   gene            610911..611795
FT                   /gene="pstC"
FT                   /locus_tag="LPST_C0572"
FT   CDS_pept        610911..611795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="LPST_C0572"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97794"
FT                   /protein_id="ADN97794.1"
FT                   /translation="MNAKRIDKIATGVLYGVAAFVVIILVALLGYILIQGVPKISWHFL
FT                   TSPALAFEAGGGIGIQLFNSFYLLFLALLISLPISLGAGIYLNEYAPQNTVTGLIRTTI
FT                   EILSSLPSVVVGLFGYLFFVVQFKLGFSILSGAFALTVFNLPILTRSIEEALANISDNQ
FT                   REAGYALGLSRWETVTKIVVPAALPSILTGVVLSAGRIFGEAAALIYTAGQSAPALDFG
FT                   NWNPFDISSPLSPLRPAETLAVHIWKINSEGIMPDAKAVSAGASAVLIIAVLLFNFLAR
FT                   WLGKRLYKHLTAE"
FT   gene            611810..612619
FT                   /gene="pstB"
FT                   /locus_tag="LPST_C0573"
FT   CDS_pept        611810..612619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="LPST_C0573"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97795"
FT                   /protein_id="ADN97795.1"
FT                   /translation="MADNTMTTTQRNIMAFDPKDHEIALSTEDLHVFYGKSEAISEGDL
FT                   QFERYKISALIGPSGSGKSTYLRSLNRMNDRIATVKGKIMYRGLDINSNDIDVYEMRRH
FT                   IGMVFQRPNPFAKSIYENIAFALRQRGMNKKQDLDEIVERSLRQAAMWDQVKDDLNKSA
FT                   LALSGGQQQRLCIARAIAIKPDILLLDEPASALDPVSTSQIEDTLLELKQNYTIIIVTH
FT                   NMQQASRISDYTAFFNLGKVLEYSETGEIFTNPQVDLTNDYISGNFG"
FT   gene            612631..613386
FT                   /gene="pstA"
FT                   /locus_tag="LPST_C0574"
FT   CDS_pept        612631..613386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="LPST_C0574"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97796"
FT                   /protein_id="ADN97796.1"
FT                   /translation="MSTILTTENLSLFYGKKEALKGINIDFDDKGITALIGPSGCGKST
FT                   FLRCLNRMNDLIPNVTITGEVNFNGHNIYAPTTDTVQLRKEIGMVFQQPNPFPFSIYEN
FT                   VIYGLRLAGVHDKERLDAAVEKSLKQAAIWDEVKDRLHANALSLSGGQQQRVCIARVLA
FT                   VEPDIILLDEATSALDPISSRMIEETLLNLRQDYTIITVTHNMQQASRISDRTAFFLNG
FT                   ELIEVNDTKQIFMNPVKQETNDYISGRFG"
FT   gene            613399..614073
FT                   /gene="phoU"
FT                   /locus_tag="LPST_C0575"
FT   CDS_pept        613399..614073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="LPST_C0575"
FT                   /product="phosphate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97797"
FT                   /protein_id="ADN97797.1"
FT                   /translation="MRRLFDDELNDIDANFTEMGMMVSETIEKAVKAFIDHDRDLAQEI
FT                   IDNDAKINQREVELEQKSFEMIALYQPVTSDLREIVTILKAVSELERMADYARNIAHAT
FT                   IRVKGNVRVPEIEAALSEMGNRVRKMVEEMLAAYVKSDDQEARRVAAKDAKVGEMYDRI
FT                   NEKGISKMERHPETVIGSTDYLNVATYLMRIGALVTNIGEWIVYLNTGEIIELNPESSN
FT                   LV"
FT   gene            614173..614484
FT                   /locus_tag="LPST_C0576"
FT   CDS_pept        614173..614484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0576"
FT                   /product="stress-responsive transcription regulator
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97798"
FT                   /protein_id="ADN97798.1"
FT                   /translation="MKSNTKQKLTKSNNRVFAGVLGGIAEYLNWNATILRVLYVILTLV
FT                   THGFGVLVYLVLMTIIPSKPDNTGFFEQMRQSTGIQAKPQAHGRKEIHNVHEEDDPRH"
FT   gene            614506..614871
FT                   /locus_tag="LPST_C0577"
FT   CDS_pept        614506..614871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0577"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97799"
FT                   /protein_id="ADN97799.1"
FT                   /translation="MGFWKRILINTILFIAIAGFFQSSFHVASVWMALIASFVLAILNA
FT                   AIKPFLLLLSLPITLLTLGLFSIVINGFMLQMTSYVVGKANFGFSSFGMAMVVSILMSI
FT                   ANVIVSNFFAKDGVDGE"
FT   gene            615017..615964
FT                   /gene="hprK"
FT                   /locus_tag="LPST_C0578"
FT   CDS_pept        615017..615964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="LPST_C0578"
FT                   /product="HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97800"
FT                   /protein_id="ADN97800.1"
FT                   /translation="MAGSVTVADLVKNTRLDVYHGADLLEKKDITTSDISRPGLALTGY
FT                   FNYYPRERVQLLGKTETAYSKNMSHDERLMIFRKMCQLTTPAFVISTGLPVPEELVQAG
FT                   EENGVPILGTKMTSSRILSNMTNYLEGKLAERQSVHGVLVDIYGLGVLITGDSGVGKSE
FT                   TALELVKRGHRLIADDRVDVYQQDEQTLVGEAPAILNHLLEIRGIGIIDVMNLFGAGAV
FT                   RQDTDIDLIVHLENWTPDKQFDRLGNGEQNRKFFDVEVPEISIPVKTGRNLAIIIEAAA
FT                   MNFRAESMGYDATKVFDDNLNKLIKTNSVHDSHK"
FT   gene            615983..616831
FT                   /gene="lgt"
FT                   /locus_tag="LPST_C0579"
FT   CDS_pept        615983..616831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="LPST_C0579"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97801"
FT                   /protein_id="ADN97801.1"
FT                   /translation="MNTVLGALNPIALRLGPIQVHWYGVIIASAVVIAVALAVREGQRR
FT                   GVRPDDIYDMILWALPFTLIAARTYYVIFQWSYYRQNPGEIIRIWDGGIAIYGGLIGAG
FT                   IVVILFCRSRFIPTWLMLDIAAPTVIMGQGIGRWGNFMNQEAFGRVTSLSFLQGLHLPD
FT                   WLINQMYIRGAYRQPTFLYESVWDLLGFALLMLTRHRTHWYKQGDVFLTYVAWYAFGRF
FT                   FTEGMRTDSLMLFNVIRVSQALSVVLFFGSIGLMIWRRRHNPNNRWYLAGSGQKVVAEN
FT                   K"
FT   gene            616849..617865
FT                   /gene="gpsA"
FT                   /locus_tag="LPST_C0580"
FT   CDS_pept        616849..617865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="LPST_C0580"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97802"
FT                   /protein_id="ADN97802.1"
FT                   /translation="MMKKIAVLGAGSWGSILANLLDENGHSVRLWSYSPAQVTELNEQH
FT                   TNERYVPDFKYSETLTAYSNLTQAIDGADVILFVVPTKAIREVAQQVTAVLAKTHQRPI
FT                   IVHASKGLEQETHKRLSQVLAEEIPAELRQAIVVLSGPSHAEEVARHDITLITAASADE
FT                   SAAELVQQLFMNDYFRIYTNTDVVGVELGAALKNIIALGAGALHGLGYGDDAKAALMTR
FT                   GLAEISRLGVALGAEPLTFIGLSGVGDLIVTATSVHSRNWRAGNELGAGQDLKTVIDTM
FT                   GMVIEGIPSTKAAYELAQQQNIEMPITEAIYDVLYKSADIKEVIPQLMRREGKPEIQ"
FT   gene            617909..618829
FT                   /gene="galU"
FT                   /locus_tag="LPST_C0581"
FT   CDS_pept        617909..618829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="LPST_C0581"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97803"
FT                   /protein_id="ADN97803.1"
FT                   /translation="MSKVRKAVIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVDEA
FT                   RKSGIEDIVIVTGKSKRSIEDYYDSNPELEDNLRAKHKEEMLKLVQETTDINLYFIRQS
FT                   HPRGLGDAVLTAKAFVGDEPFVVMLGDDLMEDKVPLTKQLMNSYDKTHASTLAVMKVPH
FT                   EEVSKYGVINPESEKEPGLYNVNNFVEKPSPEDAPSDLAIIGRYLLTPEIFDVLENQKP
FT                   GKGDEIQLTDAIDTLNKTQRVFAHEFKGTRHDVGYKFGYLKTTIEYGLTHPDVKADLRT
FT                   YIKDLGAKLSKEDSAAPKTTKKPTK"
FT   gene            complement(618927..619607)
FT                   /locus_tag="LPST_C0582"
FT   CDS_pept        complement(618927..619607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0582"
FT                   /product="diguanylate cyclase/phosphodiesterase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97804"
FT                   /protein_id="ADN97804.1"
FT                   /translation="MYRYFIQPQLDKFNNSLIGYEMLIRYRETDQDRWTLPESFDNIPI
FT                   DVQVSLLKATASELALKIGSVSINFNRKQFLNDDIAAAVIDAQKKLFPVHVIVEVTEEP
FT                   GEDTFTLAAMQQQIDKYKANGLQFSIDDVGTGINVYDHIKPLLESAEEIKFAMQNFRAE
FT                   DRENEIPIQLKFWRDIAVQHDIRLILEGVENDAEDQMANDLNISLRQGYYYGKPHLFKL
FT                   KADH"
FT   gene            619710..619838
FT                   /locus_tag="LPST_C0583"
FT   CDS_pept        619710..619838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97805"
FT                   /protein_id="ADN97805.1"
FT                   /translation="MVSIINWANDDCAKLLGEQGNFLKMSKKSISGYLAKLVWTIL"
FT   gene            619999..621411
FT                   /gene="nox1"
FT                   /locus_tag="LPST_C0584"
FT   CDS_pept        619999..621411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nox1"
FT                   /locus_tag="LPST_C0584"
FT                   /product="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97806"
FT                   /protein_id="ADN97806.1"
FT                   /translation="MKIVIVGCTHAGTAAAAQILKDHPEATVTIYERDDNISFLSCGIY
FT                   LYLGGKVNHLEDMFYSSPETLAKLGAMVRTKHNVLKIDAQSKTLQVVDMTTGKVFGDTY
FT                   DKLIMTTGSNVAVPPIFGIDESKVLLCKTYSQAQEIYQTAQDNQRIAIIGAGYIGTELS
FT                   ESYANTHHEVTLFQSHDQILNNYISKEISDQAVQLLKDHGVNVLLNHQVTAFTGNDDGE
FT                   LVIETNQGDFNADLAIVGTGFVPNTELLRGQVEMDKHGAIIINDYVQTSDPDIYAAGDS
FT                   CVVNFNPTGRSAYTPLATNAVRQGALAGANVFGNQQRYMGTQATSAMQLFDHTLATTGL
FT                   TLAMAKLNHIPAERVTYEGNWRPAYMPSTAKLMIELIYNPENRKILGAQFLSAHEVAQS
FT                   ANALSIAIQNGNTIDDLAFVDMLFSPNFDEPFNYLNLVAQQAIEQERQAGRNHPRITAY
FT                   GDWAKQNDKDLQ"
FT   gene            621449..622555
FT                   /locus_tag="LPST_C0585"
FT   CDS_pept        621449..622555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97807"
FT                   /protein_id="ADN97807.1"
FT                   /translation="MLVMLTAVVSGCRKQTTVSTPRHAPSGFVTTTAYATKVSKQRRVK
FT                   LAAFIKRGLLTKQGLYTNYLDTRKRTTATATGHEMLSESSGMWLQYLVTTRQWAQFRQF
FT                   YRQTKATFNENGLFSYRYDPRTKKRYAVNATLDDLRIIRALLTYDQAHHTNHYRQKATQ
FT                   RYQNLVNTTIKDGHLVDYYDVHARKATTTGSLAYFDLRTLKYFEQDTKKGRSAYKKQLI
FT                   VLKGGYLGDVFPLYAKSYQWTTSQYSDGNLNTSEALETLLHLAEVGHLKATSRRWLIQR
FT                   VTHRDLANGYTTRGTVNVGGESAANYALAASIFATLGDEKHYQVAMNNVWRLQVQQDSS
FT                   PINGGIGDVKTKQVYSYSNLTALNAAFN"
FT   gene            622573..624069
FT                   /locus_tag="LPST_C0586"
FT   CDS_pept        622573..624069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97808"
FT                   /protein_id="ADN97808.1"
FT                   /translation="MTKLKQQFWRATRLFQQLMPPPLLATLLCAGLAAYVAFVPPINGL
FT                   ADNGDFYRAMYTNGIYKLLGTHYNYFDFVTQKFGLMKYYNDYRSVNFSSQPLFVKVAIG
FT                   LNKLFYSKTVFDIRFMGIVNVIPYLGGIYLLTDALTYPAKRFRNYLIAGLVVLVFGDSS
FT                   FTLYLNSFFAEPQMLGLTLISFSAVLLLARQRYRRRWPLVALYFVCTVLLITNKSQNAP
FT                   LALSFVVVTIGLLFLPHFNAMRVYLLAGMVMILITGGLTYKLIGQDFVDINTYQTFSHG
FT                   ILTQTDDPSKDLAQNGIDEQYALMQSQDYYAKQFATIQASGSYVKKNLVSKLGVGWVLK
FT                   YYATHLKQFGKLMDLAAADVMITQVKAVGDYTQASGAPAGKQLTFFTTYSQIAGAFFPQ
FT                   KFAFNCLLVVALVMVYLVGFYNDLRQQRIEGVLRFFLVLGFLSIFIFVPIISIIGDGDA
FT                   DLAKHLFMVPVSIDLIVLLFISDTLNHRLWHAYREEDQDA"
FT   gene            624062..625636
FT                   /locus_tag="LPST_C0587"
FT   CDS_pept        624062..625636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97809"
FT                   /protein_id="ADN97809.1"
FT                   /translation="MHKRLWQLVIMGVIILCSWLLPTEIHAQTSATHVMLVYDSRNVAN
FT                   NDQTKIAMIQRILTGLHISIKTVAAEDYHAGELRHYQGVITLINWPQTKLNNAAFIKDR
FT                   KQFSGTKLHIGTNLTAIEAQQLNAQPVKVYQQQFFLQSNDQQVRQLLPFMSSMTALTKL
FT                   PAKAKTIGYLRAQSSLKHEYPYGTIVGRYGYLPYLSTGGYSLVLATQTMATLFGTRSHY
FT                   QPLLTITKVTPYSNLNLLNKLSATLYQQGIPFAVSTTTVGTNGKFKAYQRFAKVLRLIE
FT                   NRGGVIFLKTPVVGGVTASSGPGLSKLMDSYVIQLAQNQVYPVGISASAYWNQDRVYRQ
FT                   NALTKANQVLLLPDPKVTTYAHQDNQATVFDQAFYGVSAKSFETLKSGDQLSKLALNFA
FT                   IPTALTMTMPDSETSLHNLTRQLSRMNYQWFDPAQQMTTTMLKSGTATISYRRGTYLLN
FT                   GAPTQVTDNAPATTTLAAVKPAESWMNRFFKTQGSVLLIFFSVTLGIFVLFIVIGRRVY
FT                   LNMFKPK"
FT   gene            625735..626928
FT                   /locus_tag="LPST_C0588"
FT   CDS_pept        625735..626928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0588"
FT                   /product="group 2 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97810"
FT                   /protein_id="ADN97810.1"
FT                   /translation="MNVVLTIAGYVNYLQKVRRPEPQLPVKVPFVSIMVPAHNEGIVIV
FT                   KTLQSLLNFDYPKDRYEIIIINDNSDDNSAELLAEVQSLYPHRNLKVINTDKTNGGKGK
FT                   SNALNIGLKQARGSLISIYDADNTPQRTALRYLVAELMSDQRLAAVIGKFRTRNKNASI
FT                   LTRFINIETLSFQWMAQAGREKLFKLCTIPGTNYVIRRDILEKIGGWDVKALAEDTEIS
FT                   FRVYRMGYRIRFQPLAVTWEQEPQTLDVWFHQRTRWVKGNIYVILKNARLLFTKTGRPI
FT                   RFDLLYFLSIYFLLMTSLILSDSMFVLSVAGIAHSDLVGFSNILWLMAIITFVISTFVT
FT                   ITTEKGEMTIANLMIIVFMYLVYSQMWLAVAAHGMVGYVREQVFHQQAKWYKTKRYQ"
FT   gene            627089..629011
FT                   /locus_tag="LPST_C0589"
FT   CDS_pept        627089..629011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0589"
FT                   /product="cellulose synthase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97811"
FT                   /protein_id="ADN97811.1"
FT                   /translation="MYFIKMDYWQVKKVTINLNFQISQLANRETSDITLSLNGTKFYSF
FT                   RPKKETGLQTRAIEVPLRLIQGENQLKISGQILNKKGQQSSQLVQTPANWLTIYNGANA
FT                   NFEYRLQPPTTAIKSFYAHFSGTDTIANANSVITLPHQASNAELSAGMYALTGEARTIT
FT                   TENTQIPVTTADTAVAKQADYQLVIATYQHLPKVFQQQLDRQRLREHAVIKTYTHDDKH
FT                   YLIVSAFNTKLLQKASRFIANQELMQETVADTKYISNSTQTFTSELQYGGKTQLTTSDD
FT                   YLTGAKHQSSTYFVSLPVDRTNADGSKIRIHFRYAKNLDFKRSLVTVYVNDSALGSKRL
FT                   TAARANNDELTVSLPKGKALGHSFTIRVAFDLEMSEAAQSDNAQTPWALIKADSEATIK
FT                   SKPVAALLFTNYPYLFLKNATFNHIAVVRPRTLTSDDFQTLTNIFNLIGTYAQSNTGNI
FT                   QLYTHQPSKTVLKNSNVIAFGTPAQNAFIRSLNSKLYFKYNRHFTGFLSNEKLSIEKTY
FT                   GQNIGTAQLLRSPYNQRAGLLVVTAAKSSDVYRASTQINFQRNIAQYQGDAIVVDHDNN
FT                   HYNYRFKKHKTVNDGVNAKTVIQKNSKLVIYLGIALLIVVIILLAGFLIMRKSGLLERK
FT                   GQHHE"
FT   gene            629004..629861
FT                   /locus_tag="LPST_C0590"
FT   CDS_pept        629004..629861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0590"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97812"
FT                   /protein_id="ADN97812.1"
FT                   /translation="MNDDQRTSIFADVYLLLFLALISTMAVLMALTPNITLNTIYLGVT
FT                   IIMILMTYFFGVVTGLMANLLFIFAQAIVMIYINSTHHAVIPMMMIFWLIMPLLLSATF
FT                   YGMTRQLIQLQAANAKLRADIMKRGAFDEQTNLRTTVAYIQDAQVFIETNRRFQLPVTT
FT                   VIIRVRYYNEIRRMMSEQQYRDLLRLVSDTITSATRDNDITYSLDQNNPTWAILLFSDQ
FT                   PGAQIAANRIKSNFEKNLQRSTSLNSLEILLVVGIASWDAEKMKSPYDFMNTGIKETEY
FT                   DVAR"
FT   gene            629954..630892
FT                   /gene="trxB1"
FT                   /locus_tag="LPST_C0591"
FT   CDS_pept        629954..630892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="LPST_C0591"
FT                   /product="thioredoxin reductase (NADPH)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97813"
FT                   /protein_id="ADN97813.1"
FT                   /translation="MAKSYDVIIIGAGPAGMTAALYASRANLSVLLLDRGIYGGQMNNT
FT                   AAIENYPGFKSVLGPDLAKDMYESATQFGAEYAYGSVESVEDRGDVKIVTTDSDTFETK
FT                   ALVIGTGSEYRKLGVTGEDTYGGRGVSYCAVCDGAFFRNKHVVVVGGGDSAIEEGTYLT
FT                   QLADKVTVIHRRDQLRAQQILQDRAFANPKMEFVWNSNVTEIIGDDKKVTGVKVNNNKT
FT                   GEDSEIAVDGVFIYVGINPITKPFSNLGITDENGWIETNDHMETKVPGIFAVGDVRKKD
FT                   LRQVATAVGEGGTAGQGVYTYITALGDKVNN"
FT   gene            complement(630998..631630)
FT                   /locus_tag="LPST_C0592"
FT   CDS_pept        complement(630998..631630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97814"
FT                   /protein_id="ADN97814.1"
FT                   /translation="MFSYWDVTIKLALGLLTIILQINLSGKSNLAPISALDQVQNYVLG
FT                   AIVGGMIYSTSVTVLQYILVLLIWTLLVLVLRFLTHHNRYVKRLIDGQPQLLIKNGQLL
FT                   VSTALKNGMSANDLMFRLRTEGITDIRYVKRAVLEQNGQLTITQVGDDAVKYPIIVDGQ
FT                   VNLDALETSNHDEAWLLTQLQAQHYTVSDIYLATYTNKQLLLFPYQH"
FT   gene            complement(631631..632188)
FT                   /locus_tag="LPST_C0593"
FT   CDS_pept        complement(631631..632188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97815"
FT                   /protein_id="ADN97815.1"
FT                   /translation="MRSGPASVRIPINSEVLVSSVTIKTCYNKSYKEAIMTFYSYNYLV
FT                   HQNNNHTLVQLAAIGIIILIIAILSWLWYRHKTDLKYRDLFIIMVLLLLLLVGIQFNEW
FT                   QTIKNSFNQKSQVTQIMQRVAKEKGVRKTAVWSNTSSVSSGMLIKVHDHIYNVTINTDG
FT                   NSYTLTKATPIQSTINYVKEGQ"
FT   gene            632302..634029
FT                   /gene="pgm"
FT                   /locus_tag="LPST_C0594"
FT   CDS_pept        632302..634029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="LPST_C0594"
FT                   /product="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97816"
FT                   /protein_id="ADN97816.1"
FT                   /translation="MSWQDTYNTWKNQATLETSLKQELTGMAGDDAALEDAFYEPMEFG
FT                   TAGMRGILGPGINRMNIYTVRQATEGLARFMDTLPAEVKERGVAISFDSRHHSEDFAHE
FT                   SARVLGQHGIKSYVFESLRPTPELSFTVRHLHTYAGIMITASHNPKQYNGYKIYGEDGG
FT                   QMPPKESDLITSYIRKVDDVFAIAVADEQQLLADKTETIIGDDVDQDYLAKVKEVTINQ
FT                   KLVDEVGKDMKLVFTPLHGTGRMLGEKALKNAGFKNFSVVKEQAVADPEFSTVKFPNPE
FT                   FPEAFKIAIDLGKKEGADVLIAVDPDADRLGTAVRQPNGEYVLLTGNQIAAVLLHYILQ
FT                   ANKDAGTLPTNAAAVKSIVSSEFATKVAASYGVTMINVLTGFKYIAEQIEHFEATGEHT
FT                   YMFGFEESYGYLIKPFVHDKDAIQTTVLLAEVAAYYKQQGKNLYDGLQDLFKEYGYFRE
FT                   QTTSEEFDGVGGSDKIAALMTKFRSEAPTAFAGYDVTGTEDFQSQTESFADGHTAPIAL
FT                   PKANVLKYHLNDGTWIAIRPSGTEPKIKFYIGTLGSTLEEANDKLAKFEDAIQAFIKE"
FT   gene            complement(634153..634863)
FT                   /locus_tag="LPST_C0595"
FT   CDS_pept        complement(634153..634863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0595"
FT                   /product="diguanylate cyclase/phosphodiesterase domain 2
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97817"
FT                   /protein_id="ADN97817.1"
FT                   /translation="MEPIYRYFVQPQLNLLNNTVYGYELLIKQLTPDGWRLPESFAAIS
FT                   SQVTSDLLIATTKILGLKVRYCAVNISREQLMDTTVAKAIIQSQVQLYPAKLVVELTEE
FT                   RSPKDYPDTMLIPHLRGFIEHGMQISLDDVGTGINDFKSIQEILPLASELKFALQNFRS
FT                   DIKDPKIQQKLHFWRAISSEYGLRLILEGIEDAEDDRLSSHFDINLRQGYYYGKPQLLR
FT                   LPGDPVNFEYPTMN"
FT   gene            635017..636375
FT                   /gene="nox2"
FT                   /locus_tag="LPST_C0596"
FT   CDS_pept        635017..636375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nox2"
FT                   /locus_tag="LPST_C0596"
FT                   /product="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97818"
FT                   /protein_id="ADN97818.1"
FT                   /translation="MKVAIIGCTHAGIAAMKQILKYYPGTEITVYERHADISYMSCGTY
FT                   LHLGGTIHNLDQALYANPSEFSEQGVQMRMQYDVINVNADKHTILAQNLQTKELQTDHY
FT                   DKLVMATGSITAIPAIPGVENPKVMLCKTCEQAQQLYEAAKHAHHIAIVGGGYSGVELA
FT                   EGYVKSGHTVTLFQRGPHLINEYLDPQISEKIEDLLTTKGIQVRTNAQVTAFSDTADNR
FT                   LRVATADSEEIFDMAVICPGVIPQSELLAGQVNRTKQGAIVTDRYMGTSNPDIFAAGDV
FT                   TEVNFNPTKEHAYMPLVSHAIRQGALAGINIFDKRLGAIGTQATTGMLIFDQTVACAGL
FT                   TLTAAKAANFDAQAAFYEGNYRPDFMPTTAKVMIELVYDQQTRKVLGGQLMSAHEVSQS
FT                   ANTLSVVIHNGNTIDELAFMDMLFSPNFDEPFNYLNLVAQAAVDQEHGYRRNN"
FT   gene            complement(636821..637378)
FT                   /gene="aad"
FT                   /locus_tag="LPST_C0597"
FT   CDS_pept        complement(636821..637378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aad"
FT                   /locus_tag="LPST_C0597"
FT                   /product="D-alanyl-D-alanine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97819"
FT                   /protein_id="ADN97819.1"
FT                   /translation="MDQALTGFTNIQHLDSEIIVDLRYATTNNFTHQVIYDFTTAIVRT
FT                   GTAHKLAKASALVKQQGYRLKVWDAYRPVSAQRRLFEVYPDPEFVAQPNPNFSHQKGVT
FT                   LDLTLAHPDGSELTMPTAFDDFTAAAHRDAPRTALQEKNYQLLDTAMTAAGFVGYVNEW
FT                   WDYRDTEMDAYQPLAADPNDYA"
FT   gene            637548..638744
FT                   /locus_tag="LPST_C0598"
FT   CDS_pept        637548..638744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0598"
FT                   /product="multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97820"
FT                   /protein_id="ADN97820.1"
FT                   /translation="MDRQTRRAILILVFSEFLVCLGISLVIPVMPFIKNELHLTATDMG
FT                   IMNALFALAQFVASPIIGRVSDKVGRKPVLTVGLVLYMVSEVLFALTNQLWVFNISRIV
FT                   GGLSAAMVVPTAMALASDITTKRQRAKVIGWLSAAFSGGLILGPGIGGVLAGISYKTPF
FT                   WVAGALGLLSAIVLVILLPADRQIDPDREAITATTTTTNHPMTRAFWTVPIIILFTMIL
FT                   VSSFGLQGFESIYSIYVNEVFHFSLSNIALVLTLNGLISLFLQVALFDTFVQCWGERRV
FT                   IRVCFAAAALCTIWITQAHSKVAVMVATLVIFSAFDLLRPAITTLLTKASEANQGLING
FT                   LNMSLTSVGNIVGPIMSGMLLDMNYHYPYLVVAGFLIVSYLMAFMLRLPNQVHSHQQV"
FT   gene            638850..639497
FT                   /locus_tag="LPST_C0599"
FT   CDS_pept        638850..639497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0599"
FT                   /product="HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97821"
FT                   /protein_id="ADN97821.1"
FT                   /translation="MGMHQYFQSLSNLETIQRAPGFFKYQNHSVAAHSFKVAEVAQFLG
FT                   DVEENAGQIVDWRALYEKALNHDYNERFIGDIKTPVKYATPTLRTMLADVEHKLSQNFV
FT                   QNEIPAEFQAAYSRRLSEGKDETLEGQILSVADKIDLLYESFGEIQKGNPEPVFRDIYQ
FT                   ESLKTIVAFKKMTSVQYFLKAVLPEMLAEPFTHQDQLQALTTQILTAGPQSD"
FT   gene            639646..641649
FT                   /gene="uvrB"
FT                   /locus_tag="LPST_C0600"
FT   CDS_pept        639646..641649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="LPST_C0600"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97822"
FT                   /protein_id="ADN97822.1"
FT                   /translation="MIDRVDNNHFDLVSDYQPTGDQPQAIQQLTAGIESGEKEQILLGA
FT                   TGTGKTFTISNVIAKVNKPTLILSHNKTLAGQLYGEFKKFFPNNAVEYFVSYYDYYQPE
FT                   AYVPSSDTYIEKDSAINDEIDKLRHSATSSLLERNDVIVVASVSSIFGLGDPHEYQDHV
FT                   VSLRVGMEIDRNDLLRKLVDIQFDRNDIDFQRGRFRVHGDVVEIFPASRDDHALRVEFF
FT                   GDEIDRIREIDALTGEIVADREHVAIFPATHFMTNDAIMEHAIKGIEDELDGRLKELTA
FT                   DGKLLEAQRLKQRTTYDVEMLKEMGYTSGIENYSRFMDGRKPGEPPYTLLDFFPKDFLL
FT                   VVDESHVTMPQVRGMYNGDRARKQMLVDYGFRLPSALDNRPLKLEEVEQHINQVVYMSA
FT                   TPGPYEMDRTKHVVQQIIRPTGLLDPTIEVRPIMGQIDDLVGEINKRIEVNERVFITTL
FT                   TKKMAEDLTDYFKDLGIKVRYLHSDIKTLERTQIIRDLRLGKFDVLVGINLLREGIDVP
FT                   EVSLVAILDADKEGFLRNERSLIQTIGRAARNEHGSVIMYADTTTDSMQAAMDETARRR
FT                   AVQMKYNEDHHITPHTIKKAIPELIASTKTTEDAGKKDDFLETDFDDMTREQQLDMISK
FT                   LEEQMKTAAKKLDFEQAATLRDTVMELKAQIS"
FT   gene            641684..644539
FT                   /gene="uvrA"
FT                   /locus_tag="LPST_C0601"
FT   CDS_pept        641684..644539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="LPST_C0601"
FT                   /product="excinuclease ABC, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97823"
FT                   /protein_id="ADN97823.1"
FT                   /translation="MANDKIVIHGARAHNLKDIDVTIPRDKLVVITGLSGSGKSSLAFD
FT                   TLYAEGQRRYVESLSAYARQFLGQMQKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTVT
FT                   EINDYLRLLWARVGEPICPNDGTPIASQTVEQMVDRIQKLPERTKLQILSPIVRQKKGE
FT                   HKKIFEKIKREGFVRVRVDGDIHDISETFELNKNQQHTIEIVIDRIVVKSGDRSRLFDS
FT                   FEAALRLSGGYAIADVIGGEPIMFSEHYACPICGFTVGELEPRLFSFNAPQGACPDCEG
FT                   LGIKLEVDEDLVVPDKSLTLAEGALAPWNPISSQYYPEMLKQACEQLEIPMDVPYEDLS
FT                   KADQQTVLYGSNGKTFHFHYQNDFGGVRDVDAVFEGVINNVDRRYHETNSDFTRDVMRK
FT                   YMTELTCQTCHGFRLNRKALSVKVGGEHIGMVSDLAIGKELDFFNELSLSEQSLVIAKP
FT                   ILKEIRDRLSFLQNVGLAYLTLSRSARTLSGGEAQRIRLATQIGSNLSGVLYILDEPSI
FT                   GLHQRDNDRLIGSLKKMRDLGNTLIVVEHDEDTMRAADYIVDIGPGAGENGGEVMAAGT
FT                   PKQVARSRKSLTGQYLSGKRFIPLPETRRPGNGKKIRITGAAENNLKQIDVDFPLGEFV
FT                   VVTGVSGSGKSTLVNDVLKRVLAQKLNRNSEKPGKYKSVSGIKNIERLVNIDQSPIGRT
FT                   PRSNPATYTGVFDNIRDLFAQTNEAKLRGYKKGRFSFNTKGGRCEACHGDGILKIEMNF
FT                   LPDVFVPCEVCHGKQYNSETLEVEYKGKNIADVLQMTASEAVKFFEPIPKIRRKLQTLV
FT                   DVGLGYVKLGQPATTLSGGEAQRMKLASELHKQQSGKNFYILDEPTTGLHSEDIRRLIG
FT                   VLDRLVDAGNTVLIIEHNLDVVKSADYLIDLGPEGGDGGGTIVATGTPEQVAEVAESYT
FT                   GQYLKPVLERDRAREATAPAK"
FT   gene            644600..645076
FT                   /gene="luxS"
FT                   /locus_tag="LPST_C0602"
FT   CDS_pept        644600..645076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="LPST_C0602"
FT                   /product="S-ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97824"
FT                   /protein_id="ADN97824.1"
FT                   /translation="MAKVESFTLDHTKVLAPYVRKITVENGPKGDAITNFDLRLVQPNK
FT                   TAIDTAGLHTIEHMLAGLLRDRMDGVIDCSPFGCRTGFHLITWGEHDTVEVAKALKSSL
FT                   EFIAGPAKWEDVQGTTIDSCGNYKDHSLFSAKEWAKLILSQGISSDPFVRKVVE"
FT   gene            645413..646648
FT                   /gene="argG"
FT                   /locus_tag="LPST_C0603"
FT   CDS_pept        645413..646648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="LPST_C0603"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97825"
FT                   /protein_id="ADN97825.1"
FT                   /translation="MVKQNDKIILAYSGGLDTSVAISWLKDKGYDVVACGIDVGEGKDM
FT                   DAIKEKALKLGAVSSYMIDAKQEFAEEYALIALQGHTLYEGEYPLVSALSRPLIAKKLV
FT                   TLAKQEHAVAIAHGCTGKGNDQVRFEVAIHALAPDIKIEAPVRDWHWSREEEIDYAKEH
FT                   NIPVPINLDSPYSIDENLWGRANECGILEDPWQGAPADAFDRTKALADTPDTPTTLEIT
FT                   FEAGVPVALDGESLNLADLIIKLDQIAGEHGIGRIDHIENRLVGIKSREVYEAPAATVL
FT                   LKAHKDLEDLTFERELAHFKPIIEQKLADTIYNGLWFSPLMEAMVAFLKQTQQVVNGVV
FT                   RVQLFKGNVITEGRKSPNSLYDTNLATYTSADSFDQQAAVGFIKLWGLPTQVNAQVQAK
FT                   AQAEAKTDKAHA"
FT   gene            646648..648051
FT                   /gene="argH"
FT                   /locus_tag="LPST_C0604"
FT   CDS_pept        646648..648051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="LPST_C0604"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97826"
FT                   /protein_id="ADN97826.1"
FT                   /translation="MSTQKLWGGRFTETGAKYVDDFGASISFDQLLAAEDIAGSLAHVK
FT                   MLKKTGILPAADVDQIVAGLETLAERQKQGELEFSTVNEDIHMNIESLLTEEIGPVAGK
FT                   LHTARSRNDQVATDFHLYLKHQLPLILDRLHELETVLVDKASENVETVMPGYTHLQHAQ
FT                   PISYAHYLLAYYQMFKRDMERFEFNLKHTDISPLGAAALAGTTFPIDREYSAKLLGFSE
FT                   VYHNSLDAVSDRDFVLEFLSNASILMMHLSRFCEEIVSWSSYEFKYISLSDQFSTGSSI
FT                   MPQKKNPDMAELIRGKSGRVYGNLMGLLTVMKGIPLAYNKDLQEDKEGAFDTVTTVLTS
FT                   LHVFTGMLATLTVNEDRMADATTNDFSNATELADYLANKGIPFREAHAIVGKLVLDGLK
FT                   KQRPLQDIPLKEYQSISPLIQEDVYHDLNAKVAVERRHSLGGTGFDQIRQELQRAQTQL
FT                   SAYQSETTD"
FT   gene            648253..648789
FT                   /locus_tag="LPST_C0605"
FT   CDS_pept        648253..648789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0605"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97827"
FT                   /protein_id="ADN97827.1"
FT                   /translation="MFNDHRWGFDWTEFMTGIVFLIAAYFVIKQPQAALLSLVFLFAIA
FT                   AIISGVTTIGGYTKLRRETGLRANFALVFAIIDILVGLLFLFHAPTGVLVLGYVFAFWF
FT                   LIDSIERLTVVSHLRVFGTGYFVLSLILDIISLALGILLVINPMIAVISFNVLVSFYFA
FT                   VFGINAILIAFARRN"
FT   gene            648986..649870
FT                   /locus_tag="LPST_C0606"
FT   CDS_pept        648986..649870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97828"
FT                   /protein_id="ADN97828.1"
FT                   /translation="MAESLQLVIISGMSGAGKTVAVQSFEDLGYFCIDNMPPALLPKFS
FT                   ELVEESGKIKKVALVIDLRSRAFYDEIMDMLANLDNTDFVSTRILFLDASNEELVSRYK
FT                   ETRRSHPLAMEGRVMDGVRKERELLAPLKDRASYVIDTSTLTPRELRESIFDKFETDQD
FT                   ETFHIEMLSFGFKYGLPIDADIVMDVRFLPNPYYIPELKKLTGLDKPVADYVMQQPATE
FT                   AFYQQFLSMLESIMPGYEAEGKSSLTIAIGCTGGQHRSVALTQRIGEALAKHYKVHISH
FT                   RDIEKRKETVNRS"
FT   gene            649867..650868
FT                   /locus_tag="LPST_C0607"
FT   CDS_pept        649867..650868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97829"
FT                   /protein_id="ADN97829.1"
FT                   /translation="MRKYTFKTQRPKIVVIGGGTGLPVVLNGLRKQAVDITAVVTVADD
FT                   GGSSGIIRNYVNVVPPGDIRNVMVALSSWPDLYKDIFQYRFQGDDQFFAGHAIGNLIIA
FT                   ALTEMKSGVFDAVQELSNMMQVDGHVYPAANEALTLHGKFSDGTELVGEAEITAAHKSL
FT                   ERVWVTDKNGKEPQAVQPVIDAIMAADQIVLGPGSLFTSILPNLTIGNIGRAVCESDAE
FT                   VVYICNIMTQKGETDNFSDADHVRVLNRHLGQNFINTVLVNTEKVPEDYMDFHKFNEVS
FT                   KQVSHDFRGLREQNCRVISSNFLKLRDNGAFHDGDQVVAELMNLVGHSDVFR"
FT   gene            650881..651813
FT                   /locus_tag="LPST_C0608"
FT   CDS_pept        650881..651813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97830"
FT                   /protein_id="ADN97830.1"
FT                   /translation="MSYASDVKKELTNLAVHRENAKAELMALIRMNGAISIANHHFILN
FT                   IQTENPAIARRIYRLLKQFYDVDSELIVRRKMKLNKNNLYIVRLKTGTDMVLADLGILK
FT                   DYQIVEVAPTEVLTDDAAVRSYLRGAFLAGGSVNNPETSRYHLEIYSLYEEHNHMISEM
FT                   MNQYGLNSRTTDRRGGFITYIKEAEKIADFLSLVGATNAMLKFEDIRIMRDMRNSVNRL
FT                   VNCENANMDKVANASSKQIENILLIDATVGLQQLPPKLQEVAVARLEHREVSLKELGTL
FT                   VPGGPISKSGINHRLRKINQFAEQLQKDA"
FT   gene            652238..653890
FT                   /locus_tag="LPST_C0609"
FT   CDS_pept        652238..653890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0609"
FT                   /product="lipoprotein precursor, peptide binding protein
FT                   OppA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97831"
FT                   /protein_id="ADN97831.1"
FT                   /translation="MKKRSVLAVVMSLVLVTVLAACGKHNSQSSGNGKYASSQVLNLSY
FT                   PSSLDSIDISNMSGYGSTGNIFESLYRLGKNGSITPGLAKSTKVSKDGKTYTFTIRNAK
FT                   WSDGSKITAQDFVYSWKRTVTPATKSQYAYLFSGVKNADEIVAGKKSPSTLGVKAQGEH
FT                   TFIVTLDKPITYFKKLMTYPLFGPISEKAVKKWGNKYATKAQYMLYSGPFKLTGWTGTN
FT                   NSWQFVKNNQYWDKKAVHLQKINYTVNESTTTTLNLFQEKKLDLTQLASEQVKNMKSSS
FT                   DYTTYPYSITAFLVYNFQDSNATIKKALNNAKIRQAISLSINRKTLVKNVIGDASTVSK
FT                   TFVPQDLVKDAKTGKDFADESTVKNSTSYNKALAQKLWKQGLKETGIKKLSIQLLASND
FT                   EPNKPISQYLKSALEKNLDGLTVNLSNIPSKVASSRAQSGDFDLYLSGWGADFNDPISH
FT                   LQIMTNNSGYNYGKYNSSTYNALVNKAQNQDANDTSARWQDMINAEKTIMKDQGITPLY
FT                   QTVYSYLQNPKVKGIIHNTAGTQWNYKYAYIAK"
FT   gene            complement(654102..655076)
FT                   /gene="serA2"
FT                   /locus_tag="LPST_C0610"
FT   CDS_pept        complement(654102..655076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA2"
FT                   /locus_tag="LPST_C0610"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97832"
FT                   /protein_id="ADN97832.1"
FT                   /translation="MTKVFIAGQLPAQANTLLLQSQLVIDTYTGDNLISHAELIRRVAD
FT                   ADFLITPLSTQVDQDVLDHAPHLKLIANFGAGTNNIDIAAAAKRQIPVTNTPNVSAVAT
FT                   AESTVGLIISLAHRIVEGDHLMRTSGFNGWAPLFFLGHNLQGKTLGILGLGQIGQAVAK
FT                   RLHAFDMPILYSQHHRLPISRETQLGATFVSQDELLQRADIVTLHLPLTTQTTHLIDNA
FT                   AFSKMKSTALLINAARGPIVDEQALVTALQQHQIAGAALDVYEHEPQVTPGLATMNNVI
FT                   LTPHLGNATVEARDGMATIVAENVIAMAQHQPIKYVVNDVTPA"
FT   gene            complement(655235..655825)
FT                   /gene="clpP"
FT                   /locus_tag="LPST_C0611"
FT   CDS_pept        complement(655235..655825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="LPST_C0611"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97833"
FT                   /protein_id="ADN97833.1"
FT                   /translation="MYPVPTVIEQSSRGERAYDIYSRLLKDRIIMLSGPIEDNMANAII
FT                   AQLLFLDAQDSGKDIYLYINSPGGVVTAGLAIYDTMNFIKSDVQTIVMGMAASMASVLA
FT                   SSGTKGKRFALPNSEILIHQPSGGAQGQQTEIEIVAEEILKTRKKINQILADNSGQSVE
FT                   KLNHDTERDNYLSAQEAKDYGLIDDIMENNKLK"
FT   gene            complement(656642..656716)
FT                   /locus_tag="LPST_Ct0009"
FT   tRNA            complement(656642..656716)
FT                   /locus_tag="LPST_Ct0009"
FT                   /product="tRNA-Arg"
FT   gene            656799..658136
FT                   /gene="rpoN"
FT                   /locus_tag="LPST_C0612"
FT   CDS_pept        656799..658136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="LPST_C0612"
FT                   /product="RNA polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97834"
FT                   /protein_id="ADN97834.1"
FT                   /translation="MALGPGFRQQQRQSQKLAMTQRLQQSIQMLQFNVEELRDFLTQKA
FT                   LENPLIDVDTNWNNNHASLNAAKNVTTKADFIERVSTSNQHSLFEYLLDQIHLTMRDTH
FT                   LRQIVLYLIEYVDVNGYLRIDERQVRQETKATPIELLDAITLLQQLDPPGVGARSLQEA
FT                   LMLQTENDDHAPNLAYIVLEESFDELVNRQWDLLAKKYQVTLADISSIYDYVRTLTPVP
FT                   GAAIGQETTGYIFPDLVVTNQGGQLALRTASMAQPVVKFRSRYYQQMGQHDDQEVTEYL
FT                   KEKKSEYDWIANSLQQREATIFRVGTAIIERQADFFLEKTTDLRPLLLRDVAQQLKVHE
FT                   STISRSINGKYIQTDFGMFELKRFFTKAVSKRPTGGKIVSADSVQHRIVTLIEQENKEK
FT                   PLSDQKIVQILNAENVELSRRTVAKYRENLNIPSSSRRKQYLRTER"
FT   gene            658353..659384
FT                   /gene="cggR"
FT                   /locus_tag="LPST_C0613"
FT   CDS_pept        658353..659384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cggR"
FT                   /locus_tag="LPST_C0613"
FT                   /product="central glycolytic genes regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97835"
FT                   /protein_id="ADN97835.1"
FT                   /translation="MHSDIQWIEAIAPDMVDMLSRRYLVLRTINWMAPVGRRLLAQTLG
FT                   VSERTLRTETDTLRKLDLIMTNKSGMQVTQQGQDVLVGLSHFMDELMGIRQKERQLAQY
FT                   FNIKRCIIVSGDSDRQLKVIGTMGEEVNQLLQQLLPEGRNIIAVMGGHTMEHVASHLTN
FT                   KLGDKRDLLFVPARGGVGESVAIQANTIASQMAQHTGGKFRSLFVPEQVSERTYEPLLK
FT                   EPSIQEVLAIIGQANVVVHSIGEAISMAHRRNMSEDQIKVLRSREAIGEAFGYFFDKKG
FT                   NVVYRIPRIGLQIGELAHREIILAIAGGASKATAIAAYMKNIAPKQTCLITDEGAANLI
FT                   LKK"
FT   gene            659451..660473
FT                   /gene="gapB"
FT                   /locus_tag="LPST_C0614"
FT   CDS_pept        659451..660473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapB"
FT                   /locus_tag="LPST_C0614"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97836"
FT                   /protein_id="ADN97836.1"
FT                   /translation="MSVKIGINGFGRIGRLAFRRILELGEKSSDIEVVAINDLTSPALL
FT                   AHLLKYDSTHGTLNADVSATDDSIVVNGKNYRVYAEPQAQNIPWVKNDGVDFVLECTGF
FT                   YTSKAKSQAHLDAGAKRVLISAPAGSDLKTIVYNVNDDILTADDRIVSAGSCTTNCLAP
FT                   LAFFENKEFGIKVGTMTTIHAYTSTQMLLDGPVRGGNFRAARAAGVNTIPHSTGAAKAL
FT                   GLVIPELNGKLQGHAQRVGVVDGSLTELVAILDKKVTADEVNAAIKKHTEGNESFGYND
FT                   DEIVSSDVIGTTFGSIFDPTQTEVTSDGDNQLVKTVAWYDNEYGFTCQMVRTLLKFATL
FT                   "
FT   gene            660594..661796
FT                   /gene="pgk"
FT                   /locus_tag="LPST_C0615"
FT   CDS_pept        660594..661796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="LPST_C0615"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97837"
FT                   /protein_id="ADN97837.1"
FT                   /translation="MAKLIVSDLDVKDKKVLIRVDFNVPIKDGKIGDDNRIVAALPTIK
FT                   YVIEHDGKAILFSHLGRIKSEDDKKGLSLRPVAERLSNLLNKPVTFVPVTEGEQLETAI
FT                   NNMNDGDVLVVENTRFEDVVNGEQVKRESGNDPELGKYWASLGDVYVNDAFGTAHRSHA
FT                   SNVGIASNMDQVAAGFLMEKEIKFLGDAVDNPKHPFVAILGGAKVSDKIGVIDHLISKA
FT                   DKIIIGGGMTYTFYAAKGMGIGNSLVEKDKIELAKSIIEKAGDKLVLPSDSIVAEKFDN
FT                   DVPSKVVEGSIPDGYMALDIGPKSIEEFEDVLRDAKTVVWNGPMGVFEMSNYAKGTLEI
FT                   GKFLGTLSDATTIVGGGDSTAAVKQLGVGDKLTHISTGGGASLEYLEGKELPGIAAISE
FT                   K"
FT   gene            661823..662581
FT                   /gene="tpiA"
FT                   /locus_tag="LPST_C0616"
FT   CDS_pept        661823..662581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="LPST_C0616"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97838"
FT                   /protein_id="ADN97838.1"
FT                   /translation="MRTPIIAGNWKMNKTASEALAFVNAVKDQLPDPSKVESVVAAPAL
FT                   FLQEMVEAAKGSDLKIAAENAYFEDAGAFTGETSPAALADLGVDYVVIGHSERRGYFHE
FT                   TDEDINKKAHAIFKNGMKPIICCGESLEQREAGEAESWVSGQIKAALKDLSADQVSSLV
FT                   IAYEPIWAIGTGKTATSDQAEEICAVVRKTVADLYSQEVADKVRIQYGGSVKPANVNEL
FT                   MGKDDIDGGLVGGASLQPDSFLELVNYQNN"
FT   gene            662663..663991
FT                   /gene="eno"
FT                   /locus_tag="LPST_C0617"
FT   CDS_pept        662663..663991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="LPST_C0617"
FT                   /product="phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97839"
FT                   /protein_id="ADN97839.1"
FT                   /translation="MSIITDIYAREVLDSRGNPTVEVELYTESGAFGRGIVPSGASTGE
FT                   HEAVELRDGDKSRFMGKGVTKAVDNVNKLIAKEIVGYDVTDQRAIDQAMIKLDGTPNKA
FT                   KLGANAILGVSIAAARAAADELEMPLYNYLGGFNAHVLPTPMMNVINGGAHANNDVDFQ
FT                   EFMIMPVGASSVKEAIRMGSETFHNLKAILNERGYSTAVGDEGGFAPDLKNNEEPFEIL
FT                   VEAIERAGYKPGKDIAIAFDCAASEFYNEETGKYDLKGEGENGQSFTAEEFVDLLDSIV
FT                   DKYPIVSIEDPLDENNWEDWQMATAKLGKKVQIVGDDLFVTNTDYLAKGIKMGVANSIL
FT                   IKVNQIGTLTETVEAIEMAKEAGYTAIVSHRSGETEDTTIADLVVAMNAGQIKTGSMSR
FT                   TERIAKYNQLMRIEDQLESTSEYKGIHGFYNLDEAARNTITSK"
FT   gene            664283..665014
FT                   /locus_tag="LPST_C0618"
FT   CDS_pept        664283..665014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97840"
FT                   /protein_id="ADN97840.1"
FT                   /translation="MAAHFTVGPTQIAIFPPSEVIPQTRAYYQAERFGLTRMARLSLGA
FT                   PRLLHAGFIFDKYQFYYVIYQPLQGLTLTEFCATAKPLAKSTLGRQIGTMLTRLNTEVP
FT                   AFGPTAAQSTEWDTLGPDFVAERTAWLQVHTVTPNQFVHGNLVGENLIVTSGELGLQRF
FT                   SAAHQAAKQTELVPLILQAFNDDTDLLAGFKETYQTDDLEKDLLLGLLLRVDGPQQIQA
FT                   LHPGAPVTLAAVQQVIAQRLS"
FT   gene            665031..666584
FT                   /gene="eriC"
FT                   /locus_tag="LPST_C0619"
FT   CDS_pept        665031..666584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eriC"
FT                   /locus_tag="LPST_C0619"
FT                   /product="chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97841"
FT                   /protein_id="ADN97841.1"
FT                   /translation="MVAQRPHIAKQHFDFTRFSSIGRALIVGVIAGIVVSIFRFSIEQG
FT                   LRFVQWVYAQIHTNWLLLFPWIGLSVAVAFFVGWLVKNEPNIKGSGIPQVEGQLAGELD
FT                   YSWWSVLWRKFVGGILGIGSGLFLGREGPSIQLGATIGQGVASKLKQTGSDRRSLIAGG
FT                   AAAGLSAAFNAPIASTLFVLEEVYHNFSPIIWTTALVSAMASNFISLNFFGLVPVLHIP
FT                   YGHNLPLSQYGNLIGLGIFLGIFGYLYQNVTLTMPNWYAKLRLPSWLDGLVPFLLVIPI
FT                   GLMWPQLLGGGNAVILNLAAVTPALLALLGIFVLRFTFSTISYGSGLPGGIFLPILSLG
FT                   AILGAIYAQFMVAVGWMPTNLIPNFIIFAMAGYFAGIGKAPFTAILLITEMVGTLHHLM
FT                   PLAVVSMTAYLVVDLLGGAPIYEALLEKLIQPRLPEHSGIQDRLELPIFEGSKLEGHQV
FT                   RDFKWPAESLLIAIRRGERQVIPHGDTLMRAGDTLIILTDRDNRAWVRHQIAHLTVATP
FT                   "
FT   gene            666744..666920
FT                   /gene="secG"
FT                   /locus_tag="LPST_C0620"
FT   CDS_pept        666744..666920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="LPST_C0620"
FT                   /product="preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97842"
FT                   /protein_id="ADN97842.1"
FT                   /translation="MMQPSKTNDAMSSLTGGADDLFAKQKPRGFEAFMQKVTVVLGIAF
FT                   FILALALAWYSSK"
FT   gene            666969..667718
FT                   /locus_tag="LPST_C0621"
FT   CDS_pept        666969..667718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0621"
FT                   /product="carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97843"
FT                   /protein_id="ADN97843.1"
FT                   /translation="MMLKQPEPFFFEHGQHAVILLHAYAGSANDVRMLARALEREDYTV
FT                   YGPQFSGHATDDPRDILAQTPAQWWQDTQQAISFMRQKGYTKISIFGLSLGGIFATAAL
FT                   ERDPQLLGGGTFSSPLFAGNRSDVAEMFITLSHHQLAHSQFSIAEREQILMTLPELVQR
FT                   QLQAVNTFTTTEVTSHLSAVTQPFFIGQGGQDELIDATVARQLRDQLPQVPVDFHWYAD
FT                   AGHVITVNSAHHQLEQDVLTYLKTIYK"
FT   gene            667727..670141
FT                   /locus_tag="LPST_C0622"
FT   CDS_pept        667727..670141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0622"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97844"
FT                   /protein_id="ADN97844.1"
FT                   /translation="MSEANLQEQILTFLQAHPDRTYSVEQLTDELHFTGATAFTFLVKE
FT                   LANMERKKLVSTDDHDHFKLVQETKTVEGSFHGNDKGFGFVRYDPDLPDIYINPDNTQF
FT                   AITGDDVAVEIIRPARPGSDRGPEGKIVSIVKRDYTQIVGAYTPSTDEDGIIGSVEIKD
FT                   KKLSKYQLLITDQGLHPTEGEVIIAEVAAYPDAQHPTRMIGIAKQVIGSVDDPGMDVLQ
FT                   VVYQHDVPSVFPEEVTDEANRIPDYVTDEEKVGRVDITDQPLVTIDGAESKDLDDAVVA
FT                   WRLPNGNFHLGVHIADVSHYVTENSELDREAFKRGTSVYLTDRVIPMLPRRLSNGICSL
FT                   NPDVERLAMSCEMEIDQTGEIVNHKIFQSVIRSHARMTYDAVNQILEAHDPKTREKYAD
FT                   LVDMFDTMGDLHRILYKHRRHRGAIDFDDNEAKIIVDEAGHPIDIQLRVRGLAERMIES
FT                   FMLAANETVAKNYSQLKVPFIYRVHETPDSDRMLSFFEFVTNFGVSVKGSSKDVKPKML
FT                   QDVLKKVAGKPEEAMVSVMMLRSMKQARYADQSLGHFGLAAPYYTHFTSPIRRYPDMMV
FT                   HRLIRHYAENGTGEEARARYRDNLPNIAETTSDHERRGIDTERDVDSMKKAEYMADHVG
FT                   ETFEAVVDSVMKFGLFVELENTVEGLVHISTMDDDYYEYVEKQLALVGRKTKRTFRIGQ
FT                   PVKVQLMRVDKDQREVDFKLLNPEEAPKTDLLPKREHHDNYRGNNRRGGNNGNYRRNGN
FT                   NNNRNNDHRGGHNNNHRNGNSNGRRNNNNHNSNNNNHSTNNNRRSSTDRRR"
FT   gene            670167..670637
FT                   /gene="smpB"
FT                   /locus_tag="LPST_C0623"
FT   CDS_pept        670167..670637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="LPST_C0623"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97845"
FT                   /protein_id="ADN97845.1"
FT                   /translation="MAKQHGKHPDTALAQNRKARHDYAVEETYEAGIALTGTEIKSVRD
FT                   RRVNLKDGFVQVRNGEAWMQNVHISPFKEGNRYNVDPLRSRKLLLHKKEISKLGAATMT
FT                   KGVTIIPLKMYLKHGFAKVLIGVAHGKREYDKRQDIKKREQQRQIDRVMKHY"
FT   gene            672849..678809
FT                   /locus_tag="LPST_C0624"
FT   CDS_pept        672849..678809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0624"
FT                   /product="cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97846"
FT                   /protein_id="ADN97846.1"
FT                   /translation="MALYNGVDNPADTITWVWETSPSYADFTSKNVTGLIAGPKTTWRV
FT                   ADSVATLKDVNGTDIYATADTVVKVISVNGDTAVTTVDTQTAGTYQVDLQYTDAYGKVW
FT                   QQTSTVAVAVNQGKLVGKPLAIKMGAKPTYTINDLIDTDNSRNAAGDKLSADELATATV
FT                   TGLDTSKAGAQTVTLAYTDDATGMVHTTTTTVTMVATKADLTMRNSTIIKGSKNSSWDY
FT                   RQYVTSVTDFDGNPVSLDGLNIVVDQQPDLTQIGSQTVTLTYTDALGNVISVPTQVTVV
FT                   ASQAQVTTKAPLTIWPSEVAQLKVADLVTITAANGNPVDTSTNLTDVTMSSIDTSKGGA
FT                   QTVTITYTDEAGNLVTAYAKVTVDQSDLKTKLTNPIAGPKAKWDYLAGLEWVKDANGKL
FT                   LDNLATADIKVVTEPDLSVAMVGHDQTVTLSYTDELGKEHLVTAVVNTVASKAKITAVS
FT                   DQIIIPDEAKKLTATDLVSELIDAAGNKATNFDDVTMSGFDAKAIGPQTVTLTYSDAYG
FT                   NQTTDSTTVTVDFATITGQATHPIAGPTATWDYRDSVTQVIDANGKIIDVGDADITATT
FT                   PDLTPAKVGKPQTVTLTYTDSLGKVHTTDVIVTTTLSKAKITAVADQIIIPDEAKKLTA
FT                   TDLVSELIDAAGNKITNFDGVTMSGFDAKAIGPQTVTLTYSDAYGNQTTDSTTVTVDSA
FT                   TLTLQNHTQVAGPKATWNYADNIKAITDSKGQSLTLSDAKITVVQRPDLSVAGTYKIVL
FT                   EYTDDLGQAHTETADVEVTASKAAITAVSKQVILAEKATMVTASSLVSTLYDADGVQIY
FT                   NFDDVTMSGFNAKVIGPQTVTLAYTDAYGNQTTVSTTVTVDFATLTLQNHTQVAGSKAT
FT                   WNYADNIKAVTDSKGQSLTLSNAKITVVQHPDLSVAGTYKIVLEYTDDVGQVHTETANV
FT                   EATASKAAITAVSKQVILAENANMVTASSLVSALYDADGVQIHNFDDVTMSGFDPKAIG
FT                   PQTVTLTYTDAYGNQTTAQTTVTVDFATITGQATHPIAGPTATWDYRDSVTQVIDANGK
FT                   TIDVDTADITATTPDLTPAKAGKPQTVTLTYTDSLGKIHTTDVIVTTTLSKAKITAVAD
FT                   QIIWPDQAKQLTATDLVDRLYDAEGHLITNRDNVKMSVLDSKLAGQQRLTLTYTDVAGN
FT                   QSVAYANVTVDQAKLVTKPSTVIAGPTATWSYEAGISQLTNAAGQLITVQPGTIKVLNR
FT                   PDLNVDSVGQQQLITLIYTDELGKSQSVTAMVTAEASQAMLTAKAAVIVQPDAAAKLTA
FT                   NDLVTSLTDASGQQVTDYQIVRMSKLDATWPGVQPVSLTYTDAAGNEVSTVVKVTVDQA
FT                   KIDSQNRTQIWGPSMTWDYRQQLATVTDSQGHQFNPDQAKITVITGPQLTAKMIDKPQT
FT                   VTLMYTDDLQQTHTVSATLTLTASQAALVPRPAQIVWAKDSGLLTPANFLQTITGADGT
FT                   QVSSLTNVKMSAVDASQPGAQTVTLTYTDDYGNEVTTTAQVTVDQAALTTQTARPVAGP
FT                   TAHWDYQTNFKTVTNAAGEVINVGDANLKVLTGPDLSTAMVGRPQVVTFSYTDELGLTQ
FT                   TTTAEVTTVASRAHMTTSADQVIWPAVVGKLTVADLVTGLTDAWSQPIAVNNAAITVVA
FT                   MPDLTVAHIGQPQTVQLVYTDSLGQQQTALVQVTTVATQAKISTRPVTVIAGPKTTWSL
FT                   NDSVDWSTSLAADGTLLTAAQRQRVTVDGTLNLRRASNYPLTLSYMDRAGNLITVTTSI
FT                   NVLASQAQLQVRDSQLTVGNAWTAQDNFERATDAQGQALTLADIAVDGTVNTQRAGQYT
FT                   LTYHYTDVAGNQLTKTAVVTVVLPEDDHINTTDPDNNDHGETTNPDNNDHAGIADPSET
FT                   PKPSERPNDSDGHTVDWGVDDRITTKQQPAAATRAQTKVKTTAEPALPANNEHTSAAKA
FT                   AATPVTRVTDTTADTLPQTGERDRSAQQGAVVLGLTGLLGLMGLGRRRHTHED"
FT   gene            679202..680638
FT                   /locus_tag="LPST_C0625"
FT   CDS_pept        679202..680638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0625"
FT                   /product="glutamine ABC superfamily ATP binding cassette
FT                   transporter, substrate binding and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97847"
FT                   /protein_id="ADN97847.1"
FT                   /translation="MRKWQVAVVMLLAALGSWFAIGTQAQAKTYTIATDTTFAPFEFQV
FT                   KGGKYKGIDIDILKAIAKKENFNYKLKALSFGAAVQQLSANQVDGVIAGMNITAERKQT
FT                   FDFSDAYYTSGVVMAVAKDSKVKTFKDLKGKTVALKTGTAGATYAKSIQSKYGFKIKYF
FT                   NDSNNMYNDVKVGNSAACFEDYPVMSYGIKNGIALKIVSKQHEAGDYGFAVKKGKNAEL
FT                   LKKFNAGLKAIKADGTYKKIINKYLKSSEASLTGEDASSRTFIGLFTQNLDTIGSGLWM
FT                   TLELTVISIILATILGLILGVLGVMPGKLGPAISSTIIYIFRGMPLMVLAFFIYIGFPD
FT                   LIGHGFKIPAFVAGMITLMLNEGAYTGAFVKGGFAAVDDGQMEAARSLGLPYWTAMRKV
FT                   IMPQGIRIMIPSFINQFIITLKDTSILSVIGIVELTQTGTLIIARNFEGFKIWLMIAII
FT                   YLIIITLLTWLSNWVQRRIN"
FT   gene            680641..681375
FT                   /gene="glnQ1"
FT                   /locus_tag="LPST_C0626"
FT   CDS_pept        680641..681375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ1"
FT                   /locus_tag="LPST_C0626"
FT                   /product="glutamine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97848"
FT                   /protein_id="ADN97848.1"
FT                   /translation="MAKVIVKDLHKSYGDNEVLKGLNLEVQDNEVVCMIGPSGSGKSTF
FT                   LRCLNDLEVPTQGQVVISGYDLSDKGTNINLVRENIGMVFQHFNLFPHLSVLQNITLAP
FT                   TQLKKESQQEAEKTARDLLATVGLSDKADAMPKSLSGGQKQRVAIARALAMHPKIMLFD
FT                   EPTSALDPEMVGDVLDVMKKLAADGMTMIVVTHEMGFAKEVADRVVFMADGLIQETGKP
FT                   EDVFEHPQSPRLQDFLQKVINV"
FT   gene            complement(681649..682212)
FT                   /locus_tag="LPST_C0627"
FT   CDS_pept        complement(681649..682212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97849"
FT                   /protein_id="ADN97849.1"
FT                   /translation="MRKLYFSRNSFAQGARIVRDAHNQSHYLLVGRWGRRQDALSLYAI
FT                   QGELLAEIRQTTLGLLPKFDLYYNRQNVGSISKTLGFWHEMLYVRKLRWIIMGSLSAEN
FT                   YRVYHGTELIMTMRPVVTTNGEAFELAITDQSTEPLCICIAAILDHWQKPTNRARTPIA
FT                   KKGLNVSFGESNYTLTPRNKVPQH"
FT   gene            complement(682236..683105)
FT                   /locus_tag="LPST_C0628"
FT   CDS_pept        complement(682236..683105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0628"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97850"
FT                   /protein_id="ADN97850.1"
FT                   /translation="MISIIASDMDGTLLNNEMVVSDFNANAIRQAQQQGVHFIVSTGRR
FT                   FSEAQPLLAAQGITAPLITLNGAEVYDASGKMLDMVPITNSVARTVFHTLTSQGYYFEV
FT                   VGNDGIYSNSKAKRIEQIAHLLTNLNPDTTFKIAVSLASARLELMDINYVDNYNELLDD
FT                   PTKHVMKIIAFSEEGPAKLKPLSDEILAKHSSLKITSSSASNIEINNINAQKGIAVERY
FT                   ANMLNTPMSDVMAIGDNNNDVSMLELAGVSYAMGNASPEVKQLARYITDTNVNDGVGKA
FT                   ILEVLAKQ"
FT   gene            683221..683913
FT                   /gene="ung"
FT                   /locus_tag="LPST_C0629"
FT   CDS_pept        683221..683913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="LPST_C0629"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97851"
FT                   /protein_id="ADN97851.1"
FT                   /translation="MKAFIHTDWWDVLKPEFEKPYYHQLHEFLKNEYRTKNIHPDMYNI
FT                   FQAFEWTPFADTKVVILGQDPYHGPGQAHGLSFSVLPGVAVPPSLVNIYKELQDDVGCT
FT                   PVNHGYLESWAKQGVLLLNSVLTVQNGVAFSHAGKGWERLTDVAIQRLSERSTPVVFIL
FT                   WGKAARSKIKLIDTQTNVVLQAPHPSPLSAYRGFFGSKPFSKTNIALTSFGEQPINWQL
FT                   PEHVNLEH"
FT   gene            683937..684914
FT                   /gene="eutD"
FT                   /locus_tag="LPST_C0630"
FT   CDS_pept        683937..684914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutD"
FT                   /locus_tag="LPST_C0630"
FT                   /product="phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97852"
FT                   /protein_id="ADN97852.1"
FT                   /translation="MDLFESLAQKITGKDQTIVFPEGTEPRIVGAAARLAADGLVKPIV
FT                   LGATDKVQAVANDLNADLTGVQVLDPATYPAEDKQAMLDALVERRKGKNTPEQAAKMLE
FT                   DENYFGTMLVYMGKADGMVSGAIHPTGDTVRPALQIIKTKPGSHRISGAFIMQKGEERY
FT                   VFADCAINIDPDADTLAEIATQSAATAKVFDIDPKVAMLSFSTKGSAKGEMVTKVQEAT
FT                   AKAQAAEPELAIDGELQFDAAFVEKVGLQKAPGSKVAGHANVFVFPELQSGNIGYKIAQ
FT                   RFGHFEAVGPVLQGLNKPVSDLSRGCSEEDVYKVAIITAAQGLA"
FT   gene            685024..685485
FT                   /locus_tag="LPST_C0631"
FT   CDS_pept        685024..685485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0631"
FT                   /product="ATP/GTP hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97853"
FT                   /protein_id="ADN97853.1"
FT                   /translation="MESITVTSPEATMAIGAKLGQLVQPGDLILLDGDLGAGKTTFTKG
FT                   LAKSLGIPNNVKSPTFTLIREYRQGRLPLYHMDVYRLEDGGAEDLGLDEYFDGDGVSVV
FT                   EWSQFIADLLPTTYLRIAISRDTDADDQRVITFKPIGEHYQRLVDQLKE"
FT   gene            685491..686006
FT                   /locus_tag="LPST_C0632"
FT   CDS_pept        685491..686006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0632"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97854"
FT                   /protein_id="ADN97854.1"
FT                   /translation="MAEEVVDVRPAEVADAAQLLALLAQLGRESNTFTVDEGIEDLSET
FT                   DEQAQIERINGTTTNIIFVATLDSRLIGVSTVQASTDFSAAQGEVGVAVLKEFWGMGLG
FT                   TALIEEVLDWARNYSSLERLVLTVQLRNVRAVKLYQHLGFENCTATSYDVVDPTGKRVP
FT                   AIDMGIWV"
FT   gene            complement(686230..686751)
FT                   /locus_tag="LPST_C0633"
FT   CDS_pept        complement(686230..686751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0633"
FT                   /product="DNA-directed DNA polymerase III, epsilon chain
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97855"
FT                   /protein_id="ADN97855.1"
FT                   /translation="MDFETANAKRDSACSLALTVVRNNQISDEFYTLIKPESDFFWRNV
FT                   QIHGIHEADVADAPKFPDVWQHIEPFFQRDRLVIAHNAPFDIGVLRNTLAHYGISAPEY
FT                   LSMDTVNTSQRFYPELPNHKLDTVCQALDIDLQHHHNALDDSLACANILLTEAQAFGTE
FT                   QLKPFVRVQG"
FT   gene            complement(686829..687593)
FT                   /gene="exoA"
FT                   /locus_tag="LPST_C0634"
FT   CDS_pept        complement(686829..687593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="LPST_C0634"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97856"
FT                   /protein_id="ADN97856.1"
FT                   /translation="MKLISWNVNGLRAAVKHGFVTTFNELDADFFCVQETKLQAGQIEL
FT                   DFPGYYQYWNYAERKGYSGTAIFTKHEPLNVTYGIGVPEFDDEGRVITLEYADYYVLTC
FT                   YTPNSGGELKRLDYRQQWEDAFLTYINSLSANKPLIFCGDLNVAHENIDLKNWHSNHHS
FT                   AGFTDEERTKFDRLLAAGYTDTFRHFYPDQTDIYSWWSYRGHARDNNSGWRIDYFITSQ
FT                   QLDSQLLNARIHNEIFGSDHCPVELDIILPNH"
FT   gene            687915..688817
FT                   /locus_tag="LPST_C0635"
FT   CDS_pept        687915..688817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0635"
FT                   /product="oxidoreductase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97857"
FT                   /protein_id="ADN97857.1"
FT                   /translation="MLKIGVIGLGNIAQKAYLPVMAAMQDQYEFHLTTRNPEKRAQLAT
FT                   MYGLQHTHATLEELMAVKPAAVFVHTPTDTHAAIIKQLLLAGIHVYVDKPVATDLQVVQ
FT                   SLYDLAAARHLLLTCGFNRRFAPFNQQLKALPDKRMLVAEKVREVGSQDPETAVFDLMI
FT                   HMVDTGLFLLDEPLEHTSGRLTTTATGALAQGYLTVQTAHEQLEVITNMYGGVNLEQVT
FT                   VQTTGQRAIVTDLSTKTVMATATTTTTAFPDWTPTLEKRGFAPLIRAFLTAVTTHGPNP
FT                   IAPTSAITSHAVCRHLLSD"
FT   gene            688989..689897
FT                   /gene="murB"
FT                   /locus_tag="LPST_C0636"
FT   CDS_pept        688989..689897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="LPST_C0636"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97858"
FT                   /protein_id="ADN97858.1"
FT                   /translation="MTKDVLATFPAIEIKKNESLSHYTNTKTGGPADYVAFPKSISETK
FT                   ALITFANEQNLPLTVIGNASNLIVKDGGIRGLTIILTRMKQIHASGTKVVAEAGAAIIA
FT                   TTKVACGASLTGLEFAAGIPGSVGGAIFMNAGAYGGEMSEVVETVTVLTPAGQLKTLDH
FT                   DELDFGYRHSTIQDYDDIVVSVTFGLKPGNQTKIQARMDELNTLRAAKQPLEWPSCGSV
FT                   FKRPTGYFTGKLIHDAGLQGHRIGGAEVSKKHAGFIINVDHATATDYMDMIHYVQKVVF
FT                   ERFGVHLQTEVRIIGEDVVQG"
FT   gene            690096..692060
FT                   /locus_tag="LPST_C0637"
FT   CDS_pept        690096..692060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0637"
FT                   /product="Na(+)/H(+) antiporter (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97859"
FT                   /protein_id="ADN97859.1"
FT                   /translation="MLVFIAPMLYNDGREFPKQELWELRGAIFANAIVLVFITTILGGF
FT                   LIHVLIPTIPLAVGIALAAILSPTDPIAVQSISEGVKLPKEILHLVSGESLINDASGLI
FT                   GFKYALAAAVTGTFVLGEAVGDFFYISLVGLAVGLALITIIQLIRDVLRREGINDIVFN
FT                   VVLQILTPFAIYFIAEEWFHASGVVAVVAAGVLSHLQNSHESEDAPELRLVTERVWNVV
FT                   VYLLNGIVFLILGIELPAATQATIKGAHTNTFHAVFDVLIVWGILLLIRVAWTYAYMLF
FT                   NWLRHHKKAKPSLRIAALSGLSGVRGAITMAGVFTIPTVVASGKAFPERALVLFIAAGV
FT                   IIVSLVAAAAILPLMAAKSLPFVTRGSSPDEDDAVLAEGTDDGDDSSGQLPQLTYKQAR
FT                   IYILQLAIQNIEEHRRPANQRAAYDLILDQQFQIRRLEVASQTADELAPMLTDELELRL
FT                   VALNGERAAVREMIANKQTSKLAGQVYLRRVDRREQRFLQATHRQGLPTLRSLRLLLTR
FT                   AMQGIRLWLAPGDSEELRVALLDIQREASKAAIKALSQYLKQANVDEQQFDRQALYHLI
FT                   VHYRNRIENAKNDHTLSRDDYEQQLHGLRIKSLGAERAGVQHLLESGQISLRTAAKLRQ
FT                   FINYSENLLMLNDIEADED"
FT   gene            692199..692711
FT                   /locus_tag="LPST_C0638"
FT   CDS_pept        692199..692711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0638"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97860"
FT                   /protein_id="ADN97860.1"
FT                   /translation="MTESEIHERFVDTYMHILKYVGDFVSVPTRPYKITFEAYTVMRMI
FT                   ATSEEPLTLVKIAKEQRVSRSAIARQINVLLDLKYIEQTTNTHDRRIKYLSLTPAGHKV
FT                   EQEITTASEERFHQWVQVYGEKRASDTLRYINDAEQKATELGFSGFSGLHDKRGRHTEY
FT                   SDPKTKN"
FT   gene            complement(692787..693452)
FT                   /locus_tag="LPST_C0639"
FT   CDS_pept        complement(692787..693452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0639"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97861"
FT                   /protein_id="ADN97861.1"
FT                   /translation="MTKLQRWFVRLAFWGFFIFAAVDLHGAFHFLLLNSILAYVPIELS
FT                   FWLTPRRSPLLFWLIAVIWLLFYPNAPYLMTDLFHLSLLKPYGINGLLRFDLPMWRDFA
FT                   YLVGPMMVSTIIGTWGVDRIAQQLTQRLHFQRLPASRGIICAALFLFASVGVYVGRFLR
FT                   LHSIYLLITPQYIVKQLVEMWSLKMLAFVLMMWLLQLLIYAAWRFTMPTVPYQTPDKS"
FT   gene            693637..694479
FT                   /locus_tag="LPST_C0640"
FT   CDS_pept        693637..694479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97862"
FT                   /protein_id="ADN97862.1"
FT                   /translation="MTFNWSGLLTLQNFVRLLDILAVWFVIYELIVLLRGTKAVQLFRG
FT                   IVVIAIIKAVSVLIGLDTVSWIMDQIINWAVIAMVIIFQPEIRRGLEHLGRGSMFARGK
FT                   RQNEDEERMIAELDKAIQYMAKRRIGALMSIKMDTGLEDYIETGIALDADITGELLINI
FT                   FIPNTPLHDGAVIIQDNQIKVAAAYLPLSESNLIPKELGTRHRAAVGISEVTDALTIVI
FT                   SEETGEVSITKDNELMRGMTRENYLRYFRQVLLTPEDSTKQNALQNWFGRVFGGGPRK"
FT   gene            694476..695453
FT                   /locus_tag="LPST_C0641"
FT   CDS_pept        694476..695453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97863"
FT                   /protein_id="ADN97863.1"
FT                   /translation="MKKFMNSNWSMRLLALLCALVLFAYVNSLKTTHNASILTNSSSKT
FT                   TLTSNRKVTISAPLELNVNSTKYFVTGYPENIKVTIEGPSALVTTTANTQNFKVYANLS
FT                   KLAVGRHSVKVEVDGLNKELSYGLSQKYIHVNIQPRRTATYKVSADFNKANVADGYEVG
FT                   SARLGTSSVKVTGAVSEVSKVAKVVAVVNTNKNLEKSVNQQAIIEALDANGQNLNVVLT
FT                   PSTTSVYIPITQATTTKDVPIDLKASGKTAADTSYSFSSDTKSVTVTGTKAALAKLKSL
FT                   PVNVDVTNVDSTTTKTVDVSTSDEDGISSVSPTSVKVKITVKND"
FT   gene            695485..696840
FT                   /gene="glmM"
FT                   /locus_tag="LPST_C0642"
FT   CDS_pept        695485..696840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="LPST_C0642"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97864"
FT                   /protein_id="ADN97864.1"
FT                   /translation="MKYFGTDGVRGIANSGLTPEMAFRLGRAGGYVLTEHAENKSTQPR
FT                   VLVARDTRISGQMLEEALIAGLLSAGIEVLRLGVITTPGVAYLVRIQDADAGVMISASH
FT                   NPVEDNGIKFFGGDGFKLSDAKEEEIEELLDQPKDTLPRPAAEGLGTVADFPEGNLKYS
FT                   QFLEQTIPDDLSGIHLAVDGANGSTSNLVSRIFADLNVEFDTMATAPDGLNINKGVGST
FT                   HPEALSKFVVEKGAQVGLAFDGDGDRCIAVDELGNIIDGDKIMYICGKFLSERGKLKQD
FT                   TVVTTVMSNLGLYKALEAAGLHSKQTQVGDRYVVEEMLKDGYNLGGEQSGHVVFLDFNT
FT                   TGDGMLTGIQLLHVMKETGKKLSELAAEVTTYPQKLVNVKVQDKKAALNNDKIKAVIKD
FT                   VEDEMAGDGRVLVRPSGTQDLLRVMAEAKTDELVSAYVDRIVDVVKAEVGVE"
FT   gene            697359..699176
FT                   /gene="glmS1"
FT                   /locus_tag="LPST_C0643"
FT   CDS_pept        697359..699176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS1"
FT                   /locus_tag="LPST_C0643"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97865"
FT                   /protein_id="ADN97865.1"
FT                   /translation="MCGIVGVTGKDSAVSILLNGLEKLEYRGYDSAGIYVNDQDGHDYL
FT                   VKEKGRIDDLRKEIGEAVHGSTGIGHTRWATHGEPSVANAHPQVSADGRFYLVHNGVIE
FT                   NFEDLKQTYLSDVSFKSQTDTEVIVQLVDRFVTKEGLSTLAAFRKTLGLLGHSSYGFLL
FT                   MDKEDPDTLYVAKNKSPLLIGVGEGFNVVCSDSLAMLDQTKDFLELHDGEIVVVKPDEI
FT                   KITNQAGEPVERKPFHVDIDAAQADKGTYPFYMLKEIDEQPNVMRKLSQVYLNDAGDPI
FT                   INDDLLTALKAADRLYIVAAGTSYHAGLVGAKLFESLANVPTEVHVSSEFAYNQPLLSA
FT                   HPFFIFLTQSGETADSREVLLNVNDQHFPSLTITNVPNSTLSREATYTLLLHAGPEIAV
FT                   ASTKAYTAQIALQAILAKALGVAVDQPAATAFDVKQQLALVANGMQSLVDEKATFEKIA
FT                   KSALLNTPNAFYIGRGLDYAVSLETALKLKEISYVQAEGFASGELKHGTIALIEKDTPV
FT                   IGIITQKNTAGLTRSNLQEVAARGAKTVTIVTDSLAKDGDTVILPTVDERLTALLSVVP
FT                   GQLLAYYTSLNKGLDVDKPRNLAKSVTVE"
FT   gene            699370..700041
FT                   /locus_tag="LPST_C0644"
FT   CDS_pept        699370..700041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0644"
FT                   /product="diguanylate cyclase/phosphodiesterase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97866"
FT                   /protein_id="ADN97866.1"
FT                   /translation="MVMLKYKYFAQPINNLGTNRTILYELLLRQWDERQQTWRIPATFE
FT                   IAPTELIQLLDCAIQELNNHHVSINLTARQFANPDFQAAISHYVQTHLLPRELTVELVA
FT                   TPELSELQQLSVGYRAAGILLAFDDVGSDNLFQQIKMMLPYVNTVKFALQNMRPLGTPT
FT                   TDAIVSTLKFWFDKAEEQQMLFTFEGIESAADVQLANHLGITRGQGYYFAKPQLPATFM
FT                   A"
FT   gene            700172..700987
FT                   /locus_tag="LPST_C0645"
FT   CDS_pept        700172..700987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0645"
FT                   /product="possible sugar-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97867"
FT                   /protein_id="ADN97867.1"
FT                   /translation="MAINLIATDLNGTLLHQDQRFDKERFKRVLAQLRAINVSLVLSSG
FT                   NQYAHLRQLFKDVMADNLIVVAENGASIYAQDRLIFDGSLSADQQRKFVTVDRYQPLFK
FT                   DAYVILVGSHGSYTELGAPDKLVAMARQFYDHLHLVADLATVDDTVKKISISTSPDQAA
FT                   DLVARANDYFDGELRAHDSGYGVVDLVDQRVGKLPAIQFLATKLGLTAANVMAFGDGAN
FT                   DVPLLRYAAHSYAMCNAPADIQAAAKHVTALDNEHDGVLATIEQELLNN"
FT   gene            complement(701065..701652)
FT                   /locus_tag="LPST_C0646"
FT   CDS_pept        complement(701065..701652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0646"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97868"
FT                   /protein_id="ADN97868.1"
FT                   /translation="MPATDLRVQRTQTALKEAFRTLALKYPRYRDITVKELTSVANINR
FT                   KTFYLHFDSIDDLAETFVQEGADKILALIDPQDFKKNISQPGLIFDRLVTYFRQSEAFH
FT                   RVILLNDDYSFLSRKIHAAVVAGLTTTIQTNYHLSAIDAKVCSSFLIHNNLTFFRLYFN
FT                   GDLGLSLAELKQRLVSLNTYGIHQFFYPNQSL"
FT   gene            complement(701987..703036)
FT                   /gene="galM1"
FT                   /locus_tag="LPST_C0647"
FT   CDS_pept        complement(701987..703036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM1"
FT                   /locus_tag="LPST_C0647"
FT                   /product="aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97869"
FT                   /protein_id="ADN97869.1"
FT                   /translation="MSGSYGSEGIMKIIEHQGNGINYYTLVNNHHMSVTIMDWGATVTA
FT                   IKTHDKDGNFANIVLGFDDGADYITYQSFFGATIARVAGIIKNARWRQYDLTQNAGENH
FT                   LNGGNMPQISFEPWFLERKLHTSDQVGLVMQYITLDGENGYPGTMTITANFVLDNDGKF
FT                   TISYTGKSDKTTLFNPSNHTYFNLSGDAERLIDHHVLKINADEYAALNKHGIPTGKLPW
FT                   VTDTPFDFRDPVEVGPQVANIKGGLHHGFVLNDTPYPQVELLDRISGRKVTMRTNAPAV
FT                   VVSSATNYRDDRYRLNGGKPMRSQLGLSLQAQKLPDAIHHKEFGSIIIEPNIPVTYQTA
FT                   YRFSNIYDV"
FT   gene            703675..704937
FT                   /locus_tag="LPST_C0648"
FT   CDS_pept        703675..704937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0648"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97870"
FT                   /protein_id="ADN97870.1"
FT                   /translation="MSQDHSTKVLLQIKDPNITDLVVQEATNGSLQVLAKLTYPVTVCA
FT                   RCGKRSMVKNGFKTVHIRIPRISERVTILNLKKQRFICKNCGKSSLTTTTLVKKHHQIS
FT                   ENSLHAIDLSLTEDRTMASIAAQYNVSTNTISRRIKLLGQGTQPAFNGLPTMLCIDEFR
FT                   STGKQMSFIAVDAQTHDIITILPGRKNADIKDFFLNHYSKRHRDRVTRVVMDFNSQYQP
FT                   AIRTLFPHAKLVADNFHLVQMALRSLNQTRVQLMKRFNPKSREYRVLKYYWRLYLKDYD
FT                   SLEKRKPQWFAHLKDRMTPEQLVVAGLNLDQQFRQTYQAAHALVKAFQKRDYRSFKAAL
FT                   GHVENVSPQLMTNIKSFIKNRQLIKNMTTGRLSNGPVEGVNRKIKQIKRTAYGYKNWQN
FT                   FIYRIQIEFKIKIEKKNPIRK"
FT   gene            705147..705461
FT                   /locus_tag="LPST_C0649"
FT   CDS_pept        705147..705461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97871"
FT                   /protein_id="ADN97871.1"
FT                   /translation="MQLKNHEVLDLIQEITRNDGTSYMEIGNMLMNGRAELAAERGFIK
FT                   QVRILQLNIPHSTHVAKYEQYINETFTIPDETMDHWEEWTKTPDIQAEVDLILKENHIG
FT                   "
FT   gene            705707..706132
FT                   /locus_tag="LPST_C0650"
FT   CDS_pept        705707..706132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97872"
FT                   /protein_id="ADN97872.1"
FT                   /translation="MKNGALLQFIQSHFQTRFRFRNAFETQLTVQILSRLIGEHPESLL
FT                   LTRRDVEALAGCSLDAPALQREYFPQRAMTLLETALDELVTLSVIIHQDQGRTRYPLFR
FT                   SVQLDQVCQRIVFNLNLDVLPQLTDWSRELQQEQERF"
FT   gene            706133..706885
FT                   /locus_tag="LPST_C0651"
FT   CDS_pept        706133..706885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0651"
FT                   /product="nitro/flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97873"
FT                   /protein_id="ADN97873.1"
FT                   /translation="MTKSVIETLQDHRTRRQFTTEPISDAQFAQIITTAQQMPTSQYLQ
FT                   AYSLIEITQPALRQQLATITTMPTVGENGRLLVVVADQHRNVKLAPGATTRRALSEFDR
FT                   FAGSIEDATLITAAMVMVAESMGLGSVVLGSINNDTQAVIDALHLPDLTLPVFGLQLGH
FT                   PADVPEKKPRLGLPAVLFQDTYAEPASYQAELDRFDGVLNQYYQHRSSHARTEHLAHMT
FT                   QEATHSAAKRREFLTIARQQGFLPELDQ"
FT   gene            707179..708378
FT                   /locus_tag="LPST_C0652"
FT   CDS_pept        707179..708378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97874"
FT                   /protein_id="ADN97874.1"
FT                   /translation="MINANFRKLVLGRAVGNAGDSIYMIAMNWFILQLTNSALWIGIMN
FT                   VAIVLPGVLLFLFGDSIDRHSKRRLLVAVEFSQLVIVVMLIGLVALHIKLPGIYVGLVF
FT                   VAALFGSLAYPIQDTLVPLLVEPDQLVQAQADMSIAYKGTDYVFNALSGFLISLCSVLG
FT                   VLIMDAATFVVTVATFRRIKLAEPRQQHTREKSLYLNQILVGFKIISTDPLLRLLTFAS
FT                   VVMNFFFGGLNTYVVLFGRHFGGSIYYGILESMSAVGILLGMTVVYRQLKKLTVRQSYL
FT                   IGNFGRALFMILTVVSYNQFWLFAIIYLLSFVFQGLTQVFETPMIQATVGSDQLGKVMT
FT                   CFYTLVSVTLPLGSLAFSFLADRFDLRLFLLLFALFYAGIFLLFLASHAFKKVDELQLS
FT                   "
FT   gene            708772..708861
FT                   /locus_tag="LPST_C0653"
FT   CDS_pept        708772..708861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97875"
FT                   /protein_id="ADN97875.1"
FT                   /translation="MADERPLNSAQLVVDYFDTGTLNETLGLP"
FT   gene            709058..709288
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0008"
FT                   /note="hypothetical protein"
FT   gene            complement(709379..710905)
FT                   /gene="glpK"
FT                   /locus_tag="LPST_C0654"
FT   CDS_pept        complement(709379..710905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="LPST_C0654"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97876"
FT                   /protein_id="ADN97876.1"
FT                   /translation="MSAKYIMAIDEGTTSTRTIIFNHAGQKVADAQKEFPQYFPQPGWV
FT                   EHDATEIWNAVSSTIANVLIDANIKPNQIEAIGITNQRETTVVWDKQTGLPIYNAIVWQ
FT                   SRQTAPLAEQLIADGMGDLIHRHTGLVTDAYFSATKIRWILDHVDGAQKRAERGELLFG
FT                   TIDTWLVWKLTGGETHVTDYTNASRTMLFNIHDLQWDQTILNLLNIPAAMLPEVRSNSE
FT                   IYGTTKDYLLYGSQIPISGMAGDQQAALFGQMAFEPGMVKNTYGTGAFTVMNLGEQPQL
FT                   SDHNLLTTIAYGLDGNINYALEGSIFVAGSALQWLRDGMQLIESAPESESLAQQSHNHN
FT                   EVYVVPAFTGLGAPYWDSETRGAVFGLTRGTTRADFVKATLQSLAYQSRDVIDTMKNDA
FT                   NITMPTLMVDGGAARNNWLMQFQADISNVKIIRAADLETTALGAAFLAGLAVGYWQDLD
FT                   ELKSIHQTGNVFQPRMAAPQRANLYQGWQAAVKAAQLFKHIPIDAQSSTN"
FT   gene            711210..711992
FT                   /locus_tag="LPST_C0655"
FT   CDS_pept        711210..711992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97877"
FT                   /protein_id="ADN97877.1"
FT                   /translation="MQKRRFFLKGSAAEVAWLNRQAAWGYQLTAIHGLSYQFKEVPQAR
FT                   QLIAEYMPQTTLQAMTTVFQPLTSYTFHDDMAVVYSTVAPKQRVVNNDQQYRLAVYRHA
FT                   RDVALNWLNGWVLVVWLMMSATIVISSQLQATPLLTRLLLLGLALGAGVMVAGIIVGVR
FT                   TAIRCHREVCRLIRITGDDHETWKPTFHVLFKHQHAAPDTTCWDDLGSWQLALHNQRGD
FT                   YYFELKTTLSELEITNTLAQRFSKQDFSVVSWLGLYVV"
FT   gene            712090..712161
FT                   /locus_tag="LPST_Ct0010"
FT   tRNA            712090..712161
FT                   /locus_tag="LPST_Ct0010"
FT                   /product="tRNA-Asn"
FT   gene            712386..712808
FT                   /gene="nrpR1"
FT                   /locus_tag="LPST_C0656"
FT   CDS_pept        712386..712808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrpR1"
FT                   /locus_tag="LPST_C0656"
FT                   /product="negative regulator of proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97878"
FT                   /protein_id="ADN97878.1"
FT                   /translation="MTVNLYYSTSSKSSRSARAWLVENNIPFNERDIIANPLDRDELKQ
FT                   ILRLTENGFEDIVSTRSKAFKALHIDLSDLGFNQLLDLLVEKPQLLKRPIIYDGRRLQI
FT                   GYNEEDIRAFLPRSVRKSELREIQQKLYDDDQQAVG"
FT   gene            713077..713307
FT                   /locus_tag="LPST_C0657"
FT   CDS_pept        713077..713307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97879"
FT                   /protein_id="ADN97879.1"
FT                   /translation="MSEQDQAAWAIQALAALKTADNQVVVESIIKVIDDQQAEIESLRG
FT                   SMEGQLWSPTSWHQDQQAQRAAHEDKSTTNH"
FT   gene            complement(713475..713987)
FT                   /locus_tag="LPST_C0658"
FT   CDS_pept        complement(713475..713987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0658"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97880"
FT                   /protein_id="ADN97880.1"
FT                   /translation="MRWEPFRIILIVATLSCLVILVHVRQPQARTRQLLGLGYLFGLSV
FT                   ILFTPLSFDGTAIYVMPAGVGQVNLSRLYLHGLGFIENIILTIPLGWGIKRHFHHYPLL
FT                   GLGLTGLLVGASIESLQYFMSQHWLINRSSDINDVIANATGILIGGLVAATFQFVAQHR
FT                   KTSVTDY"
FT   gene            complement(714103..715557)
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0009"
FT                   /note="transport protein"
FT   gene            complement(715706..716659)
FT                   /gene="ppx2"
FT                   /locus_tag="LPST_C0659"
FT   CDS_pept        complement(715706..716659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx2"
FT                   /locus_tag="LPST_C0659"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97881"
FT                   /protein_id="ADN97881.1"
FT                   /translation="MENFAVIDLGSNSCRMTITQIQEDGSYAVTHRLKEMVRLSENENA
FT                   TDTPTLQAEAIDRTIAALKSFAAVYKDLPNLTIKAVATAATRKASNQKKFLKRVKNDVG
FT                   LDIEVIPGTTEAYYDYLGVVNTLPTTNCVMVDTGGGSCELVLIVNGQAKDLISLPIGAV
FT                   SLSEKFGLNDQVTASQLFKTMTFVDKIFNSVWWLRNGLNLPLVCLGGSNRTLAKINRRK
FT                   CNILNFEDIHGYRLRDNAIYDTFNTVISQDAAGRAAIPGLAKDRADIIVGGMIPAISLM
FT                   RFLDSDRMIFSQNGLREGILFEHLTALAEQSAKVSE"
FT   gene            complement(716662..718818)
FT                   /gene="ppk"
FT                   /locus_tag="LPST_C0660"
FT   CDS_pept        complement(716662..718818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="LPST_C0660"
FT                   /product="polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97882"
FT                   /protein_id="ADN97882.1"
FT                   /translation="MNYYKESYYTNRELSWLDFNYRVLDEARDKDNPLLERVRFLGITQ
FT                   SNLDEFFTVRVASLRKLMSVNYTKPDPAGLTAADQVSAISDKAHEMVKRQYNTLNRSLL
FT                   PLLEQHAIHLLSMADLNEEQHAFVKNYFDDELYPALTPMADDSSRPFPFIGNNTLNIAL
FT                   RIYKNGDKKDRKFATVQVPDVFPRVVVLPGAPNQFILIEEIIKAFVGSLFINYTVKETS
FT                   CYRVMRDLDLDVAEEDTSDLLKEVQKQLKMRERGKVMRLEVEKSMSKHQRTRLAKALGI
FT                   NESALYVINGPLNLTFLSKLVKAVQGHEDLNYPKYHAYYPAKYRERSIFDLIKDHDILM
FT                   QYPYDDFKPVVDFIHEAAEDEDVLAIKMTLYRVSADSPIIKYLGQAAQNGKQVTVLVEV
FT                   KARFDEENNVHWAKKLEEMGCHVIYGLIGLKTHCKLALVVRRENEGIKRYMHMGTGNYN
FT                   DVTAHFYTDMGLFTADTDMGIDASNIFNMLSGYSEPPYFHKLHISPDGIRDFINEKLDD
FT                   EIAIAKAGQPAVVKMKMNSLSDPQIISKLYEASHAGVKIQLIIRGICCLRTGIKGISDN
FT                   IEVHSIIGRLLEHSRIYYFSNDGEPQIYLSSADMMTRNLNRRVELLFPLLQPEISHRAM
FT                   TIFETMWADTVKTRILQPDNTYTRVDGRGLEVLDSQAEFIREAEQAVKADHGDTTPTSN
FT                   AHQFIPMMSPKNEPDASDLDREDD"
FT   gene            complement(718819..720348)
FT                   /gene="ppx3"
FT                   /locus_tag="LPST_C0661"
FT   CDS_pept        complement(718819..720348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx3"
FT                   /locus_tag="LPST_C0661"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97883"
FT                   /protein_id="ADN97883.1"
FT                   /translation="MAAKLFGIMMINVQSIELSIVNLRTLRQVERVRSDVSLGEDIYDQ
FT                   HTIDYDSVEQAAQALSGFVQIMNDYGVKDYHLWGSWSLSSANNADYIQDQLLVRTGLKI
FT                   DWLSSSQETYLRSVAVAVHFPRFKQMITKPTYLLGINSGSVGISHYDQSNFVFSRSLRL
FT                   GPVRIAEVLEDLQSSVPNYVEVLDDYISSQIVDFGRFLPGRRDQPSNVVMLGVAPFATL
FT                   FRQQQSKAGVEELSKADFQALYEDVLNASDQYLMDKYEVDEEDVRLIVPELLLINELLQ
FT                   LTNAEKIWLGNVTVLDGLIIQEAIKLGYKKYNFNDQIVTAAKNIADRYNVEPKHRDLVT
FT                   KFSLHLFDQLKPLHHLGKRERLLLQVAAIVHDVGSYIDPHQHYLHSDYILQATELMGLT
FT                   DTEKRMVALISRYHSAQTPSKDIRHFGHLQVEQRLLVSKLSAILRIADALDDGRKQKID
FT                   KISVSIRNPRVIITCFAHDDLFLENWVFAQKAEFFKEVFGLTPVIKLRGVR"
FT   gene            complement(720673..721482)
FT                   /gene="licD"
FT                   /locus_tag="LPST_C0662"
FT   CDS_pept        complement(720673..721482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licD"
FT                   /locus_tag="LPST_C0662"
FT                   /product="lipopolysaccharide biosynthesis protein LicD"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97884"
FT                   /protein_id="ADN97884.1"
FT                   /translation="MPLTPLHQVELRLMRTVIAICEAENIDYFLIGGSLLGAIRHHGFI
FT                   PWDDDIDIGMRRHDYQRFIAVANHHLDPNKFFLQTGASDPDYALSYMKLLDVNTYIEER
FT                   NNVNNAFKGVFVDIFPFDKIPDDEALRRSQMLHYKLADAAILLKLNYRFVKTPLRNLIT
FT                   KHTPQQLAEVNRYKLEREEYMRLYEQSDSRTYKNLASQYDYEKEIMTYQELTELTTVPF
FT                   EDIQVKIPSAYDTILTRMYGDYMQLPPADKRVEKHLNKLIIDNHEIL"
FT   gene            721651..722124
FT                   /locus_tag="LPST_C0663"
FT   CDS_pept        721651..722124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0663"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97885"
FT                   /protein_id="ADN97885.1"
FT                   /translation="MNSDELSKLLNDYFEAYQNTTKIMMDLVAWPLSQNKLSFEQFLIL
FT                   RRIATTDEVTLNDIAIQRQVTRSAISRQVKSLLMQHYVFQVPDPRDRRRLYLHLTERGQ
FT                   QVERIVDQAITQHFDHWVNQLGAPQIDQVLKMMGTFSQQVTDLGEPQSHPVLH"
FT   gene            complement(722339..722500)
FT                   /locus_tag="LPST_C0664"
FT   CDS_pept        complement(722339..722500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97886"
FT                   /protein_id="ADN97886.1"
FT                   /translation="MAGSKITAIFFLILYAVLLYLVFTMQNMLAMYLMAIGMFLEACEG
FT                   VYHNFFKH"
FT   gene            722780..724087
FT                   /locus_tag="LPST_C0665"
FT   CDS_pept        722780..724087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0665"
FT                   /product="xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97887"
FT                   /protein_id="ADN97887.1"
FT                   /translation="MNKIAAYFNFSELKTSMRTEVLAGLTTFVSMAYILFVNPSVLGAS
FT                   GMDKGAVFTATALASALGCLLMGLVAKYPIAIAPGLGVNAFFTYSVVIGMGIKWQTALA
FT                   GVFVAAVIFILITIFKLREMIIDAIPRDMKLAISAGIGFFIAFIGLHGGGLIVANKSTV
FT                   VGLGSLTVGTTWLTIFGLIVTLILMSRKVPGGIFIGMVLTSILGLATGLIKMPSTIVSA
FT                   APSLKPTFGVALGHIGDINSLQLIIVVLTFLLVTFFDTAGTLVGLAEQAGFMKNNKMPR
FT                   VGKALMADSTSMLVGSVLGTSPTSAYVESSAGIAVGGRSGMSAVVTGALFILGLFFSPL
FT                   LNVVTDQVTAPALIIVGVLMAESLKQISWERFEIAVPAFLTVIGMPLTYSISDGIALGF
FT                   IAYVITMVATKHAKEVHPLMYVLFFIFIIFLWILNV"
FT   gene            724707..726446
FT                   /gene="pox1"
FT                   /locus_tag="LPST_C0666"
FT   CDS_pept        724707..726446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pox1"
FT                   /locus_tag="LPST_C0666"
FT                   /product="pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97888"
FT                   /protein_id="ADN97888.1"
FT                   /translation="MAKISGSDAVLKVIQKWGVKHIYGLPGGSFDSTMNAIYNQRETLK
FT                   YIQVRHEEAGAIAASADYKLTGKIGVCFGSAGPGAVHLLNGLYDAKEDGIPMLAIVAQV
FT                   PTKRMNMDFFQAMNEEPIFDDVAVWNRTAMTAESLPMMTDEAIRQAYAHNGVAVLTIPK
FT                   DFGWAEIEDNFETNASVHTVNYPAPTAESVADAVKLIKAAKSPMIYFGVGAKDAAEELK
FT                   AASEKFKMPLVSSVLAKGIIEDDYPAYLGSTGRVAPKPGAEIGFSTDLILWVGNNVPFS
FT                   IFLFNKKAKVIQIDIDSEKFGKRHHTNVAIQADAKKALAAINAAGEARDDSAFYDAAVA
FT                   DKKNWDKWQASFNDSTESPVRPEPIFDVLNQEASDKAVWAIDVGNVNINFERLIRMHDD
FT                   QKWATSGIYATMGFGVPAALAAKVNYPDRDVYSLSGDGAFAMLSEEILAQVKYNLHIIN
FT                   IVFSNETLGFIEAEQTDDSHQPLSGVDLPDTDWAKVGEGYGAVGYTVRTKAEFKQALED
FT                   AKKTDKPVVIDVKLTHAMPFTTEHMYLDDAWQDKDKIAEFVKKYDAQALKPFSYFLKQA
FT                   QTN"
FT   gene            726587..727483
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0010"
FT                   /note="bifunctional protein: riboflavin kinase; FMN
FT                   adenylyltransferase"
FT   gene            727763..729526
FT                   /gene="pox2"
FT                   /locus_tag="LPST_C0667"
FT   CDS_pept        727763..729526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pox2"
FT                   /locus_tag="LPST_C0667"
FT                   /product="putative pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97889"
FT                   /protein_id="ADN97889.1"
FT                   /translation="MMTKMIAGQALVKVLEAWGVDHIYGIPGGSINHTVEGLYLEKADI
FT                   DYIQVRHEEVGALAASADAKFTGKIGVSFGSAGPGATHLFNGLYDAKMDHVPVLALVGQ
FT                   VPQATMNTNYFQEMDETPMFSDVAVYNRTVTTAGQLPYVINQAIREAYRQKGPAVVIIP
FT                   ENLSAEEIDYQPVSTPNTVSDTFEQRVDPQAITATLKMLKAAKHPLVYAGRGLLGAKAD
FT                   LVKFSEQFNIPVMNTVPATGVIPTSHPNAIGTFGRLGSKSGFEALQHADLILFLGSEFP
FT                   FASFWPKGIKIIQVNNNSFDIGKMVPIDYAVISDAQAYLQAMIATGETLPETAWLTTNR
FT                   QNKRNWDKWLQQLAADDHDGLAPEAVMHKVASMVGPRDTYGVDTGNVSEWAVRGLPMDQ
FT                   EQRFALSGLFATMGFGLPAGMAGALSVPDSQAWSFSGDGGFAMVAPDIITEARYGLPVI
FT                   NVIFSNQRFGFIYREQVDTKQHLYGVDLTDADWAKVADGLGGIGFTVQNNQEVETVFDQ
FT                   IKALQAKGNKRPIVVNAVIKNDDPIGTAYMPLDPELYGQAEVDAYAKANHIDIKEQPSL
FT                   GALLRAQGDQL"
FT   gene            complement(729648..730556)
FT                   /gene="pepR1"
FT                   /locus_tag="LPST_C0668"
FT   CDS_pept        complement(729648..730556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepR1"
FT                   /locus_tag="LPST_C0668"
FT                   /product="prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97890"
FT                   /protein_id="ADN97890.1"
FT                   /translation="MKQGTTIITLDNGYHLWTNTQGKGDIQLLCLHGGPGGNHEYWENF
FT                   GEELADLGVQVSMYDQLGSWYSDQPDYSDPEIAKKYLTYDYFLDEVEEVRQKLGLDNFY
FT                   LIGQSWGGALTMMYALKYGQHLKGAIISSMVDNIEEYVVNVNKCREEALPADAVAYMKQ
FT                   KEAEGNWNDPQYQKYVDVLNAGYVDRKQPTSIRHLINTTATPVYNAFQGDNEFVITGKL
FT                   KEWDIRDQIHNIKVPTLLTFGEHETMPLASARRMARDIPNSRLVTTPNGGHHHMIDNAP
FT                   VYFDHLKQFIRDVEDGSFNQK"
FT   gene            731011..732000
FT                   /gene="birA2"
FT                   /locus_tag="LPST_C0669"
FT   CDS_pept        731011..732000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA2"
FT                   /locus_tag="LPST_C0669"
FT                   /product="biotin--[acetyl-CoA-carboxylase] ligase and
FT                   biotin operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97891"
FT                   /protein_id="ADN97891.1"
FT                   /translation="MANQVAVLRLLIQAAPAYCSGDWLAQRLAISRTAIWKLVQGLQAA
FT                   GHTIESRHGRGYRYVANNQLSAPVIEYALTALPPFDLTVLPTVDSTNAYLRRLVTQTPL
FT                   ALPKIVVADTQTAGYGRSGRAFYSPAQTGIYMSIGLPLSDQKALDAGLLTTSTAVVVAQ
FT                   TLQQLFAVDVSLKWVNDVLVNHHKVVGILSEGITSLETGQISAVIIGIGINLTTTAFPA
FT                   LLAHKAGAVVANPNGVTRNQVICELLRRFFNSYGTYRSGTFMDAYRKLSMVIDQQVELK
FT                   SGTQKYRGVVTDIDAHGALVVKLETGQSRHFSSGEITKVNLLSGGYHG"
FT   gene            732422..734404
FT                   /locus_tag="LPST_C0670"
FT   CDS_pept        732422..734404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0670"
FT                   /product="acyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97892"
FT                   /protein_id="ADN97892.1"
FT                   /translation="MNENLRSVNMSRTMSRMNRHRMNPRRYITGFDGIRTLAVLGVIIY
FT                   HLMPASLQGGYLGVPIFFVVSGYLITDILLQDILSRGHVRIWRFLGHRMRRLYPAFVTM
FT                   LLGTTAYITLFQRSLLTNIRATVLTNLVYVYNWFEINHGQSYFDRFNGESPFTHLWSLS
FT                   IEGQYYLFWPLVIGILMVIFKKRSRVFWFMMIAAGISAITMAMLYDPANTNRVYYGTDT
FT                   RMFAILLGSGLAFIWPSRELSADIANVNRVTLDILGGASLIAIIWMFFQMSGQSDFTYR
FT                   GGMLLFTVLSTVLVATVAHPASHLNRVLTNPLFKYVGQRSYGIYLYQFPVMIFYETKVK
FT                   NIGDHLLLNSLIEVALILIVTELSYRFIENPMRHYDYSRLLVDFKDFLRKPKFNRVTTA
FT                   IVALTTVLFVITAVGFVQQPSKAEANKKTELQKTIAANSKAADKKNAAALKRQKAAQAA
FT                   AASSKKVATEKMQTKQAEAKLNSKQKQVEKEYDLKPQVVLAMANTDLTAIGDSVLLDVS
FT                   SDLQDVIPGTVVQGRVGRQVTEVPGIINSLKSQGQLAHNVLLNIGTNGTITDDQAEQVV
FT                   KLIGKDRQIFWVTAHVPTQSWQNQVNAQIAKTAKKHANVHVIDWHGRAQNQSGWFADDN
FT                   VHPNTTGNRQLTNLIANRIAEVNNN"
FT   gene            complement(734569..737010)
FT                   /gene="pepX"
FT                   /locus_tag="LPST_C0671"
FT   CDS_pept        complement(734569..737010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepX"
FT                   /locus_tag="LPST_C0671"
FT                   /product="Xaa-Pro dipeptidyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97893"
FT                   /protein_id="ADN97893.1"
FT                   /translation="MKNNQFAIVPTDSETAIAELTKIHFITPDMDALTTVPAVYQALLA
FT                   KSLPEVHTASGLTHKFNNIMATSQHTLSEWLADATIVNNQVFYNVGLQLLGFLPGQDFE
FT                   LADPLLAMRDIHLPMVGDSAFDREALYYAWYLLLNTRGNNGQTLIESLTTRGYFVPFYQ
FT                   LPNDQKPLFFNGKAQAVFDTNALIRDVVYVEAPLDTDHDGQRDLLKVEILRPAETETGL
FT                   KVPVLYTASPYNQGINDQAGDAQMHNVDVPLTAKEPDENTYADVEFQPTTAQLPAARTA
FT                   TTTTDTAEETFSREKSYTLNDYFLARGFAVVYAAGIGSIDSDGLAPTGDVDETTSTVAI
FT                   IEWLTGKRQAFTNRDGNIAIKAWWCNGAVAMTGRSYLGTLATAAATTGVAGLKTIISEA
FT                   AISSWYDYYRDNGLVVAPDTFQGEDTDVLAAEVFSRSLKAGDAHQIQPAFDQKLAELTA
FT                   DQDRASGNYNRFWDERNYLKNVDKIKADIIMVHGLNDWNVKPRNVANLWDKLQAVPVTK
FT                   KLILHQGQHIYINNLQSLDFTDMMNLWLSHKLYGLDNHAETLLPNVLVQDNTQAQTWHG
FT                   YDNWWQDTTDALDFKVQYKELVPADHTVDQRAAHFTDKLPDKLFDHYKHHLDSWQRDLL
FT                   QEDKLNPLYDHRLLFKSWQAPEDQLLVGIPHVAGSVAVNKNFGMLSFMLIDFGAARRLT
FT                   VSPQMLAAKALDLGYHWREDDLKDFKLAGETPFKMITKGHLNLQNRHHPWHAEAIQPNV
FT                   FYDFSVDLQPLFHHLLKGHQLGLVIYATDMKMTIRGNQDLQYSLNLNDIRLHVPMKKIT
FT                   D"
FT   gene            737130..737549
FT                   /locus_tag="LPST_C0672"
FT   CDS_pept        737130..737549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0672"
FT                   /product="probable organic hydroperoxide resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97894"
FT                   /protein_id="ADN97894.1"
FT                   /translation="MEELRLSDFPILYTTQAVNEDGIEGHAYIPNGLEVAVSSPLKAVP
FT                   GSNPEQLIGLALSTCLNATLEAIEKEHGQTHQSKVVTTVKMSRDRFGYQFFLDARVTIP
FT                   EVDAETAARWLAIAETRCPVAKLVGPSANVTIQLA"
FT   gene            complement(737667..737969)
FT                   /locus_tag="LPST_C0673"
FT   CDS_pept        complement(737667..737969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0673"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97895"
FT                   /protein_id="ADN97895.1"
FT                   /translation="MLTPKTIHDDLHEHHTQVVQLFSKHPWLIPATTLLHIIPVVVGIN
FT                   GFWKSRALSKQLKIEREKTKQLALQQVDKVQSAVTNHHCQHPSLRQLFKQIRSHH"
FT   gene            complement(738120..739517)
FT                   /locus_tag="LPST_C0674"
FT   CDS_pept        complement(738120..739517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0674"
FT                   /product="amino acid transport protein (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97896"
FT                   /protein_id="ADN97896.1"
FT                   /translation="MGIFQRIFQKEDLERYLQKDSHFERTLSAVDLIALGIGAVIGTGI
FT                   FILPGTVAATKAGPGIILSFVLAAIVCAVAAMCYAEFASVLPIAGSAYSYGNIVYGEMI
FT                   GWIIGWALVLEYVLAVATVAVGWAAYFNSFIAGFGLKLPKAITGSFDPAHGTYINVIAI
FT                   LIVCLIAWIIDTGLKTSIRLNNIIVVVKLAIIVLFLLVGSFYVKPSNWTPFAPFGGTGI
FT                   LKGAAVVFFAYLGFDAVSSSAAEVKNAKRNMPIGIIGTLVICTIFYILVSGVLTGMVSY
FT                   KQLNVDDAVAFALQLVHQNFVAGIISIGALAGMFTMMVTMIYSSSRLLYSIGRDGLLPR
FT                   FLGKIDKHHAPKNAMLTVTIVISILAGLIPLDQLANLVNIGTLIAFAFVSFGILLLRRN
FT                   PKLNAIKGFRVPLYPVLPIISGLLCLFMMTQLSMETWLASLVWFLLGLIIYFGYGIRHS
FT                   RMNKADE"
FT   gene            740023..740496
FT                   /locus_tag="LPST_C0675"
FT   CDS_pept        740023..740496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97897"
FT                   /protein_id="ADN97897.1"
FT                   /translation="MGAAIDITGQHFGRLIAVHRAGRAKNGNALWFCQCQCGRTCVVDS
FT                   YVLRHGKTRSCGCLAVEQSRQNIFNNPQAVSHMGDPRNLKIRDHHTDVSSIKKSKRNTS
FT                   GVVGVSYDKQSGSWVAHFYYKGTYILNKHFAHFEDAVRARHAMEQQYLTSSDN"
FT   gene            740860..741678
FT                   /gene="pdx"
FT                   /locus_tag="LPST_C0676"
FT   CDS_pept        740860..741678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdx"
FT                   /locus_tag="LPST_C0676"
FT                   /product="pyridoxal kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97898"
FT                   /protein_id="ADN97898.1"
FT                   /translation="MSTMLVAEDLSAVGGISLSSALPVLTAMQYDVAALPTSLLSTHTS
FT                   GYGTPAVVDLSTWLPQVFAHWTRAQLHFDQALIGYVGSVALCQQITTYLEQQTLSLLVV
FT                   DPVLGDLGQLYQGFDQDYVAAMRQLIQQADVILPNTTEAALLTGAPYQVTPDLEVILPA
FT                   LQAQLKTGAHAVITDVQRADQIGCAWLDEAGHVQYCGARRLPGHYNGTGDTLAAVIAGL
FT                   LGRGYALAPTLARANQWLNMAVAETIAQNRTDDRQGVALGDLLQAILALN"
FT   gene            741732..742151
FT                   /locus_tag="LPST_C0677"
FT   CDS_pept        741732..742151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97899"
FT                   /protein_id="ADN97899.1"
FT                   /translation="MSTEVASGAVVYQQKDGHPAYLLLQSATSDFWGFPKGHVEGNETL
FT                   AEAARREIREETQIEATLDTNFKAYTEYDLPNGNLKQVTLFVSEVPSGVVVTRQQAEIS
FT                   AIGWFDYAAARERLTYDNLKQMLDQANTYIEQHLQ"
FT   gene            complement(742228..742431)
FT                   /locus_tag="LPST_C0678"
FT   CDS_pept        complement(742228..742431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97900"
FT                   /protein_id="ADN97900.1"
FT                   /translation="MIHASRSKPTIFRREFCHMQFQKTNSWFSIVLDTQRQMFVATDKL
FT                   HPELFAEGVTIEDAVANLQTQA"
FT   gene            742528..743109
FT                   /gene="gmk2"
FT                   /locus_tag="LPST_C0679"
FT   CDS_pept        742528..743109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk2"
FT                   /locus_tag="LPST_C0679"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97901"
FT                   /protein_id="ADN97901.1"
FT                   /translation="MTTKRIFVITGPTGSGKTTVSHYLRSQYQIPQVITHTTRAPREGE
FT                   VSGRDYYFETPASFATKHYLEHVTYSGNQYGSSREGLAAAWGRSPLISIVLDTAGAITY
FT                   ARELGEQAVVIYLEVADQEALIQRLTKRGDLPSRIKKRVASDEYLRDQALPVGLVGHAH
FT                   VIVNDDWQATRRQLDELVTEYCQHDVVTKD"
FT   gene            743220..743663
FT                   /locus_tag="LPST_C0680"
FT   CDS_pept        743220..743663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0680"
FT                   /product="metal uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97902"
FT                   /protein_id="ADN97902.1"
FT                   /translation="METPIEQAVAILRRNQFKITKQRQALLDYLVTYQDHYVAISAVDE
FT                   HMRTLFAGMSHNTIYRNIKEFETLGLLELKAQANQTLVKYQCDFKHQHHHHFVCSNCGK
FT                   VTELQACPLDEYEAQLPGCTITGHRIEIYGLCANCTKKQAINS"
FT   gene            744318..745136
FT                   /locus_tag="LPST_C0681"
FT   CDS_pept        744318..745136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97903"
FT                   /protein_id="ADN97903.1"
FT                   /translation="MFSILDMINHALGYVNVNVKIKNQIYIGIGIAGNLYLGYVAIRLM
FT                   QNGAWLRGILYMLVFLALIYFITLNVIYYFTNKTAKYDLSPRIEKLLGGKPKEALAAEK
FT                   QAQQSQQQPYIPANGIFDGQELLPATVKTSRAEQENVHQIVDQLQAANIVRLDYGGLTD
FT                   DAIIQQAQATGEPVYAIGQGIQIPFSQLKLENHRLVIYAGINQMDQSPVGHITKVGLTD
FT                   VHDAHEDYKLYLASTVITGGMSKIAGRTSAIEQPGDYQVTAQVAYEGRED"
FT   gene            complement(745376..746002)
FT                   /gene="gph1"
FT                   /locus_tag="LPST_C0682"
FT   CDS_pept        complement(745376..746002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph1"
FT                   /locus_tag="LPST_C0682"
FT                   /product="phosphoglycolate phosphatase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97904"
FT                   /protein_id="ADN97904.1"
FT                   /translation="MTYQALMFDIDGTLTNSQPAYTTVMREVLATYGKPFSPAQAQKTF
FT                   PMAAEQAMTELGIAASEFDHFQAQYEDVMASHYDQIELYPGITSLFEQLPSELRLGIVT
FT                   SQRRNELESGMRSYPFMMRMAVTISADDTPKRKPDPLPLLTALEKVNVAPQNALFIGDS
FT                   VSDEQTAQAANVDFGLAVWGMDPNADHQKVAHRFQKPLDILALFK"
FT   gene            746324..747598
FT                   /locus_tag="LPST_C0683"
FT   CDS_pept        746324..747598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0683"
FT                   /product="aspartate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97905"
FT                   /protein_id="ADN97905.1"
FT                   /translation="MEFRGVRFFDPSPVRFHQQDQPNLGGIFMSINSETLVNHMNHEIA
FT                   AIQPSDILAFNAEIANIPGIVRLTLGEPDFNTPEHVKQAAIESIEADESHYAPSNGTLA
FT                   LRTAAAEFLAAKYDVHYDPASEVIITAGATGGIYTALTSILNPGDEVLIPTPIFPLYIA
FT                   IVKLSGATPVFMDTSDNGFVLSPDQLQTTLAAHPKTKAVVLNFPSNPTGVTYRHDDLKA
FT                   LAAVLADQPIFVLSDEIYSELTYGEPHESIANYLPTQTILLNGVSKSHAMTGWRIGIMC
FT                   APKAITAQLGKIHQFTVTSTTTNAQAAATEALKNGLDDAQVMKREYQERRDYLYDALND
FT                   LGFQSAKPEGAFYLFSKIPAGLPQNSMAFCRELAHEARVALIPGSSFGPGGEGYVRISY
FT                   AASMADLKTAVTRLRTYVASKKQGA"
FT   gene            747601..748593
FT                   /locus_tag="LPST_C0684"
FT   CDS_pept        747601..748593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0684"
FT                   /product="bifunctional protein: amino acid
FT                   aminotransferase; 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97906"
FT                   /protein_id="ADN97906.1"
FT                   /translation="MKILMYSVRDDEQDAIQAWAAAHQIQVDTNDLEFHPETADLVKGY
FT                   DGLVIQQRSPIGGDASLYQSLAAAGLKQLTSRTAGVDTIDIPAAKAAGLVVTNVPAYSP
FT                   NSVAEMSVAQTMRLIRNLEMFDQRISQQNFQWAGLQAREIRSLTVGIIGAGRIGGTAAR
FT                   LFHGLGAKVIAYDVVRHPELEDVLTYVDTKEDLLRQADVVDLHVDLNETSAGLIDAAAL
FT                   KLMKTDAYLINASRGPVIVTDDLVAALKAGEIAGCALDTVEGENALFNQNHQGEVLQDT
FT                   NVAQLMQMPNVIITPHVGFYTNLAVKNMVDISLDDVLAILNGETTAHAF"
FT   gene            complement(748827..749078)
FT                   /locus_tag="LPST_C0685"
FT   CDS_pept        complement(748827..749078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97907"
FT                   /protein_id="ADN97907.1"
FT                   /translation="MLLDQAANMTNIIAAQIIKVFYPFVIVKTETGAYLKLNLSTNEQR
FT                   DPLFWDELRSILQAKLWVPIGKHYHQLLDNGWLAKSIS"
FT   gene            749298..749477
FT                   /locus_tag="LPST_C0686"
FT   CDS_pept        749298..749477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97908"
FT                   /protein_id="ADN97908.1"
FT                   /translation="MKSLSKNYSAVAVPKRKANYYWLFTNNVQYWSCYSAILTENSVAV
FT                   SHYFMDIEQYLATF"
FT   gene            749611..750351
FT                   /gene="glnQ2"
FT                   /locus_tag="LPST_C0687"
FT   CDS_pept        749611..750351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ2"
FT                   /locus_tag="LPST_C0687"
FT                   /product="ABC superfamily ATP binding cassette transporter,
FT                   ABC protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97909"
FT                   /protein_id="ADN97909.1"
FT                   /translation="MSMIEFHDVEKYYGDFHALKNINLTINEGEKVVLIGPSGSGKSTL
FT                   IRTVNGLERVQSGQLLVNGFDLADRKTDMNKIRKNVGMVFQHFNLYANKTVLENIMIAP
FT                   RLVLKRPEDENKKLAMDLLDSVGLADKANSLPSQLSGGQSQRIAIARSLAMKPKCLLFD
FT                   EPTSALDPEMIDDVLNVMKSVAEDSSMTMLVVTHEMGFAREVADRVIFMADGEILEDDA
FT                   KEKFFDGQPSNERARQFLSKIITH"
FT   gene            750372..751208
FT                   /gene="glnH1"
FT                   /locus_tag="LPST_C0688"
FT   CDS_pept        750372..751208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH1"
FT                   /locus_tag="LPST_C0688"
FT                   /product="glutamine ABC transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97910"
FT                   /protein_id="ADN97910.1"
FT                   /translation="MKKLKRLIGALGMLAMLVVVLTACGSRQSLAKQDVLTNDKASKTI
FT                   TWGVKADTKLFGLMDVKDNQIKGFDADIATALTKRVLGKNATAKFVQVTSQTRIPLLKN
FT                   GNIDAIIATMTITPEREKQVDFTNSYFDAGQSLLVKKGSAIKSVKDLNKSGTKVLGVTG
FT                   ANSVENIKKAAPKAKVLELSDYAQAMTALKSGQGVALTTDNGILYGMASQNPGYEVVGG
FT                   TFTKEPYGIAVNKGQEPLKKALNKALKEIEADGTYNRILKKWFGNVAGFDYKEASR"
FT   gene            751208..751849
FT                   /gene="glnM"
FT                   /locus_tag="LPST_C0689"
FT   CDS_pept        751208..751849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnM"
FT                   /locus_tag="LPST_C0689"
FT                   /product="glutamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97911"
FT                   /protein_id="ADN97911.1"
FT                   /translation="MGYILTHYWSELIQGLGYTLLSSVIALVFSTIIGTMFAIFEVLPS
FT                   RTMRIIGRVYIEIFRNIPLLVIAMFFYVIIPMYVAKIDGFTAGTIGLTIYTSSFIAETV
FT                   RAGIQSVDPGQMEGARANGMTYWQAMSKIVLPQAFKIIIPPLGNQFINLVKNSSVLAFV
FT                   AGFDLMYQANSIASLSLDTINSYVVVGVFYLIITLPLSYYMRHLEKKLAN"
FT   gene            751866..752519
FT                   /gene="glnP"
FT                   /locus_tag="LPST_C0690"
FT   CDS_pept        751866..752519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="LPST_C0690"
FT                   /product="glutamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97912"
FT                   /protein_id="ADN97912.1"
FT                   /translation="MQNFIQAYSWINIRFLLEGLWVTVEVSVVSIIASFIIGSVLGVLR
FT                   YVKIKYLSAVVGFVVDIIRNLPLILIIFFTYFGLPHLGFKPGIIFAAILAMTIFESAML
FT                   AEIIRSGILAVDYGQMEGARANGMSYVQALWHIVFPQAIKKTIPTIVSQFISLIKDTSL
FT                   ATIIVLPELLNHAQIIYGQNSAYILPMFLMIAVMYFIICYALSILSRVLDKKLA"
FT   gene            752781..753275
FT                   /locus_tag="LPST_C0691"
FT   CDS_pept        752781..753275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0691"
FT                   /product="PTS, EIIA (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97913"
FT                   /protein_id="ADN97913.1"
FT                   /translation="MMFGIKRKKVDVFEVVTPIEGICIPITAVMDEVFAKKMMGDGFAI
FT                   RPSEDTNQVVAPISGKIVALPESKHAIGIMDETRGVSVLVHIGLDTVGLNGRGFTAHVK
FT                   LNQEVKAGTLLVTLDRQTMATAGLDMTTIVVFTEGYTGEVPLGSKLHQQLAAGTPVLKQ
FT                   A"
FT   gene            753301..754143
FT                   /gene="bglG1"
FT                   /locus_tag="LPST_C0692"
FT   CDS_pept        753301..754143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglG1"
FT                   /locus_tag="LPST_C0692"
FT                   /product="transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97914"
FT                   /protein_id="ADN97914.1"
FT                   /translation="MRVVKKINNNVVVCLDQHGEELVAFGKGLGFQKVPYELTDMTKVT
FT                   MTFYKLNYQYYQLLKEIPTEIFDLSAAIVERAQALIPRILNPNMIFSLADHINFAITRL
FT                   THYKSAQLPFSYDVEQLYPQETDVGYYAVRLINRRLNIQLPVSEVTAIAMHFVNSQTND
FT                   LATNSSVNSDDEMIKIITKIIEQEYELRINQTEFTYNRFVMHLRYYIKRMKKHEQISEN
FT                   DNSKLFNTMRHDEPEIYLVAKRIADYVDSQLDTNSNDDELFYLMIYVKRIVNKMNTQA"
FT   gene            754171..755622
FT                   /locus_tag="LPST_C0693"
FT   CDS_pept        754171..755622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0693"
FT                   /product="beta-glucosides PTS, EIIBC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97915"
FT                   /protein_id="ADN97915.1"
FT                   /translation="MKNKDKQYEKVANGVLEAVGGSANISSVTHCMTRLRFNLKDESIP
FT                   NDGEVQNIPGVIGVNRAGGQYQIIIGQAVSKVYDALLTVGNLTRNAPINEDLDNRPKEK
FT                   LTFKSAGNMILNKLAGCLTPLIPMLIAASMFKMFAAILGPSMFNVLGTKTSLYQLFTLV
FT                   GDAGFYFFPIILGYTAAKQFNTSRIISMFLGAILIDPNLIKIVTAGKAFNIFGTAMPLV
FT                   NYSSTVIPIILSVWVMSYIERFFKRYVPESISTIVIPTLTIAIMLPISLCILGPAGNFI
FT                   GNYICTGILAFGKLGGLPTIIAVGVVGALWEILVMTGMHLLMLTTMMMIFAQSGHENFV
FT                   TLGAVAASMSVAGMCLGAALRIKDQDQKTLAWGYLIASIIGGVTEPGLYGLAIRYKRPF
FT                   IGMMIGGFCGGLYAGLTTVTAYVMVPVANFLSLTAYVGGQTSNVINGVVSGVIAFVAAA
FT                   IATYAIGVEANTNKQGTKEFKLVEA"
FT   gene            755629..756387
FT                   /locus_tag="LPST_C0694"
FT   CDS_pept        755629..756387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0694"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97916"
FT                   /protein_id="ADN97916.1"
FT                   /translation="MERKVIVRADDLGYSDAVNVGIARTVHNGLINNVGVMVNMPTTMS
FT                   GLAMIKDAGVCLGFHTVISAGRPLTNPKLIPSITNPDGTFRHSSDYRAAIHDFVDLNEV
FT                   VLEIEAQYQKFVALVGRQPDYFEGHAVVSDNFVKGLEIVGERHHLNLLRFAAGPDSPSV
FT                   LFKGKVLHVFMESMGKNYNPYETLKRAALAQYNDGYAMMVCHPGYLDDYLLQHSSLTVP
FT                   RTQEVAMLTDPQMQEWLERQQIKLIKYSEV"
FT   gene            complement(756522..757853)
FT                   /locus_tag="LPST_C0695"
FT   CDS_pept        complement(756522..757853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0695"
FT                   /product="amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97917"
FT                   /protein_id="ADN97917.1"
FT                   /translation="MQETKQATTLNRSLGFWSALSLVVGTVIGSGIFFKQSSVLDSAGS
FT                   PSAALLAWLLGGLITLTAGLTIAEVGAQMPHTGGLYVYMEQIYGKLWGFLSGWMQIAVY
FT                   GPAIIASISAYLGILLVGFFNLQAGWQAPLSIGVIVLIGILNMFENRWGAAFQIATTLG
FT                   KLLPIAAIIIFGLFYGNQNALGQSLHTITQSTGSFGVAVLATLFAYDGWILVANLGGEI
FT                   KNPQKLLPQAIILGISMALIAYTLVSYGILHFVPAATIHKLGQQTTLYFAQAAFGTIGG
FT                   RLLNIGIIISMVGCLNGKIMTFPRIVYAMAAQNQLPFAKKLSYLHKKSHEPIAATIAIL
FT                   VYASIMILFFNPDRLSDLCIFTVYCFYVTTFVGVFILRKRRPASERPFSTPGFPITPLI
FT                   AILGALFVIISEIGSDLSGVLISLVIVAVGFPIYYWKQQQNQNA"
FT   gene            complement(758124..758564)
FT                   /locus_tag="LPST_C0696"
FT   CDS_pept        complement(758124..758564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0696"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97918"
FT                   /protein_id="ADN97918.1"
FT                   /translation="MKTTTIRPLEDHVCFSTYTTVHAIQRLYQPTLTAHRLTYPQYLVL
FT                   VALYATPPRAVTVKTLSTQLNLSTGTLTPVLQRMTQAGLITRHRNPQDERSILLTLTPQ
FT                   GTATRLALNDLPDLLTAKGGLNQSEWAQLTQLMTKLMTNLTR"
FT   gene            758955..759716
FT                   /locus_tag="LPST_C0697"
FT   CDS_pept        758955..759716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0697"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97919"
FT                   /protein_id="ADN97919.1"
FT                   /translation="MVIGAVTDFLDTLGIGSFVVSTAIFQASHYLKDERKLPGTLNTMH
FT                   AIPTAFEAFFFVTAVAVEPVTLISLVLAATLGALLGSEVMTKLNQRWIQLIMAGALVIT
FT                   ALLMAAKLLGWISLLGVANQATGLSGWKLLVGIGGNFILGLLMSAGVGLYAPCMVMVYF
FT                   LGLTPIAAFPIMMLSCALLMPISAVNFIRHDRVDYRGLFGIILGGIIGVVVAATLVKSL
FT                   SLTALSWLIVLVSCWTAFSLWRAAQRRKNVL"
FT   gene            759853..760293
FT                   /locus_tag="LPST_C0698"
FT   CDS_pept        759853..760293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0698"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97920"
FT                   /protein_id="ADN97920.1"
FT                   /translation="MIKMNHDEMVARQVLILARQIKRRRNQHLRTVGLTTEQADALTFF
FT                   TDQPGRTVTAFKTYQEITHQTARMIVQRLQTRGYVQLVVSPTDARAKQVVVTPSGRAKR
FT                   EQLRQHGWQTSAQMFAHLDAEQQQVFLDLLRQVNQNLESDEN"
FT   gene            760290..761447
FT                   /locus_tag="LPST_C0699"
FT   CDS_pept        760290..761447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0699"
FT                   /product="multidrug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97921"
FT                   /protein_id="ADN97921.1"
FT                   /translation="MMKTRLYTPDVKLVLMASFFFLMSPMLINPVIAGFAHGIGASSVL
FT                   AGTIAGLTNLTSLVLRPLAGNLTDRVSKYRLTFVGGCLLLLASLGYSLTTNVTLIMLLR
FT                   ILNGLGYTLCSVCMATWMASLLPPDRIGSRMGIYGLANALGMACGPAISVFLYQHYSYQ
FT                   SVFWLAAGCSLLLIIMIQFVGDHGEPIVTPQTATTKHHIRIVQPRVIPVALILLLFSLP
FT                   YFATQTYIVSYVAARHFHVAAGVFFPVYAGILLVLRIILRDWFDRVPFKRFIWLCLIFN
FT                   LLGLIGLTDMNNWAMLLLGAAGLAAGYGLMFSICQAKALMLVPKADHGLANSTFYIGVD
FT                   LGMSLGPIIGGLISSQLPMAWFYPVMMVTLPLIIVVYLVSRRQLA"
FT   gene            complement(761567..762124)
FT                   /locus_tag="LPST_C0700"
FT   CDS_pept        complement(761567..762124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0700"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97922"
FT                   /protein_id="ADN97922.1"
FT                   /translation="MKIKNVNFKIGNQMIIAAVPGIIVGTFSAQFIPQQLYNWIVGTIF
FT                   LIMGAMVLIKYVHHSKQTTAGHQPWQAAFFGLLSGLMVGIGGLSGGATTAAGLAILGLT
FT                   AVEAAGTATYVLTVMSTISLIGHLFTSTFAWQSGLVLMIGAIIGAIITPLVIRHLNLDK
FT                   VNRVLTPFLGLIIIYFGIKMFI"
FT   gene            762413..762973
FT                   /locus_tag="LPST_C0701"
FT   CDS_pept        762413..762973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0701"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97923"
FT                   /protein_id="ADN97923.1"
FT                   /translation="MRKDAQINQQKILTAARQLFAARSIETVSMKDIATAAGIGPGTLY
FT                   RHYAHKSTLCLALVTDRVATFIKTNQVYLTTTSVGAAARFDHVIGEYLAIREHNMALLM
FT                   NVEAGEPGRRQFYQSELYQQLCDLLTQLVRDLKPTLSKPACEFQADMLIAMLKGTSYAF
FT                   QRQWRGRSQSELLAQLHALMVTE"
FT   gene            complement(763085..764380)
FT                   /locus_tag="LPST_C0702"
FT   CDS_pept        complement(763085..764380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0702"
FT                   /product="GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97924"
FT                   /protein_id="ADN97924.1"
FT                   /translation="MSETNAQKVQEVIIAGMSKTVANYDYAMSELEALVAANNMHAALR
FT                   IDQGLEKPNPATFFGKGKVVEIKEVAAANDLHIMVINADLTPSQVRNLEEQTDIQIIDR
FT                   TGLILEIFGNRARSKEAKLQVKIAQLQYQLPRLRTSISNRLDQQAGAAAGGGGGFTNRG
FT                   AGETQLELNRRTIQDRISHAKHELKELNKDEVVRRSQRDKAGLPNVALVGYTNAGKSTT
FT                   MNGLVKLFGKGEDKQVFEKDMLFATLDTSIRQLTFPDNKQLLLSDTVGFVSDLPHNLIN
FT                   AFRSTLAEAANADLLIQVIDYADPHYKEMMATTEKTLKEIGVHDVPMIYAFNKADLTEA
FT                   DYPNQQDDQLIYTARDEASLQALTSMIKAKVFKNYVTTTLLIPFNDGEVVAYLNDHANI
FT                   LKTDYLADGTQLTVELNTVDAQRYEKYVVTPA"
FT   gene            764469..764906
FT                   /locus_tag="LPST_C0703"
FT   CDS_pept        764469..764906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0703"
FT                   /product="NTP pyrophosphohydrolase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97925"
FT                   /protein_id="ADN97925.1"
FT                   /translation="MGYVLDLRRQVGHQPLVVAGAALMAQNSIGKIVLIYRTDNHCWGL
FT                   PAGSTEPGETVQQTARRELKEETGLTVGELTLIDVYSGPKMHYQYPNGDIIDSVTTLYR
FT                   ANTTGGELIQATDETSTAAFFALDALPTPLTPLTKWMLCGE"
FT   gene            765048..765362
FT                   /gene="sugE"
FT                   /locus_tag="LPST_C0704"
FT   CDS_pept        765048..765362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="LPST_C0704"
FT                   /product="GroEL supressor protein SugE"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97926"
FT                   /protein_id="ADN97926.1"
FT                   /translation="MTWIYLIIAGLFEVVWATMMKLSNGFSHFGYAAATVVGMVLSFGF
FT                   LALATKHLPLSIAYPIWTGIGAVGAIIVGLVFFKDTIAPITWIFIAMLVIGIIGIKVTS
FT                   "
FT   gene            765668..765868
FT                   /locus_tag="LPST_C0705"
FT   CDS_pept        765668..765868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97927"
FT                   /protein_id="ADN97927.1"
FT                   /translation="MMMYPYLNLGPRDGVLIIAAAIMLALTVVFNWSVWELLFAVVAVV
FT                   IAFLAGSMKPSKKNVLAFLKK"
FT   gene            complement(766185..766862)
FT                   /gene="pgm3"
FT                   /locus_tag="LPST_C0706"
FT   CDS_pept        complement(766185..766862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm3"
FT                   /locus_tag="LPST_C0706"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97928"
FT                   /protein_id="ADN97928.1"
FT                   /translation="MAQFSIYFVRHGQTFFNLYNRMQGWSDSPLTEYGQATATKVGQAL
FT                   ANTAFDYYYSSDSKRAIDTAQLIRQAAGATAQPFKTLMNFREVFYGYFEGDDSSRTWSL
FT                   VGRQYGVTSMHELLEHVPIDQTRDLMREIDPWHEAEDNSMYWERINQGFDYLKAHHDHH
FT                   QKVLVVTHGTTIRSMVAHFAPEIDITNGPKNGSVTRIDIDDDQIRVVDYAQDLADVKVN
FT                   QHL"
FT   gene            complement(766877..767533)
FT                   /gene="pgm4"
FT                   /locus_tag="LPST_C0707"
FT   CDS_pept        complement(766877..767533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm4"
FT                   /locus_tag="LPST_C0707"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97929"
FT                   /protein_id="ADN97929.1"
FT                   /translation="MATFSVYMIRHGQTYFNKYRRMQGWCDSPLTAVGEQDARNAGKML
FT                   NGIDFDAVYASDMTRAMRTAELILPASGNTDLTVQPMAAFREAFYGYFEGDDTSQTWFM
FT                   VGAPHQAPSLSAIIEQYGIEKAKDFCKEADPFHRAENNAEFWQRVNGGLDTLRAHHHDG
FT                   DKVLVVSHGNTIYSIAARFAALTSPARPQNGSVTKFTISDNDVTLDYFGRKDHLD"
FT   gene            complement(767604..769460)
FT                   /gene="napA2"
FT                   /locus_tag="LPST_C0708"
FT   CDS_pept        complement(767604..769460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA2"
FT                   /locus_tag="LPST_C0708"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97930"
FT                   /protein_id="ADN97930.1"
FT                   /translation="MDQVSLVIILLAALLIPLIMAKFKINSLPTAVMEIIVGIVIGPSV
FT                   FNFVNTSDLISQLSTIGVIVLLFLSGLEIDFSLFKKRRTALTPLEQKNAVNTPKYSPVR
FT                   LSVYAYSTIIVLSLLLAAAFKVSGLFSDFWLAAILFGTISLGIVIAALKEQELLSKAFG
FT                   QTILLISVFGELVPMMGLTLYASVYGSNSQSLWLLLLILAVAALLLLRFKPFFRFYQNI
FT                   NKSTTQLDIRLAFFLIVTMVTVAESVGAENILGAFVAGIVLKLLNPSETTRERLDAIGY
FT                   GFFIPIFFITTGVDLNLRTLLTSGKTLLLIPLFFLAYMVAKIGGYWVLKLRFKQANALA
FT                   GTALTATTMTMVLAVLRVAKSMKTITSDQSGAFLLAALLTCVISPLIFNKFYSAEKEDL
FT                   VKTAVHFIGANLSTVPVAQQLRKGWYDVSMYTNHPENYQTYHAQVPVTLMENFTAQDLQ
FT                   DHGVFDTDILVLGHIDAERNYELAKAAKAYGVRRIIVRFEDRNVLNEHEDELRELGVEV
FT                   YNTPEANITLLRALIESPSTLLLLNDTENSIYEVRVLNHLYTDVQIKNLQFAQDITISQ
FT                   VIRNRKLIAPNGNTTIMYGDRLIFTGNKQTAAQIRQALATAN"
FT   gene            complement(769482..770555)
FT                   /locus_tag="LPST_C0709"
FT   CDS_pept        complement(769482..770555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0709"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97931"
FT                   /protein_id="ADN97931.1"
FT                   /translation="MSTAVQLKYYRSNFLKGMSFLFKTTQKVYPFNDLFEWRDSMQPIQ
FT                   LTAYQSDWQKQAIEYQTLLRQQLQANLLKSSHVGSTAMPQLLARPTIDLALLVKDQAAA
FT                   VATLHARPVAGTTHTYATQLAANDIHVIITTDEQHYQQLLTFRDYLNAHRTDGRKYTAI
FT                   REKGVRNGQADLAAYLQTKAAFMASINDKAQDWLATKDQHEHHDRTVRAELVNMCLITN
FT                   PATGDVLVENKIDAQWSGLTFPGGHVDRGESQVTAMKREVLEETGLHVDQLKLVGTVTW
FT                   VENADGDVSLGTLYTTSHYHGDLLAGSYEGAISWQPLSQLTPDKLAPGVDQILKVFTDA
FT                   HASEAFWGFDDDQLRVY"
FT   gene            770709..771551
FT                   /gene="bglG2"
FT                   /locus_tag="LPST_C0710"
FT   CDS_pept        770709..771551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglG2"
FT                   /locus_tag="LPST_C0710"
FT                   /product="transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97932"
FT                   /protein_id="ADN97932.1"
FT                   /translation="MRIKKVLNNNAFITHNDDHQEMIVIGKAIAYGKHFNDTVDESKVY
FT                   KMFTPISRGDRKLILDMVNEIPIQYFQIAKQIVDKAESDENIELTDSVYIALTDHISSS
FT                   VDRIKSGLMLTNQFLWEIRSYYPKEYQIGQWAIQLINGTCDVTLPDDEAGFIAIHIISG
FT                   ELGEQLDEFHEIINFIKKITSIVTYQLSVEIDRDSLDYNRFVTHLKFFWQYMMENDKKH
FT                   TIGDLSDEMLAIIKGKKVAAYECALKVKDFVQKTYHYTLNNEDLLYMTIHIARIADAN"
FT   gene            771563..773425
FT                   /locus_tag="LPST_C0711"
FT   CDS_pept        771563..773425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0711"
FT                   /product="beta-glucosides PTS, EIIBCA"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97933"
FT                   /protein_id="ADN97933.1"
FT                   /translation="MTYKEMNDQIINGVGGKSNIESVVHCATRLRFVLKDEAKADDDLV
FT                   RSIPGILQVVKKAGQYQLVIGNNVEDVYNELSDMLQLDENVDHNQSKDKRSIFDKIIST
FT                   ITGSIAPAIPLLAGAGMGKVLLLILTLSGLLTEKSQTYQMLNLIFDTGYFFMPAFIGFS
FT                   AAKIFKTNQFLGAFMGLVTVNPNWVAMVAAGKPVSFIGVPIQLVSYSSTLITAILSVWL
FT                   MSYIEKFVKKITPGMIKVFAEPMLIMLITAPLTFIVLGPIANLISMGIASISMFLYDNA
FT                   GFIAIPLLAAAYPWLVSIGIHKALSPISIQLVATQGFDPIIRVVALCSNMSQAAASLAV
FT                   GLKTKNKQLRALALSSTVTAYLGGITEPAMFGVNLKLKKPMYGAMIGGAVAGLFAGFMK
FT                   MKAFIYVTPGLLSLPMWVSKTENYVVLAVATIVIASVATFIATWLIGFEDPVSEEVMKQ
FT                   KQAQANKVVTTKHSINSPVVGEARMLNEVNDETFASGVMGKGIAVIPTEGVVIAPTDGV
FT                   ASAVFDTSHAIGLHLDNDADLLIHVGIDTVELKGQYFETLVKKGERFHAGQELLRFDLD
FT                   KIKQAGYDPTVMIIVLNTKDFLEVLPVPESNESVTADNNLLMLA"
FT   gene            773440..774942
FT                   /gene="pbg2"
FT                   /locus_tag="LPST_C0712"
FT   CDS_pept        773440..774942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbg2"
FT                   /locus_tag="LPST_C0712"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97934"
FT                   /protein_id="ADN97934.1"
FT                   /translation="MDVYKTSPNFMWGVATAANQVEGAWNEDGKGMSIADCLRYRPQID
FT                   SSDYQAVNQMDSAEIENALNDESTKGWAKRHGVDFYHHYREDIKQLADTGINTYRFSIS
FT                   WARIFPNGDDKCPNQAGLDFYLSLVKELAKYQITPVVTLSHYEMPLNLVLNYDAWYDRR
FT                   VADFFGRYARTVIDYLHDYVKYWIPINEIDSIIRHPFSSAGLVADRFASHDFKTVIYQA
FT                   MHHQFVAAAQVVKYCHRHYPQMQVGSMITRTMVYPYNSDPNNVLAATQTMREVYAFSDI
FT                   QVRGEYPEFLLTKLKKAHITIEFQEGDQEVLRENTADFVAFSYYSSICTASNVEGLRVT
FT                   KANRTVGVYNRYLPESEWGWQIDPVGLRLSLIDLFDRYQKPLFIVENGLGALDELSSDL
FT                   RVHDIYRISYLRQHIRQMLIAIANDGVDLMGYCMWGTTDMISASSNQMSKRYGLIYVDL
FT                   DDNGDGSYNRYLKDSYFWYQELLSYKNQIPAIFLDENSIVVQ"
FT   gene            complement(774993..775664)
FT                   /locus_tag="LPST_C0713"
FT   CDS_pept        complement(774993..775664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0713"
FT                   /product="DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97935"
FT                   /protein_id="ADN97935.1"
FT                   /translation="MQLKLEVAPLVNLITILTHLEQSIVPLLTTLDSWSYILLFAVIFL
FT                   ETGMVVFPFLPGESLIFLASTMAATHSDALSIQILVPVFFVAAVIGDTVNFEIGRHLIR
FT                   LPWLQRHLPQSKQQRAQQFFAKYGAKAVMFGRFVPLVRTFVPLSAGAAKMPQPTFAIWN
FT                   LVGVGIWVSVGCSLGYFFGSISFVQSHLSLCFLGITAAALIPATVVALIKTWRQQRISY
FT                   K"
FT   gene            775869..778175
FT                   /locus_tag="LPST_C0714"
FT   CDS_pept        775869..778175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0714"
FT                   /product="DNA helicase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97936"
FT                   /protein_id="ADN97936.1"
FT                   /translation="MAKSIKAAEQEHLDHVVAKIKVAEEQQSQTITRSEKDQADIKRDL
FT                   LNNINIKTDSYEGMMETGLSVRQQQQMMDERQNSWKHATKQLSTLKKLEKNAYFARIDF
FT                   HETGEPKPETIYIGLSSFSDTPDHFLIYDWRAPISSIYYDGGLGHVTYQTPDGEQTVNV
FT                   KLKRQLMVENGQIVTVYDTDEAVGDSMLLEVLDEKSDVKMKSIVTTIQKEQNTIIRDTS
FT                   SDLLFVQGAAGSGKTSSVLQRVAYLLYRYRGNLTAGQVILFSPNQLFNDYINQVLPELG
FT                   EQNMVQMTYFQYASYRLPHMQVETLQQRFETENTPQMAKVTKLEGSLAFFNAVTTYGRH
FT                   LEQADMRFRNITLNDEVIISREKIKSIYYSFNENYHLANRLSATKEELIKILNRKVESE
FT                   MRSKWVEEAVQDLSREEINQLYGNQPREFKNGDKEFKFLARKIVMQRLGKARTQIVRNR
FT                   FLSINMQYAHFLREVPKIIKLADHGISAADWDATVERKLAEIKERHISLTTVSAYMYLH
FT                   DLMTGKHGQRDIRFVFLDEIQDYNAFQLAFLKFSFPQARFTMLGDLNQAIFTKENSHSL
FT                   INELATLFDPEKTRVVQLTKSYRSTQQITDFTKEILVNGEAVTAFDRQGDLPNVVVTPN
FT                   FEAGVDQVVDQLAMNDSERDTTAIIGKSLAECEALTKALKARGEQVTLIQTENQRLAPG
FT                   VIVVPSFLAKGLEFDAVIVWNANQENYQREDERQLLYTICSRAMHELTLVAVGSLSPLL
FT                   ARVNHALYTLNEAKV"
FT   gene            778470..779399
FT                   /locus_tag="LPST_C0715"
FT   CDS_pept        778470..779399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0715"
FT                   /product="enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97937"
FT                   /protein_id="ADN97937.1"
FT                   /translation="MSITEMLGIQYPIFSGAMMRIATHELVGAVSEAGGLGVLGSAGLS
FT                   AEQLRAEIQATRKLTDKPFGVNLMLQMKNCPELAQVIIDEGVKVVTTGAGNPTSYIPPL
FT                   HAAGIKVIPVIASVHHAHKMVAAGADAVVAEGQESGGHIGQTSTMALLPQVVDAVDIPV
FT                   IGAGGVGDGRSIAAMFALGAQGVQCGTIFLTAEECPVPASYKQRVLAASDTDTIVTGRS
FT                   QRDPVRALVNPMLAQYLQLEQTNAPVAELHALADGSFAKAVEDGDMEHGTPMAGEVAGM
FT                   MTTIRPVKEIITTLFGQAREVAAQLKIE"
FT   gene            779568..780497
FT                   /gene="coaA"
FT                   /locus_tag="LPST_C0716"
FT   CDS_pept        779568..780497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="LPST_C0716"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97938"
FT                   /protein_id="ADN97938.1"
FT                   /translation="MEDQMNYYRFSREQWKQFYRNNQHQVPLTAANLHEIEAFNDRISL
FT                   DDVRDIYMPFAHLLQAKYEHYLSWRETESVFLHRQNRQSPFIIGVSGSVAVGKTTTARL
FT                   LEILFKYLYPDRRTQLITTDGFLYPNAELKKMQLMERKGFPESYDMTRLIQFLNDVKSG
FT                   KPLAKAPVYSHQTYDIVPNRFDVITHPDILIIEGINVLQLPSNQAIYISDFTDFSVYVD
FT                   ADADLIEDWYLERFKALMKTAFQDPTNYFYPWAIGDPKDAMAMAERVWEEVNLKNLNDY
FT                   ILPTRNRADLILHKVAHHVIDAVYFRKY"
FT   gene            780591..782147
FT                   /gene="guaA"
FT                   /locus_tag="LPST_C0717"
FT   CDS_pept        780591..782147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="LPST_C0717"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97939"
FT                   /protein_id="ADN97939.1"
FT                   /translation="MAKTDTASFDSILVLDFGSQYNQLITRRIRDFGVYSELLPNTITA
FT                   EEIKARHPKGIIFSGGPNSVYDDGAFRVDPEIFKLGLPILGICYGMQLMTYTLAGGKVE
FT                   SADNREYGKANIDVTSDSATLFKNMPAEQSVWMSHGDLVTQAPDGFDVVATSKNCPIAA
FT                   IQDVDRKLYGIQFHAEVRNTDYGNDILRHFAFDVCQAEANWSMDDFIDMQIEKIRAEVG
FT                   DKKVLLGLSGGVDSSVVGVLLHKAIGTQLTSIFVDHGLLRKGEADQVMASLEGKFGLNI
FT                   IKVDAKDRFLSKLAGVSDPERKRKIIGNEFIQVFDEEATKLNGMEFLAQGTLYTDVIES
FT                   GTSTAQTIKSHHNVGGLPEDMQFKLIEPLRTLFKDEARELGEKLGMPSDLVWRQPFPGP
FT                   GLGIRVIGEITEDKLEIVRDSDFILRDEIKKAGLDREIWQYFTVLPGIKSVGVMGDGRT
FT                   YDYTVGIRAVTSIDGMTADFARIPWDVLQKISVRIVNEVDHVNRIVYDVTSKPPSTIEW
FT                   E"
FT   gene            complement(782213..783904)
FT                   /gene="isp2"
FT                   /locus_tag="LPST_C0718"
FT   CDS_pept        complement(782213..783904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isp2"
FT                   /locus_tag="LPST_C0718"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97940"
FT                   /protein_id="ADN97940.1"
FT                   /translation="MQDYYNMNQTTLSIALDYQPEDHHSARYINQLVESLKLKYDYQFG
FT                   RPREYNLGAMLKLVLLAYSYGIFSSRKIEQFARENKPAGWLIADQIPSYRTICRFRISD
FT                   ELATLTTDSLSQLTQYLRQNGMIDDVSFIDGTKILADANKYSFVWKKNTIRFDKMNREK
FT                   LVDLLGELHEAKIVGEIPAGSELTPELLDIMISKVEDHLVVLNETVEATKQVSPNPAKQ
FT                   QRRTVKSQKRKLDKRRDKMREHQAQQAIYDQRNSYSKTDHDATFMRVKEDPMQNGQLKP
FT                   AYNVQIATSNQFITGYRLFQNPTDTRTLQPFIEHLKANNVLGHTIVADAGYGSESNYRY
FT                   LEDEFGQHTVLIPYGTMLKENSRKWQSDDRKVMNWDYHEKDDYFINPQNVRFNFNAYRQ
FT                   RTDKYGFTRDFKEYIAEKYDENHQLIAAALTPKGYLKRISVNENWEYFKSKQRELLSAP
FT                   ETGQIYAQRKIDVEPVFGKMKASLHFNRFSVRGFDKVTKEAGIVILALNIMKLVTVGTS
FT                   FKNQRRKQMGRETKIRFLVPFTYTEASYVTASFYQIVSDCIVFDFC"
FT   gene            complement(784086..785261)
FT                   /locus_tag="LPST_C0719"
FT   CDS_pept        complement(784086..785261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0719"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97941"
FT                   /protein_id="ADN97941.1"
FT                   /translation="MPRKWTPLKRYPGVYSYPTQKGKRYGTRRKYKSSTGKSDYWSKSG
FT                   FLSAADADLLLKKFELELATDKVGQIEGHKVTVDAYFWRIYDRKVKLNIWRPITSRSMK
FT                   NYYKEWFQAPFGNVKLDELSRSAYQEFIDSLAEKDLAKNTVERINSVMQLIMNDAETND
FT                   IIYKNKLRHMNINGKAPRDQSLSKDDFDAYMKYAKEHLSRYDYSMIYMLTLGERRAELM
FT                   GLRTRSSFQFEFDEVNQREVCAIKFDMGRTSEAKDGGPLKTPSAYRTIWVYGEMVDTIR
FT                   FAIKASDNILMNLGKPVPQDHFLWLNPQTGNPFHPAQPSTLMKRLSGKCGIKVHPHQLR
FT                   HYFATRAKSDRLSDSDVMHWLGHANIQQTNDYTRASKEGAMNVFNGIKNDI"
FT   gene            complement(785567..786433)
FT                   /locus_tag="LPST_C0720"
FT   CDS_pept        complement(785567..786433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0720"
FT                   /product="KilA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97942"
FT                   /protein_id="ADN97942.1"
FT                   /translation="MALDREIINANGTQVEAFRNNDIDADFISITDIAKYKNQDNPNDL
FT                   IRNWMRSRNTIEYLGLWEQMKNNNFNTDNYQELLNESGSNTFVLSPAKWIKETNAIGII
FT                   SKSGRYGGTYAQSDIAFEFASWVSPEFRLYLISDYQQLKQSESSHLNLDWNVNRTLSKI
FT                   NYQIHTDAIKEKLIPSTVSKKQAGYKYASEADRLNMALFGMTAKQWRSSGKRGNLRESA
FT                   TLEQLTVLANLESMNAELIKNNVSEFERTMRLNNMAKDQMATLLKNSTSMKQLKNLTAH
FT                   NSPKKLN"
FT   gene            complement(786581..786651)
FT                   /locus_tag="LPST_Ct0011"
FT   tRNA            complement(786581..786651)
FT                   /locus_tag="LPST_Ct0011"
FT                   /product="tRNA-Gly"
FT   gene            complement(786692..788680)
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0011"
FT                   /note="hypothetical protein"
FT   gene            complement(788840..789025)
FT                   /locus_tag="LPST_C0721"
FT   CDS_pept        complement(788840..789025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97943"
FT                   /protein_id="ADN97943.1"
FT                   /translation="MKQEHEARTWGFKQQMTRSQLDKLRKCYAENDYELADDLGIQVDY
FT                   LHEVGQSYGLHYKHVR"
FT   gene            complement(789243..789584)
FT                   /locus_tag="LPST_C0722"
FT   CDS_pept        complement(789243..789584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0722"
FT                   /product="putative repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97944"
FT                   /protein_id="ADN97944.1"
FT                   /translation="MTKGQRIAEMRKRKDESQNVLSKVLHVSPSTIGMWETDQRAIKDE
FT                   DLSKLADHFGVTTDYILGRKVDLGNVPVAAHIDGDFEDLSDEERQEINDYIEFKKAQFK
FT                   KRKENENKD"
FT   gene            complement(789915..791162)
FT                   /locus_tag="LPST_C0723"
FT   CDS_pept        complement(789915..791162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0723"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97945"
FT                   /protein_id="ADN97945.1"
FT                   /translation="MSQDHSTKVLLQIKDPNITDLVVQEATNGSLQVLAKLTYPVTVCA
FT                   RCGKRSMVKNGFKTVHIRIPRISERVTILNLKKQRFICKNCGKSSLTTTTLVKKHHQIS
FT                   ENSLHAIDLSLTEDRTMASIAAQYNVSTNTISRRIKLLGQGTQPAFNGLPTMLCIDEFR
FT                   STGKQMSFIAVDAQTHDIITILPGRKNADIKDFFLNHYSKRHRDRVTRVVMDFNSQYQP
FT                   AIRTLFPHAKLVADNFHLVQMALRSLNQTRVQLMKRFNPKSREYRVLKYYWRLYLKDYD
FT                   SLEKRKPQWFAHLKDRMTPEQLVVAGLNLDQQFRQTYQAAHALVKAFQKRDYRSFKAAL
FT                   GHVENVSPQLMTNIKSFIKNRQLIKNMTTGRLSNGPVEGVNRKIKQIKRTAYGYKNWQN
FT                   FIYRIQNQNRKKEPNS"
FT   gene            791401..791994
FT                   /locus_tag="LPST_C0724"
FT   CDS_pept        791401..791994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0724"
FT                   /product="putative abortive infection protein AbiGI"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97946"
FT                   /protein_id="ADN97946.1"
FT                   /translation="MGQREEIIAYLNKNGGQITSKTANSMGISPRVLRSMYAHGQLERL
FT                   APGVYIDPLEFGDDIAALQYSLSKGIFFKDTALFLYGMIDRTPSTYEMNFPLPYAYSTK
FT                   NDAPIKIYRQQKELYEIGITTTKTPGGHLVKVYDVERTLCDILRTRDRSDAETIKQAMN
FT                   SYIHRKGKNLRQLMTYARIFKVEEEIRAYMEVLL"
FT   gene            complement(792471..792839)
FT                   /locus_tag="LPST_C0725"
FT   CDS_pept        complement(792471..792839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0725"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97947"
FT                   /protein_id="ADN97947.1"
FT                   /translation="MKSKNLALTNGIVGLVGGIILLFGGWFIAGGIVSDAATGSVSNTS
FT                   GAAAFLNILKIAILALGIIALIYYKGDKRVGTASGVLLIVGGAIALIPFLGWIGGILAI
FT                   IGGSLYLASLKHFSQPQA"
FT   gene            complement(793073..793441)
FT                   /locus_tag="LPST_C0726"
FT   CDS_pept        complement(793073..793441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0726"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97948"
FT                   /protein_id="ADN97948.1"
FT                   /translation="MPAKTQNNFIRRLINLRDSRNWSKTEVARKLGLSSMQRYANYEYG
FT                   TNEPDLNMLKQIADLYDVTTDYLLGEDSASKWIARKDTTDLKDFLTAHVDSMTYGGEAL
FT                   TEEERQQVRVAMAVIFWE"
FT   gene            793979..796942
FT                   /locus_tag="LPST_C0727"
FT   CDS_pept        793979..796942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0727"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0727"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97949"
FT                   /protein_id="ADN97949.1"
FT                   /translation="MKNKQANQILRAWDLAEKISGGELDKKAKWFSGDIRKTAYQKRES
FT                   GTINEKISQNNQSSDQHVTISLLYLGAYKKQDLRDSIQNIRFRDTEMVQNRDPAKGYSV
FT                   ALIVNSDWSFQKIEVPYAAYFYLKLRQENIEEAMHGQQYDDFKSQLSQQLEEVIDRKRA
FT                   DLAECLALANQIVLKTFKLAGTRNVSQLRGLFQIQDEPPMLNSFYTEDIERVLQASADD
FT                   SLLLKYLGLNPDIATKQEVDQNRDFISKLLDVENLPDGRWPGPEKYFQSLMQQVAVNVI
FT                   RDKGPIKTDLKTVNGPPGTGKTTLLQDVFADTIVQQAKVMAQLEKPMDGFRRIKPIELF
FT                   SNCKYNAYELIPALQGYGIVVTSNNNSAVANISKEFPSRNKIRQYPNENREKQDEYRTQ
FT                   LEEIDYFSDLANRILETADSWGMFAVPMGSKANQQKVFKHINHGVLKKQLSVYSDSWAD
FT                   ARQNFNTALEAVHQEKARLHRMISIVERANPSVVDQAYLELKVVDEGIEVLNQEIANLT
FT                   QKIENTRHRLVTLPKKRFLIFWQHETPTHDSLRFHISNLNKKIEGLNERVADRRKERRH
FT                   VVHLIAQQEKIIREVEPIQKQLKKEGIVVFNDDFWRQTNEKRQQALPNNSRVLQNKRAR
FT                   LFIAAMRLRKVFICEARVPISNAWEFFAHQDKLVFAEDTLALTAGFQIMQLLIPVMSTT
FT                   LASVGRMFANFGENTIDNVYIDESGQATPASAVGIAWRAKHLVAIGDPAQIEPVVTTNE
FT                   ATLRTIARDFKVSEQYLLPTTSVQQLADQGSIYGMHRSNHTWVGIPLWVHRRCDSPMFE
FT                   IANEISYENKMVQGKPTKLSQVERSRWINSKGKATNQQFVPENVTALARIMKKRRDEGK
FT                   SLDQMFVISPFRAVVNGITNKLPKEFNDGAISKKWLQEHVGTVHRFQGKEADVVFLIIG
FT                   TDQDTDGGADWAFSKPNLLNVAVTRARHDFYLIGDYHRLKSKPYAEVAARELPLLDN"
FT   gene            797244..797936
FT                   /locus_tag="LPST_C0728"
FT   CDS_pept        797244..797936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0728"
FT                   /product="CAAX family protease"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97950"
FT                   /protein_id="ADN97950.1"
FT                   /translation="MSKSHSTNRTVTWLLNIVKLIGLFALYQLAMIPTMMPAIRHGFSA
FT                   TATLIAGVASLVLLGSLIWWLVTIYRRQAPIVTSLSRPTRPVLTIVGLFILVELGNVLA
FT                   GLIVKQTPENQVILDKVFTTSPVINVVMMAVLAPIVEELIFRGLMYRWLFPRVTNWVSF
FT                   TVALVFASLVFALAHTLSFSPALLAYLPIAVVLTFTYVWFNDIRYSIALHIINNSLAMV
FT                   GMLTLLSR"
FT   gene            798156..798500
FT                   /locus_tag="LPST_C0729"
FT   CDS_pept        798156..798500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0729"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97951"
FT                   /protein_id="ADN97951.1"
FT                   /translation="MRIITPIENSRRHEEFCPLDTTLSILSGKWKSIIICRLMGSSQRF
FT                   SSLLKGMPGCTSRMLAMQLKELVADQIVSQQTVANHSVYELTNIGVSLVPIVEAMDRWG
FT                   KAYLETLQLA"
FT   gene            complement(798632..799930)
FT                   /locus_tag="LPST_C0730"
FT   CDS_pept        complement(798632..799930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0730"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0730"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97952"
FT                   /protein_id="ADN97952.1"
FT                   /translation="MVYFYPINDSRWYTFIHLFLYCKALKLLVVPNSKGVSPIFNQITI
FT                   HNQHTENWLIIGLFCGAFVTGADAFIISALLPAIATSLHVPTNTAAYGVTVYALCYAIG
FT                   APLFGPLGDRFNKRFLLISGCGIFLLGTLLCGLANSLLTFYLYRAIAGIGAALFVPNIW
FT                   AFIGTYFNGQRLNQVMGIVMSALSLSIATGVPLGALLAQLSSWHMAFWGSAMLTLIALS
FT                   ILTIAIPSLPSQNAQPDGYFTSFKTLVHTPHAIAALLITLTWMTGFYGVYTFLGVFATA
FT                   TFHFNTMQTGLIFITYGSANFVASFFAGKLISLLGKKQSVTINGLVSATLVLSLGIWGQ
FT                   HLAVLLIILVVLALSQGWGVTALTATIVNIVPSNRSTIMSFNSAFLYYGLTLGSAAGGL
FT                   LLTKIGFYAVTIAAATALLVAVLIANALSHYSD"
FT   gene            800204..802708
FT                   /locus_tag="LPST_C0731"
FT   CDS_pept        800204..802708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0731"
FT                   /product="cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0731"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97953"
FT                   /protein_id="ADN97953.1"
FT                   /translation="MNKKLLYTSITTAALFVGTQLGVNNAQADTATDNSDTTNQTSATQ
FT                   GSAQTATNEKLATVKPTSQQQYQANVQTAKGNVVTAQNQVNTTQAKVATAQGQVTNQSQ
FT                   LVAIGQSQYDAGKARVDRAQQTLDANNQVLAEAENKVDAAKSQTAAAETQIPADQQQIA
FT                   ANKVAIANQPATEKKAQTAKDAADTALTQAKTEQATAQSDADAASAVTAAKQATVDQAS
FT                   AAQQKAATQANQAKVAVASAQDAVNKNTQAINSAKTAIQNTTSQINANNQAVSTAQAKV
FT                   TAAQAALAAAERPTTTTESQNKYDAAEFPQSQLTGAETVSVAYPSNGKYVPNADKINQY
FT                   MFEYINQLRALNGQPALKQTSTLQNNAIARAAAQVDGGLDHTGSSYAENLTQVYPQWFM
FT                   SDQETAYNAVMGWYDESNNVESGSFGHRVNLIYSTGDAGVAINLAKHVAAFEVDNAGMT
FT                   EAQQDKYVDLFDNAHTNAATGTKALPAVTFNYVQTTPADPKKIAAANATLIAATASLNG
FT                   LQNTGKTLATTLANQNASLQALQNQTSGLQATVTTKQAQVQVAATSLKAANVALTQAQG
FT                   QLATAQQQQLSPVRNLKTSIAKTAAAQVTATQAAKNLASTKTLIADLTAENARLAAEIA
FT                   ALPARIASMKAQIATAEQQLAAAKAVLAQGQAQVDTANEQLAAGKAQLDRKKTDLAQFK
FT                   QVLGAARVDLAVAQGDLTATKAFLARVEANKFTTTTAAAADGIAETINVDQSTGVTAPH
FT                   ATATKTVANSNGTINATSTSVDVSDGDVTTKLVAGAKQQPVAAQATALPQTDEKQSSSL
FT                   MAVGLFAASLALFGLVKPRKHA"
FT   gene            complement(802840..803148)
FT                   /locus_tag="LPST_C0732"
FT   CDS_pept        complement(802840..803148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0732"
FT                   /product="XRE family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97954"
FT                   /protein_id="ADN97954.1"
FT                   /translation="MEYFGDKLKSLRKAKKLTQVELAQQLDISKWAITSYEQGKTYPSI
FT                   EVLIKICSVLDTSSDYLLGISDKLPVKMSTLGFTDEEVRLLLQFLNLFQQNRTPIDK"
FT   gene            803317..805890
FT                   /locus_tag="LPST_C0733"
FT   CDS_pept        803317..805890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0733"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0733"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97955"
FT                   /protein_id="ADN97955.1"
FT                   /translation="MKKSRIALMSTALVAAGATAIGTATTAQADTTNPTTNNTTTGQTQ
FT                   TAKTSQSELDANIKDAQTAVNNAKDKTGQAQTAADAAKGAAVQSKSQASTAQATTTKVQ
FT                   TDLSTAKTAEAEAQKVADSATDDAINQAQDAVTNQQNQNQQLTQTVDTAKTDVDKAGDS
FT                   VNSAQTVVDQTNTDATQANQTVANAQAQVDHAQDVVDGKDSATAQQNLATAQQDLSQAQ
FT                   TNVKQANDATKQASQAVSDAQTKVTSAQTSVDQANQAQSAAQQNINTATQAQAAAQKAL
FT                   DDASQHQGSTQTFTLGTEYVNALKAYNDAEGYNLNSSDPVVQRLIKASDAMSQMLKFQS
FT                   NAVDKNIKINGRQDLTPEVLSQLSTYAAQLINSMRDEFGAPHVIVTNGSVKFAGDIADE
FT                   VTADQWILAVENAHDVPAINRAAAKNGLFSKATANMYEDAALAKATSNLGEWHLTLDDF
FT                   KQMIFTSLQSFMANDEEWSHANSILGAAAHGKDQYFGVSFSDSIGENVLGAPGKTLNFD
FT                   SHFAFVPQDSSYWVDESKFDKTAIKNETVSANEIKQLESDLATKKTATNTAKTALATAN
FT                   TNTTKAQNTLTAAKTTLATAKQQQANAQTTLTNAQAAVKTATAAVAAAQKAVDETSASD
FT                   ATKQQALSDAKAALKAAQAVQSQKQASLTAAKVKLATANQALAQAKVKLANAEAALKAG
FT                   QQALANKKVYLDSLTHADANLAAAKQAVVDAQAAYDQAVQALKVAQTTADSDAVTYQQL
FT                   QQVADVAKQVLVAAQAKLDQLLQTKALNDAIDRTNQETSQSKSAQGESMTNTEHDMTNG
FT                   GGTTLNTKYALGTEHATTGGDTVTLKAHRALSAEQATTLQQRKRL"
FT   gene            806031..807805
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0012"
FT                   /note="transposase"
FT   gene            807858..808430
FT                   /locus_tag="LPST_C0736"
FT   CDS_pept        807858..808430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0736"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97956"
FT                   /protein_id="ADN97956.1"
FT                   /translation="MDFLKNKRSATAGVASAQQALAADQDKLAKDKKRFHKTIIGFGIL
FT                   AVAALLLQSGASLVITSAAIAIGLFVFKYLHYLSPTNEVIQKDQASLQQELANPVYQQE
FT                   ANGFPEKFYNYWDALRLWKLVNENRARDLQEAFNLLETQHFQEDQLAAQEEIKSLQADI
FT                   AANAHATAVNSGIAAVSSTISALNSRK"
FT   gene            808640..809497
FT                   /locus_tag="LPST_C0737"
FT   CDS_pept        808640..809497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0737"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97957"
FT                   /protein_id="ADN97957.1"
FT                   /translation="MNLAEIKTGNYRSLTGSDWKMIGAKVNYHKGNGMEFDTSQVNGQL
FT                   SIAKDKITTGTLTVTKNSIAVDGKNEVTQLRNNGKIFSVSTENDDGSNWAMTFYPAGTT
FT                   SDYQVDGTGSTNRQNLITVWTSNNNYTQVFAQNMTSTSSTTAANQKDGVLWNTSKNKQL
FT                   DAFMTQWSQTMNQDYAKYDGVHELDISTGLLYPRDLSDVIVKGQRASIAWAPSGKGTHE
FT                   YNVVAIYNHDGTEPPLPNHITYFFAFRNDSPIVLVDQSRDGTPTLGETENVKLKEGFVR
FT                   IARN"
FT   gene            809564..809920
FT                   /locus_tag="LPST_C0738"
FT   CDS_pept        809564..809920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0738"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97958"
FT                   /protein_id="ADN97958.1"
FT                   /translation="MTVSKKSIIGVIIGIVVIVIAIIALKPRGLQGTYTSTSEELGTDT
FT                   IVFDGKNYKETVVKTVDVLGHKKTYRDKYSGTFNVEDNEVTFEGKTANGATAKLSKDKK
FT                   VLSIQNGQQLMKKE"
FT   gene            810515..810898
FT                   /locus_tag="LPST_C0739"
FT   CDS_pept        810515..810898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0739"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97959"
FT                   /protein_id="ADN97959.1"
FT                   /translation="MGKISSRMVFEIITIIGIVTFAVISLTPSTAKQQSVQLDHGRMSY
FT                   SGAVLKHKFDGQGTLQVNKQGRYVGNFTNGRFEGAGEFIAPNGWRLQGNFSKGALNGVV
FT                   KLRVGNKTYAKKITGDGKLENAD"
FT   gene            810888..812735
FT                   /locus_tag="LPST_C0740"
FT   CDS_pept        810888..812735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0740"
FT                   /product="acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0740"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97960"
FT                   /protein_id="ADN97960.1"
FT                   /translation="MRIKWFSLVRITGLVLVLTYHFFQTQFTGGFIGVDIFFTFSGFLI
FT                   TSLMVDEFARSDNFKLMAFYGRRFYRIVPPLFIAVLLVLPLTYLIDHDFVTDIGKQVAA
FT                   ALGFTTNYFEIATGGSYENKFIPHLFVHTWSLAVEMHFYILWGLIAWLVAKISRRLASG
FT                   RRALTRFRWGLGLLTTAFAIESFVMMYFGAVGLKDFSPVYFSSLTHCFPFFVGGLIGVL
FT                   SGIKAQGPIYRWTTAHCNPIIAGAVMLISFILLVALGDRMKFDALQTYQGGLLLATVLA
FT                   GIMIYGARLLHDHTPNLKEPRWMTFLADVSYSVYLYHWPLYVIFSHMMVNWLAALLTTV
FT                   LSIILSALSYYVLEPVIAGKRAHVFGHTVTWRQLQLPVITAGVLLAVNTGVVVKNAPQL
FT                   STLEQNLWVSGIYQDIDKIGTTHEAVLAAVTPKKKQATPKGDQEKAPGVSIIGDSVTLG
FT                   TRSYLGDHVANSNIDAEGDRTMNLAYKVMMNQQRSHTLRQYVVICIGTNALDDYEEQTM
FT                   KIIHDLEPGHKLILMTPYNARADADWNSSKLAVLERRLPAKYKFITVADWGKIAAQHPE
FT                   VFKGTDGVHFGGIRAGDILYAKVINQALTAAKQTPAKPA"
FT   gene            812976..813230
FT                   /locus_tag="LPST_C0741"
FT   CDS_pept        812976..813230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0741"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97961"
FT                   /protein_id="ADN97961.1"
FT                   /translation="MLGWLWSLIVGGVIGALAGAITSRDVPMGIIGNIIAGLVGAWIGQ
FT                   ALLGTWGPSLAGMALVPSILGAIILVLIVSAIFGMRKKR"
FT   gene            813242..813787
FT                   /locus_tag="LPST_C0742"
FT   CDS_pept        813242..813787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0742"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97962"
FT                   /protein_id="ADN97962.1"
FT                   /translation="MSRLAKFTVTLVGIVLVLLAVFELGQLYPIPWLTSWLADLTINYP
FT                   MVWSILLMVFAIIAGIVGILLVIVGLFRPVKVSTLTYDGKVGQLTIPQRALERDLQYRL
FT                   VNQLNLIDPEVHLKLRRRRRVRVKIDAMVNTDASLETTAQQAATLAQDYLKNQLGLTVE
FT                   QPVVQVKPANHQRKLTVV"
FT   gene            813800..813982
FT                   /locus_tag="LPST_C0743"
FT   CDS_pept        813800..813982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0743"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97963"
FT                   /protein_id="ADN97963.1"
FT                   /translation="MSNAQYGFLIGLLLGIVWVLTSFSAVLLVAVLGLIGWAIGRFVHV
FT                   DLAAVSQKLSEYLSK"
FT   gene            813997..814419
FT                   /gene="asp1"
FT                   /locus_tag="LPST_C0744"
FT   CDS_pept        813997..814419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asp1"
FT                   /locus_tag="LPST_C0744"
FT                   /product="alkaline shock protein 23"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97964"
FT                   /protein_id="ADN97964.1"
FT                   /translation="MAQPEQQLQTQLTFDDGVIEKIAGLASRNVDGVLSLEGGMLSNLT
FT                   NRFRDEADPTQGVDAQVGKKQVALDMTMIVEYGKDMRQIFNQICQRVQQDVERYTGLKV
FT                   IEIKVHVSDVMSKRDWQDQATGKPNTDQSTDKRQVE"
FT   gene            814441..814920
FT                   /gene="asp2"
FT                   /locus_tag="LPST_C0745"
FT   CDS_pept        814441..814920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asp2"
FT                   /locus_tag="LPST_C0745"
FT                   /product="alkaline shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0745"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97965"
FT                   /protein_id="ADN97965.1"
FT                   /translation="MVRRFLTKQGGILMEATATSLKPEVVFDDTVLAKIASNTAQEVEG
FT                   VLSLQGNLIDDISNRFTDKDRPQTGVSVDTDDDDQTVGIELTAILAYGKNGQEILARVA
FT                   DKVAKAVKSMTGYQVTKLKLVVKDMLTTEEWRQQNDKQEKAPEKKHPEPKDDGPH"
FT   gene            815094..815924
FT                   /gene="hpaG"
FT                   /locus_tag="LPST_C0746"
FT   CDS_pept        815094..815924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaG"
FT                   /locus_tag="LPST_C0746"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioateisomerase /
FT                   5-carboxymethyl-2-oxo-hex-3-ene-1,7-dioatedecarboxylase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0746"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97966"
FT                   /protein_id="ADN97966.1"
FT                   /translation="MYNNINEVINMKIGMRANRPFIITDEQHGQTVLNAKTVLEALHMP
FT                   AADRQLGSLETFAPQELAAPITAPRQIFAVGMNYRDHSAEIHITLPKVPSIFTKFSSSL
FT                   APANVTVATHGPETDWETELVVMIGKGGRDIATADAMAHVAGVMVGEDLSDRAVQFEND
FT                   NPQFSIGKSFENYAPVGPWLTTVDELANLDDEVITTTVNGQTMQQAPLSQLIFKVPDLV
FT                   HYLSTVCELQPGDLIFTGTPSGTGVGRNPQVFLQAGDQLCGQITHLGTLNITIK"
FT   gene            816056..817066
FT                   /locus_tag="LPST_C0747"
FT   CDS_pept        816056..817066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0747"
FT                   /product="lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0747"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97967"
FT                   /protein_id="ADN97967.1"
FT                   /translation="MKKVWVGLLLGSLLLAGCTTSPKSSAPKTSQKATSTKVAAKQAAS
FT                   QKSTASSDSSSPAEATLWNTGKQAALSTFMAAWQREMGQTYVGTYDDKVPDHLGFRFPN
FT                   ALLNGSLAGRIKWGSQSVDLKWSKDGEDRSEFQVVAVATGGKAEAQYPNTYFFCLHHRR
FT                   PVVFVTQTTNGDELIIHDTQNSALQAGFAKIITGSRPTTLTDSALNVNMSRDAKANQWP
FT                   QSYQGTWYYYNKYDHKINSMTQNDTDGLKLSYAAAEGQKWIHIMGAEQTAGAGNFEYVR
FT                   YHYFDGRQIPVLMNASGAGAWFDNNAYPSAAAANQMRDWQYGDESKTSPAADSLD"
FT   gene            817428..817760
FT                   /locus_tag="LPST_C0748"
FT   CDS_pept        817428..817760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0748"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0748"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97968"
FT                   /protein_id="ADN97968.1"
FT                   /translation="MQKNTEHTLNLTMTMILKIGSARSMIAAALAEIAAYRYEAAREKL
FT                   RQAETELLTAQRLQVRRLIENAKAQRFVHSTLFMNAQSALVNVMGELQMTENLIGAFER
FT                   WEPEAA"
FT   gene            817866..818438
FT                   /locus_tag="LPST_C0749"
FT   CDS_pept        817866..818438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0749"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97969"
FT                   /protein_id="ADN97969.1"
FT                   /translation="MTVTFSNEDDHKFHKLTDQCFTANPKLLTKASISVPLTTRTIQPR
FT                   RYLVVTKINQATLATATWQPVTGAIALHKHERLIYDLGALYVGHFQVAIDVAGSPMDAP
FT                   LLMRTRFAEQLQELSVDASRVTSWLPTAWIQDDTRHVELLPTTVQFERRYSCRYIMLEP
FT                   VGQSLKWQPVLADAEFEEIIDDFRQAA"
FT   gene            818620..821154
FT                   /gene="pepN"
FT                   /locus_tag="LPST_C0750"
FT   CDS_pept        818620..821154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="LPST_C0750"
FT                   /product="membrane alanine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0750"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97970"
FT                   /protein_id="ADN97970.1"
FT                   /translation="MATTTHFYETFQPEHYDLYININRADKLISGKSTITGDAKAQEVL
FT                   IHQNGLTIAGVQADGADVPFTVDNAIQGIRIELAKAGQTTLTITYSAKLTDTMMGIYPS
FT                   YYEVNGVKKELIGTQFETTAARQAFPCVDEPEAKATFDLAIKYDEHDGETILSNMPEDH
FT                   EADGVHYFETTVRMSTYLIAFAFGELQGKQTKTKSGVTIGVFGTKAHKANELDFALDIA
FT                   KRSIEFYEDFYQTPYPLPHSWQLALPDFSAGAMENWGLVTYREAYLLLDPDNTALETKQ
FT                   RVATVIAHELAHQWFGDLVTMKWWDDLWLNESFANMMEYVATDALEPDWHIWETFQTSE
FT                   ASMALQRDATDGVQSVHVQVEDPAEIDSIFDGAIVYAKGARMLVMARALVGDDALRAGL
FT                   KQYFINHKYGNAKGDDLWNALADASGMQVGDIMHSWLEQPGYPVVTAAVVDGQLTLSQQ
FT                   QFFIGEGEEVGRQWQIPLNSNYEAAPAIMKNQAVTVGDYAKLRDASGQPFRLNVGNNSH
FT                   FIVKYDQTLLDDILAHVDDLTAIDQLQLLQDLRLLAEGRQISYAAVVPLLSRFAASHST
FT                   VVNAALYQVAGNLRKFVMPDSDEEKHLQTLFDQLSAAQVKRLGWLPQAGESNDDQLTRP
FT                   YVLSAALYAKSSAAVLAAHELFEGNRDKLATLPADVRVFILRNEVKNFGSKDLFDSLLT
FT                   ASRQTADASYKADICDALTATTDPELIKQLVVKFEDADTIKPQDLRAWFRGVLANPAGE
FT                   QAAWDWIRDEWSWLEATVGGDMEFTTYITVISRVFHTAERLAEFKAFFEPKINTPGLTR
FT                   EIKMDTKVIASRVALVEDERDAVNAAVAEVVK"
FT   gene            821377..824250
FT                   /gene="hsdR"
FT                   /locus_tag="LPST_C0751"
FT   CDS_pept        821377..824250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="LPST_C0751"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0751"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97971"
FT                   /protein_id="ADN97971.1"
FT                   /translation="MMASGHQSEAELENHLIRKLQSIGYHYVEIPDVETLNAHFRAVLS
FT                   ERNQERLKGTPLSDREFQAVLNDLIGAKTHYQVAQILRGSVVQPTGKINIKRDDDSSLY
FT                   LEIFNGKQFDQNIFEVSHQMTVEGRHENRYDVLILINGMPIAQIELKRQGVEFTQAFNQ
FT                   IIRYRTESYAQAKLMRLVQVFVISNGNETRYFANGDGELNSNFMFYWTDEHNNWLNDLD
FT                   AFTTTFLSKPRLHSLIAKYTVFDSSDHKMLLMRPYQIYATEAIIKQAIDHPHENGYVWH
FT                   TTGSGKTITSFKASQLLLQETDAEKVIFMIDRADLDIQTVKNFSAYLPETTGGQSPLDR
FT                   TDNTAALVKQLSSNDNGLIVTTIQKMNNAVSNDRYKDILTPYHDRKVIFIEDESHRSQM
FT                   GEMRKNVNHWFKNAQHFGFTGTPIFQQNMGPDGRTTKDLYENQLHQYLIRDAVRDGNVL
FT                   GFSIQYLSTFEETDHDITDEQVPGIDTQEVYESEERLTKIVEHILLNHSHITKNKHYNA
FT                   IFTVANTRMALKYYQLFRRLDPDHNLKVTTIFTWAANEDDNEEHQKQDDVTSRMGLDQV
FT                   VKDYNQMYGTDFSTDKFKDYFADVSKRMRDHNDQTPTDNIDILIVVNMFLTGFDSKRLS
FT                   TLYVDKNLQWHGLIQAFSRTNRVEGKQKPFGNIIAYRNIKNKTDEAVALFSDGDSSGFL
FT                   APDYDELKAEFTDKIGQLLTVTPDVQSVDDLYNRGDDALYEFVMAFRAVLRVYNRIRVY
FT                   DDFEWAQYEPEFSDQLMEAFRGKYFTAYQTIYQRKTQERVSILDDVDFDISLLETDTIN
FT                   VDYIVNLISGIDLMSSTERKQDIQKIEHLLDNATNDQLKSKVELLEQFLNEVLPTLDTD
FT                   DDIGMSLSNFMAESQRAAIKGFSQEHHLSEDFVNEQISDYNFYGKTKDKEIIDKLSANG
FT                   LGFREKRQAKREIKDFVSTIDRKYSLS"
FT   gene            824264..825850
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0013"
FT                   /note="site-specific DNA-methyltransferase
FT                   (adenine-specific), HsdM subunit"
FT   gene            826190..827113
FT                   /locus_tag="LPST_C0752"
FT   CDS_pept        826190..827113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0752"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97972"
FT                   /protein_id="ADN97972.1"
FT                   /translation="MSTTILSFQNRVVIETLHNEGRSLRYIANYLGFSKTTIFNELHRL
FT                   NSEYQAGLAQTDFERKVSQRGRKSSLTKNLKHLIEEKIQVHKWSPEQVAHVVGIAYKTV
FT                   YNWIDQGWLDIQLPDLPDHGIRRHRAKEKRGTFNHGRSIEERPHKVETRQEFGHFEADT
FT                   VLSGKRKGQAVATFVERKSRLTIVKRLHGRDSQSMTQAVLELASQLQDKLKTLTVDHGK
FT                   EFANYQTIERRTGTQVYFAHAYSPHERGSNENRNRVLRRFIPKGQAIEELSDHQLVQIN
FT                   WYLNSRPLKCLNWHTPIEIFLLNLRH"
FT   gene            827202..828095
FT                   /locus_tag="LPST_C0753"
FT   CDS_pept        827202..828095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0753"
FT                   /product="type I restriction-modification system
FT                   specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0753"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97973"
FT                   /protein_id="ADN97973.1"
FT                   /translation="MFMDTNMMALTPVETDLYFLYFLISEENLSKIADTSTIPQINNKH
FT                   IIPYTIYLPCLMEQQRLGKVLILLSNLIAANEDKLEQLKTLKKLMMQKIFSQEWRFKGF
FT                   TDPWEQRKLKWFLRVSKLKNIDGIFDKNSVLSVSGEFGVVNQIAFQGRSFAGKSILNYG
FT                   ILDHNDVVYTKSPLKSNPYGIIKTNLGKAGVVSTLYAVYAPLKTVYSPILGYYFNLDTR
FT                   VNNYLRPLVNKGAKNDMKVRDEAVLEGKVCIPDSIETQKRICNLFSLIDNLIAANEDKL
FT                   NQLKELKKYLMQNMFV"
FT   gene            828246..829163
FT                   /locus_tag="LPST_C0754"
FT   CDS_pept        828246..829163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0754"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0754"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97974"
FT                   /protein_id="ADN97974.1"
FT                   /translation="MAQHVKFHQYFFQWMQLYKLDAVRPVTYRKYEMSHRQLVMLAPDL
FT                   KMSDLSRLTYQQLLNDYAETHERQTTMDFHRHLKGSLIDALEEGFIDRDPTRKAIIKGI
FT                   KHRQHKTKYLHQYELQALLNELNLNNEVNWDYFILLIAKTGIRFAEALGVTPADFDFAH
FT                   QTLSISKTWDYKSAKSDFAPTKNNSSVRKVPLDWQTVIQFSQLTKKLPEDHPIFVQAKV
FT                   YNDTVNHYLERLCKHASIPVISVHGLRHTHASLLLYAGVSIASVARRLGHSNMTTTQQT
FT                   YLHIIQELENQDNDKVMKHLASLI"
FT   gene            829793..830287
FT                   /gene="hsdS"
FT                   /locus_tag="LPST_C0755"
FT   CDS_pept        829793..830287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="LPST_C0755"
FT                   /product="type I restriction-modification system
FT                   specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0755"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97975"
FT                   /protein_id="ADN97975.1"
FT                   /translation="MGQSPSSANYTNNPEDHILVQGNADMKNGYVLPRVWTTQITKKAE
FT                   AGDLILSVRAPVGDIGKTDYDVVLGRGVASIKGNEFIYQTLKYMNDIGKWTRFSTGSTF
FT                   ESINSADIKDARIGYPKLNEQNLIGNILEKMDSIIAANEQVPKLVIKIVKNSLVNLLLF
FT                   N"
FT   gene            complement(830591..831121)
FT                   /locus_tag="LPST_C0756"
FT   CDS_pept        complement(830591..831121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0756"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0756"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97976"
FT                   /protein_id="ADN97976.1"
FT                   /translation="MKVYLIRHSEPTYQQVTTAGLTGFGRELGGLTDRGIMLAQQCAQQ
FT                   PLFAQVQLILSSPYTRALQTALEIVRFNDIPLKVELGLHEWLPDNTGIRTDTDEQAATA
FT                   YKLYRQHAGKRTIASPLPYETAAEMKTRVLATLNKYATSYDCIACVTHGEVMRQFGDQK
FT                   DVDYCGVRVIAVD"
FT   gene            complement(831236..835009)
FT                   /locus_tag="LPST_C0757"
FT   CDS_pept        complement(831236..835009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0757"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97977"
FT                   /protein_id="ADN97977.1"
FT                   /translation="MKPNNVNNQNKRHQSRWVITSATAMILTTLTIASQAAAADDTVTT
FT                   TTNEPTNSQLNTNTQVNATQVNLKADTSTSVSTIKSGQSAVAATSPTTSTGSPSEHSSS
FT                   VNTNPQQQSANPASQSQATTTSESTPTTDIKHPTQTAPAQTTSASTTEPTTESNTESAT
FT                   DSQAKATTTDNQASKQPSQQAVPASSNSTTTEVNTQSATSSASTDDKIVTNVNQEKLVL
FT                   KTNQPVVRAISRTASENINDWMPNTLLQQEVLSQLRKQNPDRTWNSAADITKADMLLLT
FT                   TYYGKDTYIDGKTSYSLEGLQYATNLTTVWLNNNLNAPSGSYYSDVTDISPLANLQKLQ
FT                   VVNIQQNRITDISPLANLKNLTEVDAAYNHISDFSPLKGFKNLKGTFSNQFITLPPAYI
FT                   SADNNIATLAIDCYLPDGSKVQLKPNNGVGETVFYKNGQLYVRWYFNGAGGGYYDSNGH
FT                   IYYTNMKPQQPGLTGPTFNGTTVIPMDDYYFMTAASDGNNFVVVRPYVLAATAAPITVK
FT                   YVDALTGESLVTADLTLNGIVGQPYTTQRIDDELPNYDFTNIVGNASGVFTADAQTVTY
FT                   YYTRKDAGDITIHMVDTNGNLVYEPQILPGKHNLGNAYNLDAPTFDHFKLQQTIGNAAG
FT                   IFTTDPQSITFVYVRLDAGNITVKYQDKQGHQLKPDKTISGSQSLGQAYTTEPLDIENY
FT                   TLMTTPANATGTFTDQEQTVIYVYVRRDAGQIVVKYQDSAGNPLAPDKLLDGKEQLGAA
FT                   YQTAAISIPNFYLVVTPANATGTFSTDAQTVIYQYARSNAGHITVKYQDANGTTLAPDD
FT                   ILTGNGQLGRPYQTNAKTIENYRLIQTPANATGQFSDQAQTVIYVYTREDAGDITVQYL
FT                   AENGQQLAADNVLSGQGQLGQPYETSPLNINGYTVKSTQGNTTGTYTLQPQRVVYIYER
FT                   TAGQPVTAKYQDQDGKSIHPDVVHSGYLGDNYSTEQLVIDGYTFKAVQGDVSGTFGTSA
FT                   KTVTYVYERTAGLPVTAKYLDEHGKSIHPDVVHSGYLGDSYSTEQLVIDGYTFKAVQGD
FT                   VSGTFGTTAKTVTYVYTVNTPTIPDTQGTVTVHYMTKDGIKLNEPTVLSGKTGTTYQTV
FT                   PLTFTDHELVGQPENAMGLFTADNVDVTYVYQATDTTGTDDIIDPEQPEQPTKPVEPTT
FT                   PETPNEPGTTVTQPDRIKPTQPAVAVKPAATVKPTLKPVAAQASLVKTTSPVTEHSAQL
FT                   PQTDEQTGKLAVILGLLLSVVTFGFYGKHRQS"
FT   gene            835215..835337
FT                   /locus_tag="LPST_C0758"
FT   CDS_pept        835215..835337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0758"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0758"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97978"
FT                   /protein_id="ADN97978.1"
FT                   /translation="MMEKQDLASARRRLRGTNLKSRKRALKILHDARRNASKAK"
FT   gene            835426..835920
FT                   /locus_tag="LPST_C0759"
FT   CDS_pept        835426..835920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0759"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0759"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97979"
FT                   /protein_id="ADN97979.1"
FT                   /translation="METTLVIIRGNSGSGKTTLAQALQRRVGHHTLLVSQDVVRRDMLM
FT                   SHDYPGNISIGLIEQIACYGLGRVPVVIVEGILARDRYGKMLARLSQSFPRVLTYYFEV
FT                   SFATTLARHQKRHRDFGVEDMRRWWLPHDTLGVANEVLIGEQQDLTTEVQQIMTTIHDC
FT                   D"
FT   gene            835989..836741
FT                   /locus_tag="LPST_C0760"
FT   CDS_pept        835989..836741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0760"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97980"
FT                   /protein_id="ADN97980.1"
FT                   /translation="MLLAALLKTRRCQYGLTQAQLASKLFVTTQAVSKWERGKAIPSID
FT                   NLLALSDLYNLSLDELVRGSAFFPKPYIVGRRLSFGRLLGLGLFWLFVCLLFTGFGYQP
FT                   WWLFLSLYIVGLIVVVPVGINSYWVIQPATIELHTYAASTLTKFRQIVFNCPRCQLIHY
FT                   TDLQRVTISYRCRKRFSPFDFNPDYFQLILKTNAQTYQLECALKASDYLPQFVSYLQRQ
FT                   GVTVDDPQQVVELLVSGKSLYQHFHTET"
FT   gene            836841..837392
FT                   /locus_tag="LPST_C0761"
FT   CDS_pept        836841..837392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0761"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0761"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97981"
FT                   /protein_id="ADN97981.1"
FT                   /translation="MKIVIGSKIKEQRQQHEWSQQTVAERLHVSRQTISKWELGKSYPD
FT                   LELLVALSKLFAVSTDELLGLSRRPVQRPWWQLLLRKRSRTDMTVKWYSGGQDRARVAV
FT                   GIISDLVANLNTTNEQPLRQLLATYYQELLEQRTGSVLGVFDRMNLDISKCLRQQQIKL
FT                   SPENEQLMQQLVGLNMIYYR"
FT   gene            complement(837463..838389)
FT                   /locus_tag="LPST_C0762"
FT   CDS_pept        complement(837463..838389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0762"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0762"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97982"
FT                   /protein_id="ADN97982.1"
FT                   /translation="MENKLLVFLEAIQQHNSMTKAAQSLFISQPYISRTIKSAETHFGT
FT                   PLIDRGHHPLELTYAGERLLTYLQSDARLHQRMNTELKEISQNKYQSMTIGITPPMANA
FT                   WFSQTLPAFYQRFPNIRTKILEITTSKAETLLASHQLDFFIGKTIHQTNVKTIPLQTIS
FT                   LSLVIPKTAGIYQSNQFWRPFTPTILTGMTGEPVIRAVGEARFQELVDHYFADKGIQTI
FT                   PLIEVDNSRFALSLTLQGLGSIVLATAMLAKLATQPAKYPINAFKLPTSELSLDFSIAY
FT                   LPSHVLAKPIAYLVEQACQTFNPAIDF"
FT   gene            838576..840465
FT                   /locus_tag="LPST_C0763"
FT   CDS_pept        838576..840465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0763"
FT                   /product="fumarate reductase, flavoprotein subunit
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97983"
FT                   /protein_id="ADN97983.1"
FT                   /translation="MDFERVVSMLQKMNQVKWDYQYDTVVIGFGGAGATAARFAADAHA
FT                   KVLLTDAAPNGHEGGNTRYSAQLLGTVDSFDEGKKYYQNLTAPMQLDDSMIDTFVAGMA
FT                   NMRDYVQKYLNVEPVSVKNDFTAADSPISLDSAVHEFPEFDGVQSYDFTTVHHGIFDAA
FT                   LWKILRQKVLDRQQQIDVWLSAPAQHLIQDPTTNTIIGVQIERQHRLVNVRATNGVVLA
FT                   CGGFENNQQAIQDYLGAEHLAPLGTLFNKGAGIKMAQEVGADFWHMQNYESLGFLHGLS
FT                   IAVPQGERGRLILGWPEVNHGSVITVADDGSRYFDESEANRHGHIYDHGMWRVPRTNVH
FT                   PYLVFDETQYQQMLASQYTPINNLTDLVVKATTLNDLARVMEVDGTVLTKTVHDFNYFV
FT                   ESGTDYAFNRQVDTMRAFDGGPYYALKLTNNVLNTQGGPRRNDRAEILDANQQPIPHLY
FT                   GAGELGGICANQYQGGGNLAECLIFGKIAGENAAKPKEETTQLVDEKAVAKPDANTSAS
FT                   VHQTGANDLLAEASPDITVGEHQYLGRSDDGIGGQVVVRITYVDQQLTHVEVVEQHETG
FT                   EVGGQAVAELPAKMVAANTYDVDAVSGASVSSRAIKAAVKDALSQAEQTVSND"
FT   gene            complement(840741..841214)
FT                   /locus_tag="LPST_C0764"
FT   CDS_pept        complement(840741..841214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0764"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0764"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97984"
FT                   /protein_id="ADN97984.1"
FT                   /translation="MSISTEQTILTQLKTIRTKRASTTGEQKWLQQHITEANLRRLLPD
FT                   ISIVGLHLLSELEAGPQTGIDLATNLGVTRGGVTRAAKRLVTQGLIGSFQQPDDHKKIF
FT                   YRLTPSGRKLARYHDKMHATRNHQAITLLHEHYSPAELAVIQRFLADLTDYEA"
FT   gene            complement(841323..841952)
FT                   /locus_tag="LPST_C0765"
FT   CDS_pept        complement(841323..841952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0765"
FT                   /product="FMN-dependent NADH-azoreductase 2"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0765"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97985"
FT                   /protein_id="ADN97985.1"
FT                   /translation="MTKLLMINAHPHTTVPSASLTVAASFKTAYQQTHPNDEITTRDLY
FT                   QDGVPALNDTTFEAWRKQKYGEELTSVEAELLSRHAAWLAEFLAADKIVFVNPMYNHFL
FT                   PAELKQYLDLTAVARKTFKYTVNGPVGLLPDKHVLHIQAAGGYYHQPDQHNQVEAGDPY
FT                   LRGMMQLYGIQDYRTIFIEGLDQFPEQREQAITAAQVAAEKLAGEF"
FT   gene            complement(842122..843417)
FT                   /gene="asnC"
FT                   /locus_tag="LPST_C0766"
FT   CDS_pept        complement(842122..843417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="LPST_C0766"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0766"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97986"
FT                   /protein_id="ADN97986.1"
FT                   /translation="METISIINAADHVNEQVKIGVWLSNKRSSGKIAFLQLRDGTATFQ
FT                   GVALKNELGETAFAQLTDLAQETSLWVTGTIHADTRSPFGYELAISQFEVVGTSHDYPI
FT                   TPKDHGIDFLLDHRHLWLRSSRPNAIMRIRNEVIRAVYEFFNDRGFIKIDAPILTGSAP
FT                   EGTTELFKTDYFGQDAYLSQSGQLYGEAGAMAFGKIFTFGPTFRAEKSKTRRHLTEFWQ
FT                   LEPEMAWMHQDESLEVQEQLVAYLVQAVIDHCPHELAVLDRDVATLQKYTKLPFPRVLY
FT                   DDAITLLQANGFDVDWGVDFGSPEETFLAEHFDQPVFVLNYPKAIKAFYMQAHPTRDDV
FT                   VIAADLLAPEGYGEIIGGSERSTDYDYLKERLLASGQDLQDYEWYLDLRKYGSVPHSGF
FT                   GMGLERFLTWITLQDHVRETIPFPRMLHRIYP"
FT   gene            complement(843456..844463)
FT                   /gene="asnA"
FT                   /locus_tag="LPST_C0767"
FT   CDS_pept        complement(843456..844463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="LPST_C0767"
FT                   /product="aspartate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97987"
FT                   /protein_id="ADN97987.1"
FT                   /translation="MHLIIPKDYDPKLSVKETQQAIRYIRETFQDEFGKQLNLSRLSAP
FT                   MFVEKKTGLNDNLNGVEKPVSFTMQDMGDEQIEIVHSLAKWKRVALKRYGFDMHEGLYT
FT                   NMNAIRKDEDLDNYHSAYVDQWDWEKVISKEERTVETLKATVRQIFKVIKHMEHEVWYK
FT                   FPQAVHHLPDEIHFLTTQELEDMYPDMTPRERENAICKKLGCVFLMQIGWKLDSGERHD
FT                   GRAPDYDDWKLNGDILFWYEPLDQAIEISSMGIRVDAESMKKQLKDVDAEDRLSLPYHQ
FT                   MILNADVPYTIGGGIGQSRLCMLLLGKAHVGEVQAALWPQAMIDQCAEHNIHLL"
FT   gene            844631..844765
FT                   /locus_tag="LPST_C0768"
FT   CDS_pept        844631..844765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0768"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0768"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97988"
FT                   /protein_id="ADN97988.1"
FT                   /translation="MVTYRLTANPTLTRLFQLATKKVFFGLVKFWSGFHSLPIHWQVD"
FT   gene            complement(844916..846322)
FT                   /gene="pepD3"
FT                   /locus_tag="LPST_C0769"
FT   CDS_pept        complement(844916..846322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD3"
FT                   /locus_tag="LPST_C0769"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0769"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97989"
FT                   /protein_id="ADN97989.1"
FT                   /translation="MEKRIKGSCTTILVGKKASIDGSTIISRNDDGHEALDPERLVVVN
FT                   PADQPRHYQSVISKVEVDLPDNPLRYTSIPNSILTNGTWPAAGINSENIAMSATETITT
FT                   NSRILGIDPFVAGGIGEEDLCTLVLPYIHSAKEGVTRLGALLEQYGTYEPNGIAFSDQD
FT                   EIWWLETIGGHHWVAKRIPDDAYVVAPNRMNIDDFDFNADDTLASADLEQLIEDYHLNP
FT                   DFDRVNLRHIFGSASIKDTVYNNPRAWFGQKYFTPDVVQDPMEQDLPFICHASRKISIE
FT                   DVKFVLSSHFENTKYDVYGSGSEADKTLFRPIGINRNHDVHILQIRNNVPAAVAGIHWL
FT                   AFGANTFNTVVPFYANVNDTPASYKDADGTFNLNHMYWLSCTTALLGDTDYDFYVDMRN
FT                   SYELEAMSAYRKIENDTDADLANHQDVTAYLETANQQLADTAMKLQTKLLGDMVIAGSE
FT                   KMKLRYNLND"
FT   gene            complement(846358..847596)
FT                   /locus_tag="LPST_C0770"
FT   CDS_pept        complement(846358..847596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0770"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97990"
FT                   /protein_id="ADN97990.1"
FT                   /translation="MSMMPTNLTLLERKISNNLNCLYFVNHPVYRIQKDHQLALASEYS
FT                   LAGNVTEIICDEQQRYHILFVARKEIVLTEKKVAKVTNNQLGQDTVQFLATLGYQFPPA
FT                   QPAGELSQPTILPSPTELSECPTAYVIIDCEFGTRFRRNGSAKAVSWHVIESPELRASI
FT                   FQLSAIGFSHHTQTAPFFNRYFDDPNFLPDKKLAGLSATGLTTVAYEAQGDPLTILKAF
FT                   IQQVIQPQLPLVFWDQTQDMKHIRLLLTQYYQQLTPTEQQLVSRPVTIFDAQAYTNTLI
FT                   NRGNHKVGSHDLPLNGLAALFNISNPHQHNAIWDVQTTELVMVKLAELTHQTPVITTPP
FT                   APIALPATVPAVVPSIQTPSPTPQHASHAQVHQLRARGKTYREIAAVTGFSISGINYIL
FT                   KKARSIPTRSESV"
FT   gene            complement(847641..847907)
FT                   /locus_tag="LPST_C0771"
FT   CDS_pept        complement(847641..847907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0771"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0771"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97991"
FT                   /protein_id="ADN97991.1"
FT                   /translation="MQSENLTVKYLNKSKILKLDPFMLYLQVTPLKATEPTPINCIIVK
FT                   HALTLFYQLQPDAQLALYGHYNTRHQFVITKFMVRSAVQTLAS"
FT   gene            848127..848324
FT                   /locus_tag="LPST_C0772"
FT   CDS_pept        848127..848324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0772"
FT                   /product="ISSag6 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0772"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97992"
FT                   /protein_id="ADN97992.1"
FT                   /translation="MDRGRRATLEERIAIVKYTLDHCNDYREAAKHFNVSYPQVYTWVR
FT                   KYRQHGMEGLVDHRGRPKQG"
FT   gene            848582..850390
FT                   /gene="recQ1"
FT                   /locus_tag="LPST_C0773"
FT   CDS_pept        848582..850390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ1"
FT                   /locus_tag="LPST_C0773"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0773"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97993"
FT                   /protein_id="ADN97993.1"
FT                   /translation="MIDLAAAQQVLKTTFGYDEFRPGQKAVIEQVLAGENTLAIMPTGG
FT                   GKSLCYQIPALLFQGLTVVVSPLISLMKDQVDALNDNGIAATFINSSLDFQEINERLQE
FT                   LRAGDYTLLYVAPERLDSDYFIQALGRLPIQLLAIDEAHCISQWGHDFRPSYLALSTAI
FT                   EQLPTHPQVLALTATATEQVAADICGRLAIDPQHEVNTGFARDNLDLTVVKDQDTDRYI
FT                   LDYLKVNHGEAGIIYASTRKEVMRLTSLLQKHDIKATPYHAGLDDAVRRQNQEDFLYDR
FT                   VDVMVATNAFGMGIDKSNVRFVIHAQVPGTLEAYYQEAGRAGRDGLPSEAILIFRPVDI
FT                   QLQHFFIDESEMDTEHRHLAYQKLQVMTRYANTQGCLQQFILKYFGEKSAPCGRCSNCT
FT                   DQRESQDITTAAQQVLSCVVRLHSRFGKGVVAQVLTGANNQRVRESNLNTLSTYGLMSG
FT                   QRQKSVVELIDFLTASGYLQSVGGQYPTLTVSASGVAVLKGTTTVHRKTAQKVQQTVPE
FT                   NSALFEQLRTLRRQLAEEQGVPPFVIFSDRTLHSMCDLMPEDDAAFLMVKGVGASKLEK
FT                   YGETFMATIRAAAHAESATSTDEETD"
FT   gene            850433..851314
FT                   /gene="rluE"
FT                   /locus_tag="LPST_C0774"
FT   CDS_pept        850433..851314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluE"
FT                   /locus_tag="LPST_C0774"
FT                   /product="pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0774"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97994"
FT                   /protein_id="ADN97994.1"
FT                   /translation="MEFTWQHQGQSMAMKRFLTTHAISMRTIKAIKHGTGAFLVNNQVQ
FT                   TGVITIHDGDIAGIQLPDEAPDTAVAVSEQPIQIEYEDANWLVLNKPAGLTSVPGPSNR
FT                   TDTLVNRIKGYLIASHASNQRPHLITRLDRDTSGLVLVAKHRVAQGMLTEPRIAAQLVK
FT                   TYQAWIEGTITPASGTIDRPIGRVADSPRRVVTTAGQRAITTYQVEADQLQHNVSRLRL
FT                   ELVTGRTHQIRVHLTTLGHPLLGDALYGGNLAWIQRQALHAASLQFFDPFSEQTLHFEA
FT                   ALPADLQALNHD"
FT   gene            complement(851506..851832)
FT                   /locus_tag="LPST_C0775"
FT   CDS_pept        complement(851506..851832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0775"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97995"
FT                   /protein_id="ADN97995.1"
FT                   /translation="MANFQQSETALIESATLINIFAEKIRRQIIIALGNSDNGLNVTDI
FT                   TALVNISRPAVSHHLRLMREAGVIDMRSNGVEHIYFLTLTAPLQQLQATFATLTADNAP
FT                   LSQS"
FT   gene            852168..852950
FT                   /locus_tag="LPST_C0776"
FT   CDS_pept        852168..852950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0776"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0776"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97996"
FT                   /protein_id="ADN97996.1"
FT                   /translation="MMGVENVKVLGILGAHRADGVTAQLLQAVLKGAAASADTELVNLN
FT                   DYELRPDHDSQPNADLDALEAKLMAADVWVLAAPTYLGSLSGVMKNFCDCFRGRIARFN
FT                   SVGEAVPDRFKNKHYVTITDCYAGGIENYLTGVTDATFKTLDKFLTMGGLIKLREIVVT
FT                   KTWGMQTITAAKQAECERVGARAAHKKERDDSTMKRYIQLFFMIAVMALLTMGIEAGIQ
FT                   QLIPLNNFWAYYGVFVVVFYVLLAMILHFFTVVKHRRR"
FT   gene            853216..853338
FT                   /locus_tag="LPST_C0777"
FT   CDS_pept        853216..853338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0777"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0777"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97997"
FT                   /protein_id="ADN97997.1"
FT                   /translation="MIGFGFGASKLPVFESNFVKKLIMGHAQKRVIDFKINFVK"
FT   gene            853371..854372
FT                   /locus_tag="LPST_C0778"
FT   CDS_pept        853371..854372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0778"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97998"
FT                   /protein_id="ADN97998.1"
FT                   /translation="MQVFGQFIATVGWLGLALVASELGATLIHWLGQWVGFRLIGARIV
FT                   RITGFRLQLSRVRGHWKLERPLTRHPHIVAAPPADAKRFNHAIYCFGGGLFNLLTVMLS
FT                   LITLNQFKFSFDLWLFAFIIWIWVNTLKAAQLLPMNLHGYPTAGQEFRQARESTAAMTA
FT                   AYVTACAAAVKVQTGSVRDLDASMIVMPRDGGNRNYLVVRQAWLILEWGLQHGLDTPEL
FT                   LAGLSRLEPSFNTLPPADLAKYLDATLYWNLVTNHRDPQIIAWYQDDGVQQLLRRYQPL
FT                   AHYKLTAVYEWRVHQQPEQALALIEKGLKIAQRLHDEEEIAWLKALRVQVTA"
FT   gene            854336..855586
FT                   /locus_tag="LPST_C0779"
FT   CDS_pept        854336..855586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0779"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0779"
FT                   /db_xref="EnsemblGenomes-Tr:ADN97999"
FT                   /protein_id="ADN97999.1"
FT                   /translation="MAESFTRSSNGLDYRRNLDSVKDCQNRSLYWGMGGKLVTIEVKKG
FT                   ENVKQRIKQRWGLWLTLLVIVLGLIGVGLTRVNAGLYQQTVAQVTHVQTKSRSTTTDEF
FT                   ENKDATVTQLVTVRVLNKAHRGRTYQIKNTYTRSGAMDQPYHVRNQVFLRIPSDHSSAV
FT                   TIQGLKRDTALAFVAWLALALLLLIMRFSGLMAFLSVALNAVLFYAAIQIDLATNGGHI
FT                   YLLFGVLAVIFAVLTLLLVLGFSRQMLVTLGATVVGTGLAVIISLIVFAVTHERGVTYE
FT                   SMQYVTQVPRPLFLVETVLGSLGAVMDESTDIVASLFQLKTERPDIAPRQVFKSGIQIG
FT                   RSIMGPLINVLFLIFMADTFAMTLLYFRNGNSWGYTFTMNMSLGMVQSLISGIGIVLAI
FT                   PVASWLASRLMPKAVMA"
FT   gene            855733..856347
FT                   /locus_tag="LPST_C0780"
FT   CDS_pept        855733..856347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0780"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0780"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98000"
FT                   /protein_id="ADN98000.1"
FT                   /translation="MGVSLVIGTIILAFTIFFGEDNEVAAKPAYIAALIVMVILVLIIF
FT                   PVENWIMAQGFSLEDSEDLEGMSLAIGVSFIGVAVTEAILSTLGAIAEAAIAIAAGLSE
FT                   ILAQHPQLPTKRLYIDGISIGKQIIGTTFNTLFFGFFGGFLALFIWFAGLHYSFGSVIN
FT                   NKIFVAEVLMVLFSLIGVILVVPVTTWVMTIQHRQQIKHND"
FT   gene            856344..856967
FT                   /locus_tag="LPST_C0781"
FT   CDS_pept        856344..856967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0781"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0781"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98001"
FT                   /protein_id="ADN98001.1"
FT                   /translation="MTMTAGFATVEKTVGSVVMMEIRTAQPQDSAQIAPLIAMIYRDME
FT                   MPVLKNVSEADLLAMLTELYQRPANLDGLAQTFVAVMDHKIVGVAFGHLAKNEVAVNDL
FT                   LRTTSGHHAGFEAPLELGGETRPNEWYLSMLAVDPQAQGHGVGSALLEALPGLVGQLGA
FT                   TKLSLNVDDGNPRAAKLYHRHGFVPDGQLMIGTHPYQHLVKPLS"
FT   gene            857099..857767
FT                   /locus_tag="LPST_C0782"
FT   CDS_pept        857099..857767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0782"
FT                   /product="alpha-ribazole-5'-phosphate phosphatase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0782"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98002"
FT                   /protein_id="ADN98002.1"
FT                   /translation="MQIYFIRHGRTQYNLEHRFQGGRADSPLVASGIDGAKAAGDYLST
FT                   TQFSAVYSSPQQRALDTAKYIVAANQWQPPIQIDDGLREFDFGDWDGKQEAEVQPQSYA
FT                   QVIFTKPAEYRPELAGGGESYADFVTRTTSTLHRLIDQVGVASTQPLLIVSHGLVTTMT
FT                   VKALMGVPVAELRAPFVVDGQVMKTVGHGIVDNDSLTVLSTTDNQHFELTTWNETGYLK
FT                   "
FT   gene            complement(857976..858305)
FT                   /locus_tag="LPST_C0783"
FT   CDS_pept        complement(857976..858305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0783"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0783"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98003"
FT                   /protein_id="ADN98003.1"
FT                   /translation="MLYSWHGGINVNKNDKAKRLMQQIDVAYNDPEVKQDAQVRADLLR
FT                   YAMELDKNGNYLLIATKVNGMAMRVMRDHMHQPLQAINTLYTQTARTSEYYWGVAAASI
FT                   FSGLW"
FT   gene            complement(858449..859462)
FT                   /locus_tag="LPST_C0784"
FT   CDS_pept        complement(858449..859462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0784"
FT                   /product="lipase/esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0784"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98004"
FT                   /protein_id="ADN98004.1"
FT                   /translation="MPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPA
FT                   ILENDLAALRSGSLTPAIADPVGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYF
FT                   HGGAFYGGVPGNNTVLLKLVAAKSHCEILNVDYSLAPEAPAPAGILDGLAIFQYLEQRD
FT                   AETMITVAGDSAGANVIMAATNLNQQLGSNRINQQLLLYPVTAPNADHAGPLWDLAAFP
FT                   IIDSQRAILTNYHGLFRQLDSIMTDYYVPENFDSHSPLISPLHQEDFTMTPPTTIMVGE
FT                   FDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVMAAALI"
FT   gene            complement(859449..860864)
FT                   /gene="xylP2"
FT                   /locus_tag="LPST_C0785"
FT   CDS_pept        complement(859449..860864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylP2"
FT                   /locus_tag="LPST_C0785"
FT                   /product="sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0785"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98005"
FT                   /protein_id="ADN98005.1"
FT                   /translation="MGGFIMSIFQTWKRRIAYGSTDMAGNIIWQMVSTYLLFYYTTVAG
FT                   ISAAFAGMLFFVVRFIDAFDALIYGYLIDHTHTKYGQSRPYFVWFGIPLGLLAMSLFMI
FT                   PSFGGNTTMRLVYISITYTFFSLIYSGANTPITSILPSLTDDSVERTKLASARMVMTTI
FT                   GTSAVAAITLPMVKLLGKGNQSKGFTLWAIILGLVIMGLFIFAFLNLKETNGAQNPDGT
FT                   TESAESLSIWQSLKGAASNKPWLLLACSFILLQTFWMLRGNSAIFFIKYVYGRPELAPI
FT                   FLGIGFVSVIGNLSVPFLSQRFKNRNVLQFSLVLGVIGQLLLPIAEKMRSVGLLIAGSV
FT                   IFLIAMGITFTIVFAMLSDTVDYSTKVLGLNETGFLSAVPMIGAKLGMGIGGFLAGQFL
FT                   AWGQFNAKAAVQSGRTITFINLAFIWMPIILLAAMISMMQFYRLDEKELQANKADAAAK
FT                   VEPKEDVEYDANN"
FT   gene            complement(861193..862845)
FT                   /gene="murE1"
FT                   /locus_tag="LPST_C0786"
FT   CDS_pept        complement(861193..862845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE1"
FT                   /locus_tag="LPST_C0786"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0786"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98006"
FT                   /protein_id="ADN98006.1"
FT                   /translation="MPGFFVDLDWPGDGTFNQQHTMYRAITSIISILIWGDNYPVCMYS
FT                   RNSNFIEKDANIMQASQLINSLKFKQVQPALTTDFDVTMLTQDTREVQPGAMFIAVVGY
FT                   HVDGHDLVDQAIGKGAKIIVASKPLDVNVPVIYVENTERAMAILADVFYGAPSQKMRMI
FT                   GVTGTNGKTTVTHLIEQIYRDQQQATGLIGTMYRKIKDEKLPTANTTPDAITTQRTLAA
FT                   MRDAGVETVAMEVSSIALVLGRVWGIDYDIAVFTNLTQDHLDFHKTMAKYTEAKAMLFA
FT                   QLGNKYSADGTNKVAVLNTDDPVGREFEQYTAAHVLTFGLKPDAMINAQNVEIKSHGTE
FT                   FDLSVFGHVTHVTMQLIGQFNVYNMLAAFAAAYASGIPEDQIIKSLEKVTGVKGRFQSV
FT                   PSHTGVSVIVDYSHTPDGLLNALETIQDFATKDIYCVVGCGGDRDKTKRPKMAKIAVEH
FT                   STKPIFTSDNPRTEDPTMILNDMVAGVPNADVPVYEDRHVAIAKAIEAAQPGDVVLIAG
FT                   KGHEDYQIIGRTKHHFDDSEEAAKALALKPTID"
FT   gene            complement(862869..864071)
FT                   /gene="thrA1"
FT                   /locus_tag="LPST_C0787"
FT   CDS_pept        complement(862869..864071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA1"
FT                   /locus_tag="LPST_C0787"
FT                   /product="aspartate kinase I"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0787"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98007"
FT                   /protein_id="ADN98007.1"
FT                   /translation="MEIIVQKFGGTSVKDEAARIQALKHVQYAVDQGDKVIVVVSAIGR
FT                   KGAPYATDSLLGLVGAEHSRLTNRELDMLVSVGETISTAVFTELARKQGLNVTAMTGHD
FT                   AGIVTNDDFQNAKILRVDPKPITDAFIDADVVVVTGFQGATESGHITTIGRGGSDTSAA
FT                   ILGAALKAKRVDIFTDVNGMMTADPRLVTHARFIKAISYEELANMAHEGAKVIHPRAVE
FT                   IAEQAHVPMRIRSTYQEPDELGTLVTDRTTTQIEHYRTVTGIAHQTDLTQFTVPTDTLS
FT                   SSAIFQLMAQHGLSVDFINITPHQVVFNLVDGDADVAKQLLTDAHVHCQSIANCAKVSV
FT                   VGAGITGTPGVTARIVSALAAQHIDILQSTDSYTTIWVLVKEADLKAAMNALHDEFLGI
FT                   E"
FT   gene            complement(864076..865977)
FT                   /gene="asnB1"
FT                   /locus_tag="LPST_C0788"
FT   CDS_pept        complement(864076..865977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB1"
FT                   /locus_tag="LPST_C0788"
FT                   /product="asparagine synthase (glutamine-hydrolysing)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0788"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98008"
FT                   /protein_id="ADN98008.1"
FT                   /translation="MCGFAGCLTDRTKADNAAYDQTIHEMTKMIVHRGPDDDGYFADDN
FT                   ITMGFRRLSIIDLAGGHQPLSYDNERYWMTFNGEIYNYVELREQLKQEGYEFKTSSDSE
FT                   VILAMYAKYHADATKYLRGMFAFVIWDKQEKTLFAARDQFGIKPFYYAISGDDFYYASE
FT                   SKAIYKILKDKTFDKNALQDYMTFQFVPEPETLTKEIKMLAPGCSLTKKLGSAPRIDRY
FT                   YHREFHPVQRSEDEYAKKIKDALIDSVKIHMRSDVPVGSFLSGGIDSSIIVAIAKNFNP
FT                   NLETISVGFEREGYSELDVAQETAEKLGVKNYSMTITPEAFMKAFPHFVWSMDDPLADP
FT                   AAVPQYFLAKEAVKHVKVCLTGEGADELFGGYTIYHEPESLKPFRYTKPINGALKRIAL
FT                   MMPEGMRGRSFLLRGTTPLENRYVGNAFIFGEQEKQAFFKNYNQNHPFQSITQPLYDES
FT                   VDYDPISRMQFIDMHTWLNGDLLHNADRTTMAHSLELRTPFVDREVYNLAAEIPADLRI
FT                   SHGTTKYILRKAVEDIVPAHVLHRKKLGFPVPIRFWLKDEMYDWAKQIINDSQTDQYFN
FT                   KDYFLKLLDDHKAGVRDNSRKLWTVLTFMMWHRLYVESDHLMDSPEANAVAEKVEEF"
FT   gene            complement(866448..866774)
FT                   /locus_tag="LPST_C0789"
FT   CDS_pept        complement(866448..866774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0789"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0789"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98009"
FT                   /protein_id="ADN98009.1"
FT                   /translation="MSTYIFVTILLCGLVTWLSRIVPFAIIKNLSVPQWLISFLSFVPI
FT                   AIMTAIFVESLLTYHAGHWPEFNLPNIYASIPAILAGVLTKSLLAVVITGIVAMAVLRL
FT                   VGWA"
FT   gene            complement(866771..867472)
FT                   /locus_tag="LPST_C0790"
FT   CDS_pept        complement(866771..867472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0790"
FT                   /product="amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0790"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98010"
FT                   /protein_id="ADN98010.1"
FT                   /translation="MDSSLTFRAGIKDVIPTVFGYIGVGLAMGIVANTSHLSVWAVLLM
FT                   SLIVYAGSAQFIIVSMLLAGSPISAIVLSTFLINSRMILMSMSVAQYFKKESLLQNIGL
FT                   GSLLTDETFALSMNKLNQTNQQLKTSWLHAANIVAYLVWAAATVVGCLLGNLITDPNQF
FT                   GLDFAVVGMFIGLLYLQIITDRSKSLPTQLWVVLFVALAMYFLMRWVPGNLALIFATLL
FT                   GCGFGMVVDHK"
FT   gene            867803..868021
FT                   /locus_tag="LPST_C0791"
FT   CDS_pept        867803..868021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0791"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0791"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98011"
FT                   /protein_id="ADN98011.1"
FT                   /translation="MTLEQLAAHSGVAADKIVAYTNAGLLPCKDVNAHFSADDEYWLDM
FT                   VNCFLENGSSVEDLKDLMPLCEQCAAQ"
FT   gene            complement(868093..868389)
FT                   /pseudo
FT                   /locus_tag="LPST_Cp0014"
FT                   /note="hypothetical protein"
FT   gene            868969..870111
FT                   /locus_tag="LPST_C0792"
FT   CDS_pept        868969..870111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0792"
FT                   /product="lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0792"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98012"
FT                   /protein_id="ADN98012.1"
FT                   /translation="MKSGKHRVSLLILLCLMVVGLAGCHNKAYSQSIEKGLNAVAENKY
FT                   QKALTCFDNALAQKPKDEKAQAYRDQTQAYLTTTSELKAGKVKTALTTVDKGVKITNGA
FT                   TSLTNKLKQLKVTVTSDYQEYQQLSDDVKAQLKVKNGNYSADVLKRCAAINWDKKPYLK
FT                   PLKAKVKQLLTAAKKAKTNMKVSAAEAKRAAALRRKIAAAKNKWNMAALDDVPDWFILA
FT                   LFADDSDVDDAAEELDDEYADQADDNDDYSDRDEQTTDSNDDTNDTDADSADDDWSDQD
FT                   TDSNDDTDDDSDTNSDADSDSDYSEDDDDEDSNRDDADDSETQSDDDYDDDTDSESDDD
FT                   DYDTDDQYDDDDDYDDAESLLNPAPVQPSVADRLFASASC"
FT   gene            complement(870294..870551)
FT                   /locus_tag="LPST_C0793"
FT   CDS_pept        complement(870294..870551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0793"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0793"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98013"
FT                   /protein_id="ADN98013.1"
FT                   /translation="MYYHSTSGLFWIIIALLLYMLSKTDPKNFIIKQIRRFGWLINLAI
FT                   LTYIIVRQIQQPTGVLQIMVLIVIGFSTMSSIYARFKHQP"
FT   gene            complement(870880..871443)
FT                   /locus_tag="LPST_C0794"
FT   CDS_pept        complement(870880..871443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0794"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0794"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98014"
FT                   /protein_id="ADN98014.1"
FT                   /translation="MVKTTTTTTQSLKSAGSSKQLDLLLYQSVGTADKHRVYIYKKTTN
FT                   QKKVSHTTASVKTANQVKTTTATPKLVTKTTRWTYKSNAMKFWFGLANNDKQLIKRTNY
FT                   FYINKNWVVLSTTQAKQFSKLMKQQQATLKARAKVYVTNQVKAAMVKNPTMSKAQLAKV
FT                   QKAAAAQYQANAIQSMLKTVKASK"
FT   gene            complement(871602..873080)
FT                   /locus_tag="LPST_C0795"
FT   CDS_pept        complement(871602..873080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0795"
FT                   /product="multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0795"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98015"
FT                   /protein_id="ADN98015.1"
FT                   /translation="MSTPVDTHGKPYNRGLLIAVLLVGTFCTVLNQTILTTAFPTLMKD
FT                   FDITTSTVQWLTTGFMLVNGIMIPVSAWLSSRISTKWLYLSAMAIFEVGTIICWTAPNF
FT                   GFLLAGRLIQAVGVGVTMPLLQTIMLSIFPADKRGAAMGTAGIVIGLAPAIGPTLSGWV
FT                   IDNLSWRDLFGLIVPIVAIVLIAGFFFMANVLETSKPKLDFASLVLSTIGFGSLLYGFS
FT                   SVGDNGWTSTVVLSTLIIGVIFIIGFIWRQLTMENPFLQLRVFKHAEFTIAAILSSVAN
FT                   MAMVGAEMVIPLYLQIIHGFSAFESGLSLLAGALMMGVMSPITGRAFDRFGAKRLAILG
FT                   MFLLTIGTIPFAFITRNTATVYIVVLYAVRMFGIAMVMMPATTAGMNALPVELMGHGTA
FT                   VNNTTRQIASSIGTAILTSVLSNVTDATKPAHSLIKSNPLGYQNSYFNATLNGYHAAFW
FT                   VAVGFSVVGLVVAFFMKGKQHSVKPVMNTKEVND"
FT   gene            873210..873674
FT                   /locus_tag="LPST_C0796"
FT   CDS_pept        873210..873674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0796"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98016"
FT                   /protein_id="ADN98016.1"
FT                   /translation="MDKQEDGVFFKKFKEQLGKHQFTIGISDLAKMTGVSQTQLRYWEQ
FT                   KNYIHSLKVSEKNTTHRYSYGMLMRVHFIKMMLDEGFTLAAAVERADGYNNQMEMMRIF
FT                   MMTAFQGIEERDGHHMVKLGYFDEAKTQQLYCYIQDETPHYRLYPVKSER"
FT   gene            complement(874178..874522)
FT                   /locus_tag="LPST_C0797"
FT   CDS_pept        complement(874178..874522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0797"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0797"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98017"
FT                   /protein_id="ADN98017.1"
FT                   /translation="MNDDAQLSITQLDSSLQHKAVEDFAAFYLPLFDANNLEMMSNYDV
FT                   ASYMTDINEHLTYGRYMTKAQRLSDTVSFSFTAYVNLIDRLDQQYFTSGNPALPWNEWL
FT                   AAKFAQTATS"
FT   gene            874734..875381
FT                   /locus_tag="LPST_C0798"
FT   CDS_pept        874734..875381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0798"
FT                   /product="metal-dependent regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98018"
FT                   /protein_id="ADN98018.1"
FT                   /translation="MTPMKEDYLKIIFELGGTKKKVSNKQIALSLDIAAGSVTEMVGKL
FT                   VQEGLAKHTPYAGISLTKKGIRYAETLVRKHRIWEDFLVDKLDYDLPDVHTEAEVLEHV
FT                   TSERLVDSLEAFLGNPTHCPHGGAIPDKDGHYQEDSHVSLADTQDGTTVTIERFIDNHD
FT                   LLVYLHDTPLKIGQQVTVLKHDPFEGPVTVSIQKTGEEIPVSYKAAHNVFVK"
FT   gene            875633..875833
FT                   /gene="cspC"
FT                   /locus_tag="LPST_C0799"
FT   CDS_pept        875633..875833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /locus_tag="LPST_C0799"
FT                   /product="cold shock protein CspC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0799"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98019"
FT                   /protein_id="ADN98019.1"
FT                   /translation="MEHGTVKWFNADKGFGFITRENGSDVFVHFSAIQEDGFKSLDEGQ
FT                   AVNFDVEESDRGPQAVNVTKA"
FT   gene            876002..876751
FT                   /locus_tag="LPST_C0800"
FT   CDS_pept        876002..876751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0800"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0800"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98020"
FT                   /protein_id="ADN98020.1"
FT                   /translation="MTVTTDEMIIATCLKAGKIMVENGSEISRVDDTMMRIAQNAGVVA
FT                   ANTYVTITGVMMSIQGRNATQIAAVNQRTIDLEKVAQVNQLSREFAATTIDLPTLYQRL
FT                   NQLDAASRSFPLWLQLVGAALVSGPLMIMFRQEIVNTWPTVIIGTLGYLVFYLLNRYLK
FT                   IKFLSELTAALLIGFGAEWVCQIGWGTNVNDIIIGSLMPLVPGVPLTNAVRDTLAGNFV
FT                   SGPARGVEAMLSAAALGFGIAVVITLF"
FT   gene            876785..877246
FT                   /locus_tag="LPST_C0801"
FT   CDS_pept        876785..877246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0801"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0801"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98021"
FT                   /protein_id="ADN98021.1"
FT                   /translation="MMGTIGQLVLAYIAVLGFGLIINIPHQALNVAGWIGTLTWGGYLI
FT                   VQAFDGGVVLGSLIGSVGIGVLSSLAARYKKMPAIIFNIPSLVSFVPGSQAYQMVRNFA
FT                   LGNYREAVSFTLQVIMITGAIALGFLLAELLNRLIAFCIRQWRLHRLES"
FT   gene            complement(877530..878567)
FT                   /locus_tag="LPST_C0802"
FT   CDS_pept        complement(877530..878567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0802"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0802"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98022"
FT                   /protein_id="ADN98022.1"
FT                   /translation="MEDMPSRSEMHREKSQGNNSQGNGNGPKKKHPVRNTVLIIIAVLL
FT                   VGTGAFAARTYFNAKNAADTVFKSSGIKKSRNTSAVLNGKKPVSILLLGTDTGALGRNY
FT                   KGRTDTIILATINPKTKTTTLMSLPRDSEVAVSGFEQDFPTKLNAAYAYGSAGTTIKTV
FT                   QKWLNVPIDYYALINMGGMKKVVDEIGGVDITPIRTFTYEGYTFTKGQKEHMNGAKALA
FT                   YSRMRYDDPLGDYGRQQRQRQLITAIIGESASASNLLKQDFLNSLAKQTRTDLTFGNLT
FT                   SIVTNYRSATKNIVSDHAQGTGKMIDGQSFEVVSQSEKQRVTNVLRKSLNLKAATTGEK
FT                   FANQN"
FT   gene            878828..879490
FT                   /locus_tag="LPST_C0803"
FT   CDS_pept        878828..879490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0803"
FT                   /product="phosphatase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0803"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98023"
FT                   /protein_id="ADN98023.1"
FT                   /translation="MIDKSRSRPIKFVIGVILFAYLSYFISDGAVGIDLLDVALTSLVQ
FT                   ISNSGIWTVFYKVIAWLASPGMDILWIVILAFLMYGFKYKIQAFWTLAYMVGAMALGFI
FT                   VKHIIGRARPIGHLAQDTGYSYPSGHVLGTFVLVSVIIMLIVPELPSYRMAMIVKWVSV
FT                   VWLVLVIFSRIYLNAHYPTDTIGAVLLAWSWSQIMQWFYVFWAPGLLKWPLFYRSYL"
FT   gene            complement(879675..880469)
FT                   /locus_tag="LPST_C0804"
FT   CDS_pept        complement(879675..880469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0804"
FT                   /product="lipase/esterase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0804"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98024"
FT                   /protein_id="ADN98024.1"
FT                   /translation="MQVIKQKLTATCAQLTGYLHQPDTNAHQTNLPAIIIVPGGSYTHI
FT                   PVAQAESLAMAFAGHGYQAFYLEYTLLTDQQPLGLAPVLDLGRAVNLLRQHAAEWHIDP
FT                   QQITPAGFSVGGHIVALYNDYWATRVATELNVTPAMLKPNNVVLGYPVISPLLGFPKDD
FT                   ATLATWTPTPNELAADQHVNSDNQPTFIWTTADDPIVPATNTLAYATALATAKIPYELH
FT                   VFKHGPHGLALANAQTAWKPDANQPHVAHWLTLALEWLADNR"
FT   gene            880532..881077
FT                   /locus_tag="LPST_C0805"
FT   CDS_pept        880532..881077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0805"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0805"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98025"
FT                   /protein_id="ADN98025.1"
FT                   /translation="MGMVTVTTRNEQLELRPFTLADTEDYYDLVRDPSIAASAGFTPAH
FT                   SLVEAEFLLKQQAKLPQIFAIELTAIHRVIGSVGLYERMTNTGEPATLEMDLGYMLNAR
FT                   YWGRGIMTAAVARILRYGFETLHLRRITASCLANNPASKRILEHANFRQYDAVRHPDYA
FT                   PFGAGQTELFFDCVELNL"
FT   gene            881089..881613
FT                   /locus_tag="LPST_C0806"
FT   CDS_pept        881089..881613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0806"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0806"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98026"
FT                   /protein_id="ADN98026.1"
FT                   /translation="MQLAKSFEQAACVLVLLATQQPEIPLTADVLHERIGGSASYIRKI
FT                   IRKLVVAGLVTSTSGNNGGVHLARSPEDISITDVVAAIEGTLQTFPNYGYFDRVFKDVE
FT                   PVAHEGTKVVNGIFSRADQLWLDFLDQQKLATLIKELLVVTQIPVLDWTNYSDDKMAQL
FT                   NALLSRMRAHK"
FT   gene            881799..883481
FT                   /gene="als"
FT                   /locus_tag="LPST_C0807"
FT   CDS_pept        881799..883481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="als"
FT                   /locus_tag="LPST_C0807"
FT                   /product="acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0807"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98027"
FT                   /protein_id="ADN98027.1"
FT                   /translation="MPDKKYYGADAIVDSLVNHDVKYVFGIPGAKIDRVFERLEHPVNP
FT                   KSPRLIVTRHEQNAAFIAAGIGRITGKPGVVMTTSGPGASNLATGLVTATAEGDPVLAI
FT                   SGQVQRADLLRLTHQSMNNAALFKPITKYSAEVQEPENISEVLANAYQEATAAKQGASF
FT                   VSVPQDVTDSIVRTPVITPIQAPKLGPASPVEATLLAQKIKAAKLPVLLVGMRASSPEV
FT                   TKAIRNLVAAANLPVVETFQAAGVISRDLEANHFFGRVGLFRNQPGDMLLKKSDLVIAV
FT                   GYDPIEYEPRNWNAEGKSRIVVIDAMRAEIDHNFQPETELIGDIAQTLDFLLPYMKGYD
FT                   ISDSARAYLGELQERLQTRDFVPNIDKQSKLNHPLSVIAALQQRVSDDMTVTVDVGSHY
FT                   IWMARHFRSYEPRHLLFSNGMQTLGVALPWAIAAALVRPDTQIVSVSGDGGFLFSAQEL
FT                   ETAVRLKQNIVHLIWNDGTYDMVKFQEEMKYGEDAAVHFGPVDFVKYAESFGATGLRVN
FT                   QPADLEKVLDQAFATDGPVVVDIPIDYSDNKALGKTMLPDQFY"
FT   gene            883607..883723
FT                   /locus_tag="LPST_C0808"
FT   CDS_pept        883607..883723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0808"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0808"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98028"
FT                   /protein_id="ADN98028.1"
FT                   /translation="MNGATAEIDGSVTDSSVGPWLNKSRTVAARIVAGRYRR"
FT   gene            883865..885316
FT                   /gene="lysP"
FT                   /locus_tag="LPST_C0809"
FT   CDS_pept        883865..885316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysP"
FT                   /locus_tag="LPST_C0809"
FT                   /product="lysine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0809"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98029"
FT                   /protein_id="ADN98029.1"
FT                   /translation="MAEKQHQEVHRSLQTRHLSMIALGGSIGTGLFVASGSAISTAGPG
FT                   GALLAYVGIGVMVYFLMTSLGEMATYLPVSGSFSTYATKFVDPALGFAMGWNYWFNWAI
FT                   TLAVDISTAAIVMQFWLPSVPGWVFSLIALVLIFTINALSVRSFGETEYWLSLIKVVTV
FT                   LVFLVIGVLTIVGIMGGHATGLSNFTYKKAPFVGGIPTILSVFVVAGFSFQGTELIGIT
FT                   AGESATPEKSIPAAIKQVFWRILLFYILAIFVIAAIIPYTSKDLLGSSASDIAISPFTL
FT                   VFKRAGLAAAASVMNAVILTSVLSAANSGMYASTRMLYSLSLQGYAPKTFGRVNRRGIP
FT                   IMALLGTTVIGLLTFLSSLFGERIYIFLVSASGLTGFIAWLGIAISHLRFRRAFVKQGH
FT                   QLSELRYHAKWFPFGPWFAFILCVVVIIGQDLHSFATLDWQAIGVTYMSIPLFIILYVY
FT                   YKIRYHTKMIPLDKVDLTRKRHHQD"
FT   gene            885385..885540
FT                   /locus_tag="LPST_C0810"
FT   CDS_pept        885385..885540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0810"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98030"
FT                   /protein_id="ADN98030.1"
FT                   /translation="MDLSTQGAVVFLGVLIYADNTAHNRWSRRIVMNGGLHDCNDSKRQ
FT                   IEGALI"
FT   gene            885698..886435
FT                   /gene="dacB"
FT                   /locus_tag="LPST_C0811"
FT   CDS_pept        885698..886435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="LPST_C0811"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0811"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98031"
FT                   /protein_id="ADN98031.1"
FT                   /translation="MSLAGVLAGCGASQSTSKATSSSTSAKSTKTQTKRQRLISALPKG
FT                   VKSTDSDLVVVNKWHKRAEMTFNKSSVDGIEVRSSIVKPLEAFLAGAKKAGYPATIVSG
FT                   YRSVAYQKEVWDQSIQTYENQGKSAKEALKLTKEYVAVPSGSEHETGLAADIMNTHWYS
FT                   THGNQLLSSSDKNKGQQWLINHAADYGFVLRFTKDGKQSTGIDYESWHFRYVGKASAEF
FT                   MTKHNLTLEQYVSLLQAREKAAK"
FT   gene            886831..887466
FT                   /gene="dgk1"
FT                   /locus_tag="LPST_C0812"
FT   CDS_pept        886831..887466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk1"
FT                   /locus_tag="LPST_C0812"
FT                   /product="deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0812"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98032"
FT                   /protein_id="ADN98032.1"
FT                   /translation="MLVMSGTIGAGKTSLTQLVANHFGSKAFYESVDDNPILPLFYKDP
FT                   KKYAFLLQIYFLNKRLDSIKSAFANDLDVLDRSIFEDSLLFHLNGDLGRATNTEVDIYD
FT                   SLLDNMMQELPEASHQKSPDLLIHINISFDTMLKRIQKRGRSYEQIDQDPDLYKYYQTL
FT                   NERYDDWYANYDHSPKMQIDGDQLDFVADADARKEVIRLIDEKVASLG"
FT   gene            887749..889026
FT                   /gene="serS2"
FT                   /locus_tag="LPST_C0813"
FT   CDS_pept        887749..889026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS2"
FT                   /locus_tag="LPST_C0813"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0813"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98033"
FT                   /protein_id="ADN98033.1"
FT                   /translation="MLDVKMIRQNPDFVKEQLGHRGVAASDIDDLLAADEKRRELIAKS
FT                   EQLKSTRNQVSGEISQKKRNKEDASAEIAEMQKVSADVKTLDEERRTVDAQVQDMAAHL
FT                   PNMPHPDVPVSLKEEDAVELRRIGTPRHFDFTPKAHWDIGEDLGILDFERGAKVSGSRF
FT                   LYYVGDGAKLERAVYNFFLDQHEAEGYTEVLPPYMVTDESMYGTGQFPKFKEDAFRITT
FT                   QDLTLIPTAEVPLVNYYRDEVIPAEKLPVYFTALSPAFREEAGSAGRDTKGLIRLHQFN
FT                   KVEMVKFTKPEDSWDELEKLTNNAESLLKKLGLPYHVITLTTGDMSFTAAMTHDLEVWF
FT                   PEQDKYREISSCSNCTDFQARRAHIQYRDDDGKLQFVHTLNGSGLAVGRTVAAILENYQ
FT                   NEDGTVTIPDVLVPYMHGKTKIEKQG"
FT   gene            889443..889524
FT                   /locus_tag="LPST_Ct0012"
FT   tRNA            889443..889524
FT                   /locus_tag="LPST_Ct0012"
FT                   /product="tRNA-Leu"
FT   gene            889528..889600
FT                   /locus_tag="LPST_Ct0013"
FT   tRNA            889528..889600
FT                   /locus_tag="LPST_Ct0013"
FT                   /product="tRNA-Thr"
FT   gene            889625..889696
FT                   /locus_tag="LPST_Ct0014"
FT   tRNA            889625..889696
FT                   /locus_tag="LPST_Ct0014"
FT                   /product="tRNA-Gly"
FT   gene            889705..889790
FT                   /locus_tag="LPST_Ct0015"
FT   tRNA            889705..889790
FT                   /locus_tag="LPST_Ct0015"
FT                   /product="tRNA-Leu"
FT   gene            889801..889874
FT                   /locus_tag="LPST_Ct0016"
FT   tRNA            889801..889874
FT                   /locus_tag="LPST_Ct0016"
FT                   /product="tRNA-Arg"
FT   gene            889882..889955
FT                   /locus_tag="LPST_Ct0017"
FT   tRNA            889882..889955
FT                   /locus_tag="LPST_Ct0017"
FT                   /product="tRNA-Pro"
FT   gene            890006..890079
FT                   /locus_tag="LPST_Ct0018"
FT   tRNA            890006..890079
FT                   /locus_tag="LPST_Ct0018"
FT                   /product="tRNA-Pro"
FT   gene            890199..890327
FT                   /locus_tag="LPST_C0814"
FT   CDS_pept        890199..890327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0814"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0814"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98034"
FT                   /protein_id="ADN98034.1"
FT                   /translation="MKNTVVVTHNPDKATATVSHELGEISLGTAVHRCDTSAHRLQ"
FT   gene            890569..891036
FT                   /gene="ctsR"
FT                   /locus_tag="LPST_C0815"
FT   CDS_pept        890569..891036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="LPST_C0815"
FT                   /product="transcriptional regulator CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0815"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98035"
FT                   /protein_id="ADN98035.1"
FT                   /translation="MQSQNISDIIEKYLKSILADSEHVEIRRSEIADLFNVVPSQINYV
FT                   IKTRFTIQNGYLVESKRGGGGYIRIEKVNLVDDADVLDALIQVIGDSITQRDAYAVVQS
FT                   LYEDDVLNRREAQLILVAIDHETLGLTDRDLENSLRARIIIGILNHLRYES"
FT   gene            891055..893559
FT                   /gene="clpC"
FT                   /locus_tag="LPST_C0816"
FT   CDS_pept        891055..893559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="LPST_C0816"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpC"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0816"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98036"
FT                   /protein_id="ADN98036.1"
FT                   /translation="MDNLFTPSAKSVLVLAQEQAKYFKHQAVGTEHLLLALAIEKNGIA
FT                   NKVLQQYAVSEDDIREEIERFTGYGTLSNVGKDTYLPYSPKAKEILSVAGDEAKRLGAN
FT                   KIGTEHLLLAMLSDESILSSRILMNLNLDLGQTRKVVLRKLGVSDAMSKRKGNAANRGG
FT                   KKTEGTPTLDSLARDLTQLASEQEMDPVVGRSKEVKRVIQILSRRTKNNPVLIGEPGVG
FT                   KTAIAEGLAQKIVAGDVPTDMADKRLMMLDMGSLVAGTKYRGEFEDRLKKVIDEIYNDG
FT                   HVILFIDELHTLIGAGGAEGAIDASNILKPALARGELQTIGATTLNEYQKYIESDAALE
FT                   RRFATVMVNEPTEDEAVEILDGLRPRYEEHHRVTITDEAVDQAVKLSSRYISDRFLPDK
FT                   AIDLMDEAAAKVRIDQMDQPTKLSKNQDKLAQLREDKETAIEAQDFEQAADIRKQEMQL
FT                   KQRLDRIEADQDAEVTEGATPHYDLQVTGEDIAQVVAEWTGVPLTQLQKSESERLVNLE
FT                   KILHERVVGQPEAVSAVARAIRRARSGLKDPSRPIGSFMFLGPTGVGKTELAKALAAAM
FT                   FGSEDNMIRIDMSEYMERYSTSRLIGSAPGYVGYDEGGQLTEKVRQKPYSVVLFDEVEK
FT                   AHPDVFNILLQVLDDGYLTDSKGRKVDFRNTILIMTSNLGATTLRDEKSVGFGATDKAN
FT                   DYNAVAATIRATLKQTFRPEFLNRIDETIVFHSLNKEELHEIVKLMSQEIVDRVAQQGI
FT                   KIKITPAAIDVVAKAGFDPEYGARPIRRALQTEIEDRLSEELLTGAIKVDDQVTIGASK
FT                   GTITINIKNQPKADGRSTVSSK"
FT   gene            893738..894340
FT                   /locus_tag="LPST_C0817"
FT   CDS_pept        893738..894340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0817"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0817"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98037"
FT                   /protein_id="ADN98037.1"
FT                   /translation="MATRAEQMAKTHQAILDTARELFLRNGYDATSTRDIANAIGITQP
FT                   ALYHHFKDKEVIFLAVITTVGAEIKAGIEAIQVRADWSPLDQLTEVSLLLTHKHPADVF
FT                   TLIHSSFKALTHEHIRELGGIFVTDYVKPIQTVFEQPDMQLHVGVTPQMATNFYITSLS
FT                   PLFNSFHQIGDPHADERTHVQTLLKMILYGVASEPEN"
FT   gene            894587..898201
FT                   /gene="rpoB"
FT                   /locus_tag="LPST_C0818"
FT   CDS_pept        894587..898201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="LPST_C0818"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0818"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98038"
FT                   /protein_id="ADN98038.1"
FT                   /translation="MNNLAGHLVKYGKHRTRRSYARIKEVLDLPNLIEIQTDSYQWFLD
FT                   EGLREMFEDIMPIDDFAGKLSLEFVDYQLLEPKYTVEEAREHDANYSAPLHVTLRLTNH
FT                   ETGEIKSQDVFFGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYFNEELDKNGRPSYGT
FT                   TVIPNRGAWLELETDAKNVSYVRIDRTRKIPLTELVRALGYGSDDDIIDMLGETDSLML
FT                   TLEKDVHKNTDDSRVEESLKDIYERLRPGEPKTADSSRSLLTARFFDPKRYDFAPVGRY
FT                   KVNKKLSMKTRLMDQTLAETLADPDTGEVIAQKDTVIDKNVMAKLSPYLERDDFKTVTY
FT                   TPSDEAVVTNPMVLQVVKVYSQNDPEKVVNVIGNGNIDLKFKHIVPADIIASINYFFNL
FT                   QEGLGSTDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQDAATVTPQQLIN
FT                   IRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYT
FT                   HYGRMCPIETPEGPNIGLINSLSSYAKVNRYGFIETPYRRVDWTTHKVTDKIDYLAADE
FT                   EDQFVIAQANSPLNDDGSFVEDTVLARNKEENLETPIENVDYMDVSPKQVVAVATACIP
FT                   FLENDDSNRALMGANMQRQAVPLLDPHAPLIGTGIEYKAAHDSGIALICRHEGTVEYVD
FT                   AREVRVRRDDGSLDTYKLMKFRRSNGGKNYNQRPIVKVGDHVDNDEVLADGPAMEGGEL
FT                   ALGQNPLVAFMTWNGYNFEDAIIINERLVREDVYTSIHIEEYESEARDTKLGPEEMTRE
FT                   IPNVGEDALKNLDEDGIIRIGAEVKDGDILVGKVTPKGVTELSAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIIQDVKIFTRENGDELSPGVNMMVRVYIAQKRKIQVGDKMAGRHG
FT                   NKGTVSIVVPEEDMPYMPDGTPIDIMLSPMGVPSRMNIGQVLELHLGMAARKLGIHMAT
FT                   PVFDGAQDTDIWEAIREAGVDSDAKSIVYDGRTGEPFDKRVAVGVMHYMKLSHMVDDKI
FT                   HARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRV
FT                   KTYEAIVKGEPIPKPGVPESFRVLVKELQALGLDMKVLDSEDKEIELRDMDDDDDEVVN
FT                   VDALSKFKQQQDEKAADKAAKADAAKPSETTNAQQDNQ"
FT   gene            898219..901860
FT                   /gene="rpoC"
FT                   /locus_tag="LPST_C0819"
FT   CDS_pept        898219..901860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="LPST_C0819"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0819"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98039"
FT                   /protein_id="ADN98039.1"
FT                   /translation="MIDVNKFESMQIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFDERIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVTHI
FT                   WYFKGIPSRMGLVLDMSPRALEEIIYFASYVVIESGNTPLEKKQLLSEREYREKKAQYG
FT                   NEFEAAMGAEAIKRLLNNVDLEKEARDLKETLKDASGQKRTRAVRRLDIIEAFVTSGNE
FT                   PAWMVMDAIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIDVGPFLKMNQMGLPRQMALELFKPFIMKELVKRELASNIKNAKRKIEHADDDVWG
FT                   VLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLACEAYNADFDGDQMAIH
FT                   VPLSDEAQAEARLLMLAAHHILAPKDGKPVVTPSQDMVIGNYYLTTEEIGREGEGMIFK
FT                   DLNEAQKAYQSGYVHLHSRVGIQVSSMPDKPFTDDQKQAVLVTTVGKAIFNNILPGKFP
FT                   YLNEPTNDNLIAGTPDKYFLKPGEDIHQFLDAQEIIPPFKKGFLADIIAEVYKQYHVTA
FT                   TSLLLDRMKDLGYNISTKSGLTVGVADITGLKEKPAIIAEAHKQVNTISKQFRRGLITD
FT                   DERYERVIGVWNDAKDQIQQKLIESFNADNPIFMMSDSGARGNISNFTQLAGMRGLMAA
FT                   PNGKIMELPILSNFREGLSVLEMFISTHGARKGMTDTALKTANSGYLTRRLVDVAQDVI
FT                   VREKDCGTDRGLRIHAIMEGNEVIEPLYDRILGRYTMKTVFDPETHDEIVGNNVLIDED
FT                   LAHKIVDAGVTEVTIRSAFTCNTKHGVCEHCYGRNMATGDEVEVGEAVGTVAAQSIGEP
FT                   GTQLTMRNFHTGGVAGDDITQGLPRVQEIVESRNPKGRAEISEVTGTVELIEENPAERT
FT                   KEVTVKGETDTRTYTLPLTARMAVSEGDFIHRGAALNIGSIDPKQLIQVRDVLSTENYL
FT                   LREVQKVYRMQGVEIGDKHVEIMIRQMLRKVRVMDPGDTDVLPGTLMDIADFKDENYKT
FT                   LIAGGIPATSRPVILGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLIGLKENV
FT                   IIGKIIPAGTGMPVYRHIKPKEVGNVADGVYSISDLEKQMQEQDASK"
FT   gene            complement(902512..903192)
FT                   /locus_tag="LPST_C0820"
FT   CDS_pept        complement(902512..903192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0820"
FT                   /product="type 4 prepilin-like proteins leader peptide
FT                   processing enzyme (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0820"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98040"
FT                   /protein_id="ADN98040.1"
FT                   /translation="MLTSSLFIIGLCLGSFVTCMAERISNGHILISTQRSRCPHCRHQL
FT                   RFWQLIPLLGILLQRGRCYDCRTPISLRSSLIELLCGSLLASSSTSLSLTLPLLIGYLV
FT                   LIFNSLTDYLTFEVYPLTLLLPAGLGLWQQRPPLTISLYLVLALLVGLYLLAQLTATFG
FT                   LGDVDVLLMLVFIIPADTLLTCLAIAAVAALVGFIISAPRHRLPFVPFISWSFIMVTQL
FT                   TGLA"
FT   gene            903455..903868
FT                   /gene="rpsL"
FT                   /locus_tag="LPST_C0821"
FT   CDS_pept        903455..903868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="LPST_C0821"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0821"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98041"
FT                   /protein_id="ADN98041.1"
FT                   /translation="MPTINQLIRKGRKSKVSKSNAPALNFGYNSYKKVATNNPAPQKRG
FT                   VATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHVIRGALDTAGVEDRRQSRSKYGTKKPKK"
FT   gene            903885..904355
FT                   /gene="rpsG"
FT                   /locus_tag="LPST_C0822"
FT   CDS_pept        903885..904355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="LPST_C0822"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0822"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98042"
FT                   /protein_id="ADN98042.1"
FT                   /translation="MPRKGAPAKREVLADPMYNSKLVTRLINHLMLDGKRGTASTILYD
FT                   AFDQIKEQTGNDPLEVFEEAMKNVMPVLEVKARRVGGSNYQVPIEVRPDRKTTLGLRWI
FT                   VQYARSRGEHTMSDRLAREIMDAANNTGASVKKREDTHRMAEANRAFAHYRW"
FT   gene            904497..906593
FT                   /gene="fusA2"
FT                   /locus_tag="LPST_C0823"
FT   CDS_pept        904497..906593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA2"
FT                   /locus_tag="LPST_C0823"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0823"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98043"
FT                   /protein_id="ADN98043.1"
FT                   /translation="MANTREFSLDKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGET
FT                   HDGASQMDWMAQEQERGITITSAATTAQWKNHRINIIDTPGHVDFTVEVERSLRVLDGA
FT                   IAVLDAQSGVEPQTETVWRQASTYNVPRIVFVNKMDKIGADFKYSVSTIHDRLQANAHA
FT                   IQLPIGAEDNFEGVIDLIEMKADLYDEDQLGTEWDTVDVPDEYKEEAQAARDDLIEALA
FT                   DIDDGIMEKYLGGEEISKEEIKAAIRKGTLALEFFPVLAGSAFKNKGVQMLMDAVVDYL
FT                   PSPLDVKPYKATDPETEEEVDLIAGDDKPFAALAFKVATDPFVGRLTFIRVYQGTLESG
FT                   SYVLNATKDKRERVGRLLQMHSNQRKEIPEVFSGDIAAAIGLKNTTTGDSLTSIDHPYH
FT                   LESMEFPDPVIQVAVEPKTKADQDKMNVALQKLSEEDPTFKAETNPETGETLIAGMGEL
FT                   HLDIIVDRMRREFNVEATVGAPQVSYRETFTKSTQVQGKFVHQSGGKGQYGDVWVEFTP
FT                   NEEGKGFEFEDAIVGGVVPREYIPSVEQGLKEAMANGVLAGYPLVDVKAKLYDGSYHDV
FT                   DSSEAAFKIAASLALRNAVKTAGPVILEPIMKVDIVAPEDYLGDVMGHVTARRGNIEGM
FT                   EERGNAQEVHAYVPLAEMFGYATTLRSATQGRGTFTMTFDHYEKVPKSVQEDIIKKNGG
FT                   TPAK"
FT   gene            907545..907853
FT                   /locus_tag="LPST_C0824"
FT   CDS_pept        907545..907853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0824"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0824"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98044"
FT                   /protein_id="ADN98044.1"
FT                   /translation="MAKQKIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTE
FT                   RTIYTVLRSPHKFKDSREQFEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL"
FT   gene            907891..908520
FT                   /gene="rplC"
FT                   /locus_tag="LPST_C0825"
FT   CDS_pept        907891..908520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="LPST_C0825"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0825"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98045"
FT                   /protein_id="ADN98045.1"
FT                   /translation="MTTKGILGKKVGMTQVFTESGELVPVTVVEVQPNVVLQVKTVEND
FT                   GYEAIQLGVDDKREVLTNKPAQGHAAKAKTTPKRFIREIRNVELGDYTVGDEVKADIFA
FT                   AGDAVDVTGITKGHGYQGNIHKDGQSRGPMAHGSRYHRRPGSMGAIINRVFKGKKLPGR
FT                   MGNHQRTMQNLQIVRADVENNVLLIKGNVPGANKSFVTVKTSVKSK"
FT   gene            908539..909162
FT                   /gene="rplD"
FT                   /locus_tag="LPST_C0826"
FT   CDS_pept        908539..909162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="LPST_C0826"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0826"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98046"
FT                   /protein_id="ADN98046.1"
FT                   /translation="MTSVALFKQDGTQNGDVTLNDAVFGVEPNENVVFDAILMQRASMR
FT                   QGTHAVKNRSARRGGGRKPWRQKGTGRARQGSIRSPQWRKGGIVFGPTPRSYSYKLPKK
FT                   VMRLALKSVLSQKVLDNSLVAVDSLAFDAPKTKDFVNVLNNLNVDTKTLVLVEEDNEKA
FT                   ALAGRNLPNVKILKAKGVNVLDVANSDKLVVTQKALDQLEEALA"
FT   gene            909162..909455
FT                   /gene="rplW"
FT                   /locus_tag="LPST_C0827"
FT   CDS_pept        909162..909455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="LPST_C0827"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0827"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98047"
FT                   /protein_id="ADN98047.1"
FT                   /translation="MEARDVILRPVVTESSMADLDDKRYTFDVNVQATKTQVKKAIEEI
FT                   FDVKVVKVNVMNVKGKLKRQGRYAGYTKKRRKAIVTLSSDSNEIKLFNDDQQ"
FT   gene            909479..910318
FT                   /gene="rplB"
FT                   /locus_tag="LPST_C0828"
FT   CDS_pept        909479..910318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="LPST_C0828"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0828"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98048"
FT                   /protein_id="ADN98048.1"
FT                   /translation="MGIKKYKPTTNGRRNMTASDFSEITKTKPEKSLLDSQSHTAGRNS
FT                   YGHITVRHRGGGHKQQYRLVDFKRIKDEVPATVKAIEYDPNRTANIALLVYADGVKSYI
FT                   LAPKGLEVGMQVQSGAEADIKVGNALPLTNIPVGTVIHNIELKPGKGGQLARSAGTSAQ
FT                   LLGKEGKYAIVRLSSGEVRLVLLTSRATIGTVGNEQHELINSGKAGRTRWQGKRPTVRG
FT                   SVMNPNDHPHGGGEGKAPIGHPSPMSPWGKKTLGKKTRNKKARSNKLIVRGRRPGKH"
FT   gene            910361..910636
FT                   /gene="rpsS"
FT                   /locus_tag="LPST_C0829"
FT   CDS_pept        910361..910636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="LPST_C0829"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0829"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98049"
FT                   /protein_id="ADN98049.1"
FT                   /translation="MGRSLKKGPFADAHLLKKIDAQSDSDKKSVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQDDMVGHKLGEFVPTRTFHGHGTDDKKTK"
FT   gene            910657..911004
FT                   /gene="rplV"
FT                   /locus_tag="LPST_C0830"
FT   CDS_pept        910657..911004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="LPST_C0830"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0830"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98050"
FT                   /protein_id="ADN98050.1"
FT                   /translation="MAEQVTSARATAKTVRIAARKVRLVVDLIRGKSVAEALAILKFTP
FT                   RGASPVVEKVLLSAVANAENNFDLDREDLVVSEAFVNEGPTLKRFRPRAKGSASPINKR
FT                   TSHITITVTEK"
FT   gene            911017..911670
FT                   /gene="rpsC"
FT                   /locus_tag="LPST_C0831"
FT   CDS_pept        911017..911670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="LPST_C0831"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0831"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98051"
FT                   /protein_id="ADN98051.1"
FT                   /translation="MGQKVNPTGLRVGIIRDWEAKWYAEKDFAAYLNEDLRIRKYIEQR
FT                   LADASVSTVEIERAANRVNISIHTAKPGMVIGKGGSEVEALRKELNNLTGKRVHINIIE
FT                   IKKPDLDAKLVGESIARQLEGRVAFRRAMRGAMQRTMRSGAKGIKTQVAGRLNGADMSR
FT                   VEAYSDGTVPLHTLRADIDYSWVEARTTYGKLGVKTWIYRGEILPEKKSAKGGN"
FT   gene            911673..912107
FT                   /gene="rplP"
FT                   /locus_tag="LPST_C0832"
FT   CDS_pept        911673..912107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="LPST_C0832"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0832"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98052"
FT                   /protein_id="ADN98052.1"
FT                   /translation="MLVPKRVKYRRVHRGKMRGEAKGGKTVAFGDYGLQTLESHWISNR
FT                   QIEAARVAMNRYMKRGGKVWIKIFPHKSYTEKGVGVRMGNGKGTPAGWVAPVKRNKIMF
FT                   EVAGVPEEVAREALRLAGTKLPVKTKIVKREEVGGESDEG"
FT   gene            912097..912291
FT                   /gene="rpmC"
FT                   /locus_tag="LPST_C0833"
FT   CDS_pept        912097..912291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="LPST_C0833"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0833"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98053"
FT                   /protein_id="ADN98053.1"
FT                   /translation="MKAKEIKALSTTEMLEKEKSYKDELFNLRFQLATGQLENTARLKQ
FT                   VRKNIARIKTALREQELNK"
FT   gene            912314..912583
FT                   /gene="rpsQ"
FT                   /locus_tag="LPST_C0834"
FT   CDS_pept        912314..912583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="LPST_C0834"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0834"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98054"
FT                   /protein_id="ADN98054.1"
FT                   /translation="MSEDTRNSRKVIQGRVVSDKMDKTIVVIVETYKNHPVYGKRVRYS
FT                   KKFKAHDEKNEAKTGDIVKIMETRPLSATKRFRLIEVVQKAVII"
FT   gene            912626..912994
FT                   /gene="rplN"
FT                   /locus_tag="LPST_C0835"
FT   CDS_pept        912626..912994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="LPST_C0835"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0835"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98055"
FT                   /protein_id="ADN98055.1"
FT                   /translation="MIQQESRLKVADNSGAREILTIKVLGGSGRKTANIGDVIVATVKQ
FT                   ATPGGVVKAHDVVKAVIVRTKSGVHRADGSYIKFDENAAVIIRDDKTPQGTRIFGPVAR
FT                   ELRDKDFMRIVSLAPEVL"
FT   gene            913028..913339
FT                   /gene="rplX"
FT                   /locus_tag="LPST_C0836"
FT   CDS_pept        913028..913339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="LPST_C0836"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0836"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98056"
FT                   /protein_id="ADN98056.1"
FT                   /translation="MLIKTGDKVRVISGKDRGQEGTVKKVISAKNRIVVEGVNKIKKHQ
FT                   KPTNVNPQGGIVDIEAPIDASNVMYLDPSTNEPTRLGVRREDGKRVRYAKKSGKDLEN"
FT   gene            913368..913910
FT                   /gene="rplE"
FT                   /locus_tag="LPST_C0837"
FT   CDS_pept        913368..913910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="LPST_C0837"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0837"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98057"
FT                   /protein_id="ADN98057.1"
FT                   /translation="MENRLKAQYEKEIVPALVDKFNYTSVMQVPKLAKIVLNMGVGDAV
FT                   TNAKNLDEAVEELTLISGQKPLVTRAKKSIAGFRLREGMAIGAKVDLRGERMYDFLDKL
FT                   INVSLPRVRDFHGVSTRSFDGRGNYTLGVREQLIFPEINYDNVNRVRGLDIVIVTTADS
FT                   DEESRELLTQFGMPFAK"
FT   gene            913931..914116
FT                   /gene="rpsN"
FT                   /locus_tag="LPST_C0838"
FT   CDS_pept        913931..914116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="LPST_C0838"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0838"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98058"
FT                   /protein_id="ADN98058.1"
FT                   /translation="MAKKSQIAKQKRGAKFNVQNYTRCERCGRPHSVYRKFHLCRICLR
FT                   DLAHKGQIPGMKKASW"
FT   gene            914150..914545
FT                   /gene="rpsH"
FT                   /locus_tag="LPST_C0839"
FT   CDS_pept        914150..914545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="LPST_C0839"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0839"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98059"
FT                   /protein_id="ADN98059.1"
FT                   /translation="MMTDPIADFLTRIRNANMVRHDSLEVPASKIKRNIAEILKNEGFV
FT                   RDVEYIDDDKQGIIRVFLKYGKDNERVISGLKRISKPGLRSYVKADAVPKVLNGLGIAI
FT                   ISTSEGVITDKEARAKKLGGEVLAYVW"
FT   gene            914575..915111
FT                   /gene="rplF"
FT                   /locus_tag="LPST_C0840"
FT   CDS_pept        914575..915111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="LPST_C0840"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0840"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98060"
FT                   /protein_id="ADN98060.1"
FT                   /translation="MSRIGYKVIELPAGVEVSQAGEVVTVKGPKGTLTRNIASDITMTV
FT                   EGNEVKFTRPSDDYKMKALHGTTRANVNNMVEGVTKGFTKNLQLVGVGYRAQLQGKKLV
FT                   LSVGYSHPVEFATPENLTVEVPDNTHINISGIGKQAVGDFAAEVRAVRSPEPYKGKGIR
FT                   YVDEYVRRKEGKTGK"
FT   gene            915146..915511
FT                   /gene="rplR"
FT                   /locus_tag="LPST_C0841"
FT   CDS_pept        915146..915511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="LPST_C0841"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0841"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98061"
FT                   /protein_id="ADN98061.1"
FT                   /translation="MTIVISKPDKNKTRQRRHARVRGKISGTAERPRLNVYRSNKNIYA
FT                   QVIDDVEGVTLASASTLDSEVKGNNKTEKAASVGEVVAKRAAEKKIVDVVFDRGGYLYH
FT                   GRVQALAEAARENGLKF"
FT   gene            915532..916032
FT                   /gene="rpsE"
FT                   /locus_tag="LPST_C0842"
FT   CDS_pept        915532..916032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="LPST_C0842"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0842"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98062"
FT                   /protein_id="ADN98062.1"
FT                   /translation="MTFIDPSKLDLDDNVVAINRITKVVKGGRRLRFAALVIVGDHKGH
FT                   VGFGTGKAQEVPEAIRKASEAAKKNLITVPMVGTTIPHEALGVYGGGRIMLKPAVEGSG
FT                   VAAGGAVRAVMELAGVDDVTSKRLGSNTPVNVVRATFEGLKSLKTAEQVAALRGVSAEH
FT                   LAE"
FT   gene            916047..916229
FT                   /gene="rpmD"
FT                   /locus_tag="LPST_C0843"
FT   CDS_pept        916047..916229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="LPST_C0843"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0843"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98063"
FT                   /protein_id="ADN98063.1"
FT                   /translation="MAQLKITLVRSAAHRLPKQRKIVKELGLGRINSSVVKPDDAATRG
FT                   QIFHIAHLVDVEIIK"
FT   gene            916261..916692
FT                   /gene="rplO"
FT                   /locus_tag="LPST_C0844"
FT   CDS_pept        916261..916692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="LPST_C0844"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0844"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98064"
FT                   /protein_id="ADN98064.1"
FT                   /translation="MKLHELTPSEGSRFSRRRIGRGDSSGQGKTSGRGQKGQKARGKVR
FT                   VGFEGGQMPLYRRIPKRGFTNINRKEYAVVNLDGLNRFDDGAEVTPESLKEAGLVKKSS
FT                   AVKVLGNGKLNKKLTVKASKFSATAVAAIEAAGGKTEVI"
FT   gene            916694..917989
FT                   /gene="secY"
FT                   /locus_tag="LPST_C0845"
FT   CDS_pept        916694..917989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="LPST_C0845"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0845"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98065"
FT                   /protein_id="ADN98065.1"
FT                   /translation="MLTTMKNALKVKDIRNKLLFTLGVLIVFRLGSYITVPGVNAQALQ
FT                   SVASSGLISMLNTFSGGGLTNYSILAMGVSPYITAQIIVQLLQMDIVPKFVEWGKQGEV
FT                   GRRKLNQATRWLTIVLAFVQSIGITAGFNSLSQLKLVNNPSISTYLTIGVILTGGAMLT
FT                   TWMGDMITDRGIGNGVSIIIFAGIIARMPTSIYQIYQEQFVNVSQSDWWKSGLFVVGLA
FT                   LLVLIIVMFVTWVEQANDRIPIQYTRRAAGAPDSSYLPLKVNVAGVIPVIFASSFIATP
FT                   QTILLGFQSSHGDETWYTVLSNIFNMQSTTGAILYTILIVLFTFFYAFVQVNPEKLSKN
FT                   LQKQGSYIPGVWPGKDTQDWVSKLLMRLSTVGALYLGLISLIPLLASDIWGLDESIGLG
FT                   GTSLLIVVGVALETIRQIKGLMMKRDYVGFIR"
FT   gene            918053..918703
FT                   /gene="adk"
FT                   /locus_tag="LPST_C0846"
FT   CDS_pept        918053..918703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="LPST_C0846"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0846"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98066"
FT                   /protein_id="ADN98066.1"
FT                   /translation="MNLILMGLPGAGKGTQAQKILEDFDIPHISTGDIFRAAIKNETKM
FT                   GLEAKKYIDAGNLVPDEVTNGIVRDRLAEADTKNGFLLDGYPRNIDQAHALKQIGEELN
FT                   KPLDGVINIHVEPAVLVERLSGRFICRTCGATYHKLYNKPKVEGTCDVCGGHDFYQRDD
FT                   DKPATVKNRLDVNIKLNTPLIDYYGQEKLLYNVDGDRDIDDVYKDIKKILDNL"
FT   gene            918878..919096
FT                   /gene="infA"
FT                   /locus_tag="LPST_C0847"
FT   CDS_pept        918878..919096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="LPST_C0847"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0847"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98067"
FT                   /protein_id="ADN98067.1"
FT                   /translation="MAKEDVIEIQGTIKETLPNAMFKVELENGAEILAHVSGKIRMHYI
FT                   RILPGDKVTVEMSPYDLTKGRITYRFK"
FT   gene            919280..919645
FT                   /gene="rpsM"
FT                   /locus_tag="LPST_C0848"
FT   CDS_pept        919280..919645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="LPST_C0848"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0848"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98068"
FT                   /protein_id="ADN98068.1"
FT                   /translation="MARIEGIDLPRDKRIVIGLTYIYGIGNTSAQKILAEAGVSEDVRV
FT                   RDLTPDQEDKIRAVVDGYKTEGDLRREVSLNIKLLQEIGSYRGMRHRRGLPVRGQHTKN
FT                   NARTRKGKKVSIAGRKK"
FT   gene            919670..920059
FT                   /gene="rpsK"
FT                   /locus_tag="LPST_C0849"
FT   CDS_pept        919670..920059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="LPST_C0849"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0849"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98069"
FT                   /protein_id="ADN98069.1"
FT                   /translation="MATRKTTRRRRVKKNIESGVAHIHSTFNNTLVMITDMQGNAIAWS
FT                   SAGSLGFKGSRKSTPFAAQMAAEAAAKASMEHGMKTVEVAVKGPGSGREAAIRALQATG
FT                   LEVSAIRDVTPVPHNGSRPPKRRRV"
FT   gene            920146..921090
FT                   /gene="rpoA"
FT                   /locus_tag="LPST_C0850"
FT   CDS_pept        920146..921090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="LPST_C0850"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0850"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98070"
FT                   /protein_id="ADN98070.1"
FT                   /translation="MIEFEKPNIHKIDENDNYGKFVVEPLERGYGTTLGNSLRRILLSS
FT                   LPGAAVTSIQIDGVLHEFSTIEGVTEDVTAIILNVKKIALKLESDETKTLEIDVKGPAN
FT                   VTAGDIIGDADVEVLNPDLPICTVADGAHFHMRMTANTGRGYVSAEDNKHREDDMPIGV
FT                   LAVDSLYSPIERVNYQVENTRVGQRDDFDKLTLDVWTNGSITPSEAISLSAKILTDHLS
FT                   IFVNLTDEAKNTDVMVEKEETHKEKMLEMTIEELDLSVRSYNCLKRAGINTVQELTNKT
FT                   EADMMKVRNLGRKSLEEVKAKLADLGLSLRKED"
FT   gene            921112..921495
FT                   /gene="rplQ"
FT                   /locus_tag="LPST_C0851"
FT   CDS_pept        921112..921495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="LPST_C0851"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0851"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98071"
FT                   /protein_id="ADN98071.1"
FT                   /translation="MSYRKLQRTSSQRRALLRDLTTSLIVNGKIETTEARAKEVRSTAD
FT                   KMISLAKKGDLSARRKAAAFMRDVVADVKEDGDNVAVQTALQKLFSDLGPQYADRNGGY
FT                   TRIYKTMPRRGDGAQMVVLELVD"
FT   gene            complement(921899..922891)
FT                   /gene="hepB1"
FT                   /locus_tag="LPST_C0852"
FT   CDS_pept        complement(921899..922891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepB1"
FT                   /locus_tag="LPST_C0852"
FT                   /product="trans-hexaprenyltranstransferase, component II"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0852"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98072"
FT                   /protein_id="ADN98072.1"
FT                   /translation="MQSATQLHPIWRDYPALQPELQQVMQLMTANINIQDADINDAILE
FT                   MIHGGGKLLRPAYCLLFSQFTTTDRQRMVALAASLETLHTATLIHDDIVDDAALRRHHV
FT                   TIQERFGKDTAVYAGDYLFVVVFKILAHYSSSFKSIQMNSENMEKILVGEVQQKDRHYH
FT                   LDITMAEYLQQIQGKTAELFALSCFLGAYESGQSSHFAQRARKAGLAIGMAFQILDDIL
FT                   DYQEVSQETGKPILEDVAEGVYTSPLIFALQTEAKHDLLPLMRLQGAISDTQRQEVQRL
FT                   VINAGGVVQAQELATKYTQDALAIMRKLPDQPAKTDLISLTKRLLDRHN"
FT   gene            complement(922897..923466)
FT                   /locus_tag="LPST_C0853"
FT   CDS_pept        complement(922897..923466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0853"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0853"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98073"
FT                   /protein_id="ADN98073.1"
FT                   /translation="MNNSFERSNKTHRNIYIALLVAQGVIIGILERMIPFPFAFAPGAK
FT                   LGLANLITIVAIYTLSLTDVITLTWLRLILTALLGGTLSTFLYSFGGAFLSLFAMLLVK
FT                   QLGPKRVSIIGISATGGVMHNVGQLLVASLIAQTWTVMLYLPVLSIIGLAAGSALGIAA
FT                   NYLFTHVTILRYLKFNREHHPDQTKE"
FT   gene            complement(923470..923961)
FT                   /locus_tag="LPST_C0854"
FT   CDS_pept        complement(923470..923961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0854"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0854"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98074"
FT                   /protein_id="ADN98074.1"
FT                   /translation="MRKLRTMIRTFKRYGDMIKPFDIIIIVALIILSFTPLAIFSYQQK
FT                   QQAEHAALVAKRKATSSETTYNAVVSHNGTVLKRVNITNLKTTKHFTYRDNHGHYNTIT
FT                   FKPKRVAITKANCSDQVCVRRGWIHKPGQTIVCLPHKLLVEIKASNGQVKSGGNGLVTE
FT                   "
FT   gene            complement(924056..925966)
FT                   /gene="ndh2"
FT                   /locus_tag="LPST_C0855"
FT   CDS_pept        complement(924056..925966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh2"
FT                   /locus_tag="LPST_C0855"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0855"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98075"
FT                   /protein_id="ADN98075.1"
FT                   /translation="MAKKNIVVVGAGFAGVYATKKLSKHFKKNADVEITLIDRHSYFTY
FT                   MTELHEVATERVEPEHIQYDLQRLFARRKNVRLVTDTVTGIDKKAQTVTTEHGSYQYDQ
FT                   LLISLGGESNDFGTPGVKEHGFELWSFEQAMALRAHLSAIIRRGAAELDPAKRKAMLTF
FT                   TVCGSGFTGSELIGELIEYRDVLARDNKLDPSEITLQLVEAAPTIINMLNRTQAGKAAK
FT                   YMEKHGVKIMTNSMITEVCEDHVNLKGKDPIPTYTLIWTAGVRANSIVKKFGIETNPRG
FT                   GRLMANEFMQAKDCNNIFLAGDSTSYQEPDQPRPVPQIVQGAEETAAKAVEGIIKNVDQ
FT                   TDVTIKPFKGAYQASVDSIGSKYAVAQVLEKWNVSGFIAVLLKHAINWMYYVQIFSGYY
FT                   LFQYFMHEFFRTRNNRNVFRGWVSRAGNVLWSVPLRFFYGAMWLWDCWTKVQGSESWFT
FT                   DKLRLPFEWITVAATSGASQATKAAATSGASEAATSTVKAAKGVFSLSYMYGKEPLMVF
FT                   DKMPHWFESITKVFIPNMQMALFFQKFMTCVEIVIALCIFFGLFTWFANAVTIGLVVVF
FT                   CLSGMFYWVNIWMIFVALALMNGSGRTFGLDYWVVPWMQKHLGHWWYGNVRSHYDGVKT
FT                   R"
FT   gene            926249..927175
FT                   /locus_tag="LPST_C0856"
FT   CDS_pept        926249..927175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0856"
FT                   /product="lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0856"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98076"
FT                   /protein_id="ADN98076.1"
FT                   /translation="MKFKSVITGASVVAISALALAGCGSSSSSSSSSSSKKSSSSSSSA
FT                   KTTKVAKLTAGSKMKAGTYNLEEENYSHGYRTKMSITVNNNGKITKSSYDQVNKNGKSK
FT                   VDDTSYNKQMKKIAGTNPKTYMPKLNKTLTGSAATGNVGSIDVVTGATESSKTFQNYTQ
FT                   QLVQAAQAGNKSTIKIDNGAKMKDGTYKLNEKNYSHGYKVTFAITVKDNKITKSEYNQV
FT                   NKNGKSKVDDAAYNKQMKKVAKTNPKTYQPALNKSLVKSSDPTKVDVVTGATESSNTFI
FT                   MYAEQLQNAAQKGDTNTITVDNMIFSE"
FT   gene            927228..927341
FT                   /locus_tag="LPST_C0857"
FT   CDS_pept        927228..927341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0857"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0857"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98077"
FT                   /protein_id="ADN98077.1"
FT                   /translation="MFLIEQPQKFVTQLGTTLSKLNPYMDIGLKNNSGGEC"
FT   gene            927515..928627
FT                   /gene="apbE1"
FT                   /locus_tag="LPST_C0858"
FT   CDS_pept        927515..928627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbE1"
FT                   /locus_tag="LPST_C0858"
FT                   /product="thiamin biosynthesis lipoprotein ApbE"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0858"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98078"
FT                   /protein_id="ADN98078.1"
FT                   /translation="MKLKKWVRIGLIVAMIVPLTACGTSTSRKNAASSRPKPTKVVKTP
FT                   IEDTQFMMGTVVTLRIYNKGKDNVLAGAFKLLKTEAKEITVNQKGSEIDKINAAAGKKP
FT                   VAVSKDIYPMIKAAYYYSKNSDESFDLAIGPITSLWHIGFSDAKVPTQQEIDKNVKLVD
FT                   YKKVKLNDKKRTVYLEEKGMQLDLGGIAKGYMTDQVKTYLLNHGVSTAIIDLGGNIYVL
FT                   GDSPKGTKSGNWTVGIQDPKASRGTAIGSLPAKNKSIVTSGIYERYLKKNGKVYSHLMD
FT                   PQTGAPYQNNLMGVSIISKKSVDGDALSTATFDKGLKGGMKYINGKADQGIGAIFITKD
FT                   KKVYVSNNLKKQFTLFGDAGYKYGPATDLK"
FT   gene            928710..929555
FT                   /gene="cbiO"
FT                   /locus_tag="LPST_C0859"
FT   CDS_pept        928710..929555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="LPST_C0859"
FT                   /product="cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0859"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98079"
FT                   /protein_id="ADN98079.1"
FT                   /translation="MVSPIIDVKHLDYRYPQQATDQLTLHDISFTVMPGEWVAIVGHNG
FT                   SGKSTLAKNLNGLLAPAAGTITVDGQVLSEETVWDIRRKIGMVFQNPDNQFVGATVADD
FT                   VAFSLENQGVPRPEMLTRVQAALEQVNMQDFATREPARLSGGQKQRVALAGMIAARPQI
FT                   LILDEATSMLDPRGRQEVLTTIRDMKANSALTVLSITHDIDEAASANRVLVINDGEVKE
FT                   EGTPAEIFQHGEALIKMGLDMPYAERLKAALKRQGVQVPAQYLTEKGMADWLWQLRSNK
FT                   "
FT   gene            929531..930418
FT                   /gene="cbiO"
FT                   /locus_tag="LPST_C0860"
FT   CDS_pept        929531..930418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="LPST_C0860"
FT                   /product="cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0860"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98080"
FT                   /protein_id="ADN98080.1"
FT                   /translation="MAITFKQVDFTYQPGTPFETKALTDINVTIPTGSYTALIGHTGSG
FT                   KSTLLQHLNALLKPTSGTVTIGERVITPTTSNKDLKRLRQHVGIVFQFPESQLFEETVA
FT                   KDIAFGPQNFGASEADALKTAAEMLALVGLDESLLTRSPFDLSGGQMRRVAIAGVLAMQ
FT                   PQVLVLDEPTAGLDPQGRLDMMEMFARLRHERDLTVVLVTHQMDDVANYADNIIVMDRG
FT                   QIVKTGTPREIFKDPAWLTAHQLGLPKTTAFAHTLQKQGWQFDEWPLTEDELAAAIVQQ
FT                   LPPNAMGEVAAHDE"
FT   gene            930408..931208
FT                   /locus_tag="LPST_C0861"
FT   CDS_pept        930408..931208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPST_C0861"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0861"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98081"
FT                   /protein_id="ADN98081.1"
FT                   /translation="MMNKLIFGRYIPGDSVVHHMDPRAKLLLSFYFIGIIFIANNWATY
FT                   ALLFALTLAAIYLSGVKWSFFINGVKPLIWLILFTVILQVLFSASGGHVYFQWGIITIS
FT                   QLGLINGVYIFCRFVLIIFMSTLLTLTTPPLELSDAIEYILMPLRAVRFPVYEVALMLS
FT                   IALRFVPTLMDETEKIMNAQRARGVDFGEGNIFQQMRAVVPLLIPLFVSSFNRAEDLAT
FT                   AMEARGYQGGEGRSKYRILKWHQRDTWATGCFAILTVALIFLRA"
FT   gene            931273..932061
FT                   /gene="truA"
FT                   /locus_tag="LPST_C0862"
FT   CDS_pept        931273..932061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="LPST_C0862"
FT                   /product="tRNA-pseudouridine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0862"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98082"
FT                   /protein_id="ADN98082.1"
FT                   /translation="MTTRYKVVLAYDGTNFAGFQRQPHQRTVEQVVTKAVNKMAKDPVE
FT                   PIVIYGAGRTDAGVHAFGQTLHFDLPYEINPEGVRRGLNSMLPMDTIVKAVSIVPNDFH
FT                   ARYDTVGKRYWYRAYQNEFVDPFKRHYTGHFKFAADIDRIQQAIGDLEGRHDFSTFVAS
FT                   GSQAHDHVREIYSAKAWALPDEREIQFEFCGSGFLYNQVRIMVAVLMEIGQGRRAVDCI
FT                   PALLAAKDREQARGTAPAAGLYMKKVYYEQNELQADLIKY"
FT   gene            932170..932613
FT                   /gene="rplM"
FT                   /locus_tag="LPST_C0863"
FT   CDS_pept        932170..932613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="LPST_C0863"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0863"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98083"
FT                   /protein_id="ADN98083.1"
FT                   /translation="MRTTYMAKPGEIDRKWYVVDATDVPLGRLSTVVASILRGKNKPTF
FT                   TPNVDTGDNVIVINASKVALTGKKAERKIYYHHTAYAGGLKERTAGDFLAKEPTKLIET
FT                   SVKGMLPHNSLGHKMGLKLHVYAGAEHTQQAQKPEVLDITNLI"
FT   gene            932627..933019
FT                   /gene="rpsI"
FT                   /locus_tag="LPST_C0864"
FT   CDS_pept        932627..933019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="LPST_C0864"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:LPST_C0864"
FT                   /db_xref="EnsemblGenomes-Tr:ADN98084"
FT                   /protein_id="ADN98084.1"
FT                   /translation="MAQVQYRGTGRRKDSVARVRLVPGTGKIVMNDKSVEDYIPFADIR
FT                   KELLQPFEVTETTDQYDVLVNVNGGGFHGQAGATRHGIARALLEVDPDFRTPLKRAGLL
FT                   TRDARMKERKKPGLKKARKASQFSKR"
FT   gene            complement(933317..934186)
FT                   /locus_tag="LPST_C0865"
FT   CDS_