(data stored in SCRATCH zone)

EMBL: CP002281

ID   CP002281; SV 1; circular; genomic DNA; STD; PRO; 2046464 BP.
XX
AC   CP002281;
XX
PR   Project:PRJNA32577;
XX
DT   28-OCT-2010 (Rel. 106, Created)
DT   09-JUN-2015 (Rel. 125, Last updated, Version 5)
XX
DE   Ilyobacter polytropus DSM 2926, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Ilyobacter polytropus DSM 2926
OC   Bacteria; Fusobacteria; Fusobacteriales; Fusobacteriaceae; Ilyobacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2046464
RX   PUBMED; 21304735.
RA   Sikorski J., Chertkov O., Lapidus A., Nolan M., Lucas S., Del Rio T.G.,
RA   Tice H., Cheng J.F., Tapia R., Han C., Goodwin L., Pitluck S., Liolios K.,
RA   Ivanova N., Mavromatis K., Mikhailova N., Pati A., Chen A., Palaniappan K.,
RA   Land M., Hauser L., Chang Y.J., Jeffries C.D., Brambilla E., Yasawong M.,
RA   Rohde M., Pukall R., Spring S., Goker M., Woyke T., Bristow J., Eisen J.A.,
RA   Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Ilyobacter polytropus type strain (CuHbu1)";
RL   Stand Genomic Sci 3(3):304-314(2010).
XX
RN   [2]
RP   1-2046464
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Chertkov O., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Spring S., Pukall R., Steenblock K., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   "The complete chromosome of Ilyobacter polytrpous DSM 2926";
RL   Unpublished.
XX
RN   [3]
RP   1-2046464
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Chertkov O., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Spring S., Pukall R., Steenblock K., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (18-OCT-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; fa8d810afd50055075ddafd01dbeaab6.
DR   BioSample; SAMN00116458.
DR   CABRI; DSM 2926.
DR   EnsemblGenomes-Gn; EBG00001191325.
DR   EnsemblGenomes-Gn; EBG00001191326.
DR   EnsemblGenomes-Gn; EBG00001191327.
DR   EnsemblGenomes-Gn; EBG00001191328.
DR   EnsemblGenomes-Gn; EBG00001191329.
DR   EnsemblGenomes-Gn; EBG00001191330.
DR   EnsemblGenomes-Gn; EBG00001191331.
DR   EnsemblGenomes-Gn; EBG00001191332.
DR   EnsemblGenomes-Gn; EBG00001191333.
DR   EnsemblGenomes-Gn; EBG00001191334.
DR   EnsemblGenomes-Gn; EBG00001191335.
DR   EnsemblGenomes-Gn; EBG00001191336.
DR   EnsemblGenomes-Gn; EBG00001191337.
DR   EnsemblGenomes-Gn; EBG00001191338.
DR   EnsemblGenomes-Gn; EBG00001191339.
DR   EnsemblGenomes-Gn; EBG00001191340.
DR   EnsemblGenomes-Gn; EBG00001191341.
DR   EnsemblGenomes-Gn; EBG00001191342.
DR   EnsemblGenomes-Gn; EBG00001191343.
DR   EnsemblGenomes-Gn; EBG00001191344.
DR   EnsemblGenomes-Gn; EBG00001191345.
DR   EnsemblGenomes-Gn; EBG00001191346.
DR   EnsemblGenomes-Gn; EBG00001191347.
DR   EnsemblGenomes-Gn; EBG00001191348.
DR   EnsemblGenomes-Gn; EBG00001191349.
DR   EnsemblGenomes-Gn; EBG00001191350.
DR   EnsemblGenomes-Gn; EBG00001191351.
DR   EnsemblGenomes-Gn; EBG00001191352.
DR   EnsemblGenomes-Gn; EBG00001191353.
DR   EnsemblGenomes-Gn; EBG00001191354.
DR   EnsemblGenomes-Gn; EBG00001191355.
DR   EnsemblGenomes-Gn; EBG00001191356.
DR   EnsemblGenomes-Gn; EBG00001191357.
DR   EnsemblGenomes-Gn; EBG00001191358.
DR   EnsemblGenomes-Gn; EBG00001191359.
DR   EnsemblGenomes-Gn; EBG00001191360.
DR   EnsemblGenomes-Gn; EBG00001191361.
DR   EnsemblGenomes-Gn; EBG00001191362.
DR   EnsemblGenomes-Gn; EBG00001191363.
DR   EnsemblGenomes-Gn; EBG00001191364.
DR   EnsemblGenomes-Gn; EBG00001191365.
DR   EnsemblGenomes-Gn; EBG00001191366.
DR   EnsemblGenomes-Gn; EBG00001191367.
DR   EnsemblGenomes-Gn; EBG00001191368.
DR   EnsemblGenomes-Gn; EBG00001191369.
DR   EnsemblGenomes-Gn; EBG00001191370.
DR   EnsemblGenomes-Gn; EBG00001191371.
DR   EnsemblGenomes-Gn; EBG00001191372.
DR   EnsemblGenomes-Gn; EBG00001191373.
DR   EnsemblGenomes-Gn; EBG00001191374.
DR   EnsemblGenomes-Gn; EBG00001191375.
DR   EnsemblGenomes-Gn; EBG00001191376.
DR   EnsemblGenomes-Gn; EBG00001191377.
DR   EnsemblGenomes-Gn; EBG00001191378.
DR   EnsemblGenomes-Gn; EBG00001191379.
DR   EnsemblGenomes-Gn; EBG00001191380.
DR   EnsemblGenomes-Gn; EBG00001191381.
DR   EnsemblGenomes-Gn; EBG00001191382.
DR   EnsemblGenomes-Gn; EBG00001191383.
DR   EnsemblGenomes-Gn; EBG00001191384.
DR   EnsemblGenomes-Gn; EBG00001191385.
DR   EnsemblGenomes-Gn; EBG00001191386.
DR   EnsemblGenomes-Gn; EBG00001191387.
DR   EnsemblGenomes-Gn; EBG00001191388.
DR   EnsemblGenomes-Gn; EBG00001191389.
DR   EnsemblGenomes-Gn; EBG00001191390.
DR   EnsemblGenomes-Gn; EBG00001191391.
DR   EnsemblGenomes-Gn; EBG00001191392.
DR   EnsemblGenomes-Gn; EBG00001191393.
DR   EnsemblGenomes-Gn; EBG00001191394.
DR   EnsemblGenomes-Gn; EBG00001191395.
DR   EnsemblGenomes-Gn; EBG00001191396.
DR   EnsemblGenomes-Gn; EBG00001191397.
DR   EnsemblGenomes-Gn; EBG00001191398.
DR   EnsemblGenomes-Gn; EBG00001191399.
DR   EnsemblGenomes-Gn; Ilyop_R0001.
DR   EnsemblGenomes-Gn; Ilyop_R0002.
DR   EnsemblGenomes-Gn; Ilyop_R0003.
DR   EnsemblGenomes-Gn; Ilyop_R0004.
DR   EnsemblGenomes-Gn; Ilyop_R0005.
DR   EnsemblGenomes-Gn; Ilyop_R0006.
DR   EnsemblGenomes-Gn; Ilyop_R0007.
DR   EnsemblGenomes-Gn; Ilyop_R0008.
DR   EnsemblGenomes-Gn; Ilyop_R0009.
DR   EnsemblGenomes-Gn; Ilyop_R0010.
DR   EnsemblGenomes-Gn; Ilyop_R0011.
DR   EnsemblGenomes-Gn; Ilyop_R0012.
DR   EnsemblGenomes-Gn; Ilyop_R0013.
DR   EnsemblGenomes-Gn; Ilyop_R0014.
DR   EnsemblGenomes-Gn; Ilyop_R0015.
DR   EnsemblGenomes-Gn; Ilyop_R0016.
DR   EnsemblGenomes-Gn; Ilyop_R0017.
DR   EnsemblGenomes-Gn; Ilyop_R0018.
DR   EnsemblGenomes-Gn; Ilyop_R0019.
DR   EnsemblGenomes-Gn; Ilyop_R0020.
DR   EnsemblGenomes-Gn; Ilyop_R0021.
DR   EnsemblGenomes-Gn; Ilyop_R0022.
DR   EnsemblGenomes-Gn; Ilyop_R0023.
DR   EnsemblGenomes-Gn; Ilyop_R0024.
DR   EnsemblGenomes-Gn; Ilyop_R0025.
DR   EnsemblGenomes-Gn; Ilyop_R0026.
DR   EnsemblGenomes-Gn; Ilyop_R0027.
DR   EnsemblGenomes-Gn; Ilyop_R0028.
DR   EnsemblGenomes-Gn; Ilyop_R0029.
DR   EnsemblGenomes-Gn; Ilyop_R0030.
DR   EnsemblGenomes-Gn; Ilyop_R0031.
DR   EnsemblGenomes-Gn; Ilyop_R0033.
DR   EnsemblGenomes-Gn; Ilyop_R0034.
DR   EnsemblGenomes-Gn; Ilyop_R0035.
DR   EnsemblGenomes-Gn; Ilyop_R0036.
DR   EnsemblGenomes-Gn; Ilyop_R0037.
DR   EnsemblGenomes-Gn; Ilyop_R0038.
DR   EnsemblGenomes-Gn; Ilyop_R0039.
DR   EnsemblGenomes-Gn; Ilyop_R0040.
DR   EnsemblGenomes-Gn; Ilyop_R0041.
DR   EnsemblGenomes-Gn; Ilyop_R0042.
DR   EnsemblGenomes-Gn; Ilyop_R0043.
DR   EnsemblGenomes-Gn; Ilyop_R0044.
DR   EnsemblGenomes-Gn; Ilyop_R0045.
DR   EnsemblGenomes-Gn; Ilyop_R0046.
DR   EnsemblGenomes-Gn; Ilyop_R0047.
DR   EnsemblGenomes-Gn; Ilyop_R0048.
DR   EnsemblGenomes-Gn; Ilyop_R0049.
DR   EnsemblGenomes-Gn; Ilyop_R0050.
DR   EnsemblGenomes-Gn; Ilyop_R0051.
DR   EnsemblGenomes-Gn; Ilyop_R0052.
DR   EnsemblGenomes-Gn; Ilyop_R0053.
DR   EnsemblGenomes-Gn; Ilyop_R0054.
DR   EnsemblGenomes-Gn; Ilyop_R0055.
DR   EnsemblGenomes-Gn; Ilyop_R0056.
DR   EnsemblGenomes-Gn; Ilyop_R0057.
DR   EnsemblGenomes-Gn; Ilyop_R0058.
DR   EnsemblGenomes-Gn; Ilyop_R0059.
DR   EnsemblGenomes-Gn; Ilyop_R0060.
DR   EnsemblGenomes-Gn; Ilyop_R0061.
DR   EnsemblGenomes-Gn; Ilyop_R0062.
DR   EnsemblGenomes-Gn; Ilyop_R0063.
DR   EnsemblGenomes-Gn; Ilyop_R0064.
DR   EnsemblGenomes-Gn; Ilyop_R0065.
DR   EnsemblGenomes-Gn; Ilyop_R0066.
DR   EnsemblGenomes-Gn; Ilyop_R0067.
DR   EnsemblGenomes-Gn; Ilyop_R0068.
DR   EnsemblGenomes-Gn; Ilyop_R0069.
DR   EnsemblGenomes-Tr; EBT00001769778.
DR   EnsemblGenomes-Tr; EBT00001769779.
DR   EnsemblGenomes-Tr; EBT00001769780.
DR   EnsemblGenomes-Tr; EBT00001769781.
DR   EnsemblGenomes-Tr; EBT00001769782.
DR   EnsemblGenomes-Tr; EBT00001769783.
DR   EnsemblGenomes-Tr; EBT00001769784.
DR   EnsemblGenomes-Tr; EBT00001769785.
DR   EnsemblGenomes-Tr; EBT00001769786.
DR   EnsemblGenomes-Tr; EBT00001769787.
DR   EnsemblGenomes-Tr; EBT00001769788.
DR   EnsemblGenomes-Tr; EBT00001769789.
DR   EnsemblGenomes-Tr; EBT00001769790.
DR   EnsemblGenomes-Tr; EBT00001769791.
DR   EnsemblGenomes-Tr; EBT00001769792.
DR   EnsemblGenomes-Tr; EBT00001769793.
DR   EnsemblGenomes-Tr; EBT00001769794.
DR   EnsemblGenomes-Tr; EBT00001769795.
DR   EnsemblGenomes-Tr; EBT00001769796.
DR   EnsemblGenomes-Tr; EBT00001769797.
DR   EnsemblGenomes-Tr; EBT00001769798.
DR   EnsemblGenomes-Tr; EBT00001769799.
DR   EnsemblGenomes-Tr; EBT00001769800.
DR   EnsemblGenomes-Tr; EBT00001769801.
DR   EnsemblGenomes-Tr; EBT00001769802.
DR   EnsemblGenomes-Tr; EBT00001769803.
DR   EnsemblGenomes-Tr; EBT00001769804.
DR   EnsemblGenomes-Tr; EBT00001769805.
DR   EnsemblGenomes-Tr; EBT00001769806.
DR   EnsemblGenomes-Tr; EBT00001769807.
DR   EnsemblGenomes-Tr; EBT00001769808.
DR   EnsemblGenomes-Tr; EBT00001769809.
DR   EnsemblGenomes-Tr; EBT00001769810.
DR   EnsemblGenomes-Tr; EBT00001769811.
DR   EnsemblGenomes-Tr; EBT00001769812.
DR   EnsemblGenomes-Tr; EBT00001769813.
DR   EnsemblGenomes-Tr; EBT00001769814.
DR   EnsemblGenomes-Tr; EBT00001769815.
DR   EnsemblGenomes-Tr; EBT00001769816.
DR   EnsemblGenomes-Tr; EBT00001769817.
DR   EnsemblGenomes-Tr; EBT00001769818.
DR   EnsemblGenomes-Tr; EBT00001769819.
DR   EnsemblGenomes-Tr; EBT00001769820.
DR   EnsemblGenomes-Tr; EBT00001769821.
DR   EnsemblGenomes-Tr; EBT00001769822.
DR   EnsemblGenomes-Tr; EBT00001769823.
DR   EnsemblGenomes-Tr; EBT00001769824.
DR   EnsemblGenomes-Tr; EBT00001769825.
DR   EnsemblGenomes-Tr; EBT00001769826.
DR   EnsemblGenomes-Tr; EBT00001769827.
DR   EnsemblGenomes-Tr; EBT00001769828.
DR   EnsemblGenomes-Tr; EBT00001769829.
DR   EnsemblGenomes-Tr; EBT00001769830.
DR   EnsemblGenomes-Tr; EBT00001769831.
DR   EnsemblGenomes-Tr; EBT00001769832.
DR   EnsemblGenomes-Tr; EBT00001769833.
DR   EnsemblGenomes-Tr; EBT00001769834.
DR   EnsemblGenomes-Tr; EBT00001769835.
DR   EnsemblGenomes-Tr; EBT00001769836.
DR   EnsemblGenomes-Tr; EBT00001769837.
DR   EnsemblGenomes-Tr; EBT00001769838.
DR   EnsemblGenomes-Tr; EBT00001769839.
DR   EnsemblGenomes-Tr; EBT00001769840.
DR   EnsemblGenomes-Tr; EBT00001769841.
DR   EnsemblGenomes-Tr; EBT00001769842.
DR   EnsemblGenomes-Tr; EBT00001769843.
DR   EnsemblGenomes-Tr; EBT00001769844.
DR   EnsemblGenomes-Tr; EBT00001769845.
DR   EnsemblGenomes-Tr; EBT00001769846.
DR   EnsemblGenomes-Tr; EBT00001769847.
DR   EnsemblGenomes-Tr; EBT00001769848.
DR   EnsemblGenomes-Tr; EBT00001769849.
DR   EnsemblGenomes-Tr; EBT00001769850.
DR   EnsemblGenomes-Tr; EBT00001769851.
DR   EnsemblGenomes-Tr; EBT00001769852.
DR   EnsemblGenomes-Tr; Ilyop_R0001-1.
DR   EnsemblGenomes-Tr; Ilyop_R0002-1.
DR   EnsemblGenomes-Tr; Ilyop_R0003-1.
DR   EnsemblGenomes-Tr; Ilyop_R0004-1.
DR   EnsemblGenomes-Tr; Ilyop_R0005-1.
DR   EnsemblGenomes-Tr; Ilyop_R0006-1.
DR   EnsemblGenomes-Tr; Ilyop_R0007-1.
DR   EnsemblGenomes-Tr; Ilyop_R0008-1.
DR   EnsemblGenomes-Tr; Ilyop_R0009-1.
DR   EnsemblGenomes-Tr; Ilyop_R0010-1.
DR   EnsemblGenomes-Tr; Ilyop_R0011-1.
DR   EnsemblGenomes-Tr; Ilyop_R0012-1.
DR   EnsemblGenomes-Tr; Ilyop_R0013-1.
DR   EnsemblGenomes-Tr; Ilyop_R0014-1.
DR   EnsemblGenomes-Tr; Ilyop_R0015-1.
DR   EnsemblGenomes-Tr; Ilyop_R0016-1.
DR   EnsemblGenomes-Tr; Ilyop_R0017-1.
DR   EnsemblGenomes-Tr; Ilyop_R0018-1.
DR   EnsemblGenomes-Tr; Ilyop_R0019-1.
DR   EnsemblGenomes-Tr; Ilyop_R0020-1.
DR   EnsemblGenomes-Tr; Ilyop_R0021-1.
DR   EnsemblGenomes-Tr; Ilyop_R0022-1.
DR   EnsemblGenomes-Tr; Ilyop_R0023-1.
DR   EnsemblGenomes-Tr; Ilyop_R0024-1.
DR   EnsemblGenomes-Tr; Ilyop_R0025-1.
DR   EnsemblGenomes-Tr; Ilyop_R0026-1.
DR   EnsemblGenomes-Tr; Ilyop_R0027-1.
DR   EnsemblGenomes-Tr; Ilyop_R0028-1.
DR   EnsemblGenomes-Tr; Ilyop_R0029-1.
DR   EnsemblGenomes-Tr; Ilyop_R0030-1.
DR   EnsemblGenomes-Tr; Ilyop_R0031-1.
DR   EnsemblGenomes-Tr; Ilyop_R0033-1.
DR   EnsemblGenomes-Tr; Ilyop_R0034-1.
DR   EnsemblGenomes-Tr; Ilyop_R0035-1.
DR   EnsemblGenomes-Tr; Ilyop_R0036-1.
DR   EnsemblGenomes-Tr; Ilyop_R0037-1.
DR   EnsemblGenomes-Tr; Ilyop_R0038-1.
DR   EnsemblGenomes-Tr; Ilyop_R0039-1.
DR   EnsemblGenomes-Tr; Ilyop_R0040-1.
DR   EnsemblGenomes-Tr; Ilyop_R0041-1.
DR   EnsemblGenomes-Tr; Ilyop_R0042-1.
DR   EnsemblGenomes-Tr; Ilyop_R0043-1.
DR   EnsemblGenomes-Tr; Ilyop_R0044-1.
DR   EnsemblGenomes-Tr; Ilyop_R0045-1.
DR   EnsemblGenomes-Tr; Ilyop_R0046-1.
DR   EnsemblGenomes-Tr; Ilyop_R0047-1.
DR   EnsemblGenomes-Tr; Ilyop_R0048-1.
DR   EnsemblGenomes-Tr; Ilyop_R0049-1.
DR   EnsemblGenomes-Tr; Ilyop_R0050-1.
DR   EnsemblGenomes-Tr; Ilyop_R0051-1.
DR   EnsemblGenomes-Tr; Ilyop_R0052-1.
DR   EnsemblGenomes-Tr; Ilyop_R0053-1.
DR   EnsemblGenomes-Tr; Ilyop_R0054-1.
DR   EnsemblGenomes-Tr; Ilyop_R0055-1.
DR   EnsemblGenomes-Tr; Ilyop_R0056-1.
DR   EnsemblGenomes-Tr; Ilyop_R0057-1.
DR   EnsemblGenomes-Tr; Ilyop_R0058-1.
DR   EnsemblGenomes-Tr; Ilyop_R0059-1.
DR   EnsemblGenomes-Tr; Ilyop_R0060-1.
DR   EnsemblGenomes-Tr; Ilyop_R0061-1.
DR   EnsemblGenomes-Tr; Ilyop_R0062-1.
DR   EnsemblGenomes-Tr; Ilyop_R0063-1.
DR   EnsemblGenomes-Tr; Ilyop_R0064-1.
DR   EnsemblGenomes-Tr; Ilyop_R0065-1.
DR   EnsemblGenomes-Tr; Ilyop_R0066-1.
DR   EnsemblGenomes-Tr; Ilyop_R0067-1.
DR   EnsemblGenomes-Tr; Ilyop_R0068-1.
DR   EnsemblGenomes-Tr; Ilyop_R0069-1.
DR   EuropePMC; PMC5225283; 28116104.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002281.
DR   SILVA-SSU; CP002281.
DR   StrainInfo; 158229; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085717
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Ilyobacter polytropus CuHBu1, DSM 2926
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Germany
CC   environment         :: Marine
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 2926
CC   biotic_relationship :: Free living
CC   trophic_level       :: Chemoorganotroph
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02536
CC   Type Strain         :: Yes
CC   Funding Program     :: DOE-GEBA 2007
CC   Gene Calling Method :: Prodigal, GenePRIMP
CC   Isolation Site      :: Marine mud from Germany
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Nonmotile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 30C
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2046464
FT                   /organism="Ilyobacter polytropus DSM 2926"
FT                   /strain="DSM 2926"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /isolation_source="marine mud"
FT                   /note="type strain of Ilyobacter polytropus"
FT                   /db_xref="taxon:572544"
FT   gene            24..1862
FT                   /locus_tag="Ilyop_0001"
FT   CDS_pept        24..1862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: fnu:FN0001 chromosomal replication initiator
FT                   protein DnaA; SPTR: C6JLE5 Chromosomal replication
FT                   initiator protein dnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81791"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:E3H632"
FT                   /protein_id="ADO81791.1"
FT                   /translation="MAIEENNMLDKFSITSSGSLMDDIKKVDIKMNEVPDIEVREVVIK
FT                   ETGNFLNLKENIINIPIEMIVFPFFTPQKQNKRVNFQYSFEDLGVTMYCTLVAKDSKDE
FT                   IFQPSIFEEKIYTYLISMYEMKKEINDTDEYIEFEISDFIVNFLGNKMNRNYYSKVEQA
FT                   LKNLKNTEYQFVVSNHTKLGKYKFEDEEFKLLTYQKLKKGKKVYYRVTLNKNIRKKIKD
FT                   KRYIKYNSKALLEILAKDPIAGRIYKYISKIRYEKAEDTINIRTLAAIVPLKTEQVTER
FT                   FNKNGEVKTYVLSRMKQVLKRIEKAFKALKDLGYVEKYKTSYKKDEDNYYIQYKFNPEK
FT                   DGTCHVSSFVESANKKPKELLDWSKEPVEKKKIKISKNDIIDAEIVETVKSKTVNRLKK
FT                   SLKEDEKFTSDIYGDVSDELIEKILKAKRNIYVSKAWNKRADNKILKIVHEDGEELALE
FT                   ILNILYKRLNTEIKSTLVQYINGIIKNLRKDHMESIKKASRQNLTLFNQGSRDKPLTSK
FT                   KKINQSRRKLKKPTITSVKDIMDTPESVNNVIREFDKYDDYQKLKIEEKALQICSKEEK
FT                   IDVNFLLTLKSKSKTIYLNTIRKYIQTVLEDGEWRS"
FT   gene            2034..2240
FT                   /locus_tag="Ilyop_0002"
FT   CDS_pept        2034..2240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0002"
FT                   /product="S4 domain protein YaaA"
FT                   /note="COGs: COG2501 conserved hypothetical protein;
FT                   InterPro IPR014330:IPR002942:IPR010916; KEGG: fnu:FN2129
FT                   putative cytoplasmic protein; PFAM: RNA-binding S4 domain
FT                   protein; SPTR: C3WFI8 Putative uncharacterized protein;
FT                   TIGRFAM: S4 domain protein YaaA; PFAM: S4 domain; TIGRFAM:
FT                   S4 domain protein YaaA"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81792"
FT                   /db_xref="GOA:E3H633"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E3H633"
FT                   /protein_id="ADO81792.1"
FT                   /translation="MKKVKITSEFIKLDQFLKWADVTSSGVEAKYMVQDGEVTVNGEPE
FT                   ERRGRKLYPGDTVEVMGKKFIVE"
FT   gene            2255..3385
FT                   /locus_tag="Ilyop_0003"
FT   CDS_pept        2255..3385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR001238:IPR018078:IPR003395;
FT                   KEGG: fnu:FN2128 RecF protein; PFAM: SMC domain protein;
FT                   SPTR: C6JLE7 DNA replication and repair protein recF;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM:
FT                   RecF/RecN/SMC N terminal domain; TIGRFAM: recF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81793"
FT                   /db_xref="GOA:E3H634"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E3H634"
FT                   /protein_id="ADO81793.1"
FT                   /translation="MQISEINYVNFRNLKDNNLKFSSKFNLFLGKNGQGKTSILEAVYF
FT                   SATGKSFRTPRQNEIINHSRERTGSFVVFEDSISKKTLSVKLGKGKKEYSYNKKRVKYD
FT                   DFHGKLNIVSFIPEDISLLTGAPGVRRSFFDYEISQANKEYYQDLKNYTKLLKFRNKYL
FT                   KEKKHNDPMFDIYQNEFIKFGARIIKKRLDYVRNISILLNLNYRKLFDDKKELRLKYSC
FT                   FLGELKKVETAQIEKLIQEKINQVFWQEKRYGFSLVGPQKDDFIFLLNDKEAKSYASQG
FT                   EKKSIVFSIKLSEIDMIIKEKKESPIFIIDDISSYFDSLRKESIIKYFKKRDIQLFISS
FT                   TTDLNMASKNFYIEKGDIYEEYDQCKKDNRGSRDQK"
FT   gene            3339..4187
FT                   /locus_tag="Ilyop_0004"
FT   CDS_pept        3339..4187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0004"
FT                   /product="protein of unknown function DUF721"
FT                   /note="InterPro IPR007922; KEGG: nth:Nther_0005
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF721; SPTR: C6JLE8 Predicted protein; PFAM: Protein of
FT                   unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81794"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E3H635"
FT                   /protein_id="ADO81794.1"
FT                   /translation="MTSVKKIIEEAVIKSKKLKEAIIRAKWDEIVEGLFFKSSPLYIKE
FT                   GVLYVTVESSVLLQHMYMNKNNYIKRINIILKGNYITDMIFKVGKIPLEEYFKDNIASE
FT                   KEKPDEVEAALSPDEYKELQKSVENIENKQIKDRVLSLKVKSLKREKSLRKIGYKYCNE
FT                   CGILHKNSGGLCTICENKHHLKREETLLKLFRENPYTTLEEAEKIIDKLSKEEYDKGKE
FT                   KKLDKIYKRAEFAIKDRNIEDARLDLIEYFKLETGEREIKRIKEKADNLIKLIIEKLQR
FT                   R"
FT   gene            4190..4477
FT                   /locus_tag="Ilyop_0005"
FT   CDS_pept        4190..4477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_0005 hypothetical protein; SPTR:
FT                   C3WFJ1 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81795"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:E3H636"
FT                   /protein_id="ADO81795.1"
FT                   /translation="MYIYLEDEFFIPLKEIVAVVDYNKFMSSPEGKKFYDENKNKIIDL
FT                   SAKDRRSLVITDKFFYMTSYVVRSIQDRGNEFERLKAKGKRNIKKYNGGL"
FT   gene            4477..6381
FT                   /locus_tag="Ilyop_0006"
FT   CDS_pept        4477..6381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR011557:IPR003594:IPR013759:IPR013760:IPR
FT                   020568:IPR018522:IPR013506:IPR006171:IPR002288:IPR001241:I
FT                   PR000565; KEGG: fnu:FN2126 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein; PRIAM: DNA
FT                   topoisomerase (ATP-hydrolyzing); SMART: DNA topoisomerase
FT                   II; ATP-binding region ATPase domain protein; SPTR: C6JLF0
FT                   DNA gyrase subunit B; TIGRFAM: DNA gyrase, B subunit; PFAM:
FT                   Toprim domain; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; DNA gyrase B; DNA gyrase B subunit,
FT                   carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81796"
FT                   /db_xref="GOA:E3H637"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3H637"
FT                   /protein_id="ADO81796.1"
FT                   /translation="MSNYQAENITVLEGLEAVRKRPGMYIGSTSARGLHHLVWEIVDNS
FT                   VDESLAGYCNKIEIKVLKDNIIEVSDNGRGIPVGIHPKHGKSALEIVLTVLHAGGKFEN
FT                   SNYKVSGGLHGVGVSVVNALSEWTEVFVKRDGKIHNQRYNRGVPEFDVKVVGKTNETGT
FT                   TVRFKADSEIFETLEYDFDVLKSRLKEMAYLNKGLEIVLIDERKEEIKEEILKFDGGIV
FT                   DFIKEVEEGQATLIPEPIYMAGESEDIIVEIAILYTEKQRETIYSFVNNINTHEGGTHV
FT                   SGFRMALTRIINEMAKSLGLLKERDGNFQGQDIREGVTAIISIKVPEPQFEGQTKTKLG
FT                   NSEVTAVVSSIMGQFLKMHMEDHPSDARNIIERILMSRKAREAAKKARELVMRKSALEV
FT                   GSLPGKLADCSSKKPEESEVFIVEGDSAGGSAKQGRDRHTQAILPLRGKIINVEKSGLH
FT                   KALENNEVRSMVTAFGANIGDDLELEKLRYHKIIIMTDADVDGAHIRTLILTFFYRYMV
FT                   DLIHGGYIYIAQPPLFKVTAGRTIQYAYSDKQLKEITTVMDADNKRYTLQRYKGLGEMN
FT                   PDQLWETTMNHDTRTLLQVTIDDAREADILFDKLMGDKVEPRRNFIEEHSHFVKNLDI"
FT   gene            6509..8968
FT                   /locus_tag="Ilyop_0007"
FT   CDS_pept        6509..8968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0188 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) A subunit;
FT                   InterProIPR005743:IPR013758:IPR013757:IPR013760:IPR
FT                   002205:IPR006691; KEGG: fnu:FN2125 DNA gyrase subunit A;
FT                   PFAM: DNA gyrase/topoisomerase IV subunit A; DNA gyrase
FT                   repeat beta-propeller; PRIAM: DNA topoisomerase
FT                   (ATP-hydrolyzing); SMART: DNA gyrase/topoisomerase IV
FT                   subunit A; SPTR: C6JLF1 DNA topoisomerase; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV,
FT                   subunit A; DNA gyrase C-terminal domain, beta-propeller;
FT                   TIGRFAM: DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81797"
FT                   /db_xref="GOA:E3H638"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E3H638"
FT                   /protein_id="ADO81797.1"
FT                   /translation="MSNINVRYIEEEMKQSYLDYSMSVIVSRALPDVRDGLKPVHRRIL
FT                   FAMSEMGMTHDKPFKKSARIVGEVLGKYHPHGDSAVYNTMVRMAQDFNFRYQLIDGHGN
FT                   FGSIDGDSAAAMRYTEARMAKITSELLVDIDKNTIDYRKNFDDSLDEPQVLPAKLPNLL
FT                   LNGATGIAVGMATNIPPHNLGELLDGVLALIENKEITPEELMEYVTGPDFPTGGIIDGT
FT                   KGIYEAYTTGRGRVRVRGKVDIEELKNGKSNIIITEIPFQVNKARLIEKIAELVKEKKI
FT                   TGITDLRDESSAREGMRIVVELKRDEEPEIVLNKIYKYTELQNTFGIILLALVDNMPKV
FT                   LNLKEILSHYINHRFDVITRRTKYDLEKSENRAHILEGFRVALENIDRIIEIIRGSKDG
FT                   NTAREHLIEKYSFSDIQARSILDMKLQRLTGLEREKVENEYTALMEHIKELKDILSNDQ
FT                   RVYDIIKEDCEELKEKYSDERRTQIEEERLDINIEDLIKDEKVIVTLTNKGYVKRMNLD
FT                   KYKAQKRGGKGVSTQNTVEGDFLENMYTASNLDTLMIFTDTGKVYNLKVYEIPEFSKQS
FT                   RGKLIANLINLQENEKVKSIIKTREFSDTQDLLFVTKEGLVKKTVLSEFKNLNRSGLRA
FT                   IKLKDGDDLIFVGLVESPNDQVFIATKNGYSIKFPHENARNMGRATIGVRGINLRKDDD
FT                   VVSAVIIKRDDTTILTVTENGYGKRTREDEYPLQSRSGKGVINLRCNEKTGVVVEVTSV
FT                   TEEEELMAITSNGIVIRTPADTISLIGRATQGVRIMRVEEDEKLVSIVKVMKNIEEKIL
FT                   EEEEKSE"
FT   gene            9016..9444
FT                   /locus_tag="Ilyop_0008"
FT   CDS_pept        9016..9444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0418 hypothetical protein; SPTR:
FT                   B1C796 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81798"
FT                   /db_xref="UniProtKB/TrEMBL:E3H639"
FT                   /protein_id="ADO81798.1"
FT                   /translation="MKSIILLLLSMYMFGCTSVPKQKTAEKRSYSFDSPEAVIEVYYTA
FT                   LKTGDEELLNSCFIDKKNLTIVGKMRDIQYKIRKSRLISKDEADLRNIGSTASVLEEGD
FT                   VELFLYETIKNNREEMTFILRKQGFEWRIYSHSLGYYV"
FT   sig_peptide     9016..9090
FT                   /locus_tag="Ilyop_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            9535..10308
FT                   /locus_tag="Ilyop_0009"
FT   CDS_pept        9535..10308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lba:Lebu_2298 hypothetical protein; SPTR:
FT                   C6JLF2 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81799"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3H640"
FT                   /protein_id="ADO81799.1"
FT                   /translation="MLRKVVILFGNELNTENLLKTGKALKEKYNCEIKGLYVRDLRKHE
FT                   IIPPSVEGLVVDPSSRYIVEEWEKFESEQITILKDKFKSYFDENNLIVKDGVTPDTALE
FT                   ELKGFDLLVLGKGERISPDLKFILKNHYKPIIIVSQEPIKFDKVMIANDKSFKINKSFF
FT                   RFMSIFEDIKEFDSYSVGLEDEEDNSFSEYLQGSDKVIRTKECQGDELEVLIEEAKEHN
FT                   LLIMGNLTHSYLVEKITGHIGVKLIESLKIPIFIA"
FT   gene            10321..10776
FT                   /locus_tag="Ilyop_0010"
FT   CDS_pept        10321..10776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0010"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro
FT                   IPR000979:IPR004843; KEGG: fnu:FN2124 hypothetical protein;
FT                   PFAM: metallophosphoesterase; SPTR: C3WMI3
FT                   Phosphodiesterase; TIGRFAM: phosphodiesterase, MJ0936
FT                   family; PFAM: Calcineurin-like phosphoesterase; TIGRFAM:
FT                   phosphoesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81800"
FT                   /db_xref="GOA:E3H641"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E3H641"
FT                   /protein_id="ADO81800.1"
FT                   /translation="MKILVVSDSHQHLEKLIDIFEKENPDIVISAGDNSSDVIDLSNIK
FT                   EKADYYIVRGNCDYFDFKTDDIEEFNIAGKKIFLTHGHLYDVKSGYEKIKNEALKKQAD
FT                   IVIFGHTHIPYLNNETPVLFNPGAAKDGNYGTIDISGDEIKFYHKKL"
FT   gene            10877..11893
FT                   /locus_tag="Ilyop_0011"
FT   CDS_pept        10877..11893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0011"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COGs: COG0016 Phenylalanyl-tRNA synthetase alpha
FT                   subunit;
FT                   InterProIPR004529:IPR006195:IPR010978:IPR018087:IPR
FT                   004188:IPR002319; KEGG: fnu:FN2123 phenylalanyl-tRNA
FT                   synthetase alpha chain; PFAM: phenylalanyl-tRNA synthetase
FT                   class IIc; aminoacyl tRNA synthetase class II domain
FT                   protein; PRIAM: Phenylalanine--tRNA ligase; SPTR: C6JLF4
FT                   Phenylalanyl-tRNA synthetase subunit alpha; TIGRFAM:
FT                   phenylalanyl-tRNA synthetase, alpha subunit; PFAM: tRNA
FT                   synthetases class II core domain (F); Aminoacyl tRNA
FT                   synthetase class II, N-terminal domain; TIGRFAM:
FT                   phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81801"
FT                   /db_xref="GOA:E3H642"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:E3H642"
FT                   /protein_id="ADO81801.1"
FT                   /translation="MRNRIESLKLSAEEAICKAASLKELDELRVGILGKKGELTEIMKG
FT                   MRELSKEERPVMGQLANEVRDSITEALEKKMIEVKEKEKQERISSENIDITLPGRKSSS
FT                   GRYHPITETMNMLKEIFIEMGFDVAEGPEIEKTEYNFDALNIPENHPSRDLQDTFYMSD
FT                   DVVLRTHTSPVQVRYMKDKKPPFRMVCPGKVYRSDYDVSHTPMFHQMEGLMVGENISFA
FT                   NLKAILTEFVKKVFGDTEVRFRPHFFPFTEPSAEMDVQCVICKGKGCRLCKDSGWLEIM
FT                   GCGMVDPEVLKAVGYNHEEVSGFAFGMGIERVTMLRHGIDDLRAFFENDIRFLKQFK"
FT   gene            11925..14312
FT                   /locus_tag="Ilyop_0012"
FT   CDS_pept        11925..14312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0012"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COGs: COG0072 Phenylalanyl-tRNA synthetase beta
FT                   subunit;
FT                   InterProIPR004532:IPR002547:IPR005121:IPR012340:IPR
FT                   020825:IPR005147:IPR016027:IPR009061:IPR005146; KEGG:
FT                   fnu:FN2122 phenylalanyl-tRNA synthetase beta chain; PFAM:
FT                   B3/4 domain protein; t-RNA-binding domain protein; tRNA
FT                   synthetase B5; ferredoxin-fold anticodon-binding; SPTR:
FT                   C6JLF5 Phenylalanyl-tRNA synthetase subunit beta; TIGRFAM:
FT                   phenylalanyl-tRNA synthetase, beta subunit; PFAM: tRNA
FT                   synthetase B5 domain; Ferredoxin-fold anticodon binding
FT                   domain; B3/4 domain; Putative tRNA binding domain; TIGRFAM:
FT                   phenylalanyl-tRNA synthetase, beta subunit, non-spirochete
FT                   bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81802"
FT                   /db_xref="GOA:E3H643"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:E3H643"
FT                   /protein_id="ADO81802.1"
FT                   /translation="MLISLDWLKQYVDIKENTKELENTLTMIGQEVEAIEVQGEDLDNV
FT                   VVGQIVEYGRHPEAEKLSLLKVEVGEGEPLQIVCGAPNHKDGDKVVVAKLGAVLPGEFK
FT                   IKKAKVRGIESCGMLCSEVELGIGEDGEGIIILPEDAPVGEEYRKYIGLDDTIFELEIT
FT                   PNRPDCLSHIGIAREVAAYYKRKVKYPKYEMDEVIEPASSHIHVNIEDKERCKRYCTRI
FT                   LKGVKIQESPEWLKKRLRSIGLRPINNIVDITNFVMFEYNHPMHAFDLDKLDGSKIIVR
FT                   KAKTGEKIVTLDEEERELNNGELVIADEKKPVAIAGIMGGLDTKVDEETTDILLEVAYF
FT                   TPENIRKTSKSLGLSSDSSYRFERGIDRENSIEVIDRAAKLMKDIAGGEILSGIVEKYV
FT                   EKYEKIELTLDIDKLNKFVGKEISVETVGEILRNLGLEIKALVGKILTVCPPSYRSDLV
FT                   RTADLYEEVIRMYGFENIEDVMPEANIKAGVKDPETEAVDKVKLVLKKLGLQEVINYSF
FT                   IPSDAVSKLKMNVETMAIKNPINEDLAVMRPTLIYGLLSNIRDNFNRNQFDLKLFEVSR
FT                   TFTSSEELANEEVKIAVAVSGRAEKDLWNSKPEAYDFFDIKGYVEGFLEYMGINRFQLA
FT                   RTNNPTFHPGRSAEIRMGKDVIGSFGEIHPDVAEAMDIKKERAYIAELDLIKILKYGKS
FT                   KIKYERIVKFPAVTRDLAIVLDGDILVGDMLGDIKKSSKIIESVELFDVYQGDKVESGK
FT                   KSVAINIVMRKSNGTLEEKEITEGVEKILQTIRKKYKGEIRQ"
FT   gene            14448..15662
FT                   /locus_tag="Ilyop_0013"
FT   CDS_pept        14448..15662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0013"
FT                   /product="protein of unknown function DUF187"
FT                   /note="COGs: COG1649 conserved hypothetical protein;
FT                   InterPro IPR017853:IPR003790; KEGG: bld:BLi02129 YngK;
FT                   PFAM: protein of unknown function DUF187; SPTR: C4BXQ8
FT                   Uncharacterized conserved protein; PFAM: Uncharacterised
FT                   BCR, COG1649"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81803"
FT                   /db_xref="GOA:E3H644"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E3H644"
FT                   /protein_id="ADO81803.1"
FT                   /translation="MKRIFLLLSVYIIFSFISYGQEAEISYNGVNFYKKNGEKNEFRGV
FT                   WVATVANLNWPKKKSTSPREQRKDFKEILKEIKIMNMNAIIMQVRPSGDAVYKSKIVPW
FT                   SRYITGTQGKYPGYDPLKFMVERSHKMGIEFHAWFNPYRVALNDEEFKSLSSDNFAVKN
FT                   PETVIKYGKKYYFDPGIPKVREHLIKVVLEVVDNYDIDAVHIDDYFYPYTIEDLDFPDL
FT                   ETYRTYGYEFSEIKEWRRENVNKFIEELHKEIKKRDKKVKFGISPFGVWRNHRDDARGS
FT                   DTAAFQTSYDNLYADVLKWIDMGWIDYVIPQVYWNFGFAPAPYEKLVDWWSKETSGKKV
FT                   KLFIGQGAYKVGKENWENPDELINQIYYNRSKGIEGSAFFDIKSLVENPYNLKDRLKID
FT                   VFREN"
FT   sig_peptide     14448..14522
FT                   /locus_tag="Ilyop_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            15813..17021
FT                   /locus_tag="Ilyop_0014"
FT   CDS_pept        15813..17021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0014"
FT                   /product="serine dehydratase alpha chain"
FT                   /note="COGs: COG1760 L-serine deaminase; InterPro
FT                   IPR005131:IPR005130; KEGG: dde:Dde_3034 L-serine
FT                   ammonia-lyase; PFAM: serine dehydratase alpha chain; serine
FT                   dehydratase beta chain; SPTR: C6JLF6 L-serine
FT                   ammonia-lyase; PFAM: Serine dehydratase alpha chain; Serine
FT                   dehydratase beta chain; TIGRFAM: L-serine dehydratase,
FT                   iron-sulfur-dependent, single chain form"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81804"
FT                   /db_xref="GOA:E3H645"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:E3H645"
FT                   /protein_id="ADO81804.1"
FT                   /translation="MDSLRELFKIGNGPSSSHTMGPERSAKKFKVDNPDACSYRVELYG
FT                   SLAATGKGHLTDWIIIETLKPKKTEILWKSEVSYEYHANGMKFFALDSDGNILKEWLVF
FT                   SVGGGTIMEDGQARQGGSDVYPLGKMTEIMEWCSKNRKELWEYVEEMEGSSIWPFLEKI
FT                   WEAMESCIKTGINKTGVLPGTLKYPRKAQSFYRKARRDNSRNGFIGKIFAYTLAVSEEN
FT                   GGGGRVVTAPTCGASGVIPGLLYALKEEYNLSEDEVLKGLAIAGLIGNIIKENATISGA
FT                   EGGCQAEVGAACSMAAGMSTFLLGGSLKQIEYSAEIALEHHLGLTCDPVGGYVQIPCIE
FT                   RNAAAAVRALDAANYSLYTDGQHAVSFDQVVLTMKETGRDLKCEYKETSLGGLAKFNFD
FT                   AEC"
FT   gene            17181..17750
FT                   /locus_tag="Ilyop_0015"
FT   CDS_pept        17181..17750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0015"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COGs: COG0193 Peptidyl-tRNA hydrolase; InterPro
FT                   IPR001328:IPR018171; KEGG: fnu:FN1597 peptidyl-tRNA
FT                   hydrolase; PFAM: peptidyl-tRNA hydrolase; PRIAM:
FT                   Aminoacyl-tRNA hydrolase; SPTR: C3WFJ9 Peptidyl-tRNA
FT                   hydrolase; TIGRFAM: peptidyl-tRNA hydrolase; PFAM:
FT                   Peptidyl-tRNA hydrolase; TIGRFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81805"
FT                   /db_xref="GOA:E3H646"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:E3H646"
FT                   /protein_id="ADO81805.1"
FT                   /translation="MKLIVGLGNPGEKYSKTRHNIGFEVIDMLAEDLKVSGFREKFQGL
FT                   IGETVIKDEKVFLLKPQTFMNLSGNSINEVIKFYKIDPEEDLIVIYDDMDLDLGQLKIK
FT                   VKGSPAGHNGIKSIISHIGENFLRVKCGIGKAKSREETVNFVLGRFSKEESNEVDPMIE
FT                   NASKAAQSLITAKDISRVMQKYNKKK"
FT   gene            18216..18935
FT                   /locus_tag="Ilyop_0016"
FT   CDS_pept        18216..18935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0016"
FT                   /product="MIP family channel protein"
FT                   /note="COGs: COG0580 Glycerol uptake facilitator and
FT                   related permease (Major Intrinsic Protein Family); InterPro
FT                   IPR012269:IPR000425; KEGG: tex:Teth514_1019 MIP family
FT                   channel protein; PFAM: major intrinsic protein; SPTR:
FT                   C6Q9K0 MIP family channel protein; TIGRFAM: MIP family
FT                   channel protein; PFAM: Major intrinsic protein; TIGRFAM:
FT                   MIP family channel proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81806"
FT                   /db_xref="GOA:E3H647"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:E3H647"
FT                   /protein_id="ADO81806.1"
FT                   /translation="MGVYLAEFIGTMILILLGNGVVANVVLNKSKGNNSGWIVITAGWG
FT                   FAVAVAVYVTGWVSGAHINPAVTIALATIGAFDWGMVPGYIAAQVAGAFTGGVLVYLTY
FT                   KQHYDETEDADGKLATFSTGPAISGAKWNATTEIIGSAMLVIGVLGITNGNNNVGPMAA
FT                   LLVGILVWSLGLSLGGPTGYAINPARDLGPRIAHALLPIKGKRDSDWAYAWIPVVAPIV
FT                   GGIIGAQLYTVCLSVWS"
FT   sig_peptide     18216..18284
FT                   /locus_tag="Ilyop_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            19112..20623
FT                   /locus_tag="Ilyop_0017"
FT   CDS_pept        19112..20623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0017"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="COGs: COG0554 Glycerol kinase; InterPro
FT                   IPR005999:IPR018483:IPR018484:IPR018485; KEGG:
FT                   cbe:Cbei_4509 glycerol kinase; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: C4IKF1 Glycerol kinase; TIGRFAM: glycerol
FT                   kinase; PFAM: FGGY family of carbohydrate kinases,
FT                   N-terminal domain; FGGY family of carbohydrate kinases,
FT                   C-terminal domain; TIGRFAM: glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81807"
FT                   /db_xref="GOA:E3H648"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E3H648"
FT                   /protein_id="ADO81807.1"
FT                   /translation="MSKKYVIALDQGTTSSRAIVFDKDGNTVGVSQKEFTQIYPKAGWV
FT                   EHNPMEIWASQSSVVTEVIAKTGITNDEIAAIGITNQRETTVVWDKNTGEPVYNAIVWQ
FT                   CRRTANICNELKEKGLEDYVRRNTGLVVDAYFSGTKVKWILDNVEGAREKAEKGDLLFG
FT                   TVDTWLIWKLTNGKVHVTDYTNASRTMLFNIRDLKWDEKMLEELNIPKSMLPEVKNSSE
FT                   VYGQANLGGVGGTGGIRVPIAGAAGDQQSALFGQACFEKGEAKNTYGTGCFLLMNTGEN
FT                   AVESKNGLLTTIAIGIDNKVEYALEGSVFVGGASVQWLRDELRLINDAADTEYFSKKVK
FT                   DSNGVYVVPAFVGLGSPYWDMYARGTIVGLTRGANRNHIIRATLESIAYQSRDLIDAME
FT                   DDSKIKLAALKVDGGAVKNNFLMQFQSDILGTDVLRPVVTETTALGAAYLAGLAVGFWE
FT                   SKEEIRNRWQVESKFDPAIGEDHKEQLYKGWKKAVERSTAWEEME"
FT   gene            21017..22327
FT                   /locus_tag="Ilyop_0018"
FT   CDS_pept        21017..22327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0018"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="COGs: COG4656 NADH:ubiquinone oxidoreductase subunit
FT                   RnfC; InterProIPR010208:IPR017896:IPR012285:IPR009051:IPR
FT                   017900:IPR011538:IPR019554:IPR001450; KEGG: fnu:FN1596
FT                   nitrogen fixation iron-sulphur protein RNFC; PFAM:
FT                   Respiratory-chain NADH dehydrogenase domain 51 kDa subunit;
FT                   Soluble ligand binding domain; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: C6JLF8 NADH
FT                   dehydrogenase; TIGRFAM: electron transport complex,
FT                   RnfABCDGE type, C subunit; PFAM: Respiratory-chain NADH
FT                   dehydrogenase 51 Kd subunit; SLBB domain; TIGRFAM: electron
FT                   transport complex, RnfABCDGE type, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81808"
FT                   /db_xref="GOA:E3H649"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E3H649"
FT                   /protein_id="ADO81808.1"
FT                   /translation="MKLFTFRGGVHPPENKAQTENKEIEVFSVSKTLYVPMLQHIGAPL
FT                   EPNVKVGDRVLKGQKIADSEAFVSSPVHSPVSGVVKKIEVMPFPLSGKVKTVVIENDEK
FT                   EEWAELTKIQNLEKATKEELLAMVREKGIVGVGGACFPTHIKLNPPKDVAIDVLLLNGA
FT                   ECEPYLNSDNRLMIEEPHKIVEGIKIINKILGISRAVVGIEDNKTEAIEKMTKACEGTG
FT                   IEVAMLKTQYPQGGEKQLIKAVLDRDVPSGGLPSAVGVVVQNTGTAGAIYEGLVEGKPL
FT                   IEKIVTVSGKAVERPSNLKVRIGTMFSEILDYAGTNRESMDKLVMGGPMMGMAQHTENV
FT                   PVVKGTSGLLALTKEETNPYKPKSCILCGKCVKACPINLLPNMYAKLARFKQWEEMGKN
FT                   HLMDCIECGSCSYICPANRPLTEAIKIGKAKLRTMKK"
FT   gene            22346..23281
FT                   /locus_tag="Ilyop_0019"
FT   CDS_pept        22346..23281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0019"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="COGs: COG4658 NADH:ubiquinone oxidoreductase subunit
FT                   RnfD; InterPro IPR011303:IPR004338; KEGG: fnu:FN1595
FT                   Na(+)-translocating NADH-quinone reductase subunit B; PFAM:
FT                   NQR2 and RnfD family protein; SPTR: C3WFK1
FT                   Na(+)-translocating NADH-quinone reductase subunit B;
FT                   TIGRFAM: electron transport complex, RnfABCDGE type, D
FT                   subunit; PFAM: NQR2, RnfD, RnfE family; TIGRFAM: electron
FT                   transport complex, RnfABCDGE type, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81809"
FT                   /db_xref="GOA:E3H650"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:E3H650"
FT                   /protein_id="ADO81809.1"
FT                   /translation="MEKILKMGPSPHIRTKERVEDVMYDVVIALVPALLMAVYVFGMRA
FT                   LTVTVTAVLSCMVTEWICQKAMKQEIAIFDGSAIITGILYAFVIPAFMPIPYIIVGSVV
FT                   SIALGKMVFGGLGHNIFNPALVGRAFVQASWPVAITTFYYDGSAGATVLDAMKRGLDLD
FT                   TSLLQGGNPYVQALIGRMGGCLGETSAIAILIGGIYLIKKKQVDWKVPAIIIGTVFLLT
FT                   ALAGANPLLHILSGGLFLGAFFMATDMVTSPYTEKGKIYYAVGIGILISAIRLKGGYPE
FT                   GTAFAILIMNGVVPIINRYTAPKKFGEVAK"
FT   gene            23281..23811
FT                   /locus_tag="Ilyop_0020"
FT   CDS_pept        23281..23811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0020"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /note="COGs: COG4659 NADH:ubiquinone oxidoreductase subunit
FT                   RnfG; InterPro IPR010209:IPR007329; KEGG: fnu:FN1594
FT                   nitrogen fixation protein RNFG; PFAM: FMN-binding domain
FT                   protein; SPTR: C3WL29 Nitrogen fixation protein RNFG;
FT                   TIGRFAM: electron transport complex, RnfABCDGE type, G
FT                   subunit; PFAM: FMN-binding domain; TIGRFAM: electron
FT                   transport complex, RnfABCDGE type, G subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81810"
FT                   /db_xref="GOA:E3H651"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:E3H651"
FT                   /protein_id="ADO81810.1"
FT                   /translation="MNRFIHYGLVLLSIAAISAGILASVNNMTKDVIAANAKKAVNEAR
FT                   IKVLPGAVSFNEEEKKSVEGLDYVPGYSDGGEVVGYVVTVAQPGYAANINFVLGFGSEG
FT                   DIKGLNIIGHQETPGLGSKVSDPDWQSHWIGKKLGYEFNKSTDAFAGATISPQAVYTGM
FT                   MRALSTYETEVKN"
FT   sig_peptide     23281..23382
FT                   /locus_tag="Ilyop_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            23811..24437
FT                   /locus_tag="Ilyop_0021"
FT   CDS_pept        23811..24437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0021"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /note="COGs: COG4660 NADH:ubiquinone oxidoreductase subunit
FT                   RnfE; InterPro IPR010968:IPR003667; KEGG: fnu:FN1593
FT                   electron transport complex RsxE subunit; PFAM: RnfA-Nqr
FT                   electron transport subunit; SPTR: C6JLG1 SoxR-reducing
FT                   system protein RsxE; TIGRFAM: electron transport complex,
FT                   RnfABCDGE type, E subunit; PFAM: Rnf-Nqr subunit, membrane
FT                   protein; TIGRFAM: electron transport complex, RnfABCDGE
FT                   type, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81811"
FT                   /db_xref="GOA:E3H652"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:E3H652"
FT                   /protein_id="ADO81811.1"
FT                   /translation="MGKKEMKILTQGLIKENPVFVLLLGLCPTLGVTSSAINGLAMGLA
FT                   TMAVLVCSNSIISAVKKIIPDKVRIPAYIMVIASLVTIVEMVMKAYVPALYAVLGLFIP
FT                   LIVVNCIVLGRAESFAAKNGVFLSFLDGVGTGLGFALALTLLGGIREILGNGSLFNISF
FT                   IPEGFSPALIFILAPGAFITIGCIIATQNYIKIRKSEKIQNSVEV"
FT   sig_peptide     23811..23918
FT                   /locus_tag="Ilyop_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            24441..25025
FT                   /locus_tag="Ilyop_0022"
FT   CDS_pept        24441..25025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0022"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="COGs: COG4657 NADH:ubiquinone oxidoreductase subunit
FT                   RnfA; InterPro IPR011293:IPR003667; KEGG: fnu:FN1592
FT                   Na(+)-translocating NADH-quinone reductase subunit D; PFAM:
FT                   RnfA-Nqr electron transport subunit; SPTR: C3WFK4
FT                   Na(+)-translocating NADH-quinone reductase subunit D;
FT                   TIGRFAM: electron transport complex, RnfABCDGE type, A
FT                   subunit; PFAM: Rnf-Nqr subunit, membrane protein; TIGRFAM:
FT                   electron transport complex, RnfABCDGE type, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81812"
FT                   /db_xref="GOA:E3H653"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:E3H653"
FT                   /protein_id="ADO81812.1"
FT                   /translation="MDLGNLFSIVVGAIFINNFIFAKFLGICPFMGVSKKVESSIGMGM
FT                   AVAFVMTLASAVTWIVYKFLLVPYGLEYLQTIAFILIIASLVQFVEMAIQKTSPHLYKA
FT                   LGVFLPLITTNCAVLGVAILNIQEGFNFIETVVNGFAGAIGFTLALVLLAGIRERLEYA
FT                   DVPRPFQGVPIAFISAGLLAMAFMGFSGMQI"
FT   sig_peptide     24441..24506
FT                   /locus_tag="Ilyop_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            25048..26052
FT                   /locus_tag="Ilyop_0023"
FT   CDS_pept        25048..26052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0023"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="COGs: COG2878 NADH:ubiquinone oxidoreductase subunit
FT                   RnfB; InterProIPR010207:IPR017896:IPR017900:IPR007202:IPR
FT                   001450; KEGG: amt:Amet_2285 electron transport complex,
FT                   RnfABCDGE type, B subunit; PFAM: Fe-S cluster domain
FT                   protein; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: C6JLG3 Electron transport complex protein;
FT                   TIGRFAM: electron transport complex, RnfABCDGE type, B
FT                   subunit; PFAM: Putative Fe-S cluster; 4Fe-4S binding
FT                   domain; TIGRFAM: electron transport complex, RnfABCDGE
FT                   type, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81813"
FT                   /db_xref="GOA:E3H654"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E3H654"
FT                   /protein_id="ADO81813.1"
FT                   /translation="MEAILIPVLILGGIGLFMGLFLAFASKKFEVEVNPNVEKIMEVLP
FT                   GINCGACGFPGCAGYAEAIALEGAEITSCAPGGTAVVESIGKIMGLTADTGGEKMVARV
FT                   LCQGDNTRTNKLYDFDVELKSCATAMLYFGGDKSCWHSCLGYGDCAAVCPVDAITITDK
FT                   GVAVINEDKCVSCEKCVKECPKRVISMTPQSQKVTVLCSSREKGAVARKNCSVACIGCG
FT                   VCVRACPVDAIDLNNNLAKIDPEKCIQCGLCAIKCPTNAITSEVKEIKKAEIIEEKCIG
FT                   CTACARVCPVDAIEGEVKQKHKVIEEKCIGCQLCYEKCKFGAIKINVTEKKDI"
FT   sig_peptide     25048..25122
FT                   /locus_tag="Ilyop_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(26101..26643)
FT                   /locus_tag="Ilyop_0024"
FT   CDS_pept        complement(26101..26643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0024"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase gamma subunit;
FT                   InterPro IPR019752:IPR002869; KEGG: amt:Amet_4303 pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; PFAM:
FT                   Pyruvate/ketoisovalerate oxidoreductase; SPTR: A6TW09
FT                   Pyruvate ferredoxin/flavodoxin oxidoreductase; PFAM:
FT                   Pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81814"
FT                   /db_xref="GOA:E3H655"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E3H655"
FT                   /protein_id="ADO81814.1"
FT                   /translation="MTEKIICAGFGGQGVMVLGKLIAYAGMLHDRQVSWLPSYGPEMRG
FT                   GTANCHVILSEKPIGSPIVSGDADFAIVMNKPSLDKFESSLVPGGRLLVNSSLISDKAS
FT                   RDDIEVYYIPANEIASECGIEKDSNLVMLGAYLELTNLIKEKEIIEAFTKVFDNEKAKL
FT                   IPLHKKALEKGAESLKI"
FT   sig_peptide     complement(26569..26643)
FT                   /locus_tag="Ilyop_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(26645..27394)
FT                   /locus_tag="Ilyop_0025"
FT   CDS_pept        complement(26645..27394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0025"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase beta subunit;
FT                   InterPro IPR011766; KEGG: amt:Amet_4304 thiamine
FT                   pyrophosphate binding domain-containing protein; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   SPTR: A6TW10 Thiamine pyrophosphate protein domain protein
FT                   TPP-binding; PFAM: Thiamine pyrophosphate enzyme,
FT                   C-terminal TPP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81815"
FT                   /db_xref="GOA:E3H656"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3H656"
FT                   /protein_id="ADO81815.1"
FT                   /translation="MEIVFKKTKGLTDAVTHYCPGCTHGIIHRLVGEVLEELGVLDKSI
FT                   GVASVGCSALSYKYFNCDMQAGPHGRAPALATGIKRVNSDCTVFTYQGDGDLASIGCAE
FT                   IIHAALRGENFTTIFVNNAVYGMTGGQMAPTTLIDQKSTTSPYGRDKTIHGMPIKMSEI
FT                   LATLDRAVYVVRVSVHDPKHVREAKKAIKKAFELQIKGEGFTIVEVLSTCPTNWGMTPI
FT                   EALDWLKDNMIPYYPLGVIKSPEKEED"
FT   gene            complement(27394..28455)
FT                   /locus_tag="Ilyop_0026"
FT   CDS_pept        complement(27394..28455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0026"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterPro IPR015941:IPR009014:IPR002880; KEGG: amt:Amet_4305
FT                   2-ketoisovalerate ferredoxin reductase; PFAM: pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein; SPTR:
FT                   A6TW11 Pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; PFAM: domain; Transketolase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81816"
FT                   /db_xref="GOA:E3H657"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:E3H657"
FT                   /protein_id="ADO81816.1"
FT                   /translation="MSKVLMKGNEAMAAAAIKAGCKFFFGYPITPQNEIPEYMSRNLPL
FT                   AGGTFVQAESEIAAINMVYGAAGSGARVMTSSSSPGISLKQEGISYIAGAELPCLIINV
FT                   MRAGPGLGGIQPAQADYFQAVKGGGHGDYHLPVFAPASIQEAVDLIPTAFEVADRYRTP
FT                   VMLLADGMIGQMMEAVEFKDLPQKTTVEKKWATTGTRGKREPNIITSLDLDSHRLEKHI
FT                   LEIKKKMDLICEKECRWEEYNIEDADIVAVAYGTTSRILKSAVEKLKNEGINVGILRPI
FT                   TLFPFPYHVLENLPEKVKAVLTVEMSTGQMVEDVRLGVNGRLPVHFFGRTGGVIPTPQE
FT                   IIDKVYEILGGGQ"
FT   gene            complement(28474..28689)
FT                   /locus_tag="Ilyop_0027"
FT   CDS_pept        complement(28474..28689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0027"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="InterPro IPR017896:IPR017900:IPR001450; KEGG:
FT                   cdl:CDR20291_0114 ferredoxin; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Q18CK1
FT                   Ferredoxin; PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81817"
FT                   /db_xref="GOA:E3H658"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E3H658"
FT                   /protein_id="ADO81817.1"
FT                   /translation="MGKGIVTFNEERCKGCGLCTVNCPVNIVFLQKNKINSKGYNPAGV
FT                   TDPDKCIGCGNCAIMCPDLVIRVKKI"
FT   gene            complement(29523..30863)
FT                   /locus_tag="Ilyop_0028"
FT   CDS_pept        complement(29523..30863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0028"
FT                   /product="transporter, NhaC family"
FT                   /note="COGs: COG1757 Na+/H+ antiporter; InterPro IPR018461;
FT                   KEGG: aoe:Clos_2739 Na+/H+ antiporter NhaC; PFAM: Na+/H+
FT                   antiporter NhaC-like; SPTR: A8MKD8 Na+/H+ antiporter NhaC;
FT                   PFAM: Na+/H+ antiporter family; TIGRFAM: Na+/H+ antiporter
FT                   NhaC; (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81818"
FT                   /db_xref="GOA:E3H659"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:E3H659"
FT                   /protein_id="ADO81818.1"
FT                   /translation="MDILLGMAFIFILLIFSVINKIFIGYPLFIALFVFSLLSIKRGYG
FT                   ARDVLKMIFDGGKKSFIVLQVFSLIGILTSLWISAGTIPTIVYYGIKFMNPNFFIIYTF
FT                   FIVSSVSLLLETSFGTVSTIGMAIIVMAKAGNINLAIVTGAIMSGAYFGDRCSPMSSSA
FT                   ILVANLTETDLYTNIKNMLKTEIFPLIASAFFYLILSLDNPIAFTHENIGESMREVFSI
FT                   GLIPLIPAAIIFGASLLKVNVKKSMSISILSAVFISILVQSYTPLEVINFSFFGFKLEN
FT                   SVKIGNILNRGGIISMIKAGIVVFISCSLAGIFHKTAMLEKFNKISLKSKNRFQLFSCT
FT                   AITSVLTGIFGCSQTISIVLTEQFLKDAYKKLGFTREKLALDIENTAVMIAPLIPWNIA
FT                   AFVPTETLKVNFYSYIPYAFYLYFVPISSLLVFKFQNYKLKLKENIV"
FT   sig_peptide     complement(30729..30863)
FT                   /locus_tag="Ilyop_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            31033..31416
FT                   /locus_tag="Ilyop_0029"
FT   CDS_pept        31033..31416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0029"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="COGs: COG0251 Putative translation initiation
FT                   inhibitor yjgF family; InterPro
FT                   IPR006056:IPR013813:IPR019897:IPR006175; KEGG: fnu:FN1973
FT                   translation initiation inhibitor; PFAM: Endoribonuclease
FT                   L-PSP; SPTR: C6JLL7 Translation initiation inhibitor;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP; TIGRFAM: endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81819"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E3H660"
FT                   /protein_id="ADO81819.1"
FT                   /translation="MGKKVINTEKAPAALGPYSQAIEVNGMLFVSGQIPFVPETMTCIS
FT                   DDVQEQTKQALENVKAVLEEAGYSLKDVVKVGVFIKNMDDFAKINEVYNEYLGDVKPAR
FT                   ACVEVARLPKDVKVEIEVIAVKG"
FT   gene            complement(31544..31912)
FT                   /locus_tag="Ilyop_0030"
FT   CDS_pept        complement(31544..31912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mcp:MCAP_0526 putative lipoprotein; SPTR:
FT                   C0BHF6 Cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81820"
FT                   /db_xref="UniProtKB/TrEMBL:E3H661"
FT                   /protein_id="ADO81820.1"
FT                   /translation="MKKFILFFSLVFILSFTSAEASRYSFNFGKIRITEAKLSRKNNKS
FT                   RSFSGLIENRSSKKLTVTMDIYFKDSEVNNGREVLVASPTFYNLSPRSTKNFRTYLYVG
FT                   EINGRDFRVKLSKTLEVK"
FT   sig_peptide     complement(31850..31912)
FT                   /locus_tag="Ilyop_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(32668..33918)
FT                   /locus_tag="Ilyop_0031"
FT   CDS_pept        complement(32668..33918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0031"
FT                   /product="Citrate transporter"
FT                   /note="COGs: COG2610 H+/gluconate symporter and related
FT                   permease; InterPro IPR004680; KEGG: cno:NT01CX_0983 GntP
FT                   family permease, putative; PFAM: Citrate transporter; SPTR:
FT                   A0PXH8 GntP family permease, putative; PFAM: GntP family
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81821"
FT                   /db_xref="GOA:E3H662"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:E3H662"
FT                   /protein_id="ADO81821.1"
FT                   /translation="MQVSALGTLIGLALSITLIVKKNNPVYSLILGAFVGGVTGGASLP
FT                   ETVSLMVEGAKGITPAILRILTAGVLAGVLIESGAAVKIAETIIEKLGSKRSILALALA
FT                   TMLLTAVGVFISVAVITVSPIAITIAKRLKVSKMSILLAMIGGGKSGNIISPNSNTIVS
FT                   SQNFGVDLSSLMAANIIPAIFGVVVTCFLAQTLIKKGEQILESGEEDLEKELPSFFSSM
FT                   TGPVIAIILLALGPITGIYVDPLIALPLGGAIGCLAMGKQSYFKEYIQYGLSKMTEIAI
FT                   LLLSTGTVAGIIKHSTLKDVTIELLDKSGFPEFLLAPISGALMSAATASTTAAATVASA
FT                   TFSTAIVAAGVKSLYGAAMLHAGATVFDHLPHGSFFHTTASCTSTNLEERFKLIPYESA
FT                   IGFTLTLFSTLIYGLIL"
FT   sig_peptide     complement(33874..33918)
FT                   /locus_tag="Ilyop_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            34213..35076
FT                   /locus_tag="Ilyop_0032"
FT   CDS_pept        34213..35076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0032"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="COGs: COG0564 Pseudouridylate synthase 23S
FT                   RNA-specific; InterPro IPR006225:IPR020103:IPR006145; KEGG:
FT                   fnu:FN0651 ribosomal large subunit pseudouridine synthase
FT                   D; PFAM: pseudouridine synthase; SPTR: C6JLM4
FT                   Pseudouridylate synthase; TIGRFAM: pseudouridine synthase,
FT                   RluA family; PFAM: RNA pseudouridylate synthase; TIGRFAM:
FT                   pseudouridine synthase, RluA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81822"
FT                   /db_xref="GOA:E3H663"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E3H663"
FT                   /protein_id="ADO81822.1"
FT                   /translation="MKKFIIEPQYSNYKISQYLREVKGYSGRSLRNIECYLDGKRVKTT
FT                   KKLRKLNRLVVKEKDKGTDMKPIKMDLNIVYEDNNLILIDKEPYIIVHPTQKKVDKTLA
FT                   HGIIHYIHEKTGKILAPRFYNRLDMNTTGIIVVAKNAYTQAFLQYKAEVKKYYQAIVKG
FT                   IIEEDEIMIEKPLGKEGDELRRKVMPVEKGGQDAKTFVKVIKRYPEKDLSLVELELFTG
FT                   RTHQIRAHMESLGHPVLGDELYGAKDDRARRQMLHSYKLEFTNPDNLHQETVEIELPED
FT                   MKEVLG"
FT   gene            35282..36289
FT                   /locus_tag="Ilyop_0033"
FT   CDS_pept        35282..36289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0033"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="COGs: COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase;
FT                   InterProIPR006424:IPR020831:IPR016040:IPR020830:IPR
FT                   020828:IPR020829:IPR020832; KEGG: fnu:FN0652 glyceraldehyde
FT                   3-phosphate dehydrogenase; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NAD(P) binding domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, catalytic domain; PRIAM:
FT                   Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating);
FT                   SPTR: C5VQN0 Glyceraldehyde-3-phosphate dehydrogenase, type
FT                   I; TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase, type
FT                   I; PFAM: Glyceraldehyde 3-phosphate dehydrogenase,
FT                   C-terminal domain; Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NAD binding domain; TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81823"
FT                   /db_xref="GOA:E3H664"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3H664"
FT                   /protein_id="ADO81823.1"
FT                   /translation="MAVKVAINGFGRIGRLAFRLMFDSPEFEIVAINDLTDAETLAYLL
FT                   KYDTAQGRYKSDSIEAIEGGIKVDGKELKIYAERDAKNLPWGDLGVDVVLECTGFYCSK
FT                   EKSQAHIDAGAKKVVISAPASGDLKTVVFNVNDSVLDGSETVISGASCTTNCLAPVAKV
FT                   LNDNFGLVKGFMTTIHAYTNDQNILDAPHAKPISARRGRAGAANMVPTSTGAAVAVGKV
FT                   LPELNGKLDGGAVRVPTITGSCVDLVVELEKEVTAEAINAAIKAAANETLGYTEDPIVS
FT                   SDTIGMEFGSLFDAACTKVMTVDGKQLVKLLTWYDNEMSYTAQLVRTCKKFASL"
FT   gene            36400..37593
FT                   /locus_tag="Ilyop_0034"
FT   CDS_pept        36400..37593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0034"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COGs: COG0126 3-phosphoglycerate kinase; InterPro
FT                   IPR015824:IPR015901:IPR001576:IPR015911; KEGG: lwe:lwe2406
FT                   phosphoglycerate kinase; PFAM: phosphoglycerate kinase;
FT                   PRIAM: Phosphoglycerate kinase; SPTR: C6JLM6
FT                   Phosphoglycerate kinase; PFAM: Phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81824"
FT                   /db_xref="GOA:E3H665"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:E3H665"
FT                   /protein_id="ADO81824.1"
FT                   /translation="MAKKIVTDLELKGKKVLMRVDFNVPLKDGKITNDNRITAALPTIQ
FT                   YVLDQGASVIAFSHLGRVKTEEDKAGKSMAPVAARLTELLGKEVKFVPETRGADLEAAV
FT                   SEIKPGEIMMFENTRFEDIDGKKESKNDPELGKYWASLGDVFVNDAFGTAHRAHASNVG
FT                   IASNIEESAAGFLMEKEIKFIGGAVDAPERPLVAILGGAKVSDKIAVIENLIAKADKII
FT                   VGGGMMFTFLKAKGLSIGKSLCEEDKLDLAKELMEKAGDKLILPIDTVAAKAFAADAEH
FT                   RTVAVADMAEDEMGLDIGAASIELFTKALEGSKTVVWNGPMGVFEMPAFAKGTIGVCEA
FT                   IANLDGATTIIGGGDSATAAIDLGFADKFTHISTGGGASLEYLEGKLLPGVESISEC"
FT   gene            37804..39603
FT                   /locus_tag="Ilyop_0035"
FT   CDS_pept        37804..39603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0035"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="COGs: COG0737 5'-nucleotidase/2' 3'-cyclic
FT                   phosphodiesterase and related esterase;
FT                   InterProIPR008334:IPR004843:IPR018392:IPR002482:IPR 006179;
FT                   KEGG: cdl:CDR20291_2424 putative membrane-associated
FT                   5'-nucleotidase/phosphoesterase; PFAM: 5'-Nucleotidase
FT                   domain protein; metallophosphoesterase;
FT                   Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM; SPTR: C6JPY3 5'-Nucleotidase
FT                   domain-containing protein; PFAM: Calcineurin-like
FT                   phosphoesterase; 5'-nucleotidase, C-terminal domain; LysM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81825"
FT                   /db_xref="GOA:E3H666"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:E3H666"
FT                   /protein_id="ADO81825.1"
FT                   /translation="MKRKFYMLSGTALLLALTACSNGDIKEDTELSIKKPKDFKLVVAH
FT                   INDTHGRVEEGKYDGMGFPRISTVLKDLRKENDNVLFLDAGDTIHGTTFATLSEGESVV
FT                   EILNYMKLDASTPGNHDFNYGKDRLKEIEKLADYEILGANVVTENGGKFIEPYIIKDMN
FT                   GVSIGVFGIATPETAYKTNPKNVDGIKFGDPVEYSKKSVQELKSKGADFIIALTHLGMD
FT                   ESTKDGLKSTDIAKSVEGIDLIIDGHSHTTLEDGMVVNKTTIVQTGEYDKNMGIVHIKV
FT                   ENGVTTINPRLISKEEALGKTIEREIAMEITEKLKVNEDYLIKDGDTLSEISYSTKVPV
FT                   ADLASINEISNVDLIYKGNTIMVPVEKNVTKTVTQVEKVKVGGIEKDPQLVKLIDSIKG
FT                   EQKKITQVKIGETPVSLNGERKFVRTGETNLANMITEAMLWKTGADIALTNGGGIRASI
FT                   PAGEITVGDIISVLPFGNYVVTKEMTGSEVIEALEHGISDYPATKGAFPQIAGMKVQFD
FT                   PSKAPGERLVSVTMNNGEELLPDSVYLVATNDFIAAGGDDYKMFKGKAEAGNFEGLDEI
FT                   LMDYIKAKGITERGKDNRISVNK"
FT   sig_peptide     37804..37872
FT                   /locus_tag="Ilyop_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            39738..39814
FT                   /locus_tag="Ilyop_R0001"
FT   tRNA            39738..39814
FT                   /locus_tag="Ilyop_R0001"
FT                   /product="tRNA-Pro"
FT   gene            39820..39895
FT                   /locus_tag="Ilyop_R0002"
FT   tRNA            39820..39895
FT                   /locus_tag="Ilyop_R0002"
FT                   /product="tRNA-Gly"
FT   gene            39902..39978
FT                   /locus_tag="Ilyop_R0003"
FT   tRNA            39902..39978
FT                   /locus_tag="Ilyop_R0003"
FT                   /product="tRNA-Arg"
FT   gene            40004..40079
FT                   /locus_tag="Ilyop_R0004"
FT   tRNA            40004..40079
FT                   /locus_tag="Ilyop_R0004"
FT                   /product="tRNA-His"
FT   gene            40088..40163
FT                   /locus_tag="Ilyop_R0005"
FT   tRNA            40088..40163
FT                   /locus_tag="Ilyop_R0005"
FT                   /product="tRNA-Lys"
FT   gene            40171..40254
FT                   /locus_tag="Ilyop_R0006"
FT   tRNA            40171..40254
FT                   /locus_tag="Ilyop_R0006"
FT                   /product="tRNA-Leu"
FT   gene            complement(40390..41403)
FT                   /locus_tag="Ilyop_0036"
FT   CDS_pept        complement(40390..41403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0036"
FT                   /product="glycosyl transferase family 9"
FT                   /note="COGs: COG0859 ADP-heptose:LPS heptosyltransferase;
FT                   InterPro IPR002201; KEGG: fnu:FN0544 ADP-heptose:LPS
FT                   heptosyltransferase II; PFAM: glycosyl transferase family
FT                   9; SPTR: C6JLQ4 LPS heptosyltransferase II; PFAM:
FT                   Glycosyltransferase family 9 (heptosyltransferase);
FT                   TIGRFAM: lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81826"
FT                   /db_xref="GOA:E3H667"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:E3H667"
FT                   /protein_id="ADO81826.1"
FT                   /translation="MKILIIHTAFIGDIVLSTPLIKKLKEKYPDSSITYVTTPVGSSIL
FT                   RNNPNLSEIIEYDKRGEHKGLKGLFLLGKRLKYKNFDMIITPHRYLRSSLLTWLTGAPV
FT                   RVGYDNSSGKLFFNKKVHYDKSKHEVEKLLSFVEDKNDKYYGIELFPGKAEKIRVDEIW
FT                   SENHLENKKIVAIAPGSKWFTKQWPLEYFNNLIDDLSKRKDTAIILIGGREELLLNIKE
FT                   TDKTINLIGKTSLLEVAEVTRRSHVVLTNDSSPIHIASAWKNTHIIAIFGATVKELGFY
FT                   PWSKNSQIIENNGLPCRPCGLHGGKKCPKGHFKCMLDLKPAMVLEKIEEKLNQITI"
FT   sig_peptide     complement(41353..41403)
FT                   /locus_tag="Ilyop_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(41400..42437)
FT                   /locus_tag="Ilyop_0037"
FT   CDS_pept        complement(41400..42437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0037"
FT                   /product="glycosyl transferase family 9"
FT                   /note="COGs: COG0859 ADP-heptose:LPS heptosyltransferase;
FT                   InterPro IPR002201; KEGG: fnu:FN0543 lipopolysaccharide
FT                   heptosyltransferase-1; PFAM: glycosyl transferase family 9;
FT                   SPTR: A5TXF4 LPS heptosyltransferase II; PFAM:
FT                   Glycosyltransferase family 9 (heptosyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81827"
FT                   /db_xref="GOA:E3H668"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:E3H668"
FT                   /protein_id="ADO81827.1"
FT                   /translation="MEIKRIIVSRTDKIGDLVLSIPSFYMLRKMYPQAEITVLVRKYNY
FT                   EIVKNLPYINRVIKIDDFRQKELIEKIKHFKADVFIALYNDSFVSKLAKASKAKWRIGP
FT                   ISKLSSIFAYNKGIRQRRSLSIKNEAEYNLDLIKKLDGKLFDENYEINNSIFLEERHKR
FT                   AAEVFIKENSIEGKILVINPFMGGSAKNISDEDYADLIKTVKKKIPALNVVLTCHISEE
FT                   ERGEKIIEKIKEDKIFLFANGGDLLNLAAVMSKADLYFGGSTGPTHIAASMKRNIVAIY
FT                   PNKKTQHPVRWGVFGWNNAQYIIPDKDNPKEDYSHKYFDSYNNEIKNSIADIIVDKLKK
FT                   NEVDR"
FT   gene            complement(42449..43222)
FT                   /locus_tag="Ilyop_0038"
FT   CDS_pept        complement(42449..43222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0038"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: fnu:FN0542 beta
FT                   1,4 glucosyltransferase; PFAM: glycosyl transferase family
FT                   2; SPTR: C6JLQ2 Beta 1,4 glucosyltransferase; PFAM:
FT                   Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81828"
FT                   /db_xref="GOA:E3H669"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3H669"
FT                   /protein_id="ADO81828.1"
FT                   /translation="MKLSVGIITFNEAKILPLTLKAASKVADEIVIVDSNSSDGTVEIA
FT                   RNLGAKVYDEEWKGFGPQKNSVIEKCNGEWILLIDADEELSEDLIKKINKIKNGIYDYQ
FT                   VYQINRCSICFGKELKYGGWSNQYATRLWKKGSVKVSDNLVHEDYITDCEIGKIKEKIN
FT                   HYSYITMKDYFDRFNRYTTLGAEEYYKRGKKSGILKIILNPMYKFFRMYFLRLGFLDGI
FT                   EGFVIACTSSMYSMVKYFKLREIYRNGAYVENKNS"
FT   sig_peptide     complement(43157..43222)
FT                   /locus_tag="Ilyop_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(43439..43515)
FT                   /locus_tag="Ilyop_R0007"
FT   tRNA            complement(43439..43515)
FT                   /locus_tag="Ilyop_R0007"
FT                   /product="tRNA-Met"
FT   gene            complement(43521..43597)
FT                   /locus_tag="Ilyop_R0008"
FT   tRNA            complement(43521..43597)
FT                   /locus_tag="Ilyop_R0008"
FT                   /product="tRNA-Met"
FT   gene            complement(43725..44486)
FT                   /locus_tag="Ilyop_0039"
FT   CDS_pept        complement(43725..44486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0039"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="InterPro IPR000189:IPR008258; KEGG: sat:SYN_01413
FT                   soluble lytic murein transglycosylase; PFAM: Lytic
FT                   transglycosylase catalytic; SPTR: C6P9M4 Lytic
FT                   transglycosylase catalytic; PFAM: Transglycosylase SLT
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81829"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E3H670"
FT                   /protein_id="ADO81829.1"
FT                   /translation="MEKTKLYPYPHMKNSNKDNMKLISVLLFLVLTVLLLFNLHKKELA
FT                   IKSLKNEILQIQLNEKEKEKKYIEKEMQYMEKLKNTETVIEKQKNEIEELKEFKLILEK
FT                   VKEISKGNINEKEALAVAKALYDVHNETGVGWEILAAMIMVESSYRPDIISSDPSYGLM
FT                   QLTYDVGKDVGKKMNKKNIIRNDLLDIERNIYYGAYYLLKQIIYFSNVSDGIMAYNLGA
FT                   SRVTKLKSEHSGKLESKYLKRVKKYYKGIKK"
FT   sig_peptide     complement(44352..44486)
FT                   /locus_tag="Ilyop_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(44559..44717)
FT                   /locus_tag="Ilyop_0040"
FT   CDS_pept        complement(44559..44717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0040"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="COGs: COG1773 Rubredoxin; InterPro
FT                   IPR004039:IPR018527:IPR001052; KEGG: tme:Tmel_0414
FT                   rubredoxin-type Fe(Cys)4 protein; PFAM: Rubredoxin-type
FT                   Fe(Cys)4 protein; SPTR: C4C708 Rubredoxin; PFAM:
FT                   Rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81830"
FT                   /db_xref="GOA:E3H671"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:E3H671"
FT                   /protein_id="ADO81830.1"
FT                   /translation="MEKWVCVVCGYVYDPEVGDPDSGVEPGTKFEDIPEEWVCPLCGVG
FT                   KDQFEKA"
FT   gene            complement(44757..44915)
FT                   /locus_tag="Ilyop_0041"
FT   CDS_pept        complement(44757..44915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0041"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="COGs: COG1773 Rubredoxin; InterPro
FT                   IPR004039:IPR018527:IPR001052; KEGG: tme:Tmel_0414
FT                   rubredoxin-type Fe(Cys)4 protein; PFAM: Rubredoxin-type
FT                   Fe(Cys)4 protein; SPTR: C4C708 Rubredoxin; PFAM:
FT                   Rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81831"
FT                   /db_xref="GOA:E3H671"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:E3H671"
FT                   /protein_id="ADO81831.1"
FT                   /translation="MEKWVCVVCGYVYDPEVGDPDSGVEPGTKFEDIPEEWVCPLCGVG
FT                   KDQFEKA"
FT   gene            complement(44941..45099)
FT                   /locus_tag="Ilyop_0042"
FT   CDS_pept        complement(44941..45099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0042"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="COGs: COG1773 Rubredoxin; InterPro
FT                   IPR004039:IPR018527:IPR001052; KEGG: hor:Hore_22490
FT                   rubredoxin-type Fe(Cys)4 protein; PFAM: Rubredoxin-type
FT                   Fe(Cys)4 protein; SPTR: C4C708 Rubredoxin; PFAM:
FT                   Rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81832"
FT                   /db_xref="GOA:E3H673"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:E3H673"
FT                   /protein_id="ADO81832.1"
FT                   /translation="MDKWACVVCGYVYDSVIGDPDAGIEVGTAFEEIPEDWICPLCGVG
FT                   KDQFEKI"
FT   gene            complement(45117..45692)
FT                   /locus_tag="Ilyop_0043"
FT   CDS_pept        complement(45117..45692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0043"
FT                   /product="Rubrerythrin"
FT                   /note="COGs: COG1592 Rubrerythrin;
FT                   InterProIPR004039:IPR009040:IPR012347:IPR009078:IPR 003251;
FT                   KEGG: dae:Dtox_2716 rubrerythrin; PFAM: Rubrerythrin;
FT                   Rubredoxin-type Fe(Cys)4 protein; SPTR: C6JI88
FT                   Rubrerythrin; PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81833"
FT                   /db_xref="GOA:E3H674"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:E3H674"
FT                   /protein_id="ADO81833.1"
FT                   /translation="MSIKGTKTEKNLLKAFAGESQARMRYTFFAERAKEEGYEQIAELF
FT                   LETAENEKEHARRFFSFLDRGDNLEIDAAYPAGYVGNTLKNLKMAAAGEHEEHSELYPT
FT                   FGKIAQEEGFPEVAAVFRLISKVEVEHENRYLKLASNIEKNMVFEREDKVRWKCRKCGY
FT                   VHEGKLSLEICPVCNAPKAFFELKESDY"
FT   gene            complement(45711..46220)
FT                   /locus_tag="Ilyop_0044"
FT   CDS_pept        complement(45711..46220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0044"
FT                   /product="Ferroxidase"
FT                   /EC_number="1.16.3.1"
FT                   /note="COGs: COG1528 Ferritin-like protein; InterPro
FT                   IPR009040:IPR012347:IPR009078:IPR008331; KEGG:
FT                   dvl:Dvul_1565 ferritin, Dps family protein; PFAM: Ferritin
FT                   Dps family protein; PRIAM: Ferroxidase; SPTR: B5IGW4
FT                   Ferritin-like domain subfamily; PFAM: Ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81834"
FT                   /db_xref="GOA:E3H675"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:E3H675"
FT                   /protein_id="ADO81834.1"
FT                   /translation="MNKRVEDALNEQVNKEFYSAYLYLSMSSYFSEKNLNGFANFMRVQ
FT                   YQEEVSHGMKIFDYIMERGGRAKLKPIDEVKLEWNDVIEVFEETCDHEKFITDSINSIV
FT                   DISYEERDHATVNMLQWFIEEQVEEESTVQGLLEQLKMIDGKGAGLFMIDRELMARTFV
FT                   DATQEA"
FT   gene            complement(46288..46707)
FT                   /locus_tag="Ilyop_0045"
FT   CDS_pept        complement(46288..46707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0045"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
FT                   InterPro IPR002481; KEGG: fnu:FN2045 ferric uptake
FT                   regulation protein; PFAM: ferric-uptake regulator; SPTR:
FT                   C6JLP9 Ferric uptake regulation protein; PFAM: Ferric
FT                   uptake regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81835"
FT                   /db_xref="GOA:E3H676"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3H676"
FT                   /protein_id="ADO81835.1"
FT                   /translation="MKLHIEDIGAYLKSHEIKPSYQRMKIFDYLITHRNHPTVDTIYRS
FT                   LSQEIPTLSKTTVYNTLNLFVEKNIAVVIVIEENETRYDADVDIHGHFKCEKCNKVYDV
FT                   DIDTKKIDISSLDQFQINEHHLYFKGICENCLKSS"
FT   gene            complement(46873..47322)
FT                   /locus_tag="Ilyop_0046"
FT   CDS_pept        complement(46873..47322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0046"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: fnu:FN2046
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   SPTR: C6JLP8 Acetyltransferase; PFAM: Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81836"
FT                   /db_xref="GOA:E3H677"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3H677"
FT                   /protein_id="ADO81836.1"
FT                   /translation="MEFIEVNGEDREIIKGILDLENNAFGDNGAIDIWTLKPFVRYGKV
FT                   FALLENDVVVSAIEFIHKFDSKEIYLFGVSTREEFRGRGCAKKLMERSTQYFKEKGMEK
FT                   ISLTVAPENKSAVGLYKKMGYIIENIQNSEYGEGVDRLYMVKKII"
FT   gene            complement(47341..48072)
FT                   /locus_tag="Ilyop_0047"
FT   CDS_pept        complement(47341..48072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0047"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="COGs: COG0101 Pseudouridylate synthase;
FT                   InterProIPR001406:IPR020094:IPR020095:IPR020103:IPR 020097;
FT                   KEGG: fnu:FN1600 tRNA pseudouridine synthase A; PFAM:
FT                   Pseudouridine synthase I, TruA, alpha/beta domain; PRIAM:
FT                   tRNA-pseudouridine synthase I; SPTR: C6JLP7 Pseudouridylate
FT                   synthase; TIGRFAM: tRNA pseudouridine synthase A; PFAM:
FT                   tRNA pseudouridine synthase; TIGRFAM: pseudouridylate
FT                   synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81837"
FT                   /db_xref="GOA:E3H678"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E3H678"
FT                   /protein_id="ADO81837.1"
FT                   /translation="MKNIKIEYEYDGSGFFGFQRQPSARTVQGEIESALKVVLKEEINL
FT                   ASSGRTDRGVHAYMQVSNFFTSSKIPLDRLEFAVKNLIPEDIKIHSMKNVSEEFHARFS
FT                   AKSRAYEYIMGWDRTAFETKYVSGIKGKVDPEKLYKILEPIVGRHNFEGFRLTDCSGKN
FT                   PVRDISEIRCYPKGENKLAVYIKGNAFLKSQIRIIMGTALAVYFEKRPKNYLINKLKNP
FT                   DSKDEKIVADGSGLYLCDIEY"
FT   gene            48911..49561
FT                   /locus_tag="Ilyop_0048"
FT   CDS_pept        48911..49561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0048"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG4988 ABC-type transport system involved in
FT                   cytochrome bd biosynthesis ATPase and permease components;
FT                   InterPro IPR003439:IPR017871:IPR003593; KEGG: amt:Amet_1587
FT                   ABC transporter related; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: A6TNJ8 ABC transporter related;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81838"
FT                   /db_xref="GOA:E3H679"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3H679"
FT                   /protein_id="ADO81838.1"
FT                   /translation="MYRLENVKYKDIIYIESLEILPQKITCILGESGGGKTTLIKLLNK
FT                   MISPTSGDIFYKEKSLRKIDSVELRREVVMLSQSPGIFPGSVRDNLLIGLKFSEKDPAD
FT                   DSELVEIMKKVHLYKSLDDVAENLSGGEKQRVALGRVMLMDPKILLLDEPSSALDEKTE
FT                   KNIIKEVTDYVKTKNKTLIMVTHSKEIARDHADEIIEMAQGRVIDKKVGDRNG"
FT   gene            49554..50342
FT                   /locus_tag="Ilyop_0049"
FT   CDS_pept        49554..50342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0390 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR005226; KEGG:
FT                   amt:Amet_1586 hypothetical protein; PFAM: conserved
FT                   hypothetical protein; SPTR: A6TNJ7 Putative uncharacterized
FT                   protein; PFAM: Uncharacterised protein family (UPF0014);
FT                   TIGRFAM: conserved hypothetical protein TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81839"
FT                   /db_xref="GOA:E3H680"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:E3H680"
FT                   /protein_id="ADO81839.1"
FT                   /translation="MDKIIDLEIWQVGSAFVFIIILMFIVKVKGISREKEILVSSVRMT
FT                   LQLMFTGYLLTYLFKSKNPFYTLLVLVIMETFAVKNIFKRVKTPLSSRLRKIIAFSMVC
FT                   GTTASLAYFILVVVNLSPWYEPRYVIPIGGMIIGNSMTGISLGVTKLVDGFFSKKHLVE
FT                   TSLMLGATPKSASKEIVDGAFDSAILPTINSMVGMGIVFLPGMMTGQILSGTSPLTAIQ
FT                   YQIAIMLGIAGSVSLTVILFVQEGYKTFFNDEQQLVLEES"
FT   sig_peptide     49554..49643
FT                   /locus_tag="Ilyop_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(50395..51030)
FT                   /locus_tag="Ilyop_0050"
FT   CDS_pept        complement(50395..51030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0050"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="InterPro IPR018490:IPR000595; KEGG: chu:CHU_1132
FT                   transcriptional regulator; PFAM: cyclic nucleotide-binding;
FT                   SPTR: Q11W09 Transcriptional regulator; PFAM: Cyclic
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81840"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E3H681"
FT                   /protein_id="ADO81840.1"
FT                   /translation="MHSSEFPITLLPKSVRDKIKFKRYKKGEFIYEDGDEKVFYIKKGR
FT                   GMKIRCDEDGEKVFPYIFSDDEFIGVNAYFTGGSDWEVIAYSKEVTGFEIPKSIFKEYI
FT                   LSTPLFTEEYLPKCVKLLFQGLRGFYIDSQGGAAAYYAYVLSCFCKESNIFHFDSYTEL
FT                   TKAVYVNKSTLYKITNQFIDEGIIEKYKNSIKIINREALVKYFDTYKY"
FT   gene            51366..51785
FT                   /locus_tag="Ilyop_0051"
FT   CDS_pept        51366..51785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0051"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /note="COGs: COG3193 Uncharacterized protein possibly
FT                   involved in utilization of glycolate and propanediol;
FT                   InterPro IPR005624; KEGG: cbt:CLH_1936 DhaG protein; PFAM:
FT                   protein of unknown function DUF336; SPTR: B2V3H0 DhaG
FT                   protein; PFAM: Domain of unknown function (DUF336)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81841"
FT                   /db_xref="GOA:E3H682"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:E3H682"
FT                   /protein_id="ADO81841.1"
FT                   /translation="MYKETKRITLAAAKLMGEKALEKSVEIGKPFVFSVVDAGGHILYT
FT                   QRMEDAFITSISIAIDKAFTAATMKRATHLLTERVKPESELFGLNHTNNGRIVPFGGGL
FT                   PVTVDGEVIGGVGASGGTVEEDIQVVTAALNALGL"
FT   gene            52016..52963
FT                   /locus_tag="Ilyop_0052"
FT   CDS_pept        52016..52963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0052"
FT                   /product="glycerol dehydratase, cobalamin-independent,
FT                   small subunit"
FT                   /EC_number="4.2.1.30"
FT                   /EC_number="1.97.1.4"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterProIPR012839:IPR017896:IPR011352:IPR001989:IPR
FT                   007197; KEGG: dhd:Dhaf_0367 glycyl-radical enzyme
FT                   activating protein family; PFAM: Radical SAM domain
FT                   protein; PRIAM: [Formate-C-acetyltransferase]-activating
FT                   enzyme; SPTR: C9A819 Pyruvate formate-lyase; TIGRFAM:
FT                   glycyl-radical enzyme activating protein family; PFAM:
FT                   Radical SAM superfamily; TIGRFAM: glycyl-radical enzyme
FT                   activating protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81842"
FT                   /db_xref="GOA:E3H683"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:E3H683"
FT                   /protein_id="ADO81842.1"
FT                   /translation="MSQKGIIFNIQHFTIHDGPGIRTELFLKGCPLRCDWCGNPESLKA
FT                   HIEPGVYSSKCISREKCGACEEVCSDKSMLNFKDGKLVSIDGGKSTDWIACYNECPSDA
FT                   IKQWGKSMSVEECMKEILKDKGYYERSGGGVTVSGGDPILQSDFVRELFKACKDEDIHT
FT                   CFESTFYGDWKEVEKVLSYTDLFISDLKHMDTNIHKKHTGVNNDKILENLKKLTNEKKE
FT                   LILRIPVIPNVNDDMKNIKATADFILNELGGRVRTLQLLSFMRLGEEKYQSLGMPYKMK
FT                   DVNIDRESFQKHVSNFADYFNSRGIHCLVGTKEK"
FT   gene            53005..55542
FT                   /locus_tag="Ilyop_0053"
FT   CDS_pept        53005..55542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0053"
FT                   /product="glycerol dehydratase, cobalamin-independent,
FT                   large subunit"
FT                   /EC_number="2.3.1.54"
FT                   /EC_number="4.2.1.30"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase; InterPro
FT                   IPR001150:IPR004184; KEGG: pca:Pcar_1397 glycerol
FT                   dehydratase; PFAM: pyruvate formate-lyase PFL; formate
FT                   C-acetyltransferase glycine radical; PRIAM: Formate
FT                   C-acetyltransferase; SPTR: A6CWD5 Formate acetyltransferase
FT                   2; PFAM: Glycine radical; Pyruvate formate lyase; TIGRFAM:
FT                   pyruvate formate-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81843"
FT                   /db_xref="GOA:E3H684"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="UniProtKB/TrEMBL:E3H684"
FT                   /protein_id="ADO81843.1"
FT                   /translation="MNINVTSASNTQNQENILFKVLMGTNACGTEPFDKTYSLGYQANH
FT                   EDWSPYPRVNYLRQKFLDRPYDIDVERLRLVTEAYKKHELAPRKLQCAYAFENVLLNST
FT                   LYIYDQDLILGEIAAPAKASPIYPEFSVDWIIDEILNSPFEERSNDQFYIRNDEERQEI
FT                   LELCKYWKGKSANELITARLDEDQKKGSHMGEKVFQTNNYHFAGIGHFAMDYKKLMTLG
FT                   YNGVIQEVKAAFANLSKQDPEYGEKRDYYKATVIMLEASKKYITRYAKLAEDMAAVETD
FT                   KKRKQEFDSMATNCHAIAGDPPKTFWQALQLFNFATTLIQIEGNGHSISYGRMDQWLYP
FT                   FYEADMKNSNISKEFILELIEVQYVKMNNPTKLKDKGTVKVRNGRGFGGESLTIGGVDT
FT                   QGNDATNDLTMLMLEGSAHTRMMNPWVCVRMHENTPYELKIKTTECIRAGYGHPKIFND
FT                   GPAIKAMLSKGVTLEEARDYCVVGCVEPSLPGKEFGWQDAGYVNTAKMMEMVINGGRTL
FT                   IEGKQLGPDTGSLETYKSFDDVLESIDKQFAYWCDQLCSCLNITDAVHRMVKPTPYVSA
FT                   FFEGCIESGKDMTEGGAKYNGTAPQAAGIATCADSLSTIKKLMFDDKTQTGSELLQAVK
FT                   DNWEGHEKLYALVNSSKIPHYGNDDDYADELFKFMFECYCRHIKGRKTPRGGEFSPGVY
FT                   TVNANVGMGLYTNASLDGRKNNEPISDNMGPVHTAGGSHDISGPTAVVNSVAKVDHSLA
FT                   SNGTLLNLRFPEEAVAGIEGRDILVSFIEEYIYKQGMHVQFNVMSSETMRAAQKNPEKY
FT                   KDMLVRVAGYSAYFVELGKPLQEDLIQRTELHF"
FT   gene            55643..56530
FT                   /locus_tag="Ilyop_0054"
FT   CDS_pept        55643..56530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0054"
FT                   /product="protein of unknown function DUF81"
FT                   /note="InterPro IPR001484:IPR002781; KEGG: ere:EUBREC_2591
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF81; SPTR: C9A821 Predicted protein; PFAM: Sulfite
FT                   exporter TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81844"
FT                   /db_xref="GOA:E3H685"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E3H685"
FT                   /protein_id="ADO81844.1"
FT                   /translation="MVFEFGFLLVGLMQIFAFFVQGTTGFGATVISAPVTNGILGIPVG
FT                   VPYGTIICIPFLYYLAIKGRKDISWKDLASIVIGCAPGLVIGQKLFYKLSPQTAKISIG
FT                   SMIILIAVMNIYKYIIKPLMLNGAEEAPVEDTLGRKIFRYSCLILGGIVHGAFNIGGPL
FT                   ITVYTLEAVKDKKKFRNTMTSLWCILNVWNAFNQYRNGLFVPRLGMSLLVGMPFATAGF
FT                   FLGMRFLEKINKAQFLRIVYLILFFIGVNMTVRNVPGIPKNFQGAIIVIPVILVAALLT
FT                   ILEKRTRAAKLVKN"
FT   sig_peptide     55643..55723
FT                   /locus_tag="Ilyop_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            56602..57750
FT                   /locus_tag="Ilyop_0055"
FT   CDS_pept        56602..57750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0055"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR018211:IPR001670; KEGG: ere:EUBREC_0100 alcohol
FT                   dehydrogenase; PFAM: iron-containing alcohol dehydrogenase;
FT                   SPTR: C0BZV4 Putative uncharacterized protein; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81845"
FT                   /db_xref="GOA:E3H686"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E3H686"
FT                   /protein_id="ADO81845.1"
FT                   /translation="MQDFNFKIPQNIKFGMGSLKKLPEILKENNSEHVFLISDRGLESI
FT                   GVVKKVQEIIEAGGIKCTAYLDVKPNPTIDIVNEATVSYKECGATSIVALGGGSPLDVS
FT                   KTVGVLTTHGGDIRDYEGTDKVPGPIVPIIAIPTTAGTGSEVTASSVITDESRNYKFSI
FT                   VSYETLPKYAVLDPELIMTAPASIASSCGVDALIHAIEAYLSKNASPFTDAMAEKAMEL
FT                   IGKNLRKFVANRKDEEAACGMMSGSNFAGISFAWARLGNVHAMSHPVSAFCHVPHGVAN
FT                   SVLLPTVMEFNALVDNGRYEKIYNYIREGNEEVRDFKPEMLVEALKKLNEDLGIPKSLS
FT                   EVGVKEHMIEDMAKDAMKSGNVLANPRETSLNDMIELYKKAI"
FT   gene            58042..59460
FT                   /locus_tag="Ilyop_0056"
FT   CDS_pept        58042..59460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oan:Oant_2946 hypothetical protein; SPTR:
FT                   A6X350 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81846"
FT                   /db_xref="GOA:E3H687"
FT                   /db_xref="UniProtKB/TrEMBL:E3H687"
FT                   /protein_id="ADO81846.1"
FT                   /translation="MRIKREYGKEEPYIPAGPFKIRLPFVHLGFEKLDFYQGLLLCAVC
FT                   LGAIPMLQEYLGMPFDVAMTVVVLNGFLYFLHIFLGDPIIPGWITPAIPIVMLYVSQYP
FT                   AGSERVYALIAFQFSLGLLAVFLGITGLGKKVTSIVPNAMKSGVIIGAGIAAVNSVMQK
FT                   GGRFEKYPISIIICMGIGFYFLFSSHFKSKKNLNKFTRLLADMGSLPIIILAIILGPLV
FT                   GEVTISHIEWGITTLAVKELITEWTIFGLGLPPLKMFINGLPVVISCYIILFGDMIQAQ
FT                   SLLEDASKERPDEIIDYNANRSHLIFGLRNILMSIFGPNIALCGPLAAAMQVVLCERYK
FT                   NGRETMDSIHGGAVSYRYGTTLGYFLLPIVTLVKPILGIALAATMLIQGYVSVRVGVMK
FT                   SKTSNDLGIAGIMAAVIATRGAAWGLAAGILLCGFINIGKNEEFESPLLEDSNSADLVV
FT                   GEEIELKEVKLKEA"
FT   gene            complement(59541..60500)
FT                   /locus_tag="Ilyop_0057"
FT   CDS_pept        complement(59541..60500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0057"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR011991:IPR005119; KEGG: bpu:BPUM_0295 LysR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   LysR; LysR substrate-binding; SPTR: C0CX49 Putative
FT                   uncharacterized protein; PFAM: Bacterial regulatory
FT                   helix-turn-helix protein, lysR family; LysR substrate
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81847"
FT                   /db_xref="GOA:E3H688"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3H688"
FT                   /protein_id="ADO81847.1"
FT                   /translation="MAIDVELKTIKIMLAIEQEGSFSKAAEVLYISQPALTQYIKRIES
FT                   VLSFPLYNRENGKCVPTKAAKILLKEGQLLLEQYDSMLKKMNNTVDSKVVNIQLGWPTG
FT                   YTVQYLNSIMSSISNLESINVKVTENLVETLIQLLLQKKLNVLIIPALYFHPDLVYTTI
FT                   RREEFYLAVPKNHVANTIINKDRPTDYANLSDLKDMPFISLSANAYKKFIDPLFHEAGY
FT                   NPNIIFNCTNWYSSHSLVEDGLGLSIVPYWFAEKGHEKINYYHIQSKQRAYRILACVFH
FT                   RDQLVSPELKGFIDHIKNIYGDQYAHLPFDYSNLNQNI"
FT   gene            60853..61695
FT                   /locus_tag="Ilyop_0058"
FT   CDS_pept        60853..61695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0058"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR016040:IPR002198:IPR002347;
FT                   KEGG: hsm:HSM_0413 D-mannonate oxidoreductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR: B0A7B5
FT                   Putative uncharacterized protein; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81848"
FT                   /db_xref="GOA:E3H689"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3H689"
FT                   /protein_id="ADO81848.1"
FT                   /translation="MNNYDFNLKDKVAVITGGGGVLTGVFAEALCTRGAKVALFDINKE
FT                   AADMAAEKLMSAGGIAKGYKADVLSKESLTAAYEEVKKDFGTCDILLNGAGVHHPLATT
FT                   GHEQLTKENMGDGRTFFDLDIEKVEWVYDIDFMGTFLPTQVISKDMVGKTGCSVINISS
FT                   MNAISPTTTVPIYSAAKAGVNNFTAWLSSYFALVGIRVNALAPGFFVTNLNKNIMYKED
FT                   GNLSGRSERIIAGTPMSRFGNPDECAGTLLYLLDPKLSGFVTGAVIPIDGGFSNYCGV"
FT   sig_peptide     60853..60939
FT                   /locus_tag="Ilyop_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            62064..63008
FT                   /locus_tag="Ilyop_0059"
FT   CDS_pept        62064..63008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0059"
FT                   /product="glycerol dehydratase, cobalamin-independent,
FT                   small subunit"
FT                   /EC_number="4.2.1.30"
FT                   /EC_number="1.97.1.4"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterProIPR012839:IPR017896:IPR011352:IPR001989:IPR
FT                   007197; KEGG: cno:NT01CX_0497 pyruvate formate-lyase; PFAM:
FT                   Radical SAM domain protein; PRIAM:
FT                   [Formate-C-acetyltransferase]-activating enzyme; SPTR:
FT                   C9A819 Pyruvate formate-lyase; TIGRFAM: glycyl-radical
FT                   enzyme activating protein family; PFAM: Radical SAM
FT                   superfamily; TIGRFAM: glycyl-radical enzyme activating
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81849"
FT                   /db_xref="GOA:E3H690"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:E3H690"
FT                   /protein_id="ADO81849.1"
FT                   /translation="MNGGIIFNIQHFTIHDGPGIRTELFLKGCPLRCDWCGNPESLKAY
FT                   IEPGVYSSKCITQEKCGACEEVCSDKNMLNFKDGKLVSIDGGKSTDWIACYNECPSDAI
FT                   KQWGKSMSVEECMKEILKDKGYYERSGGGVTVSGGDPILQIDFVRELFKACKGEDIHTC
FT                   FESTFYGEWKEVEKVLSYTDLFISDLKHMDTNIHKKHTGVHNEKILENLKRLTNEDREL
FT                   ILRIPVIPNVNDDMENIKATADFILNDLGGRVRTLQLLSFMRLGEEKYKSLGIAYKIKD
FT                   VNIDRESFQKHVNKLADYFNSRGIHCLVGTKEK"
FT   gene            63047..65605
FT                   /locus_tag="Ilyop_0060"
FT   CDS_pept        63047..65605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0060"
FT                   /product="glycerol dehydratase, cobalamin-independent,
FT                   large subunit"
FT                   /EC_number="2.3.1.54"
FT                   /EC_number="4.2.1.30"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase; InterPro
FT                   IPR001150:IPR004184; KEGG: cno:NT01CX_1220 pyruvate
FT                   formate-lyase; PFAM: pyruvate formate-lyase PFL; formate
FT                   C-acetyltransferase glycine radical; PRIAM: Formate
FT                   C-acetyltransferase; SPTR: C9A820 Formate
FT                   acetyltransferase; PFAM: Glycine radical; Pyruvate formate
FT                   lyase; TIGRFAM: pyruvate formate-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81850"
FT                   /db_xref="GOA:E3H691"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="UniProtKB/TrEMBL:E3H691"
FT                   /protein_id="ADO81850.1"
FT                   /translation="MNVNATSVSQVEESNDILINSLQNTKGDGVACGTEPFDHTYGVGY
FT                   QVGHEDWSPFPRVNKLRQTFLDRTYEIDVQRLRLVTEAYKNNENVPRILQCAYAFDNVL
FT                   RNVELNVYDEELILGELAAPAKATPIYPEFSVEWIIDEILNFPFEERAYDQFYIRNDKE
FT                   RQEILDLCEYWRGKTVASLADARLDQDQRKGSQFGEDIYKTNYYHYAGVGHISIDYERL
FT                   MKLGYDGIIESAEKAKANLNKRDFEYADKRDFYQATLIMLKAAKAHIARYVPLVREHAE
FT                   KEADPKRKEELLAMAANCEQISGGAPKTFWQAMQLFSFTTALIQVESNGHSISYGRMDQ
FT                   WLNPFYEADMENGTLTKEFALELIEVQYVKLNNPVKLKEKGTVIVRNGRCAGGESLTIG
FT                   GMDKDGNDATNDITMMMLEASAHTRMMNPWLCVRMHENTPYELKIKTVEVIRAGFGHPK
FT                   IFNDEPAIKALLRKGTSLEEARDYAVVGCVEPNIPGKEYGWHDAAYVNTPKMMEMVVNG
FT                   GRILDGADKDKQLGPDTGSLDTYESFDEVLESVDAQFAYWLDQMCSSLNIIDDAHKTRK
FT                   PVPFLSAFYEDCIESGKDISAGGAKYNGIGPQAAGIATCADSLTAIKQLVFDEKRCTGS
FT                   ELLQAIKDNWEGHEKLYALVNSKKVHHYGNDDDYADELFKFMFECYCRNVAGREISRGG
FT                   QFNPGVYTVNANVGMGMNTNASVDGRKKGEPISDNMGPVHTAGGAHDFAGPTAIANSVS
FT                   KVDHSLATNGTLLNLKFPQEAVSGIEGRDNLVSYIGEYIAKQGMHVQFNVMSSETLKAA
FT                   QKNPEKYKDMLVRVAGYSAYFVELGKPLQEDLIQRTELKF"
FT   gene            65693..66592
FT                   /locus_tag="Ilyop_0061"
FT   CDS_pept        65693..66592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0061"
FT                   /product="protein of unknown function DUF81"
FT                   /note="InterPro IPR002781; KEGG: ele:Elen_0179 protein of
FT                   unknown function DUF81; PFAM: protein of unknown function
FT                   DUF81; SPTR: C9A821 Predicted protein; PFAM: Sulfite
FT                   exporter TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81851"
FT                   /db_xref="GOA:E3H692"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E3H692"
FT                   /protein_id="ADO81851.1"
FT                   /translation="MIFEISFLIVGLMQVIAFFILGTTGFGATVISAPVTNGLFGTAMG
FT                   VPYGTIVCIPFLYYLAIKDRKNISWKDLAKIVALCAPGIFIGQKLFYSISPQTAKISIG
FT                   TMICLIAIMNIHKYIIKPLVLNEVEDTEAPDTITPDTITRKIFRYGCLILGGIVHGAFT
FT                   IGGPLITVYTLEAVKDKKKFRNTMTSLWCVLNVWNAFTQYQNGAFTLRLGSALLVAMPL
FT                   AAIGYFLGMRFLEKINRDQFLRIVYMLLLFIGVNMFLRNVPSDMLKAVLITTSIVFVGY
FT                   IFIILKKKNTNKEQIKNA"
FT   sig_peptide     65693..65788
FT                   /locus_tag="Ilyop_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            66638..67786
FT                   /locus_tag="Ilyop_0062"
FT   CDS_pept        66638..67786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0062"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR018211:IPR001670; KEGG: ere:EUBREC_0100 alcohol
FT                   dehydrogenase; PFAM: iron-containing alcohol dehydrogenase;
FT                   SPTR: C0BZV4 Putative uncharacterized protein; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81852"
FT                   /db_xref="GOA:E3H693"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E3H693"
FT                   /protein_id="ADO81852.1"
FT                   /translation="MKDFNFKIPQNINFGMGSLKKLPEILKENNSEHVFLISDRGLESI
FT                   GVVKKVQDIIESGGIKCTAYLDVKPNPTIDIVNEATALYKDCGATSIVALGGGSPLDVS
FT                   KTVGVLAKYGGRITDYEGMDKVPGPIVPMIAIPTTAGTGSEVTASSVITDESRNYKFSI
FT                   VSYETLPKYAVLDPELIMTAPASIASSCGVDALIHAIEAYLSRNASPFSDAMAEKAMEL
FT                   IGKNLRRFVENRKDEEAACGMMSGSNFAGISFAWARLGNVHAMSHPVSAFCHVPHGVAN
FT                   SVLLPTVMEFNALVDNGRYEKIYNYIREGNEAIKDFKPEMLIEELKNLNEDLGIPKSLS
FT                   EVGVKEHMIEDMAKDAMKSGNVLANPRETSLDDMIELYKKAI"
FT   gene            67930..69342
FT                   /locus_tag="Ilyop_0063"
FT   CDS_pept        67930..69342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0471 Di- and tricarboxylate transporter;
FT                   KEGG: dsy:DSY4285 hypothetical protein; SPTR: Q24PG8
FT                   Putative uncharacterized protein; PFAM: Sodium:sulfate
FT                   symporter transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81853"
FT                   /db_xref="GOA:E3H694"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:E3H694"
FT                   /protein_id="ADO81853.1"
FT                   /translation="MENLIKKTMPSRSEFLSKSAMQWHLTIIIPLVLGFILMRNHVDMT
FT                   MVMFLSVTVTGILMFLFERVHMVITSLLLMTAYVLFGIAPMETVFSGWMAESIWITFGC
FT                   LVLVMVLGNTTLVERVTFHLIILSGGTYKGILFALIGLGIITNLLVPGVMVGVMIAALA
FT                   YSLCQTLGLGKSKASAGIMIGALGVGFYDVETFILSPGNYTLITNSASDVIDLTVNYWI
FT                   FFKDNFIFFPIVIIEALILNKLFAPKEMGNIKDKFQDKLHRLGSINYKEKKLIGVLILL
FT                   FLYLVTQPLHNFSMWYGFVFAPTVLFFPFFDLGKSEDIPKINFSIIIFMVACLGIGKTA
FT                   VYIGIGEKLALWAVNNLMVENPPMIVGSIFMLAVAVNFLMTPFAAMSSLGGTLAQIASS
FT                   LDVSFYPISYAFFFGCQTIFFPYETALYAILYGFGNIRLMDFLKFMTIRAILWLVYLMV
FT                   IGTGYWNLIGYF"
FT   sig_peptide     67930..68031
FT                   /locus_tag="Ilyop_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            69722..70474
FT                   /locus_tag="Ilyop_0064"
FT   CDS_pept        69722..70474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0064"
FT                   /product="protein of unknown function DUF81"
FT                   /note="InterPro IPR002781; KEGG: pat:Patl_2981 hypothetical
FT                   protein; PFAM: protein of unknown function DUF81; SPTR:
FT                   Q15RJ9 Putative uncharacterized protein; PFAM: Sulfite
FT                   exporter TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81854"
FT                   /db_xref="GOA:E3H695"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E3H695"
FT                   /protein_id="ADO81854.1"
FT                   /translation="MMEVLSNYDFTMIQWAVVIMTSFVVGIDKSGLPTLLIIIPIVAQI
FT                   LGGKLSAGFLLPLLVIGDIFAVIYYKRHMEIKILLKLLPWAIFGVMIGLFVGGLVSDAQ
FT                   FKMIIGIIVLICVFLLIAKKDSLSNYLSEKWYFHIVMGILGGFSSMIGNAAGPIMVVYF
FT                   LSMNLSKNRFIGTMSWFFFVLNLIKLPLYAFVWHNITLESFQLNLMIFPLILVGAFIGV
FT                   RVVKFVPEKSYRLMMIGVTIIGAARLLS"
FT   gene            complement(70608..71429)
FT                   /locus_tag="Ilyop_0065"
FT   CDS_pept        complement(70608..71429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0065"
FT                   /product="Endonuclease I"
FT                   /note="COGs: COG2356 Endonuclease I; InterPro IPR007346;
FT                   KEGG: ttu:TERTU_4549 extracellular protease/nuclease; PFAM:
FT                   Endonuclease I; SPTR: C5BJR3 Extracellular
FT                   protease/nuclease; PFAM: Endonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81855"
FT                   /db_xref="GOA:E3H696"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:E3H696"
FT                   /protein_id="ADO81855.1"
FT                   /translation="MKKILSILLLSLFLLSCEKKSQEKVINKIASTNDKYYTKVNGKTG
FT                   EELKKTLNKIITENHKKLTYKKAYNALEFTDEDPNNPENIILFYTGRSQAKKLRSQFDY
FT                   KNGWNREHVWPKSKGFKSQSSNYAYTDLHHLRPTDTTVNSSKGNKDLDDGGKNVKEAKG
FT                   TKSDYDSWEPRDEIKGDVARMMFYMAVRYEGLGDKYDDYDLELVDYTGTESSKEDFDGR
FT                   YGKLSTLLEWHALDPVDDRERLRHERVYEIQKNRNPFIDNPEWVGYIWPEN"
FT   sig_peptide     complement(71361..71429)
FT                   /locus_tag="Ilyop_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(71444..72103)
FT                   /locus_tag="Ilyop_0066"
FT   CDS_pept        complement(71444..72103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0066"
FT                   /product="putative phage repressor"
FT                   /note="COGs: COG2932 transcriptional regulator protein;
FT                   InterPro IPR001387:IPR011056:IPR015927:IPR019759; KEGG:
FT                   fnu:FN1589 LexA repressor; PFAM: Peptidase S24/S26A/S26B,
FT                   conserved region; helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; SPTR: A5TRP9 Possible
FT                   transcriptional regulator; PFAM: Helix-turn-helix;
FT                   Peptidase S24-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81856"
FT                   /db_xref="GOA:E3H697"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:E3H697"
FT                   /protein_id="ADO81856.1"
FT                   /translation="MNFQERIKIYMKRSSVKGKELAVKCQISPQYLSDIRSGRRTPTFH
FT                   IFNLILDNLKLLEDERNELLELWKESKDKNYSRSNVKNVIGEIIKLPIVGTASASPGKL
FT                   NFENPEKHSPVITYEGMSYSKCFIMKVEGDSMEPRIKDGSEIIVDTNKNTLEENLNKIV
FT                   VFNLNDEAYVKVLKLNKNKLVLQSINDKYPNIAIKSTDDFNIVGRVVEVRYRELLK"
FT   gene            72246..73421
FT                   /locus_tag="Ilyop_0067"
FT   CDS_pept        72246..73421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0067"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0389 Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair; InterPro
FT                   IPR017963:IPR017961:IPR001126; KEGG: cbi:CLJ_B3045 DNA
FT                   polymerase IV; PFAM: UMUC domain protein DNA-repair
FT                   protein; PRIAM: DNA-directed DNA polymerase; SPTR: C4C2M7
FT                   Nucleotidyltransferase/DNA polymerase involved in DNA
FT                   repair; PFAM: impB/mucB/samB family C-terminal;
FT                   impB/mucB/samB family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81857"
FT                   /db_xref="GOA:E3H698"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:E3H698"
FT                   /protein_id="ADO81857.1"
FT                   /translation="MDRIILHIDFDMFFAAVELLDNPMLKNKAIAVAPPKAKRGIITTA
FT                   SYEARKFGIGSGMAIDIAKRKCPDLTLVSPRMWKYEKINRIFREIVSQYTDRYEFVALD
FT                   EAYLDITYTYEFYDTPDQLAVNIQKDMYRKTGCTCSVGLGYNKISAKLASEKNKPNGFG
FT                   KLKTKKEFIKYTADKKLTKINGIGNKMAENLYHLFYKETLGQLREVSLDELRFYLGKPG
FT                   VTIYHMIRGIDSRIIGDCYKRDGYASRQTFQKDIFGREEVLKKIVKRIEEASWQMKKDN
FT                   KSAYTVSLIIRYSEGFHRITKNKTLKNPVKEPLEIYKVIEKISEEVELDKFIRQIGVRL
FT                   SKTGKTSKLYQLSFGEGKSFTRKKEVFKLTYELKKNFGRRVILDPLEARSR"
FT   gene            73446..73844
FT                   /locus_tag="Ilyop_0068"
FT   CDS_pept        73446..73844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmx:PERMA_1425 type 4 fimbriae expression
FT                   regulatory protein PilR; SPTR: C6LWS8 TFIIH basal
FT                   transcription factor complex helicase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81858"
FT                   /db_xref="UniProtKB/TrEMBL:E3H699"
FT                   /protein_id="ADO81858.1"
FT                   /translation="MGIINILALNEREIETIKLLLEYAEKKAKNEEMKLICSQLLEKIS
FT                   LKYYFSPEEDGKLKGLSPKARSLYYEFYEKYDFDLIDFVGRISQEYRAPNDIYKALLRQ
FT                   FPISTSLFKGHPQEIIDIIILVLDDNIG"
FT   gene            complement(join(73942..74511,75792..76121))
FT                   /pseudo
FT                   /locus_tag="Ilyop_0069"
FT   gene            complement(74539..75716)
FT                   /locus_tag="Ilyop_0070"
FT   CDS_pept        complement(join(74539..75429,75429..75716))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Ilyop_0070"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: pca:Pcar_1348 transposase
FT                   and inactivated derivatives; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: C4C830 Transposase; PFAM: Integrase
FT                   core domain; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81859"
FT                   /db_xref="GOA:E3H6A0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6A0"
FT                   /protein_id="ADO81859.1"
FT                   /translation="MMEEKRRYARFSEEKQKQIAELSFLKIKTKVELSNEYGITTNTVA
FT                   AWEKKYFGGPKKDMELSAQDKEIIRLKNLLKEKEEDIEILKKATAIFSRKKKITKRELF
FT                   IFVEIHRNVHSISQICRALEVSRSGFNKFQNNKTTERKKKDQGILDSILEVRKNRHKRS
FT                   YGAPRLKVELKDEYGIITSERRINRIMKENDISVNSTKKFKTGNEKSKRENITGNIVKR
FT                   KFKVGRKNEVWVTDITYIWTSEGWLYLSTIMDLFSRRIIAYDIGKRMTSELVIDTLTRS
FT                   FLLEEPEEELIIHSDQGSQYSSREYSNLVKKLGLIQSMSRRGNCYDNAVIESFHASLKK
FT                   EMIYVEGLVTKRYMKAMVFDYIEFYNKERRHSFLGNVSPVEFEKIQKKLVLG"
FT   gene            76332..77024
FT                   /locus_tag="Ilyop_0071"
FT   CDS_pept        76332..77024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0071"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="COGs: COG0684 Demethylmenaquinone methyltransferase;
FT                   InterPro IPR005493; KEGG: dds:Ddes_2380 dimethylmenaquinone
FT                   methyltransferase; PFAM: Dimethylmenaquinone
FT                   methyltransferase; SPTR: A8S131 Putative uncharacterized
FT                   protein; PFAM: Demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81860"
FT                   /db_xref="GOA:E3H6A1"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6A1"
FT                   /protein_id="ADO81860.1"
FT                   /translation="MSANNRKIIKDFPRPEKSLINEFENIQTANIGDCLDRDAALYSNI
FT                   KTINNKNLVGPAFTIDISDGDNLLVYIALDLAKEGDVLVISGGNYKERAILGEIIAKYA
FT                   EKKNLGGIVLDGCLRDYEVLSNMDFPIFATSISPNGPYKNGPGKINTPISIGGKMVTPG
FT                   DLIIGDSDGVVVVSPKDMNDILKKVNEISIYEEKLLKNIEENNVLDIRWAYDKLEKENY
FT                   YFIDYQNY"
FT   gene            77043..78227
FT                   /locus_tag="Ilyop_0072"
FT   CDS_pept        77043..78227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0072"
FT                   /product="sodium/glutamate symporter"
FT                   /note="COGs: COG0786 Na+/glutamate symporter; InterPro
FT                   IPR004445; KEGG: apr:Apre_0244 sodium/glutamate symporter;
FT                   PFAM: sodium/glutamate symporter; SPTR: C2BGT9 ESS family
FT                   glutamate:Na+ symporter; TIGRFAM: sodium/glutamate
FT                   symporter; PFAM: Sodium/glutamate symporter; TIGRFAM:
FT                   sodium--glutamate symport carrier (gltS)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81861"
FT                   /db_xref="GOA:E3H6A2"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6A2"
FT                   /protein_id="ADO81861.1"
FT                   /translation="MNISLDVIQTLGLAVIVFIFGSFVKSRVKVFQTYFIPAPVIGGLS
FT                   FSFLMFALYNLNGTTIIFDKVLQNFFMNIFFTCVGFTVSVKLMKKSGRQGVLLALIAVL
FT                   FLVIQNLVGVSLASVFGINKLLGIAMGSISMSGGVGSGAAFGPTLEKFGAEGATTIGVA
FT                   AATFGLLMGSMIGGPVAKKLIDRHNLKSDFLKSGVNEEKKLLGDVLIEKNLLNSVLIVL
FT                   LGAATGTIISMLLKFTGFTFPYYVGCLFGGAIARNLADIGAFELRMKEVDILGNISLAL
FT                   FLSMALMSLNINKLVDLAIPMLMILVIQATTMIIYAYFITFRSMGKSYDAAVMAAGHCG
FT                   VGLGQTPNALANMSSVIEKNGPAPNAWFVLPVITVVFINIFNPIIITFFINFFK"
FT   gene            78406..78699
FT                   /locus_tag="Ilyop_0073"
FT   CDS_pept        78406..78699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0073"
FT                   /product="SAF domain protein"
FT                   /note="InterPro IPR013974; KEGG: chy:CHY_1255 UxaA family
FT                   hydrolase; PFAM: SAF domain protein; SPTR: Q3ACP5
FT                   Hydrolase, UxaA family; PFAM: SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81862"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6A3"
FT                   /protein_id="ADO81862.1"
FT                   /translation="MKVKAIVAKGIDNVASVISFIEKNEVVGVNLDGEIKEVFVNHSVP
FT                   YGHKIALRDIKNGEDVYKYGEVIGRATDDIKYGDYVHVHNVESKRGRGDWKK"
FT   gene            78734..79894
FT                   /locus_tag="Ilyop_0074"
FT   CDS_pept        78734..79894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0074"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="COGs: COG2721 Altronate dehydratase; InterPro
FT                   IPR007392; KEGG: chy:CHY_1256 UxaA family hydrolase; PFAM:
FT                   D-galactarate dehydratase/Altronate hydrolase domain
FT                   protein; PRIAM: Altronate dehydratase; SPTR: Q3ACP4
FT                   Hydrolase, UxaA family; PFAM: D-galactarate dehydratase /
FT                   Altronate hydrolase, C terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81863"
FT                   /db_xref="GOA:E3H6A4"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6A4"
FT                   /protein_id="ADO81863.1"
FT                   /translation="MKIQGYRRENGKVGIRNHVAILPSSVCASETAVRISNLVPGTVAL
FT                   PHQHGCCQVGADSEQTINTLIGLGSNPNVAKVLVVGLGCEGAEPLRISEEIKKTGKEVQ
FT                   MITIQNCGGTLKTIEEGARIARKMITKVAMLKKEEIDISELTLAIECGGTDTTSGLCAN
FT                   PAVGTASDILLSHGGTAMLSETTELIGAEHVLANRAVSSEVKDKLLEIVKRTEDRAMSL
FT                   GVDIRGGQPTPGNIEGGVITIEEKSLGCIYKAGSSDIQGVLEYGEIPSSGKGFYVMDTP
FT                   GQDIESITGMVAGGAQLVIFTTGRGTPTGFPIAPVIKITGNETTYNNMIDNIDINAGRV
FT                   ITEGASIKSIGEEIFSEMMEVSNGKPTKSESLGHKEFGIYKIAPTF"
FT   sig_peptide     78734..78901
FT                   /locus_tag="Ilyop_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            79906..80850
FT                   /locus_tag="Ilyop_0075"
FT   CDS_pept        79906..80850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0075"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="InterPro IPR004684; KEGG: sec:SC0161
FT                   2-keto-3-deoxygluconate permease; PFAM:
FT                   2-keto-3-deoxygluconate permease; SPTR: C6JIS8
FT                   2-keto-3-deoxygluconate permease; PFAM:
FT                   2-keto-3-deoxygluconate permease; TIGRFAM:
FT                   2-keto-3-deoxygluconate transporter; (TC 2.A.10.1.1)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81864"
FT                   /db_xref="GOA:E3H6A5"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6A5"
FT                   /protein_id="ADO81864.1"
FT                   /translation="MEIKRSIEKIPGGMMVIPLVLGALMNTFTPGILKIGGFTTAIASG
FT                   ASALIGVFLVCMGAGINLKAAPMAAKKGFSITLSKFLIGTVVGLLVAKFLGPNGLFGLS
FT                   SLAIISAMTNTNGGLYAALAGEFGDETDIGAIAIISVNDGPFLTMIALGTAGVATIPIK
FT                   ALIGVLLPIVVGMILGNLDPKMKEFLTKGGPMLIPFFAFGLGAGINFAMLLKAGLPGIL
FT                   LGVLTAVVGGTFNVMADKASGGTGIAGAAASSTAGNAVATPAAVALADPSLAGIAAIAT
FT                   PQVAASTITTALLVPIITSYLVKRNKKQESIKV"
FT   sig_peptide     79906..80040
FT                   /locus_tag="Ilyop_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            80910..82184
FT                   /locus_tag="Ilyop_0076"
FT   CDS_pept        80910..82184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0076"
FT                   /product="type III effector Hrp-dependent outers domain
FT                   protein"
FT                   /note="COGs: COG3395 conserved hypothetical protein;
FT                   InterPro IPR010737; KEGG: chy:CHY_1258 hypothetical
FT                   protein; PFAM: type III effector Hrp-dependent outers;
FT                   SPTR: Q3ACP2 Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function, DUF1537"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81865"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6A6"
FT                   /protein_id="ADO81865.1"
FT                   /translation="MSKYVIIADDFTGANDTGVKFSKKSIKTIVTTKLEDFKVELMNCN
FT                   TLVVDLESRFDDKDTAFEKAYQVSKNLKSMGIKKIYKKIDSTFRGNIGSEIDGAMEGGK
FT                   FNATFLIPALPNAMRTTENGNVFLNDVLLEKTEISIDPRTPVKESFIPKILSIQSKRKV
FT                   GLVNYEEIETGKIKKRIDELFLNGCEIIIFDSITDNHLNLISICIEKNFKNENIMMAGS
FT                   AGFAEKIPHIYNLIPKAPPALLIAGSISEVTRKQVDFLREKSKIRAIKVVVENLFNGNK
FT                   SLEKLEIMKEVENRYIKNEDILIYTTDKREEVNGLFSKIETNGLSLEKISEEIANFLGE
FT                   IAKEILEKFEISGLFLTGGDTAIKVSVALKAEGVIIKNEIIEGVPYGYFLDEKYKDIII
FT                   VSKAGAFGTEDAILKSLEFIKKESK"
FT   gene            82187..83170
FT                   /locus_tag="Ilyop_0077"
FT   CDS_pept        82187..83170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0077"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="COGs: COG1995 Pyridoxal phosphate biosynthesis
FT                   protein; InterPro IPR005255; KEGG: oih:OB1013
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; PFAM:
FT                   Pyridoxal phosphate biosynthetic protein PdxA; PRIAM:
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; SPTR: C6JJI6
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; TIGRFAM:
FT                   4-hydroxythreonine-4-phosphate dehydrogenase; PFAM:
FT                   Pyridoxal phosphate biosynthetic protein PdxA; TIGRFAM:
FT                   4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81866"
FT                   /db_xref="GOA:E3H6A7"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6A7"
FT                   /protein_id="ADO81866.1"
FT                   /translation="MNKIIGITMGDPSGIGPEIILKSFFNKKIKSGKYLVIGDYEIIEF
FT                   FNKKLGLNVKLEKLINIDNINFSKDVLSILDLGLIKIENLKIGEVSLNSGNAAFQYLKK
FT                   AIELAMNGKISGIATAPLNKEAMNKAGHFYSGHTEILGYYTSTKDYAMLLYDEKLSTIH
FT                   VSTHVSLKEAIKRTKKERVEEVIRLADKTFRKLGLKNPKIAVAGLNPHSGENGLFGMEE
FT                   IEEIIPAINSSISKGINVEGPIPPDTVFLKAVEGNYDVVVAMYHDQGHIPLKLLGFNSG
FT                   VNITVGLPIIRTSVDHGTAFEIAGKNIANEESMINAINLVHKLSDA"
FT   gene            83226..83912
FT                   /locus_tag="Ilyop_0078"
FT   CDS_pept        83226..83912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0078"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="COGs: COG2186 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011991:IPR011711; KEGG: cno:NT01CX_1608 GntR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   GntR HTH; GntR domain protein; SMART: regulatory protein
FT                   GntR HTH; SPTR: A0PZ87 Transcriptional regulator, GntR
FT                   family, putative; PFAM: Bacterial regulatory proteins, gntR
FT                   family; FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81867"
FT                   /db_xref="GOA:E3H6A8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6A8"
FT                   /protein_id="ADO81867.1"
FT                   /translation="MFFPIEVSDISELISNSIKNLIIEGKLKPGDKLPSERVLAEKFNV
FT                   SRNTLREALGNLRLLGIIETKRNDGNFVSLNLEKVFIEMLKFMFLLKGTRKDVFIFRKS
FT                   IEVEATIDSVKNFTDEDLLELSEKLEKFKNTPEKDYEEIAKLDMDFHFKLISKCENYLM
FT                   FTLYKAIYALITEFLNDSVKIMDKKLLDQHHEEMFNYAKVKDIKQLKKSLENHLEVVQE
FT                   FNFERN"
FT   gene            85019..85807
FT                   /locus_tag="Ilyop_0079"
FT   CDS_pept        85019..85807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0079"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="COGs: COG0388 amidohydrolase; InterPro IPR003010;
FT                   KEGG: aoe:Clos_1009 nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase; PFAM: Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase; SPTR:
FT                   A8MG18 Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; PFAM: Carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81868"
FT                   /db_xref="GOA:E3H6I3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6I3"
FT                   /protein_id="ADO81868.1"
FT                   /translation="MRVSAVQMDMKFEDPEKNYEKAEQLIRMAAKQKPDTIVLPETWNT
FT                   GFFPEKNVSSFSDKGGQRTIELFSALSKELDVNIIAGSVVNEKQEGMYNTTYIFDRKGK
FT                   CIAEYDKTHLFSYMNEDEHFKKGEKLTTFELDGVKCGVIICYDIRFLELIRTLTLQGIK
FT                   ILFVVAQWPVPRIKHWEILNQARAIENQIFVACVNSCGTAGETIYGGHSALIDPWGENI
FT                   VQAGNTEEIITGDFDIEIVDKIRDTINVYNDRRTELYKII"
FT   gene            85823..86515
FT                   /locus_tag="Ilyop_0080"
FT   CDS_pept        85823..86515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2408 hypothetical protein;
FT                   SPTR: C0FJ78 Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF2848)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81869"
FT                   /db_xref="InterPro:IPR021269"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6I4"
FT                   /protein_id="ADO81869.1"
FT                   /translation="MKNVDFMLNKLSGQEKFSVPYEKVLVIGYSGRNMEKTMEHIKELE
FT                   EQLNVPAPKKIPTIFECSLETLTQEKNIKFVGDQTSGEIEYIIIYMNGKTYIGIGSDHT
FT                   DRKLESVSVPKSKQVCAKPIGNELWDYDDIKEHWDQIKMVSCQIIDGKEVKYQDGKLAD
FT                   ILKVEKILEELKERVGNIDNSIIYSGTVPLLDGFKYGDTFKCMMIDEVLKRTLKLEYGI
FT                   DTISEEER"
FT   gene            86517..87542
FT                   /locus_tag="Ilyop_0081"
FT   CDS_pept        86517..87542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0081"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="COGs: COG1638 TRAP-type C4-dicarboxylate transport
FT                   system periplasmic component; InterPro IPR004682:IPR018389;
FT                   KEGG: chy:CHY_1301 TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: Extracellular solute-binding protein, family
FT                   7, bacteria; SPTR: C0FJ77 Putative uncharacterized protein;
FT                   TIGRFAM: TRAP dicarboxylate transporter, DctP subunit;
FT                   PFAM: Bacterial extracellular solute-binding protein,
FT                   family 7; TIGRFAM: tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81870"
FT                   /db_xref="GOA:E3H6I5"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6I5"
FT                   /protein_id="ADO81870.1"
FT                   /translation="MKKNVSIALMLVVILGMLVGCGEKSTSDAEKGNKSGKAPVEIKIA
FT                   TVGNEEHQSTIMAKLFEEELEKVYDGDVKVSIYSNGSLGGEREAAEGVKLGTIQMTVVT
FT                   SDGALPAWVPDIQVLSIPYLFENKEQAFKILDGVMSEQLNPKFEKQGFKHLGFGELGFR
FT                   HFTNNKKEIRSVKDMEGLSIRVQEAPIWFALMKSLKASAVPVSFNELYTALQQGMVDGQ
FT                   ENPIASIATSKFNEVQKYLTLDGHTYAAVSMVMNKSFYDGLSEELKSAIDQAAKNSIPR
FT                   QRKAIDDKEQAYLKQLEDSGMVITDPDKKSFVEATKDLYTKEEVKKLVDPDLVELVMQN
FT                   K"
FT   sig_peptide     86517..86603
FT                   /locus_tag="Ilyop_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            87616..88113
FT                   /locus_tag="Ilyop_0082"
FT   CDS_pept        87616..88113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0082"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="COGs: COG3090 TRAP-type C4-dicarboxylate transport
FT                   system small permease component; InterPro IPR007387; KEGG:
FT                   bha:BH2672 C4-dicarboxylate transport system (permease
FT                   small protein); PFAM: Tripartite ATP-independent
FT                   periplasmic transporter DctQ component; SPTR: C0FJ76
FT                   Putative uncharacterized protein; PFAM: Tripartite
FT                   ATP-independent periplasmic transporters, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81871"
FT                   /db_xref="GOA:E3H6I6"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6I6"
FT                   /protein_id="ADO81871.1"
FT                   /translation="MKTIDSFIGGFLKFVMAFSSLILSVVTFIQVITRFIYKDPIAWGQ
FT                   DVIRLSFIYLVFWGGAYCIKEKEHLNIDILLTSVGIKTRKIMEIVINLILAIFFIFIVY
FT                   YGFIFMQSGASQKAPYLPIPMSLYYLALPSSVLLMLYYQIQIIFQQIKNFNKISNEVEV
FT                   QI"
FT   sig_peptide     87616..87708
FT                   /locus_tag="Ilyop_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            88110..89375
FT                   /locus_tag="Ilyop_0083"
FT   CDS_pept        88110..89375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0083"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="COGs: COG1593 TRAP-type C4-dicarboxylate transport
FT                   system large permease component; InterPro
FT                   IPR004681:IPR010656; KEGG: chy:CHY_1303 TRAP dicarboxylate
FT                   transporter, DctM subunit; PFAM: TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; SPTR: C0FJ75
FT                   Putative uncharacterized protein; TIGRFAM: TRAP
FT                   dicarboxylate transporter, DctM subunit; PFAM: DctM-like
FT                   transporters; TIGRFAM: TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81872"
FT                   /db_xref="GOA:E3H6I7"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6I7"
FT                   /protein_id="ADO81872.1"
FT                   /translation="MIILALFTVFLLGFPIAFSLGMVSLGQILINDFPVLVVIQRMFTG
FT                   ADSIALTAIPLFILSGGLMYKGGMSKRIVNFADLLLGHFPSGLAMVSILACMFFAAITG
FT                   SAIAATAAIGGIMIPLMVEKGYDKKFCTPLVACGGSIGPIIPPSIPLLIFGVMANVSVA
FT                   KLFLGGFLPGLLMGAGLMGYSYVVGKNRGYIGRETKAPSNEVFKAAKDALLALLMPIII
FT                   IGGIMSGLFTPTESGTIAVFYALGVGMFVYRELTLSDLWEALRDCAKSTGQVLVVVAFA
FT                   SLFTWVITVNNIPQEVGAYLSAAIGNKYVLLLVINVILLIAGTFIDTTSAVVIFTPLFL
FT                   PLAKSFGIDLIHFGLIMAVNLTIGMCTPPLGVCLFVSGSVAKVSLKEQFKDLMPMLVVL
FT                   LTVLMIVTYIPEIVLMLPNFLG"
FT   sig_peptide     88110..88187
FT                   /locus_tag="Ilyop_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            89516..90166
FT                   /locus_tag="Ilyop_0084"
FT   CDS_pept        89516..90166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0084"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1802 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011991:IPR011711; KEGG: mta:Moth_0073 GntR
FT                   family transcriptional regulator; PFAM: GntR domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; SPTR: C0FJ81 Putative uncharacterized
FT                   protein; PFAM: Bacterial regulatory proteins, gntR family;
FT                   FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81873"
FT                   /db_xref="GOA:E3H6I8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6I8"
FT                   /protein_id="ADO81873.1"
FT                   /translation="MIEKQLAYKYKLYEKIKEDIITGVYSQGEVLNERKLSKTMGISRT
FT                   PVREALQLLSHDGWVVNEIYKGTVVRTFEEGYVLNTLKVRTALELLAIEDAILYMNNQG
FT                   IEEIDEIIYRQEKSLIDYNPTEFMKLDREFHDKIYSFSKNNVLIDLLKNFNDIIRYFGI
FT                   QALTIPERNLHTLKEHKNIVSEMKNKNIEEAKKTMETHMLMTGSAIFEYSGKK"
FT   gene            90307..90501
FT                   /locus_tag="Ilyop_0085"
FT   CDS_pept        90307..90501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0085"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR017896:IPR017900:IPR001450; KEGG:
FT                   tte:TTE1339 ferredoxin 2; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Q8RA89 Ferredoxin
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81874"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6I9"
FT                   /protein_id="ADO81874.1"
FT                   /translation="MEEKVLVVKKGLCKGCEICVEFCPKDILDMKDGKVNVKNISACIQ
FT                   CNMCGKLCPDYAIGIRRNG"
FT   gene            90501..91634
FT                   /locus_tag="Ilyop_0086"
FT   CDS_pept        90501..91634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0086"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterPro IPR015941:IPR009014:IPR002880:IPR005476; KEGG:
FT                   amt:Amet_2634 pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain-containing protein; PFAM: pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein;
FT                   Transketolase domain protein; SPTR: A6TRG8 Pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein; PFAM:
FT                   domain; Transketolase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81875"
FT                   /db_xref="GOA:E3H6J0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6J0"
FT                   /protein_id="ADO81875.1"
FT                   /translation="MSKIKFMQGNEACVEGAIAAGMKFFAGYPITPSTEVMEKSAEMLP
FT                   KVEGKFIQMEDEIAGIAAAIGGSIAGSKSMTATSGPGFSLKMENLGYAVIAEIPLVVVN
FT                   VQRNGPSTGLPTSPSQGDMMQAKWGTHGDHPVIALSPSTVQECYSLTARAFNLAEKYRM
FT                   PVLFMLDEVVGHMREKVVLDTTLIEEIVDRAKPAKDDASYLPYGVSGDELVPKMSSFGE
FT                   GHRYHITGLVHDETGFPTNSTKVADKLMTRLMDKVEKNKDDIIQYEEYMMEDAEYVIFS
FT                   YGSTARSSKQAVMDLREKGIKAGLFRAITIWPFPEDRIRELAQKSKGILVAEMNLGQMV
FT                   LEVERIANGSCPVKLMGKGNGEFISPAEIVEKFGEVM"
FT   gene            91637..92461
FT                   /locus_tag="Ilyop_0087"
FT   CDS_pept        91637..92461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0087"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase beta subunit;
FT                   InterPro IPR011766; KEGG: aoe:Clos_1570 2-oxoglutarate
FT                   ferredoxin oxidoreductase subunit beta; PFAM: thiamine
FT                   pyrophosphate protein domain protein TPP-binding; SPTR:
FT                   A8MFF0 Thiamine pyrophosphate protein domain protein
FT                   TPP-binding; PFAM: Thiamine pyrophosphate enzyme,
FT                   C-terminal TPP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81876"
FT                   /db_xref="GOA:E3H6J1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6J1"
FT                   /protein_id="ADO81876.1"
FT                   /translation="MDTCKNKSYYREDKLPHIWCPGCAHGIVMHALVNAIENIGLNKDD
FT                   VCVVSGIGCSSRAPGYLDFNTLHTTHGRSLAFATGIKMAKPGMKVIALGGDGDFTAIGG
FT                   NHLIHAARRNIDIAAIIFNNNIYGMTGGQFSPTTPVGDYATTTPTGNIDPNFDIVKLVD
FT                   GAGASYVARGTAYHFDALVKLFENAINHKGFSLVEAVSTCPTSYGRKNKGFKGNPAAML
FT                   KYMRDNTVPVAAVAKLPKEKVEGKLVIGEFKNEQRPEYTEEYQKIIDKVRGV"
FT   gene            92465..92986
FT                   /locus_tag="Ilyop_0088"
FT   CDS_pept        92465..92986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0088"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase gamma subunit;
FT                   InterPro IPR019752:IPR002869; KEGG: aoe:Clos_1569
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate/ketoisovalerate oxidoreductase; SPTR: A8MFE9
FT                   Pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   TIGRFAM: 2-oxoacid:acceptor oxidoreductase, gamma subunit,
FT                   pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81877"
FT                   /db_xref="GOA:E3H6J2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6J2"
FT                   /protein_id="ADO81877.1"
FT                   /translation="MAKEIRLSGSGGQGLILAGIILAEAALHQGKVAVQSQSYGPEARG
FT                   GASKSEVIISDTEILYPKVNHSDIFLSLTQKSFDTYSSGNKENCIIVIDSSVKTPEGLN
FT                   VVKLPILETAKEKVGNSIVANIVSLGAIQAATNIVDRDVLEEAILGRVPAHVKELNKKA
FT                   FQAGIDLVNL"
FT   sig_peptide     92465..92539
FT                   /locus_tag="Ilyop_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(93318..93815)
FT                   /locus_tag="Ilyop_0089"
FT   CDS_pept        complement(93318..93815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0089"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="COGs: COG1959 transcriptional regulator protein;
FT                   InterPro IPR000944; KEGG: cac:CAC3525 hypothetical protein;
FT                   PFAM: protein of unknown function UPF0074; SPTR: Q97DF2
FT                   Uncharacterized conserved protein, YjeB/RRF2 family;
FT                   TIGRFAM: transcriptional regulator, Rrf2 family; PFAM:
FT                   Transcriptional regulator; TIGRFAM: rrf2 family protein
FT                   (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81878"
FT                   /db_xref="GOA:E3H6J3"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6J3"
FT                   /protein_id="ADO81878.1"
FT                   /translation="MLQFSIGVEYGLHCLLYLVDHPEGKAISVKELSTFQGISETYLSK
FT                   VFTKLKKSGIVRSTPGVKGGYELARDSKDISFWDVIEAIEGNSNLFQCAGILKSTVINT
FT                   EEEVEKYSGDCPCIIKNVMLDAEEQMRIYLREKSLYWLNEKVKEEVSETRIEATKKWFT
FT                   PN"
FT   gene            94014..94391
FT                   /locus_tag="Ilyop_0090"
FT   CDS_pept        94014..94391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0090"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="InterPro IPR012349:IPR009002:IPR011576; KEGG:
FT                   gme:Gmet_2650 pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein; PFAM: pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding; SPTR: Q39SA6 Pyridoxamine
FT                   5'-phosphate oxidase-related, FMN-binding protein; PFAM:
FT                   Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81879"
FT                   /db_xref="GOA:E3H6J4"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6J4"
FT                   /protein_id="ADO81879.1"
FT                   /translation="MLNEKLLEILSHEVDSAVTIVSEGENGPHLVNTWNSYIQVVEENK
FT                   LLIPAAGFIKTEKNLLKNNKLRLSICNRNVDGYRGQGTGVIVEGTGEIIKSGEYFDFMK
FT                   EKFDWARAILVVNIDVAKQTF"
FT   gene            94431..94565
FT                   /locus_tag="Ilyop_0091"
FT   CDS_pept        94431..94565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_0880 hypothetical protein; SPTR:
FT                   Q0SUK2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81880"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6J5"
FT                   /protein_id="ADO81880.1"
FT                   /translation="MNIKEKIIKLLKDSDPLRSGEIAKKIGEEKNEVDKAIKELKKNK"
FT   gene            94994..95890
FT                   /locus_tag="Ilyop_0092"
FT   CDS_pept        94994..95890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0092"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: cdf:CD1413 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: Q18BT4 Putative membrane protein;
FT                   PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81881"
FT                   /db_xref="GOA:E3H6J6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6J6"
FT                   /protein_id="ADO81881.1"
FT                   /translation="MEKKGYGLAFLAGVAWGTLGIISNYLGQTGVGSFEVAFLRLFFAF
FT                   LSMFIFYLIADVNKIKIRREGVKHTLLIGIITQVTMSLAVFKCISMTSTTVAIMMVCLG
FT                   PLFTAILSMIFFNEKITLFKGLALFLAFYGAFLMITSGDFSVLKANGAGIFVGLISALA
FT                   YGFFPILSKNIPKECNLTGIIMYSFLVGSICIFPIIDTKMILQALSFNMICFSIILGIV
FT                   PTILSFNFYSKAIKYTTPTKAGIVTLVELPTAAIIGHFFLEEYLFTINVVGIIILLVGI
FT                   MISKIDLTNKKIILDKV"
FT   sig_peptide     94994..95053
FT                   /locus_tag="Ilyop_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(96102..96800)
FT                   /locus_tag="Ilyop_0093"
FT   CDS_pept        complement(96102..96800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0093"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0655 Multimeric flavodoxin WrbA; InterPro
FT                   IPR005025; KEGG: dat:HRM2_34720 putative iron-sulfur
FT                   flavoprotein; PFAM: NADPH-dependent FMN reductase; SPTR:
FT                   C0Q942 Putative iron-sulfur flavoprotein; PFAM:
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81882"
FT                   /db_xref="GOA:E3H6J7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6J7"
FT                   /protein_id="ADO81882.1"
FT                   /translation="MGKIIGFSGSPVKNSNTDRLLKQVLENSGQEYEFIKLSHYNIKPC
FT                   IACKGCVEDNTCVVKDDFLEIAEKVRNSDSIVIASYTPYGIIDGFTKALLERFFSLHHN
FT                   GGHLSGKFLVSIVSSIDIDAQKTAHRALVVESIIENMKHVEALDITGSLPCNTCGRGDI
FT                   CETSAVKALHGEEATAGSHNCINVENQDVWKKGKEVGVKLGKLINREDEYVPSELTKEV
FT                   IARMQDIGRK"
FT   gene            complement(96834..97229)
FT                   /locus_tag="Ilyop_0094"
FT   CDS_pept        complement(96834..97229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR009002; KEGG: det:DET0297 hypothetical
FT                   protein; SPTR: Q3Z9Q4 Putative uncharacterized protein;
FT                   PFAM: Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81883"
FT                   /db_xref="GOA:E3H6J8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6J8"
FT                   /protein_id="ADO81883.1"
FT                   /translation="MKMPENVMNLLNDREASKVLTTVDSQGIPHSIVVGSIMAPAGDLL
FT                   CAAEVLMKKTAKNLETNKNIAVLAVKGTESYLVNATVIERQISGNLFDTVAEELKKLGL
FT                   PTQAVWTFNPTAIYDQSAGPNAGTKIS"
FT   gene            97378..97746
FT                   /locus_tag="Ilyop_0095"
FT   CDS_pept        97378..97746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0095"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="COGs: COG1733 transcriptional regulator protein;
FT                   InterPro IPR002577; KEGG: cac:CAC2934 transcriptional
FT                   regulator; PFAM: helix-turn-helix HxlR type; SPTR: Q97F21
FT                   Predicted transcriptional regulator; PFAM: HxlR-like
FT                   helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81884"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6J9"
FT                   /protein_id="ADO81884.1"
FT                   /translation="MEQLMQECKECKVIEELRSKLCSVCLTQRLIRGKWKILIIFLLKD
FT                   GALRFSHIKKSIPKVTQAYLSSQLKELEATGIIVRHSYNQVPPKVEYYLTDEGKSFIEV
FT                   IDNMHFWGVDYINKNLKK"
FT   gene            98495..99676
FT                   /locus_tag="Ilyop_0096"
FT   CDS_pept        98495..99676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0096"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /note="COGs: COG1473 Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase; InterPro
FT                   IPR010168:IPR017439:IPR011650:IPR002933; KEGG:
FT                   amt:Amet_1192 amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; PRIAM: Aminoacylase;
FT                   SPTR: A6TMI2 Amidohydrolase; TIGRFAM: amidohydrolase; PFAM:
FT                   Peptidase family M20/M25/M40; Peptidase dimerisation
FT                   domain; TIGRFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81885"
FT                   /db_xref="GOA:E3H6K0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6K0"
FT                   /protein_id="ADO81885.1"
FT                   /translation="MDIIREIEDLREELINLRRDFHKHPELGFQEFRTSEIITNYLKEL
FT                   GIEVKSGIAKTGVVGLLKGKSPGRTVLLRADMDALAIQEEVDTTYKSVHDGKMHACGHD
FT                   GHIAMLLIAAKILVKYKDEINGNIKFLFQPNEEEAGARAMIDEGVLENPHVDAAFAIHL
FT                   WTPIEYKNIGVTPGPVMAAHDNFKVTIKGKGGHTSSPHISIDPMIAAANVIQSVQSIQT
FT                   REIDVLSPTSIIFGKINGGTASNIIPETVELEGTIRYLYEGKDNSEEKPRIRFERIVRN
FT                   VCNLYRTEYELQIMPSSYAVINNDKLTNIAMDESSMIVNRNGGKIVSYICMAGEDFSEF
FT                   SSEVPSTLIFVGAGNKAKEAHYPHHHPRFDIDEDALAVGVELHVRNVIAFLKR"
FT   gene            99712..100887
FT                   /locus_tag="Ilyop_0097"
FT   CDS_pept        99712..100887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0097"
FT                   /product="creatinase"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000994:IPR000587; KEGG: amt:Amet_1194 creatinase; PFAM:
FT                   creatinase; peptidase M24; SPTR: A6TMI4 Creatinase; PFAM:
FT                   Metallopeptidase family M24; Creatinase/Prolidase
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81886"
FT                   /db_xref="GOA:E3H6K1"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6K1"
FT                   /protein_id="ADO81886.1"
FT                   /translation="MMPFEKKEYLERMKKVKESMNHKGIEVLLITDPANICYLSGHNAW
FT                   SFYVHQILLVTLDDEMPIFIGRYMDAFCGVVKTTWLDENHVRAYPDYYVQSLIKHPMDY
FT                   VCDVVKELNLDKKSIGVEMDNYYFTASAYKHLVQGLPDARFVDGDLVVNWVRVIKSDKE
FT                   IELQRRAAKIVEKAMQTAIDSLEPGARKCDVAADILHAQVSGTQEFGGDYTSIVPLMPC
FT                   GETAGAPHLTWDESRYTDNTVVAVELAGCHQRYHSPMARTVSLGKPSPKVEEIAKITIE
FT                   GLNAALDVIKPGVTCEEVELAWRKTIGKYGIEKESRIGYSMGLNYPPDWGEHTISLRPG
FT                   DKTILKPNMTLHCIPGMYFDDFGVSISEALVVTENGCETLANFPRKLFVKE"
FT   gene            100945..101481
FT                   /locus_tag="Ilyop_0098"
FT   CDS_pept        100945..101481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0098"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="COGs: COG3090 TRAP-type C4-dicarboxylate transport
FT                   system small permease component; InterPro IPR007387; KEGG:
FT                   bha:BH3392 C4-dicarboxylate transport system (permease
FT                   small protein); PFAM: Tripartite ATP-independent
FT                   periplasmic transporter DctQ component; SPTR: C1TQL5
FT                   TRAP-type C4-dicarboxylate transport system, small permease
FT                   component; PFAM: Tripartite ATP-independent periplasmic
FT                   transporters, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81887"
FT                   /db_xref="GOA:E3H6K2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6K2"
FT                   /protein_id="ADO81887.1"
FT                   /translation="MNLIKKVDDFTRKIEEVILSYGIIFMAITLIGNVISRTLFNKSWT
FT                   WAEEVGQILVISITFVGTSHAARVGRHIRMSAFFDMLSQKNQKILILIMSLVTSITMFY
FT                   LSYLSLLYTMKIYSIGRVTPSMRLPMYKITSVVVFGFFLTGIQYLINFILNIKEKDVYI
FT                   GTEKKIGDEELISGY"
FT   gene            101535..102815
FT                   /locus_tag="Ilyop_0099"
FT   CDS_pept        101535..102815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0099"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="COGs: COG1593 TRAP-type C4-dicarboxylate transport
FT                   system large permease component; InterPro
FT                   IPR004681:IPR010656; KEGG: bha:BH3391 C4-dicarboxylate
FT                   transport system (permease large protein); PFAM: TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit;
FT                   SPTR: Q9K7H0 C4-dicarboxylate transport system (Permease
FT                   large protein); TIGRFAM: TRAP dicarboxylate transporter,
FT                   DctM subunit; PFAM: DctM-like transporters; TIGRFAM: TRAP
FT                   transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81888"
FT                   /db_xref="GOA:E3H6K3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6K3"
FT                   /protein_id="ADO81888.1"
FT                   /translation="MIVTLIGIMIVLLLLGFPMLMSMIVSPLAVTLIYFPNINATLLIQ
FT                   QLVAGVQPFVLLAVPMFIFAADIMCAGKTANRLLDFVEKFVGHIHGGMAITTATACTLF
FT                   GAISGSTQATVVAIGKPMRQKLLKMGYDDSDAMALIINASDIALLIPPSIGMIMYAVVT
FT                   GASVGELFIAGIGPGLVLLVCFSIYSYIFARKNNIPRTPKASIKEKMRATKKALLPLGF
FT                   PVIIIGGIYSGIFSPTEAAAASVLYAVILEVVVYKAIKIKELYNIALSTGLVTAAVFIL
FT                   VGGGQAFSWLISYAKIPQMMTSVLLGGSPSPLRILLTVTIFYFVGCMFVDPIVVIIILT
FT                   PIFYPLAMAAGIDPIHLGILITLQSAIGSATPPFGCDIFTACAVFEKPYLEVIRKTPPY
FT                   IFILVVISIIMIFFPGIALFFRDLVFS"
FT   gene            102894..103946
FT                   /locus_tag="Ilyop_0100"
FT   CDS_pept        102894..103946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0100"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="COGs: COG1638 TRAP-type C4-dicarboxylate transport
FT                   system periplasmic component; InterPro IPR004682:IPR018389;
FT                   KEGG: vex:VEA_000634 TRAP-type C4-dicarboxylate transport
FT                   system component; PFAM: Extracellular solute-binding
FT                   protein, family 7, bacteria; SPTR: A6C4S8 C4-dicarboxylate
FT                   transport system (C4-dicarboxylate-binding protein);
FT                   TIGRFAM: TRAP dicarboxylate transporter, DctP subunit;
FT                   PFAM: Bacterial extracellular solute-binding protein,
FT                   family 7; TIGRFAM: tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81889"
FT                   /db_xref="GOA:E3H6K4"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6K4"
FT                   /protein_id="ADO81889.1"
FT                   /translation="MIKKISLLMLIVILTLSLFGCSDGGSANNEASSGKPVTWRITHEE
FT                   VVGSVQDVYANKFKELIEEKSAGKIKVEVYPVGQLGDGVTQVELLQDGGVDFAINNPGA
FT                   VATIIPENQVFSLQFLLSDDMDVNQKVMTEGAAKDELNNIYLKKGIKVLDWFTEGFQMW
FT                   TGNKSLTSIDDFKGFKMRTMASPMISAGYEAYGANPTPIPYMEVYSSLQLNMIDGQVNP
FT                   IFAIEEMKFYEVQKYLMMSKQNTFVGTFCVNPDFWDKLGDSDKGMVESIVPELNKYIFE
FT                   VQENLNTERLEKIKEVSDIQIVELTDGERDSFKEASIPVRDVYVNEVGEKGKKILDLLI
FT                   KDVEKFENEK"
FT   sig_peptide     102894..102974
FT                   /locus_tag="Ilyop_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            104041..104769
FT                   /locus_tag="Ilyop_0101"
FT   CDS_pept        104041..104769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0101"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="COGs: COG3473 Maleate cis-trans isomerase; InterPro
FT                   IPR015942; KEGG: amt:Amet_1195 Asp/Glu racemase; PFAM:
FT                   Asp/Glu/hydantoin racemase; SPTR: A6TMI5 Asp/Glu racemase;
FT                   PFAM: Asp/Glu/Hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81890"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6K5"
FT                   /protein_id="ADO81890.1"
FT                   /translation="MKDFLYGEKLKIGLIYPCGGWVMEPEFYDMSPVGVSTYTTRVLLD
FT                   NVNENELTKVGDRAIRATKLLCKAPVDIVALGCTSGSFIGGAKYDEELIKKMEKASEGV
FT                   PCLTTSSAVVAALKNLNIKKVALATPYTNDVNMRCKIFLEEYGFEITNICGLGLTNDSE
FT                   IDRQKLEVIYKLAKDADTTDAEAVAILCTGVRSIPILQDLETDLGKPVISAVQATFWHC
FT                   LCMAGVKEKISGYGSLLESI"
FT   gene            104837..105505
FT                   /locus_tag="Ilyop_0102"
FT   CDS_pept        104837..105505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0102"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1802 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011991:IPR011711; KEGG: dhd:Dhaf_1564
FT                   transcriptional regulator, GntR family; PFAM: GntR domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; SPTR: B8FP89 Transcriptional regulator,
FT                   GntR family; PFAM: Bacterial regulatory proteins, gntR
FT                   family; FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81891"
FT                   /db_xref="GOA:E3H6K6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6K6"
FT                   /protein_id="ADO81891.1"
FT                   /translation="MIIKSKFFHENLSDKVVEFIKQKIFTGEYKKGHHILEQEIANELN
FT                   ISRAPVREGIKLLQNQELIKFIPRKGNYVNEFTMEDIKEIYDIRLLIETSVFEILINEK
FT                   KLTEEDFQNLIKIIDEMVELAKKEGELSTKIMNLNKKDMEFHRYIWNKSGSNRRIRILS
FT                   TLYTQLQLAMIIDTKLAGNLENTAKEHYAIIEYLRQGDLDSCIKAFEDHILIYRNKNNQ
FT                   "
FT   gene            105558..106733
FT                   /locus_tag="Ilyop_0103"
FT   CDS_pept        105558..106733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0103"
FT                   /product="Methionine gamma-lyase"
FT                   /EC_number="4.4.1.11"
FT                   /note="COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase; InterPro
FT                   IPR015421:IPR015422:IPR000277:IPR015424; KEGG:
FT                   nth:Nther_1160 cystathionine gamma-synthase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; PRIAM:
FT                   Methionine gamma-lyase; SPTR: B2A1K3 Cystathionine
FT                   gamma-synthase; PFAM: Cys/Met metabolism PLP-dependent
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81892"
FT                   /db_xref="GOA:E3H6K7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6K7"
FT                   /protein_id="ADO81892.1"
FT                   /translation="MKINTDLLHAQQKHDPVTGSHVSPLYQTSTFVLPNFDEAVRLNQN
FT                   IDQGFVYSRFGNPTVDEFERKVAHLEQAEAAVASASGLGAITLAVMSLVKTGDHVIFGD
FT                   VIYGCTFALFTKILPSLGVAYTIVDTTNPEAIEAAIKPNTVLVYVETPANPTLKISDIE
FT                   AVSKVTKKHEKVKLVVDSTFASPYLQNPIVLGADMVVHSATKYLCGHGTVTAGVLAGSK
FT                   ELIDRAKMPYLQCFGSVLDPFAAWTIMQGMKTLGVRMEKHCSNAMKVAEFLDNHPMVDK
FT                   VYYPGLPSHESHETAKKQMKDFGAMMSVDIKGGIDSCRTVMNSVKVFSLATSLGNVDSL
FT                   IQHSPTMSHFDMTLEERCKVNIFDGQVRISVGIEDVEDLIEDLDQALKSIK"
FT   gene            106922..107506
FT                   /locus_tag="Ilyop_0104"
FT   CDS_pept        106922..107506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0104"
FT                   /product="pyruvate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase gamma subunit;
FT                   InterPro IPR011894:IPR019752:IPR002869; KEGG: ckr:CKR_2649
FT                   hypothetical protein; PFAM: Pyruvate/ketoisovalerate
FT                   oxidoreductase; PRIAM: Pyruvate synthase; SPTR: C3WB17
FT                   Pyruvate ferredoxin oxidoreductase; TIGRFAM:
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   TIGRFAM: 2-oxoacid:acceptor oxidoreductase, gamma subunit,
FT                   pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81893"
FT                   /db_xref="GOA:E3H6K8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6K8"
FT                   /protein_id="ADO81893.1"
FT                   /translation="MSNLVEIRWHGRGGQGAKTASLLLADAAFTIGKFVQGFPEYGPER
FT                   MGAPITAYNRISGEKIRVHSNIYEPDYVVVVDDTLLSAVDVTKGLKKEGAIIINTSIPQ
FT                   KEILSKLKKYDGNVFLCDARKISEESLGKNFPNTPMLGAVVKVSGIMSEEEFLGSMEES
FT                   FKHKFASKPEVIKGNMKALKVSMGEVKICEK"
FT   gene            107496..107798
FT                   /locus_tag="Ilyop_0105"
FT   CDS_pept        107496..107798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0105"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /note="COGs: COG1144 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase delta subunit;
FT                   InterPro IPR011898:IPR017896:IPR017900:IPR001450; KEGG:
FT                   ckr:CKR_2648 hypothetical protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: C3WB18 Pyruvate
FT                   oxidoreductase; TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S binding domain;
FT                   TIGRFAM: 2-oxoacid:acceptor oxidoreductase, delta subunit,
FT                   pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81894"
FT                   /db_xref="GOA:E3H6K9"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6K9"
FT                   /protein_id="ADO81894.1"
FT                   /translation="MKNKKGMVIDENIKWQDITPGGIVYGGGTSEAVNTGDWRTKKPVF
FT                   IEGKCKQCLLCTPVCPDMSIPIKDGKRADFNYYFCKGCGICYEVCPFDAIKMENE"
FT   gene            107813..108991
FT                   /locus_tag="Ilyop_0106"
FT   CDS_pept        107813..108991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0106"
FT                   /product="pyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterPro IPR015941:IPR009014:IPR002880; KEGG: ckr:CKR_2647
FT                   hypothetical protein; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; SPTR: C3WB19 Pyruvate
FT                   synthase subunit porA; PFAM: domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81895"
FT                   /db_xref="GOA:E3H6L0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6L0"
FT                   /protein_id="ADO81895.1"
FT                   /translation="MAIKERMSGNESIAIAMRQINPDVLPAFPITPSTEIPQYFSKYVA
FT                   DGLVQTEFIPVESEHSAMSAAIGAQAAGARTTSATSSAGLALMWEMLHVAASCKLPITL
FT                   ACVNRALTGPININADHSDSMGARDTGWIQIYSETNQEAYDNYIQAVRIAEHKDVMLPA
FT                   MVCQDGFITSHAVENIELLEDKEVRDFVGEYAPEDSLLNPGYPISHGPYDTATFYMEHK
FT                   RLQAESMKKAKKVILSVAEEFKKVSGREYGLFEEYRMEDAEYAMVIINSSAGTAKVAVD
FT                   ELRKEGKKVGLIKIRVFRPFPMEELAEALKHLKAIAVMDKSEGFSSAGGPIFAEVRSAM
FT                   YDLSEKPSVVNYIYGLGGRDFTVDSAKQVYDEIEDIKGTSIDDIYRYLGVRG"
FT   gene            109002..109940
FT                   /locus_tag="Ilyop_0107"
FT   CDS_pept        109002..109940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0107"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase beta subunit;
FT                   InterPro IPR011766; KEGG: ckr:CKR_2646 hypothetical
FT                   protein; PFAM: thiamine pyrophosphate protein domain
FT                   protein TPP-binding; SPTR: C3WB20 Pyruvate synthase subunit
FT                   porB; PFAM: Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81896"
FT                   /db_xref="GOA:E3H6L1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6L1"
FT                   /protein_id="ADO81896.1"
FT                   /translation="MAYNLKEQMNKPERLSGGHRMCAGCGAPIAVRTMLRALKPEDKAT
FT                   IVSATSCLEVSTFLYPYTAWKDSFIHTAFENAGATMSGVEGAYNALRRKGKLDETYKFI
FT                   AFGGDGGTYDIGFQSLSGAMERNHDMVYVCYDNGAYMNTGIQRSSATPKYADTTTTPVG
FT                   TESSGKIQPRKDMAAIMAAHNIPYAAQTTFMGNMKDMHEKAEKAIYTKGAAYLNVMAPC
FT                   PRGWRYDESKLMEICKAAVDTCYWPCFEVINGEWKLSYRPKEKLPIEEFLKSQGRFKHL
FT                   FKPENKHLIEEMQKEVDRRWNELLKKCGEEV"
FT   gene            110277..111863
FT                   /locus_tag="Ilyop_0108"
FT   CDS_pept        110277..111863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0108"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro
FT                   IPR011704:IPR003593; KEGG: aha:AHA_3364 MoxR-related
FT                   protein; PFAM: ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; SPTR: A0KNK2
FT                   MoxR-related protein; PFAM: AAA domain (dynein-related
FT                   subfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81897"
FT                   /db_xref="GOA:E3H6L2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6L2"
FT                   /protein_id="ADO81897.1"
FT                   /translation="MRKRLEKIIDELNISLVERGSHTRLALLTALAGENMILVGPPGTA
FT                   KSEISRRVAEVFDTKYFEYLLTKFTTPEELFGPVSIRELEQDNFRRKTDGYLSDANIVF
FT                   LDEIFKSNSSILNSLLTILNEKIYHNGNLKEKTDIYSIISASNELPTDSGELMALYDRF
FT                   LLRVVVDYVKEPSKLLTLEDRYRGISQDLKLNKETLEEIGKESKKVEVPHHIAMIILNL
FT                   KEKLDEHFKDEIKGKIQEKVSDRKLVKSIKLLKTSAYTNGRDCLNISDTLLLLHCYWNK
FT                   IENRDVIKKYLFEEIIKLTKEDLENYRNISRVWSEEFNGLFKKQRVDENGTPLYYDVDN
FT                   KLVDFSYGDIHVMDKYGDYVHYKGHTEYVKVLAELGNFDYGYIDSGIATDNGKIVWKYE
FT                   CSPVEVVTSAERELEGYERLVVKGNLKPANIESYEEYIKAYTVISANLIPKMEGIRRNI
FT                   EEEIIEIRSVSDYLNKVRQSLKAENLWVVGDDIKELQTLVEKTYEGMNASLLKLEEVTD
FT                   KIDRAKVSSER"
FT   gene            111868..113304
FT                   /locus_tag="Ilyop_0109"
FT   CDS_pept        111868..113304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0109"
FT                   /product="von Willebrand factor type A"
FT                   /note="COGs: COG2425 Uncharacterized protein containing a
FT                   von Willebrand factor type A (vWA) domain; InterPro
FT                   IPR002035; KEGG: bhy:BHWA1_02664 hypothetical protein
FT                   containing a von Willebrand factor type A (vWA) domain;
FT                   SMART: von Willebrand factor type A; SPTR: C0QYN2 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81898"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6L3"
FT                   /protein_id="ADO81898.1"
FT                   /translation="MDIFDKRVKNNFDIMKNIWINYPETRLKRESIAKKWWMALYEGKA
FT                   DQESNGFLEASIEVLSIFKEMTIGNEILCNKLIGDYFAKVKEKYDNDIYSEVIGEEKKI
FT                   IDILNQSEIKRLLQSKEENTEPSFFKEDKYNGYREKKDKYSEMWKDIQGEVTEYFQLEY
FT                   EKMKKMRDILGDSMMDKMGWDLSKVDKKTLFDLEELNRIALEDEKLNYLLKMLGRKKRK
FT                   KNLDLDISEIQKSPNKKDLLGVHLSNDLVRLLPSELSLMHNKHLRRYFHAKYIENRLST
FT                   YLLSDMDEDPNPGERDNQDSEGPIILCIDTSSSMKGLPEKLAKASTLFLLKEAQKKERK
FT                   VYIIAFSGDESLKELELVQSSDGIRRALEFFNWEFYGGTDYLTPLRRSIEIIEKSGYRK
FT                   ADLLMISDGIAEVPDEFIEYIDRVKQSLKFKIYSLIIGSKDVKNTFSDKVLYYEYRKKK
FT                   EAYIGSEYQSLNRSFLSNHG"
FT   gene            complement(113420..114427)
FT                   /locus_tag="Ilyop_0110"
FT   CDS_pept        complement(113420..114427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0110"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR010982:IPR001761; KEGG: hor:Hore_15580
FT                   transcriptional regulator, LacI family; PFAM: periplasmic
FT                   binding protein/LacI transcriptional regulator; regulatory
FT                   protein LacI; SMART: regulatory protein LacI; SPTR: A6D931
FT                   Putative dna-binding sucrose operon transcriptional
FT                   repressor transcription regulator protein; PFAM: Bacterial
FT                   regulatory proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81899"
FT                   /db_xref="GOA:E3H6L4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6L4"
FT                   /protein_id="ADO81899.1"
FT                   /translation="MNIKDIAKLANVSIATVSRAINGTAYVSPKTKEKIDKIIKENGYK
FT                   PNLLAREFVKSKSNTIGVMLPRIDLATFSLAVEGISNFFKDKGFSIILINTQSNLELED
FT                   ELSYFDFLEKKRVAGVIYFATELTDQHIDVLKKVKYPVVFLGQSNKKLNLPCVKYDHFN
FT                   AARSVVKYLIENGHKRIACLSVKYTNYEFAKLRKEGYISALRESNIEIDEEIICDGDWE
FT                   MTSTVENVNEIMKNSKNKPTAFFTVSYRKAMATIHALTEQGYKIPEDFSVVGVDECEES
FT                   KYYSPSITTACFDNYYAGEKAAELMLNIIENKTVEENEILINYKLSVRKSVAKI"
FT   gene            115274..116155
FT                   /locus_tag="Ilyop_0111"
FT   CDS_pept        115274..116155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0111"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="COGs: COG1319 Aerobic-type carbon monoxide
FT                   dehydrogenase middle subunit CoxM/CutM homologs; InterPro
FT                   IPR016166:IPR016169:IPR005107:IPR002346; KEGG:
FT                   nth:Nther_2153 molybdopterin dehydrogenase FAD-binding;
FT                   PFAM: molybdopterin dehydrogenase FAD-binding; SPTR: B2A7L0
FT                   Molybdopterin dehydrogenase FAD-binding; PFAM: FAD binding
FT                   domain in molybdopterin dehydrogenase; CO dehydrogenase
FT                   flavoprotein C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81900"
FT                   /db_xref="GOA:E3H6L5"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6L5"
FT                   /protein_id="ADO81900.1"
FT                   /translation="MIREIEYYAPTHKKELFEIIHNDNRDICLIAGGTDLIININKKHL
FT                   SPDAIVNLKSMEELNYIEEEDGIIKIGATATHNQIANSLLIKEKALALAQACKSVGSTQ
FT                   IRNLGTIGGNIVNASPAADSVAALLALDASVLLESYGDKRKVKISDLHTHTGGIDLNKG
FT                   EVLTEISFKSYSKNIFSYFVKFGLREALAIVELSVTAVMEIDENNFCKDAKISIGAIER
FT                   HPVSAKCVEEEFVGKELNLETIEDCIEKMSEFTAKTLFKTPFKDLIPYKKQCIKGVSRE
FT                   VFEAIYYKAVRK"
FT   gene            116179..116652
FT                   /locus_tag="Ilyop_0112"
FT   CDS_pept        116179..116652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0112"
FT                   /product="purine hydroxylase delta subunit apoprotein"
FT                   /note="COGs: COG2080 Aerobic-type carbon monoxide
FT                   dehydrogenase small subunit CoxS/CutS homologs; InterPro
FT                   IPR001041:IPR012675:IPR002888:IPR006058; KEGG:
FT                   nth:Nther_2152 (2Fe-2S)-binding domain protein; PFAM:
FT                   [2Fe-2S]-binding domain protein; ferredoxin; SPTR: B2A7K9
FT                   (2Fe-2S)-binding domain protein; PFAM: 2Fe-2S iron-sulfur
FT                   cluster binding domain; [2Fe-2S] binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81901"
FT                   /db_xref="GOA:E3H6L6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6L6"
FT                   /protein_id="ADO81901.1"
FT                   /translation="MKKFKMSFSLNHKDVYVEVDPSKRLLDMLREDFGLTGVKEGCGEG
FT                   ECGACTVIMNGDAITSCTVLAPQVEDSRIITIEGISKEGELDEIQEAFIKYGAVQCGFC
FT                   TPGMVLSIKALLMKNSNPSDDDIKEAIEGNLCRCTGYKKIIDATKEVVANSNR"
FT   gene            116668..117924
FT                   /locus_tag="Ilyop_0113"
FT   CDS_pept        116668..117924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0113"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR000674:IPR008274; KEGG: nth:Nther_2151 aldehyde oxidase
FT                   and xanthine dehydrogenase A/b hammerhead; PFAM: aldehyde
FT                   oxidase and xanthine dehydrogenase molybdopterin binding;
FT                   aldehyde oxidase and xanthine dehydrogenase a/b hammerhead;
FT                   SPTR: B2A7K8 Aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; PFAM: Molybdopterin-binding domain of
FT                   aldehyde dehydrogenase; Aldehyde oxidase and xanthine
FT                   dehydrogenase, a/b hammerhead domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81902"
FT                   /db_xref="GOA:E3H6L7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6L7"
FT                   /protein_id="ADO81902.1"
FT                   /translation="MSDFDVIGKNVIKKDAISKVTGKALFSSDYEFENMLYAKVLRSEV
FT                   ASAKIISIDTSKAKELQGVACVLTHKDIPGENRVGIIIKDEPVLVEDKIRRVGDALALV
FT                   AAETIEIAEKALELISVEYEELPVVTDIFEAMKEDSPKVHGDTNILMEKNLIKGDVKEA
FT                   FKKCDVIVENTYKTPAVAHMFIEPEAGVAKFEKGKISFWCSTQNPHFDRGEVARVLALP
FT                   QSKVRGVRSEVGGGFGGKLDISVQCHIGLLTYYTKRPVKLVFSREESMQVSSKRHPHIM
FT                   KVKTGATEDGKLLAMEAVFYADTGAYSSYGPAVVSRAMVHATGPYEIPNVKIKSTMMYT
FT                   NNPMCGAMRGFGVPQVAIAHESQIDMIAEKLNISSFEIRLINAFKYGSKNANNQIMNNS
FT                   IGIMETLEAAKKKADEILK"
FT   gene            117939..118919
FT                   /locus_tag="Ilyop_0114"
FT   CDS_pept        117939..118919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0114"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR008274; KEGG: nth:Nther_2150 aldehyde oxidase and
FT                   xanthine dehydrogenase molybdopterin binding; PFAM:
FT                   aldehyde oxidase and xanthine dehydrogenase molybdopterin
FT                   binding; SPTR: B2A7K7 Aldehyde oxidase and xanthine
FT                   dehydrogenase molybdopterin binding; PFAM:
FT                   Molybdopterin-binding domain of aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81903"
FT                   /db_xref="GOA:E3H6L8"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6L8"
FT                   /protein_id="ADO81903.1"
FT                   /translation="MKKIGIGIGSMFYGIGNTGLPNPAAAFVEVHSDGSATVLAGAADI
FT                   GQGSNTVMCQIVAEVLGIDYESVNITAADTAVTPEAGATSASRQTYVSGNACKIAAEMA
FT                   KETLVRVAGEILCEEPAKIILKNKKAFVKGCEENYITLSDVLKGLKERGLIAVGSGTFN
FT                   PNASSLDPITMEGNPYATYAFATHIAQVEVETETGKVKVLKIIAAHDVGKAINTINVEG
FT                   QIEGGCLMGTGFALSEEVKIENAKMKNPNFSKYLIHTSKDMPEIYPVIVEETDITGPFG
FT                   AKGVGEPTLIPVAPAIINAVYDAIGIRFTELPITPKKVLEALHKI"
FT   sig_peptide     117939..118016
FT                   /locus_tag="Ilyop_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            118943..119989
FT                   /locus_tag="Ilyop_0115"
FT   CDS_pept        118943..119989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0115"
FT                   /product="putative PTS system, EIIC component"
FT                   /note="COGs: COG3641 membrane protein putative toxin
FT                   regulator; KEGG: cdf:CD2256 putative PTS system, EIIC
FT                   component; SPTR: C6JJY3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81904"
FT                   /db_xref="GOA:E3H6L9"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6L9"
FT                   /protein_id="ADO81904.1"
FT                   /translation="MEKTVELKKESFLKRKNIEFSVKRYLIDALSFMALGLFSSLIIGS
FT                   ILNQIGSKFGILFLSETIWPIARQMTGPAIGVAVACGLQAPPLVMFSSAITGAAGAALG
FT                   GPVGAFVAAVAGAEFGKAVSKETKVDILVTPATTIIVGCLLGSLVGPGVSAFMTGFGNL
FT                   IMYATELNPIPMGILVSTLMGIALTLPISSAAIGIMLGLGGIASGAATVGCAAQMVGFA
FT                   VISFRENGVGGLLAQGLGTSMLQVPNIVKNWKIWIPSIMTSAILGPISTTVLKLENTPI
FT                   GSGMGTSGLVGQFGTISAMEAAGRGGATLYITILLFHLVLPAIMTLAIAEYMRKKEWIK
FT                   EGDLKLDL"
FT   gene            120186..121073
FT                   /locus_tag="Ilyop_0116"
FT   CDS_pept        120186..121073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0116"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="COGs: COG2084 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenase;
FT                   InterProIPR016040:IPR013328:IPR008927:IPR002204:IPR
FT                   006115:IPR006183; KEGG: nth:Nther_2161 3-hydroxyisobutyrate
FT                   dehydrogenase; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; SPTR: B2A7L8 3-hydroxyisobutyrate
FT                   dehydrogenase; PFAM: NAD binding domain of
FT                   6-phosphogluconate dehydrogenase; TIGRFAM:
FT                   3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81905"
FT                   /db_xref="GOA:E3H6M0"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6M0"
FT                   /protein_id="ADO81905.1"
FT                   /translation="MKVAFIGLGVMGKNMAINILNNNYQLRIYDVIKENMIELEEMGAG
FT                   VGNSPADAAKGCDVIMTSLPNSKIVEDVILGKNGVLEAAKEGAVIVDLSSITPKVIQNI
FT                   YEKCIEKCIEVIDAPVSGGAKGAKEGTLTIMAGGKIEVLEKVRPILDCIAKKVNYVGEV
FT                   GAGDTVKLINNMLLGINMVACAEAMALGTKAGIKPDLLYEIISQSSGSSYALKAKYENF
FT                   ISQGNFEPGFMIDLQYKDLQLAISTAKELNAPMFMGNIAQQMFETARAEGLGKKDISAV
FT                   INLYEKWLNVSVRK"
FT   gene            121097..122257
FT                   /locus_tag="Ilyop_0117"
FT   CDS_pept        121097..122257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0117"
FT                   /product="enamidase"
FT                   /EC_number="3.5.2.18"
FT                   /note="COGs: COG1228 Imidazolonepropionase and related
FT                   amidohydrolase; InterPro IPR011059:IPR006680; KEGG:
FT                   nth:Nther_2144 amidohydrolase; PFAM: amidohydrolase; SPTR:
FT                   B2A7K1 Amidohydrolase; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81906"
FT                   /db_xref="GOA:E3H6M1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6M1"
FT                   /protein_id="ADO81906.1"
FT                   /translation="MKMLGIKNIGVLITGDVANPIRKATTIIVADGIIKKIGNEDLLTE
FT                   YPCNKIIDANGITVAPGLLDSHVHPVLGDFTPRQNTVGFISSSLHGGVTTMISAGEPHT
FT                   PGRPKDPSGTKALAILGKKSSQNVRPGGVKLHGGSLILEKGLVEKDFEELAKEGVNIVG
FT                   EIGLGSVKDPEEASIMVKWAKKNGFKVMMHTGGTSIPGSSSISADDVIKTNPDVVSHIN
FT                   GGPTAIPLSEVDTLIDETKLTLEVVQCGNFKVMKHVVNKLVEKQDLERLIIGNDSPSGS
FT                   GIIPLGVLRTISYIASETKATPEQAICFATGNSAKAFDLNVGIIEEGKAADFVLMDAPM
FT                   GSVGTDSLKALEAGDLPGIASVIIDGEILVTKSRNTPPATNMPTIS"
FT   gene            122362..123879
FT                   /locus_tag="Ilyop_0118"
FT   CDS_pept        122362..123879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0118"
FT                   /product="6-hydroxynicotinate reductase"
FT                   /EC_number="1.3.7.1"
FT                   /note="InterPro IPR017896:IPR017900:IPR001450; KEGG:
FT                   nth:Nther_2148 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: B2A7K5 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81907"
FT                   /db_xref="GOA:E3H6M2"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6M2"
FT                   /protein_id="ADO81907.1"
FT                   /translation="MIKIDLKKCKGCKICANNCPISAIDMLDKKALIKDNCVSCGICLR
FT                   VCPFAAIEKTTEENNNSMKCTNCPVNCAIPLGMTGACKRYTNIDGNITRSRKLVVDAIT
FT                   TIPEKNNLPYKPVITAVGSGTNYPCCRPAPFIIQENLEGVDVVTVVTEAPLSYSGVKVK
FT                   IDTNMHIGEEGAKVKRDGKVVGMVTTEEYGSKMLTIGGANLLSNGNDGFIVAKTIVDLA
FT                   NGREVQLKIDQGSVIKIKQGESPIIDGKKEKLMRVGCGSATIGMFARNLCKVVDEAIIL
FT                   DYHVIGLLSEHFAGVEVGMKYSGIIPTGTKSTRGRYFGEHGHGWGGTKIDNPLDAVKSI
FT                   DMNTAKPGYKILVTETTGQKSALLEIKEDGDVKEVPLTEEVADVVRLISKTCEEAKVSV
FT                   VYTGGTGGSARAGVTNFPKKLTDAIHREEVHMTVAGAPTFILPGGGINFMVAVEKMVPE
FT                   STTWVPTPATVAPIEYTMTREKYQQLGGHVEEILTKKELLKKLNLEG"
FT   gene            123882..124727
FT                   /locus_tag="Ilyop_0119"
FT   CDS_pept        123882..124727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0119"
FT                   /product="ApbE family lipoprotein"
FT                   /note="COGs: COG2122 conserved hypothetical protein;
FT                   InterPro IPR003374; KEGG: nth:Nther_2147 hypothetical
FT                   protein; PFAM: ApbE family lipoprotein; SPTR: B2A7K4
FT                   Putative uncharacterized protein; PFAM: ApbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81908"
FT                   /db_xref="GOA:E3H6M3"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6M3"
FT                   /protein_id="ADO81908.1"
FT                   /translation="MIQELDDKRVFINYGPIQMTLDIKVGFMRNTEIAFKVADYIIGEL
FT                   QNLLKYMPQLKELNSLQDLNEDYPKVLNKMITGVNRCGDKTINVLGAVAGSFSDIALEK
FT                   AIELGASRVIINNGGDIAFKDMSGDPVKIGIPLNRDLSRNQLVMTITDDMNIRGICTSG
FT                   LGGRSFTKGVATASVVLADNAAVADVCATYLGNMTNVEDERITRCFAEDIDSGTDIPGH
FT                   MVTLSVGNISKEKIYQALLNGANAAEKLYEKGIIKGALLCVKNEIVMIPDNINYIENRN
FT                   "
FT   gene            124744..125331
FT                   /locus_tag="Ilyop_0120"
FT   CDS_pept        124744..125331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0120"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="InterPro IPR009569; KEGG: nth:Nther_2145 protein of
FT                   unknown function DUF1185; PFAM: protein of unknown function
FT                   DUF1185; SPTR: B2A7K2 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF1185)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81909"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6M4"
FT                   /protein_id="ADO81909.1"
FT                   /translation="MDIKIRKFCTFVEEIMIDGEKTIQGKVNKRSSAAVIIKNPFAGKY
FT                   VEDLSQLTEWSVEIAPILTKKALEAAGMEMGEVESYGKAAIVGGNGELEHAASILHPKL
FT                   GKPFRDEVGGGKAIIPSSKKMGYPGCTIDVPLHYKDAAFVRSHFDAMEVRIPDAPRGDE
FT                   IVVILSITNCGRPHPRVGGLKKDEAKCEDGLR"
FT   gene            125371..126297
FT                   /locus_tag="Ilyop_0121"
FT   CDS_pept        125371..126297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0121"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="COGs: COG0679 permease; InterPro IPR004776; KEGG:
FT                   lbr:LVIS_0568 AEC family permease; PFAM: Auxin Efflux
FT                   Carrier; SPTR: C5RQK3 Auxin Efflux Carrier; PFAM: Membrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81910"
FT                   /db_xref="GOA:E3H6M5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6M5"
FT                   /protein_id="ADO81910.1"
FT                   /translation="MSRIISSVILVMLMVGTGCFLTKKEILGEESNKLFSQLVLKICLP
FT                   ALIIQGLTGRFTREGLIKSAQWLGLSFIIIIVLIIASKVIILSKHIKRKALFQISFIFA
FT                   NTIFVGLPVNIALFGDESIPYIFLYYFASTTFFWTYGIYCVQGEGNIREGLKKLLTPTT
FT                   TAFFIGVILLLFKVPIPGFIATYMKYIGGMTTPLAMLYLGTSMYSLGIKSLKPDFESVI
FT                   GLVSKFIIAPAIVFIIIKIADGFLILPLLLKKVYFIQTTMPLMTNVAIVSGYYNKSPKE
FT                   ASKLVGLSTILVIVTIPFYAILTEFIF"
FT   sig_peptide     125371..125454
FT                   /locus_tag="Ilyop_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(126595..126978)
FT                   /locus_tag="Ilyop_0122"
FT   CDS_pept        complement(126595..126978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0122"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="COGs: COG0251 Putative translation initiation
FT                   inhibitor yjgF family; InterPro
FT                   IPR006056:IPR013813:IPR019897:IPR006175; KEGG:
FT                   amt:Amet_2316 putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; SPTR: A6TQK5 Putative
FT                   endoribonuclease L-PSP; TIGRFAM: endoribonuclease L-PSP;
FT                   PFAM: Endoribonuclease L-PSP; TIGRFAM: endoribonuclease
FT                   L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81911"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6M6"
FT                   /protein_id="ADO81911.1"
FT                   /translation="MNKAIFTKNAPAAVGPYSQAMRAGDMIFVSGQIPFVPETMTLVSE
FT                   DIREQTRQSLENVKAILEEAGASLNNVVKAGVFIKDMNEFGAINEVYSEYFTDNKPARA
FT                   CVEVARLPLDVRVEIEVIAYVGK"
FT   gene            complement(127011..129566)
FT                   /locus_tag="Ilyop_0123"
FT   CDS_pept        complement(127011..129566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0123"
FT                   /product="selenium-dependent molybdenum hydroxylase 1"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs;
FT                   InterProIPR017697:IPR001041:IPR012675:IPR000674:IPR
FT                   008274:IPR002888:IPR006058; KEGG: cbt:CLH_0595
FT                   selenium-dependent molybdenum hydroxylase 1; PFAM: aldehyde
FT                   oxidase and xanthine dehydrogenase molybdopterin binding;
FT                   [2Fe-2S]-binding domain protein; ferredoxin; aldehyde
FT                   oxidase and xanthine dehydrogenase a/b hammerhead; SPTR:
FT                   C6JK28 Selenium-dependent molybdenum hydroxylase 1;
FT                   TIGRFAM: selenium-dependent molybdenum hydroxylase 1; PFAM:
FT                   Molybdopterin-binding domain of aldehyde dehydrogenase;
FT                   2Fe-2S iron-sulfur cluster binding domain; Aldehyde oxidase
FT                   and xanthine dehydrogenase, a/b hammerhead domain; [2Fe-2S]
FT                   binding domain; TIGRFAM: selenium-dependent molybdenum
FT                   hydroxylase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81912"
FT                   /db_xref="GOA:E3H716"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017697"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E3H716"
FT                   /protein_id="ADO81912.1"
FT                   /translation="MYEIIVNGKLTKTDKVKNLLKYLRDDLDLKAAKNGCEEGACGTCT
FT                   VLVDGKAIKACVLKTDKLKGKKITTLEGLSQRKRDVFAYAFTEVGAVQCGFCIPGMVMS
FT                   ATALFLKTLEPTKDEIKKSLTGNICRCTGYVKIEEAIELAAEILRTEREIPKRDCKGMV
FT                   GEHVHRIDGPAKAIGEGVYAEDIRIEGMYYGGAVRSLYPRARVLSIDVSEAEAMEGVLK
FT                   VLTAEDVPGINNIGHLSFISDWDALIPVGKITRYRGDAIALVAAKDKETLEAAKKAVKI
FT                   EYEELTPVLSIEGAKDENAPKIHENGNLLFHQKLSKGNVEKAISDSKYVVTEIYNTPAT
FT                   EHAYLEPESATALPTNDGIQLYTSSQSIFDEQREVSRLLGVKPSKVRVTSTLVGGGFGG
FT                   KEDMTVQHHAGLLAYVLQVPVQVTLSRQESIYVSTKRHSMEIEMTTACDENGILTAMKT
FT                   TILSDTGAYSSLGGPVLQRACTHASGPYNYHNIEIDGKAYYTNNPPGGAFRGFGVTQST
FT                   FASESNINKLAKLAGISAWEIRSRNAIRPGQILPNGQIADAGTGLVETLEAVKDEFYKN
FT                   KYVGLACAFKNSGIGVGLPDIGRCRLTVIDGKVHLRTSAACIGQGVGTVNLQILCQTTG
FT                   LDPKNIIIETPDTHVTPDSGTTTASRQTVFTGEAVRLAALELKNTLKGKTLKEIEGYDH
FT                   TEEYSGITDKIGSFKENPKSHIAYGYATQLVVLNESGKIEKVVAAHDVGKAINPKSVEG
FT                   QIEGGVVMGLGYALTEIMPFENGMPQVKFGTLGLLRSTLVPEIKSIIIEKNTEELAYGA
FT                   KGVGEITVIPTAPAVQGAYYNFDGEFRTELPLKKTAYKK"
FT   gene            complement(129585..130961)
FT                   /locus_tag="Ilyop_0124"
FT   CDS_pept        complement(129585..130961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0124"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="COGs: COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolase; InterPro IPR011778:IPR011059:IPR006680;
FT                   KEGG: cbh:CLC_2783 dihydropyrimidinase; PFAM:
FT                   amidohydrolase; SPTR: C6DXN6 Dihydropyrimidinase; TIGRFAM:
FT                   dihydropyrimidinase; PFAM: Amidohydrolase family; TIGRFAM:
FT                   D-hydantoinase; dihydroorotase, multifunctional complex
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81913"
FT                   /db_xref="GOA:E3H717"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3H717"
FT                   /protein_id="ADO81913.1"
FT                   /translation="MKLLLKNGTIVTSDKVFKEDILIENGLISKIGKNLEIDKGEVVDL
FT                   GGKYVMPGGVDVHTHFNLDVGIAVAKDDFYTGTLAAACGGTTTIIDHMGFGPKNCTLHH
FT                   QLNKYKSDAEKDAVIDYGFHGVIQHLNREILEEMESMVKDGVTSFKAYMTYDNKLQDEE
FT                   IKLVMKRLRSLGAMTTIHAEVHEEILELREKYISKGKTDAIYHAKSRPVKTEVEAIKRM
FT                   IKMSKEANDAPLYIVHLSSGDGLDVIKKAKAEGRNVYAETCPQYLFLDDERYLEDQDRG
FT                   LKYVMSPPIREKSNNERLWSGIAEGNIQTVATDHCPFDFKLKKELGSEDFTKCPNGGPG
FT                   VETRIALMFSEGVGKNRISINKFVDVVSTAPAKLFGLYPKKGSISIGADADLMVIDPDK
FT                   QVTIQHENLHENVDYTLYEGMKLKGYPIMTISRGEIIVKNNKFIGQKGRGRYLKRKTIF
FT                   "
FT   gene            complement(130972..132072)
FT                   /locus_tag="Ilyop_0125"
FT   CDS_pept        complement(130972..132072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0125"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="COGs: COG0167 Dihydroorotate dehydrogenase;
FT                   InterProIPR005720:IPR017896:IPR013785:IPR012135:IPR
FT                   017900:IPR001450; KEGG: cbt:CLH_0590 dihydroorotate
FT                   dehydrogenase family protein; PFAM: dihydroorotate oxidase;
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; SPTR:
FT                   C6JK27 Dihydroorotate dehydrogenase; TIGRFAM:
FT                   dihydroorotate dehydrogenase family protein; PFAM:
FT                   Dihydroorotate dehydrogenase; 4Fe-4S binding domain;
FT                   TIGRFAM: dihydroorotate dehydrogenase (subfamily 1) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81914"
FT                   /db_xref="GOA:E3H718"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="UniProtKB/TrEMBL:E3H718"
FT                   /protein_id="ADO81914.1"
FT                   /translation="MANIKVNFAGLEYENPVIVAAGPPSKDAETCVRAVENGAAGVVTK
FT                   TISSVAAEIPKPCMHDFKGKHFLNTELWSEESPEHWVENEYARCKAANEPLIIGLGYVE
FT                   ADIRKLIPMIDKFADAYEISSHYVGRDLTPMLSTLRAAKELSEKPVFMKVSPGIENLSE
FT                   VARELEANGADGLVAINSVGPCLSIDIETGKPHMGSKNGYGWMSGAAIKPIAMRVVYEL
FT                   SSAVEIPVFAVGGISKGEDVIEFIMAGATAVQVCTQAIIEGPKAFGRIVRETEKWLDDH
FT                   GYDSLDDIRGIAGRHLNKRTAPNYVTTPPSVSKEKCIGCGICADLCPYHAIHINENKLA
FT                   VIDADKCFGCGVCVSKCPKDAMTISR"
FT   gene            complement(132130..133458)
FT                   /locus_tag="Ilyop_0126"
FT   CDS_pept        complement(132130..133458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0126"
FT                   /product="selenium metabolism protein SsnA"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro
FT                   IPR017700:IPR011059:IPR006680; KEGG: cbe:Cbei_1978 putative
FT                   chlorohydrolase/aminohydrolase; PFAM: amidohydrolase; SPTR:
FT                   C6JK25 Amidohydrolase; TIGRFAM: selenium metabolism protein
FT                   SsnA; PFAM: Amidohydrolase family; TIGRFAM: putative
FT                   selenium metabolism protein SsnA"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81915"
FT                   /db_xref="GOA:E3H719"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017700"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3H719"
FT                   /protein_id="ADO81915.1"
FT                   /translation="MFVVGNGRLITHDQINPFFHNGAVAVKGNKVVETGKTEEIRAKYT
FT                   EAEFIDAKGQLIMPGMINTHHHIYSAFARGMTSNKPAPKNFMDILENLWWKVDKNLNLE
FT                   EIKYSAFATYIESIKNGVTTVFDHHASPMSVKNSLFTIADAAKKIGIRTCLCYEVSDRD
FT                   GIEILEEGIKENTDFIRHYNLQDQNMIKGMFGMHASFTLSDESLKKCVKAIKGLDVGYH
FT                   IHTAEAIDDLEDSIKKYNKRVVERLNEYGILGEKTIAVHCIHVNEKEMDILKRTGTQVV
FT                   HNPESNMGNAVGCSPALDLLAKGINVGLGTDGYTNDMFESMKVANIIHKHVKADPSVAW
FT                   METPQMLFENNRKIVAEYFDGNIGVLTEGSAADIIIADYNPLTPMNETNYNSHILFGLM
FT                   GRSVNTTIIDGKIIMRDRKILSVDEDMILKKSRETSKQMWDRM"
FT   gene            complement(133468..135057)
FT                   /locus_tag="Ilyop_0127"
FT   CDS_pept        complement(133468..135057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0127"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="COGs: COG3653 N-acyl-D-aspartate/D-glutamate
FT                   deacylase; InterPro IPR011059:IPR006680:IPR012855; KEGG:
FT                   cdl:CDR20291_3038 D-aminoacylase; PFAM: amidohydrolase;
FT                   D-aminoacylase domain protein; PRIAM: N-acyl-D-amino-acid
FT                   deacylase; SPTR: Q181U6 D-aminoacylase; PFAM:
FT                   D-aminoacylase, C-terminal region; Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81916"
FT                   /db_xref="GOA:E3H720"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3H720"
FT                   /protein_id="ADO81916.1"
FT                   /translation="MDILIKNGNIVDGTLKKPFTGDIYIKDGIIQAIGTDIHVEAKKVV
FT                   DARGRLVSPGFIDTHSHSDLIMLLNPYNEVKIRQGVTTEVLGQDGISMAPLPVEYISPW
FT                   RKNLAGLDGDSDEINWEYKTTENYLNMMAEKGVGLNEAYLVPHGNIRMEAMGLSGEIAS
FT                   DEQIEKMCEITRREMEAGAYGLSTGLIYMPCAYSETKEVIEMCKIVAEYDGVFVVHQRS
FT                   EADTILGSMKEIIKIGKESGVKVHFSHFKVCGKQNWKYIDDVIELLEEAKKLGIKISFD
FT                   QYPYAAGSTMLGVILPPWAHNGGTDELIKRLGNKSDREKMKKDIVDGIPGWDNFVDFAG
FT                   IDQIFITSVKNEKNQDVVGMSLEELGKYRKQDPLDATFDLLLDEENAVGMVDFYGKEEH
FT                   VIKFMQRPEQNVCTDGLMSEGKPHPRAYGSFPKILGRYVREQKVLTIEQAINKMTKKAA
FT                   EAMGIKNRGSLEVGRHADILVIDMETVSDRGTYIDPVQFPVGIDNVFINGHHVIDEGIY
FT                   NKVLAGKVIKRS"
FT   gene            complement(135082..136272)
FT                   /locus_tag="Ilyop_0128"
FT   CDS_pept        complement(135082..136272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0128"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR011650:IPR001261:IPR002933;
FT                   KEGG: cdf:CD3183 peptidase; PFAM: peptidase M20; peptidase
FT                   dimerisation domain protein; SPTR: Q181U8 Putative
FT                   amidohydrolase; PFAM: Peptidase family M20/M25/M40;
FT                   Peptidase dimerisation domain; TIGRFAM: putative selenium
FT                   metabolism hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81917"
FT                   /db_xref="GOA:E3H721"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E3H721"
FT                   /protein_id="ADO81917.1"
FT                   /translation="MLSQTREEKLIELCQELIRNPSVSGKEEKVAEATKKAMLEEFGFD
FT                   DVQIDKYGNVIGRIKGNKPGKSILFDGHIDTVPVTDESVWNYDPFGGDIIEGKIYGRGT
FT                   SDMKGQTSAMIAAASYFAEDVNKDFAGEIYVAGVVHEELFEGIAAREISKNIKPDYVVI
FT                   GESSELNLKIGQRGRGEIVVEIFGKPAHSANPEKGINSVVKMAKVIERIEQLVPTEHPE
FT                   LGKGILCLTDIKSEPYPGASVVPEYCRVTFDRRVLVGETKESVLAPIKELLEEMMAEDP
FT                   ELKAKVSYAIGRETCYTGNIIEGERFFPGWLYSEDDDFVQTAYRGLKEAGIDSKITQYS
FT                   FCTNGSHYAGEAGIQTIGFGPSKENLAHTIDEYIEIEQLCLGAKGYYGILKSVYNK"
FT   gene            complement(136303..137508)
FT                   /locus_tag="Ilyop_0129"
FT   CDS_pept        complement(136303..137508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0129"
FT                   /product="diaminopropionate ammonia-lyase"
FT                   /EC_number="4.3.1.15"
FT                   /note="COGs: COG1171 Threonine dehydratase; InterPro
FT                   IPR019871:IPR010081:IPR001926; KEGG: cbe:Cbei_1977
FT                   diaminopropionate ammonia-lyase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   SPTR: A6LUW7 Diaminopropionate ammonia-lyase; TIGRFAM:
FT                   diaminopropionate ammonia-lyase; PFAM: Pyridoxal-phosphate
FT                   dependent enzyme; TIGRFAM: diaminopropionate ammonia-lyase
FT                   family; diaminopropionate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81918"
FT                   /db_xref="GOA:E3H722"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="InterPro:IPR019871"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E3H722"
FT                   /protein_id="ADO81918.1"
FT                   /translation="MEKNIKWTTNNMERTNYKQCIEFLSKEEVGKAKKFHESFDQYTVT
FT                   PLADLNKLAKHIGLDGVYVKDESYRFGLNAFKVLGGSFAMGKYLASKLGKDISELGYKE
FT                   LISDKIKEELGDITFATATDGNHGRGVAWTANKLNQKSVVYMPKGSSLTRLENIRSEGA
FT                   EASITEVNYDEAVRIATDYANENNGVVIQDTAWEGYEEIPAWIMQGYGTMALESIEQLR
FT                   ANEIEKPTHVFLQAGVGSLAGAVQGVFASIYGDECPTTIIVESNLADCLYKSAKAGEMK
FT                   YVGGDMQTIMAGLACGEPNTIGWEVLKNHSAAFVSCPDWVAANGMRILGNPLKGDDQVI
FT                   SGESGAVTTGLLFEVMTNPEYAQMKKDLKLDENSKVLVFSTEGDTDPEVYRDIVWKGAH
FT                   TK"
FT   gene            complement(137567..138913)
FT                   /locus_tag="Ilyop_0130"
FT   CDS_pept        complement(137567..138913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0130"
FT                   /product="xanthine permease"
FT                   /note="COGs: COG2233 Xanthine/uracil permease; InterPro
FT                   IPR006042:IPR017588:IPR006043; KEGG: amt:Amet_0465
FT                   uracil-xanthine permease; PFAM: Xanthine/uracil/vitamin C
FT                   permease; SPTR: A6TKH5 Uracil-xanthine permease; TIGRFAM:
FT                   xanthine permease; uracil-xanthine permease; PFAM: Permease
FT                   family; TIGRFAM: uracil-xanthine permease; xanthine
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81919"
FT                   /db_xref="GOA:E3H723"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:E3H723"
FT                   /protein_id="ADO81919.1"
FT                   /translation="MKNNKNSFIYQLDGKPPLNTAILLGLQHVLAMFVGNVTPIIIISG
FT                   MLKLPIDQKAFLIQSAMLVSGVVSLIQCYPIGPVGARLPIIMGTSFGFLPVCLAIASKY
FT                   GLAGVLGATMIGGIFQVILGFFLKHLRKYFPPLITGIVLVSIGLSLVATGMKYFAGGVG
FT                   APDFGSSANLLLGTTVLLIILILKHFTKGITSMSSVLIALIVGYLIAIPMGKINFTSVA
FT                   NASWFAFPIPLKYGIEFHFDAILSILIMFVISTVETVGNTCGIVSGGLGREATDREVSG
FT                   AVIADGLGSSFAALFNVLPNTSYGQNVGLITMTKIINRFSIATGAVFLLITGLFPKVGA
FT                   IIAVMPASVLGGAAVLMFSMMVVSGINQITEEPLAGRNTTIFAVSIGLGVGFSLVPGAS
FT                   QNFPHLFKMLFEGSGVAVATLVAILLNIVLPKDEVEETVSSEINEESAL"
FT   gene            complement(139674..140516)
FT                   /locus_tag="Ilyop_0131"
FT   CDS_pept        complement(139674..140516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0131"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="COGs: COG1319 Aerobic-type carbon monoxide
FT                   dehydrogenase middle subunit CoxM/CutM homologs; InterPro
FT                   IPR016166:IPR016169:IPR005107:IPR002346; KEGG:
FT                   swo:Swol_1137 dehydrogenase; PFAM: molybdopterin
FT                   dehydrogenase FAD-binding; SPTR: C6DXN3 Molybdopterin
FT                   dehydrogenase, FAD-binding; PFAM: FAD binding domain in
FT                   molybdopterin dehydrogenase; CO dehydrogenase flavoprotein
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81920"
FT                   /db_xref="GOA:E3H724"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:E3H724"
FT                   /protein_id="ADO81920.1"
FT                   /translation="MVENYIPKSLDEALEIVSKKDCLLFAGGSDLMIKNKSWTGDLCIN
FT                   KSTVFIGNVPELKKISIEENTLYIGACATCDEIMESDIVPEYIKDVMATMASPAIRNTA
FT                   TIGGNICNSSPVADSLPLLYACESSLVLEKKDSRRLVDIDDFITSPGRNIIKSDEILTK
FT                   IILPLNNFNNILFKKVGTRNSIALAKLSFMGMADIDENNNEIKDIRLSFGAVAPTIVKD
FT                   KDIEQEIVSYKKLNEEKISIIINKYSSLIVPITDQRSDKEYRKQVALRLLESFLKKLS"
FT   gene            complement(140510..140980)
FT                   /locus_tag="Ilyop_0132"
FT   CDS_pept        complement(140510..140980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0132"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="COGs: COG2080 Aerobic-type carbon monoxide
FT                   dehydrogenase small subunit CoxS/CutS homologs; InterPro
FT                   IPR001041:IPR012675:IPR002888:IPR006058; KEGG:
FT                   ppd:Ppro_1445 2Fe-2S iron-sulfur cluster binding
FT                   domain-containing protein; PFAM: [2Fe-2S]-binding domain
FT                   protein; ferredoxin; SPTR: C6DXN2 Xanthine dehydrogenase, E
FT                   subunit; PFAM: 2Fe-2S iron-sulfur cluster binding domain;
FT                   [2Fe-2S] binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81921"
FT                   /db_xref="GOA:E3H725"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E3H725"
FT                   /protein_id="ADO81921.1"
FT                   /translation="MKINFTLNYKEIEIEINPLMRTLDLLRKEFGLFATKEGCGDGECG
FT                   ACAIILDDKIVNSCMVPVANIHGKEIVTIEGLEKTERYSILKKSFEDAGAVQCGFCIPG
FT                   MMMAAEALFRRHKTPTLEQIKEGISGNLCRCTGYNMIIEAIELAAERGKEIW"
FT   gene            complement(140996..143131)
FT                   /locus_tag="Ilyop_0133"
FT   CDS_pept        complement(140996..143131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0133"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR000674:IPR008274; KEGG: swo:Swol_1135 hypothetical
FT                   protein; PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; SPTR: C6DXN1 Putative
FT                   xanthine dehydrogenase, molybdenum-binding subunit; PFAM:
FT                   Molybdopterin-binding domain of aldehyde dehydrogenase;
FT                   Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81922"
FT                   /db_xref="GOA:E3H726"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E3H726"
FT                   /protein_id="ADO81922.1"
FT                   /translation="MDISKKIIRVDAEDKLLGKSKYIGDIEFENMLFAKTVRSDRVRAK
FT                   IKSIKYPKLPKGYFIVDKNDVPGLNKVKAIENDQPFFADGVVNYIGEPIALVIGESKYK
FT                   ILDLISQIEIEYEDLEAIYTIEDGLKTSNPIFGVDNCFADYHYSKNSLEEVKSKAKYVI
FT                   SGEYKTGYQEQMYLEPQGVVGIYKNGKVEVHGSMQCPYYIKGAVEQCMGFDPENVRIVQ
FT                   TTTGGAFGGKEDYPSLIAGHVAVAAYKAKQPVQLIFSREEDVEVTPKRHPSIIHLTSYI
FT                   DQNHKIMGMEADIKLEGGAYLTLSAIVLQRSMFAAIGVYNVENVFVRGQAIATNTVPSG
FT                   AFRGFGAPQSIFALETHMEKCAKEMGVDALDFKLKNLMKQNDRSSTNGIMRDPIILPEM
FT                   VERTDELSKFRKKKAEFSKYNKTNPEKLKGIGMSIFFHGGGFTGSGEQDHIKAKIKLHK
FT                   SSEGKINLLLANVEMGQGVHTTMKKIAAKTLDLPIESIAYNNPDTDYTMDSGPTAASRT
FT                   IMVVGKLVQEACEELKANWIDDKEQTIITNYRQPKGFNWDDKNFIGDVYNSYSWGVNVV
FT                   EVSVDPITFQVDVDHIWAIYDIGKAIDEMVVRGQIEGGIIQGLGYGGLEVMEVKKGKIQ
FT                   QKSITDYIISTSKDVPKITSELMNVPYIHGPYGAKGLGELTLIGTAPAYSLAVSNALDM
FT                   EINKIPIKPEELIKLVK"
FT   gene            complement(143299..144225)
FT                   /locus_tag="Ilyop_0134"
FT   CDS_pept        complement(143299..144225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0134"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1079 ABC-type transport system permease
FT                   component; InterPro IPR001851; KEGG: hmo:HM1_2691 branched
FT                   chain amino acid abc transporter, permease protein; PFAM:
FT                   inner-membrane translocator; SPTR: B0TBU7 Branched chain
FT                   amino acid abc transporter, permease protein; PFAM:
FT                   Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81923"
FT                   /db_xref="GOA:E3H727"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3H727"
FT                   /protein_id="ADO81923.1"
FT                   /translation="MVVEFIVGIISAGIMLCIPYMIAGLGEMFGQKSGVFNLGVEGIMM
FT                   VGAFFAFFTELKTGSSFLGFIMAMIAGGLMGAIYAYLAVTLRVVQGIAGIGLHLFGWGL
FT                   ASTFFRIYLGAITTIDGVQALNVPFLSKLPILGDLFFKHNIMVYIGFALVPISWYALNK
FT                   TAWGLKVRAVGTKPRAADTVGINVNAIRYQCVILGGIMAGLGGAYITLCQTQIFTDNIT
FT                   AGRGFIAVALVYFGKWKPKGVMFGALLFSLAHALQRSLQVYGIDFPYELAVMIPYVLVI
FT                   VVLAFSSKSKHVKPADLGIPYNRESRL"
FT   sig_peptide     complement(144157..144225)
FT                   /locus_tag="Ilyop_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(144226..145380)
FT                   /locus_tag="Ilyop_0135"
FT   CDS_pept        complement(144226..145380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0135"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4603 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR001851; KEGG:
FT                   drm:Dred_2767 inner-membrane translocator; PFAM:
FT                   inner-membrane translocator; SPTR: A4J868 Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81924"
FT                   /db_xref="GOA:E3H728"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3H728"
FT                   /protein_id="ADO81924.1"
FT                   /translation="MENKNIKNKHYIDTCYKLGIVVTAIFIALFLGGILFLMAGANPFE
FT                   AYAVMFTKPLGNKFGITEMLVRAAPLMFVGVGISVAFRSGILNIGGEGQIMMGAAAGIA
FT                   FTLIFKDLPRSVLIPSAFIASFIGGALWAGIAGYMKAYLQVNEILSTVMLNYIAAQIYV
FT                   FLIRGPLIDPKEIASGTGIAQTELLTKTAWLGKLIKGTRLHTGIIIAIVLSVLIYIMLW
FT                   KTTLGYKLRAVGAEAKAANYAGMNVKLYLVMAIMISGGFCGMAGAVEALGVHHRGLEGL
FT                   SAGYGFSGIVVALFGGLHPLGIIPASALFGLLILGADMMQRAVEVPSAIVLAIQGLIIL
FT                   AIVSTRIFLTDKKIKEKILKKIFFQKKDKIENNTKTDTLETEEV"
FT   sig_peptide     complement(145258..145380)
FT                   /locus_tag="Ilyop_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(145463..146980)
FT                   /locus_tag="Ilyop_0136"
FT   CDS_pept        complement(145463..146980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0136"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3845 ABC-type uncharacterized transport
FT                   systems ATPase components; InterPro
FT                   IPR003439:IPR017871:IPR003593; KEGG: hor:Hore_08780 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: B8CWG5 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81925"
FT                   /db_xref="GOA:E3H729"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3H729"
FT                   /protein_id="ADO81925.1"
FT                   /translation="MRESIKQLEMKNITKRFPGVLACDNVSIELKQGEILALLGENGAG
FT                   KTTLMNILYGLYHQDEGVVRINDKEVKINSPKAAFKLGIGMVHQHFMLVPNLTVLENIA
FT                   LGIRNTNTIKLDLEEIREKIKEITNKYDLSVNPDAFIWQLSVGEQQRVELVKTLCLGAN
FT                   LLILDEPTAALTPQETDELLILLRKMAEEGCSIIFISHKLNEVKSVTHKVAVLRNGKLV
FT                   YNGATDDHSQEELAAKMAGHDIHIHVSEEKENFGKAVLELKDVWAKGDRGTFALNGVSL
FT                   TIREGEIVGIAGVSGNGQKELAEVINGIRKVKNGNIIFKDEDITNLSAKKIIKKHMGYI
FT                   PEDRNHEGIIPSFSIKENLIMKDYFKDSFSKFSFLNRKRIIGNAKRLVEKFNIKCPDID
FT                   TACGTLSGGNIQKVIFAREITRDPKMLVAAYPIRGLDIGAAEYVHNQLLEARDRNMAIM
FT                   VISEELDELINICDKIAVIYEGKILDVLSKKDVTKSKLGLLMAGVSS"
FT   gene            complement(147005..147484)
FT                   /locus_tag="Ilyop_0137"
FT   CDS_pept        complement(147005..147484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0137"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="COGs: COG0590 Cytosine/adenosine deaminase; InterPro
FT                   IPR016193:IPR002125; KEGG: pjd:Pjdr2_1200 CMP/dCMP
FT                   deaminase zinc-binding; PFAM: CMP/dCMP deaminase
FT                   zinc-binding; SPTR: A7B6T8 Putative uncharacterized
FT                   protein; PFAM: Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81926"
FT                   /db_xref="GOA:E3H730"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E3H730"
FT                   /protein_id="ADO81926.1"
FT                   /translation="MDHEKYLRRCIEISEESVASGNNPFGALLVDKEGNILIESGNIEV
FT                   TEKDITGHAETTVAKLAGKKYSKEFLWETTLYTTAEPCCMCTGAIYWANIGNVVYGISE
FT                   KKLLELTGSNEKNPTFDVPCREIIAKGQKNIKVTGPIASPELEQAIVKPHMGFWD"
FT   gene            complement(147554..148570)
FT                   /locus_tag="Ilyop_0138"
FT   CDS_pept        complement(147554..148570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0138"
FT                   /product="basic membrane lipoprotein"
FT                   /note="COGs: COG1744 Uncharacterized ABC-type transport
FT                   system periplasmic component/surface lipoprotein; InterPro
FT                   IPR003760; KEGG: drm:Dred_2769 basic membrane lipoprotein;
FT                   PFAM: basic membrane lipoprotein; SPTR: A4J870 Basic
FT                   membrane lipoprotein; PFAM: Basic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81927"
FT                   /db_xref="GOA:E3H731"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:E3H731"
FT                   /protein_id="ADO81927.1"
FT                   /translation="MKRMKFLSKFIMGLLMFVSVFTFFGCGKKAEESSSEAIKIALILP
FT                   STIDDMAWSQAMYEGAKAVQEKLGEDKVELKFSERLGNPIEAGVALREYASEDYDIVIA
FT                   HGAQYESVISEVAADFPEVSFAYGGYGVKADNVFGYDVDAHEGSFLLGMLAGLKTKTNI
FT                   IGIVGPVAAGESIKYNSGFIQGVKYVNPEADVRIAYTGSFGDTVAAGEIARTHVNAGAD
FT                   ILTGTSQQSVGAIKVVSQYDGIYWFGNNIDQTVLAPNSILACELYIFEGLISQFVEKRA
FT                   AGVKGGEGFHMTLENKMLDLTFNDELKDIFTGEELEKINVAMDEIKTGSRKVEAIVK"
FT   sig_peptide     complement(148472..148570)
FT                   /locus_tag="Ilyop_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(149214..149855)
FT                   /locus_tag="Ilyop_0139"
FT   CDS_pept        complement(149214..149855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0139"
FT                   /product="YheO domain protein"
FT                   /note="COGs: COG2964 conserved hypothetical protein;
FT                   InterPro IPR013559; KEGG: dsy:DSY4780 hypothetical protein;
FT                   PFAM: YheO domain protein; SPTR: Q24N23 Putative
FT                   uncharacterized protein; PFAM: YheO-like PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81928"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:E3H732"
FT                   /protein_id="ADO81928.1"
FT                   /translation="MNTRLKPYIQIVEFLGKVLGKNFEIILHDLENLDGSIIASANSTR
FT                   KIGDSFWGPISSISDRISNNQLDFEQDYIINYDGFSKAGKPVKFSTFFIKDENNKTIGL
FT                   LGINADYSDLEIIKEKVDSLLNFDMMGKSENKDLDSIEIIASNIIDNTINEFKDKNPEM
FT                   SLDRKLKLIEDFNRKGVFLVKGTVQKIAKLLDISEPSIYRYLSKIKDTSE"
FT   gene            complement(150240..151625)
FT                   /locus_tag="Ilyop_0140"
FT   CDS_pept        complement(150240..151625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0140"
FT                   /product="short chain fatty acid transporter"
FT                   /note="COGs: COG2031 Short chain fatty acids transporter;
FT                   InterPro IPR006160; KEGG: tle:Tlet_1558 short chain fatty
FT                   acid transporter; PFAM: short chain fatty acid transporter;
FT                   SPTR: A8F7H9 Short chain fatty acid transporter; PFAM:
FT                   Short chain fatty acid transporter; TIGRFAM: conserved
FT                   hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81929"
FT                   /db_xref="GOA:E3H733"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:E3H733"
FT                   /protein_id="ADO81929.1"
FT                   /translation="MSNNTQEISLSSDKGSFLWRFSKKFQFAADKVIPDSFVFCVILTL
FT                   VIFVFGMVAGSSPIDLINGWYGKIWAMNGFAFQMSLMVIVCGAAAKSPQISAGLEKISK
FT                   IAKTRNMAIVMLLIFGLASSVINWSFSLILTPIFARQLSKNVKGLHFPLLIAAGYSTML
FT                   LGQSWCPSASAYALLAGKDHFLVDQLGVMPQSMTTYNPINTILFFIIAAVTIGIVILTK
FT                   APADEVVSFEGDLDAAVAEEKTVESEMTPADKMNNNKFIMFLLGIAGLIVIATSIFSKG
FT                   FLNSLNFNFVIFMFLVLNVFLYKTPTKFTGAFSDSIKSAAPVMIQFPFYSGIMGLMAVS
FT                   GLATIVANAMISIATPNTMPLFAYLSASVVNLFVPSQGGQWIIQGPILVEAGKSVGAHM
FT                   PTIVNAFILGDEATNLIQPLYVIPALSLVGMKLKSVWGFMAFIWFVWAIVTSVGLLILP
FT                   SIL"
FT   sig_peptide     complement(151542..151625)
FT                   /locus_tag="Ilyop_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(151726..152670)
FT                   /locus_tag="Ilyop_0141"
FT   CDS_pept        complement(151726..152670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0141"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="COGs: COG1250 3-hydroxyacyl-CoA dehydrogenase;
FT                   InterProIPR016040:IPR013328:IPR008927:IPR006176:IPR 006108;
FT                   KEGG: bbe:BBR47_11730 putative 3-hydroxybutyryl-CoA
FT                   dehydrogenase; PFAM: 3-hydroxyacyl-CoA dehydrogenase
FT                   NAD-binding; 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; SPTR: C6JMJ3 3-hydroxyacyl-CoA dehydrogenase;
FT                   PFAM: 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81930"
FT                   /db_xref="GOA:E3H734"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3H734"
FT                   /protein_id="ADO81930.1"
FT                   /translation="MKNITVVGAGTMGHGIAEAFAIHGYNVNLFDLSAEALTKAIAAIR
FT                   EELLILASEKVIKSDEIDEIIGRITLCEDLESAAKEADYIIESVLERLDIKKELFKKLD
FT                   KLAPAEAIFASNTSSLKLSDMVSEASEKRKKNCIINHWYNPPHIMPIAELTFFGDTSQE
FT                   TYDKVEKLYKSIGKQIVKVLKEVDGLVANRIQQAVAREVFSLIEMEVAEPADIDRALKF
FT                   GPAFRYCSTGQLEIADFGGLDIWKIVGDNLLAVMDNTQKANPLLEKKVEEGKLGLKSGE
FT                   GFYKYEGTEAAKTAKEAYTIKLLKQLKVSKDYI"
FT   gene            complement(152670..153494)
FT                   /locus_tag="Ilyop_0142"
FT   CDS_pept        complement(152670..153494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0142"
FT                   /product="3-keto-5-aminohexanoate cleavage enzyme"
FT                   /note="COGs: COG3246 conserved hypothetical protein;
FT                   InterPro IPR008567; KEGG: aoe:Clos_2443 hypothetical
FT                   protein; PFAM: protein of unknown function DUF849; SPTR:
FT                   A8MJJ3 Putative uncharacterized protein; PFAM: Prokaryotic
FT                   protein of unknown function (DUF849)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81931"
FT                   /db_xref="GOA:E3H735"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3H735"
FT                   /protein_id="ADO81931.1"
FT                   /translation="MKTIITVATTGAWPTKKDNPNVPLTPQEIANDVYDCYKAGAAVAH
FT                   LHMRDEEGKGTMDKEKFKETAALIKEKCDIIINMTTSGDLNATDETRQAHLKELRPDMA
FT                   SYDCGSMNWGHSGLFINSPQFLEELGTTMQECNVKPEIEIFDAGMVYNSLYYLKKGILK
FT                   APIHYQFVLGAAGGSTATVENLVYLKSLIPEGSTWSALGIGKGHLPILLTSLAMGGHVR
FT                   VGLEDNVMYSKNELAKSNRQLVERAARIVEEFGNKVATPDEAREILGLKKEA"
FT   gene            complement(153993..154934)
FT                   /locus_tag="Ilyop_0143"
FT   CDS_pept        complement(153993..154934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0143"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR011991:IPR005119; KEGG: amt:Amet_3215 LysR
FT                   family transcriptional regulator; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR: C0CZZ7
FT                   Putative uncharacterized protein; PFAM: Bacterial
FT                   regulatory helix-turn-helix protein, lysR family; LysR
FT                   substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81932"
FT                   /db_xref="GOA:E3H736"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3H736"
FT                   /protein_id="ADO81932.1"
FT                   /translation="MELKELNYVTEINECGSISKAAKKLSMAQSSLSHFLKNYEKQIGY
FT                   EIFIRSNGGLRPTYEGELYLKAADSILNIKKKLSNEIADVSNLKRGKVIFSISSPKAPY
FT                   LLPQVLPKFKEKYENIDVEIIEADIAYQESLLLHEKVDVALVSLPLANSKLKYDLIFKE
FT                   EVLLCAHKSFGLNKIAKTAGKTGKPWIDLDEVKDLPFLTFNVSSLIMSEFFDKVKKEYR
FT                   ENLRISNTKNSFNTVLSLVKVGVGTTLMPELYTYKNKDLEYYSIGPEGLYRSLALAYPA
FT                   SGYVSKATKIFSKIIMTSMREENIESRNNYEK"
FT   gene            155253..157844
FT                   /locus_tag="Ilyop_0144"
FT   CDS_pept        155253..157844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0144"
FT                   /product="exporter of the RND superfamily protein"
FT                   /note="COGs: COG1033 exporter of the RND superfamily
FT                   protein; InterPro IPR000731; KEGG: cts:Ctha_0153 exporter
FT                   of the RND superfamily protein-like protein; SPTR: B3QSY1
FT                   Exporter of the RND superfamily protein-like protein; PFAM:
FT                   Sterol-sensing domain of SREBP cleavage-activation; MMPL
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81933"
FT                   /db_xref="GOA:E3H737"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E3H737"
FT                   /protein_id="ADO81933.1"
FT                   /translation="MLVKIGKFVQKFHKIILSVSLAVTFIMLFFMSQLQMNMQFTDLLP
FT                   KTEKTVISYKNAMKNFDTLDSIVVAVKGREEDIKNFLEKGARDIEKIDGVKTVSYENQV
FT                   NFMEKNIFLLMKEKDLKNREDALTAANLKDFFYGVNEGFEKEYIQESQSGKIDKDRIKI
FT                   LNFLNFLEEIILKIKKNKISPEDGKRFVRGERYIVSPDKSMGLLVVKSAVSIDDFENVI
FT                   KTVNSLEEYFQKESKKYNVEIEMTGLQVLSRDEMVISQRDMEISSLLSLMLVLGIFIFS
FT                   FKIIRYSLLALVPLITGIIWTMGLTYLIIGTLNMMTAMMGAILIGLGIDYSIHIISVFL
FT                   QERNKGMNIENSVSAIYSKVMRGVTTGAGTTAVGFFMFVFSDFPGFREFGLVLGLGIIC
FT                   TLISSVFLLPSLLIIFGRKTGIKKPKNSQLLEKSQYFLIGRKKSSFIIIILILIVIGSK
FT                   AGKVEFENDMLKIEPKNLQSVALNREIIDKFDFSSDSTIIVSENLEKAQKIYDKADKLK
FT                   SIGVISSVVSYLPSEEKQIKRIEAGKKIKEKTGIVPENEIYAEELTEELVRLENNLIEL
FT                   GDLSYIGGEEDIRQKCDKILEEGIISELAENMDIYKKNLEESQKIFIGELQSIIRKSNT
FT                   EKIINLKDLPDKIKDEFVGKNKTYISTFYPKEDIWKSDFQKIYMKEIDTLGENTTGSVK
FT                   IFLKVIEISATEGRKILILTLAAIYFVLVADFRSLKYATAAILPMTFSVFGTLGIMGWT
FT                   GFKFDMVNIIGIPLIIGIGVDDGVHIIHRYLVDKNLFVALKSTGKSVTLTTITTVAAFG
FT                   TLMLARYRGFVHFGILLTIGVLFAYLLTMSLLVSLISILDRIEKKSEGDKL"
FT   sig_peptide     155253..155360
FT                   /locus_tag="Ilyop_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            157841..158563
FT                   /locus_tag="Ilyop_0145"
FT   CDS_pept        157841..158563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tme:Tmel_1019 hypothetical protein; SPTR:
FT                   A6LLS9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81934"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:E3H738"
FT                   /protein_id="ADO81934.1"
FT                   /translation="MKKISVIFFMLINICAFSKDASEILKKMEDAQNYTTSKGEYLMVI
FT                   ENKGKKITLGFEGYHKKSQEDLQLMRFTFPPRIEDTAILIKDENIWYYNKRSNRVRLLS
FT                   KNAKKGSMMGSSFSYDDLNIDYVDDFTGEIIEETENYYMLKVYPVDKDRSYKYILAKVR
FT                   KDNYIEESLEYYDDNEIKYKFMTTQDVKLVKKRWVPLKLTMTDLISGKVTYIETEEKSL
FT                   DFDFFIEDSKFSEKNLKK"
FT   sig_peptide     157841..157939
FT                   /locus_tag="Ilyop_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            158576..159613
FT                   /locus_tag="Ilyop_0146"
FT   CDS_pept        158576..159613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpf:Rpic12D_5304 hypothetical protein; SPTR:
FT                   A0YA60 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81935"
FT                   /db_xref="UniProtKB/TrEMBL:E3H739"
FT                   /protein_id="ADO81935.1"
FT                   /translation="MKVFGFVLIFLSITYTVFSMELVTELKYQGFDTEKIDFDDEALGR
FT                   VTLKDNSNENYSFFIEYVFGDGTDRVDAGQIKIMKNNMDFEIGRNRIGWGSGYNLNPTD
FT                   IFNDIPVGSAYDPTYVKNGRDSIIGTYYTENSSIQGIYAIKDDSEKDEDYGIKYKTSFS
FT                   EYDLDAVYIHKGNRSAVWGEEEKDDIIGGDISTSIPDLNYGVWIEAAYYLDKRDLVYII
FT                   GIDNYFGEKYRVMFEYLYYGLGEDKKGNYNVSRILAGFPEGKSYLMPSITYEYSEKISV
FT                   TGYCYINTEDSSYLLGTTISYLYTDHIDINLMPFYADGKTGSEYGVLGESFGNIGVSFV
FT                   MRVVF"
FT   sig_peptide     158576..158632
FT                   /locus_tag="Ilyop_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            160240..160938
FT                   /locus_tag="Ilyop_0147"
FT   CDS_pept        160240..160938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0147"
FT                   /product="Mn2+dependent serine/threonine protein kinase"
FT                   /note="InterPro IPR011009:IPR009330; KEGG: fnu:FN0545
FT                   lipopolysaccharide core biosynthesis protein RfaY; PFAM:
FT                   lipopolysaccharide core biosynthesis protein; SPTR: C6JLQ5
FT                   Lipopolysaccharide core biosynthesis protein rfaY; PFAM:
FT                   Lipopolysaccharide core biosynthesis protein (WaaY)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81936"
FT                   /db_xref="GOA:E3H740"
FT                   /db_xref="InterPro:IPR009330"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E3H740"
FT                   /protein_id="ADO81936.1"
FT                   /translation="MDKIKKGKVSIYLQDDKYRGLAEVILQGDYKVIKVLKNDQRSRVK
FT                   LIEYEQEKLVLKIPLEKNRRRWQRFLSAFRGSSSKREYENCLKILSEGFLGAKPVLVID
FT                   KKIGPFVKESCFVSNFIEGQEGNFQHLKEIGEELNKIHNAGYLHGDSQLVNFMVSNEEI
FT                   YLIDCKLQKNIFGKFGSRYEFIYLEESCPKKIDIYRKDDLYYRGAKLLNSYLHWWGRTR
FT                   KKLKGKELTK"
FT   gene            160957..161949
FT                   /locus_tag="Ilyop_0148"
FT   CDS_pept        160957..161949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0148"
FT                   /product="glycosyl transferase family 9"
FT                   /note="COGs: COG0859 ADP-heptose:LPS heptosyltransferase;
FT                   InterPro IPR002201; KEGG: fnu:FN0546 lipopolysaccharide
FT                   core biosynthesis protein RfaQ; PFAM: glycosyl transferase
FT                   family 9; SPTR: C6JLQ6 Lipopolysaccharide core biosynthesis
FT                   protein rfaq; PFAM: Glycosyltransferase family 9
FT                   (heptosyltransferase); TIGRFAM: lipopolysaccharide
FT                   heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81937"
FT                   /db_xref="GOA:E3H741"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:E3H741"
FT                   /protein_id="ADO81937.1"
FT                   /translation="MRVLVIRLSSIGDIILTTPVLKEFKKKYPDAVVDFMVLDKFKDSI
FT                   EGCPYVDNLIIFNKKEHRGIKGLKKFSDSIKDNGYDYVFDLHSKLRSVAISIFIGTKTL
FT                   RYRKRALWKTLLVKARLIKYSADDTIVKNYFGALKKLGVEYKGEDLNFTFSEKDIKAVS
FT                   EYKDFVVFAPGASKNTKKWTTEGFGNLARLLREKYGKKIALIGGAGDKEICEEINSISH
FT                   ESCVNLAGKLSLKESGALLSESDFLVTNDSGPFHISRGVKKKAFVIFGPTDPKMFEYDQ
FT                   YGVLVYRDEPCSPCSLHGDKICPKKHFNCMKNLKAEDVLKIIEKNMGWC"
FT   gene            162287..163348
FT                   /locus_tag="Ilyop_0149"
FT   CDS_pept        162287..163348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0149"
FT                   /product="recA protein"
FT                   /note="COGs: COG0468 RecA/RadA recombinase;
FT                   InterProIPR013765:IPR020588:IPR020587:IPR020584:IPR
FT                   003593:IPR001553; KEGG: lba:Lebu_1700 RecA protein; PFAM:
FT                   RecA domain protein; SMART: AAA ATPase; SPTR: C6JLQ7
FT                   Protein recA; TIGRFAM: recA protein; PFAM: recA bacterial
FT                   DNA recombination protein; TIGRFAM: protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81938"
FT                   /db_xref="GOA:E3H742"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3H742"
FT                   /protein_id="ADO81938.1"
FT                   /translation="MAKAKKEIADKDKALEVAMKQIQKDFGEGSIMKLGANTHMNVETI
FT                   STGSIGIDMALGLGGVPRGRVVEIYGAESCGKTTVALHIVAEAQKKGGIAAFIDAEHAL
FT                   DPAYARALGVDVDELLISQPDNGEQALEIGDMLVRSGAVDVIVVDSVAALVPKSEIEGE
FT                   MGDQQMGLQARLMSKALRKLTGSLNKSKTTMIFINQIREKIGGFGFGPQTTTTGGRALK
FT                   FYSSVRMEIKRIGSVKQGDNVIGNETSIKITKNKIAPPFKEAKFQIMYGKGISRAGEIL
FT                   DMAIDNDIVSKSGAWFSYGDIRLGQGKENVKLRLEEEKDLLGQIESDLNKILFPEAEVS
FT                   EKAENEDTESKEK"
FT   gene            163305..163871
FT                   /locus_tag="Ilyop_0150"
FT   CDS_pept        163305..163871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0150"
FT                   /product="regulatory protein RecX"
FT                   /note="COGs: COG2137 conserved hypothetical protein;
FT                   InterPro IPR003783; KEGG: lba:Lebu_1699 regulatory protein
FT                   RecX; PFAM: regulatory protein RecX; SPTR: C6JLQ8
FT                   Regulatory protein recX; PFAM: RecX family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81939"
FT                   /db_xref="GOA:E3H743"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3H743"
FT                   /protein_id="ADO81939.1"
FT                   /translation="MKRQKMKILNLKRNKLYLEDNEIIDVSPDIIYEMKLSGKEELSIE
FT                   EYKRVVYLAALSKSYYLLSRRDHTSKELEKKLRMKFREKEIIKIVISVIEEKGYIDDYS
FT                   YAKSFIEKSKEGRKKIEYDLRLRGINSEIIREAFEEEGNKEVPKIKRLLHKISGKPYDK
FT                   KINYLLRKGFDYENIKRALNNEDEE"
FT   gene            163935..164666
FT                   /locus_tag="Ilyop_0151"
FT   CDS_pept        163935..164666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0151"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR004552:IPR002123; KEGG:
FT                   lba:Lebu_1698 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase; SPTR: C6JLQ9
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; TIGRFAM:
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; PFAM:
FT                   Acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81940"
FT                   /db_xref="GOA:E3H744"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:E3H744"
FT                   /protein_id="ADO81940.1"
FT                   /translation="MLGLVLALVSGLSFFIYMTLFYLPIIVFSGEEKSARLARREFKKF
FT                   GTWVLGSIGAKLEVIYEDKEAIENLKADDGIVVVGNHQSNMDIPVLLAGFPFVVGYVAK
FT                   KEMEKWPFFGVWMKKSHCVFLDRSNPREGIKSIKKAVEIIKAGYPIAIFPEGERSQTGE
FT                   IGEFKKGSFRLATETKGIIVPVTIKGTYEIQKRGSVKTKMGKNVKLIISKPIYVKDMET
FT                   AEIKKLDKIVRDIVVENFEKF"
FT   sig_peptide     163935..164021
FT                   /locus_tag="Ilyop_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            165181..167412
FT                   /locus_tag="Ilyop_0152"
FT   CDS_pept        165181..167412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0152"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="COGs: COG1882 Pyruvate-formate lyase;
FT                   InterProIPR005949:IPR001150:IPR010916:IPR019777:IPR 004184;
FT                   KEGG: pdi:BDI_3392 formate acetyltransferase; PFAM:
FT                   pyruvate formate-lyase PFL; formate C-acetyltransferase
FT                   glycine radical; PRIAM: Formate C-acetyltransferase; SPTR:
FT                   C6JLR0 Formate acetyltransferase; TIGRFAM: formate
FT                   acetyltransferase; PFAM: Glycine radical; Pyruvate formate
FT                   lyase; TIGRFAM: formate acetyltransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81941"
FT                   /db_xref="GOA:E3H745"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:E3H745"
FT                   /protein_id="ADO81941.1"
FT                   /translation="MFEQWQGFKGDLWKKEINVRDFIQNNYTPYTGDESFLVEPTDATK
FT                   KLWNKLSEMFKVEQEKGVYDAETKVPSALDAYGPGYIDKDLEKIVGVQTDAPLKRGIFP
FT                   KGGVRLVEQALDAYGYELDAFTKEIFTKYRKHHNQGVFDVYTPEIKAARSNGLVTGLPD
FT                   AYGRGRIIGDYRRIAIYGLDKLIEDKKSQLDLLDVDTMTDDIIRRREEVSEQVRALQAF
FT                   GKMCASYGFDISKPAETAQEAIQFVYFAYLGAVKDQDGAAMSLGRTATFLDIYINRDLE
FT                   NGKITEEEAQEFIDQFIMKLRIVRFLRPPAYNELFSGDPVWTTEVLGGEGTDGRTLVSK
FT                   TSFRYLNTLYNLGPAPEPNLTVLWSRKSPENWKKFCAKVSIDTSALQYENDDLMRPQFG
FT                   DDYAIACCVSPMKVGKGMQFFGARVNLPKALLYAINGGKDEKSGKQVAPHLAPITSEYL
FT                   DFDVVMERYEEVLKWLAGVYVRALNIIHYMHDKYAYETFEMALHDLEIERTQAHGIAGV
FT                   SIVADSLAAIKNAKVKVIRDEAGMAVDFEIEGDYEAFGNNHDETDQFAVSITKKFMDMI
FT                   RTHQMYRGARPTQSILTITSNVVYGKKTGATPCGRKSGAPFAPGANPMNGRDKKGAIAA
FT                   LTSVAKLPFEHANDGISYTFAITPATLGKEKEDRCNNLVNLMDGYFEPAGGHHLNVNVF
FT                   DKALLEDAMAHPEKYPQLTIRVSGYAVNFTKLNKEQQLDVISRTINERI"
FT   gene            167549..168283
FT                   /locus_tag="Ilyop_0153"
FT   CDS_pept        167549..168283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0153"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR012838:IPR001989:IPR007197; KEGG:
FT                   cyc:PCC7424_2837 pyruvate formate-lyase activating enzyme;
FT                   PFAM: Radical SAM domain protein; PRIAM:
FT                   [Formate-C-acetyltransferase]-activating enzyme; SPTR:
FT                   C6JLR1 Pyruvate-formate lyase-activating enzyme; TIGRFAM:
FT                   pyruvate formate-lyase activating enzyme; PFAM: Radical SAM
FT                   superfamily; TIGRFAM: pyruvate formate-lyase 1-activating
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81942"
FT                   /db_xref="GOA:E3H746"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:E3H746"
FT                   /protein_id="ADO81942.1"
FT                   /translation="MGKVLGKLHSYESCGTVDGPGLRYVVFTQGCPLRCKYCHNPDTWH
FT                   MPDASYEEDANYIVKEISRYKPFFRNGGGMTLSGGEPFMQAEFAKELFRLCKENDINTA
FT                   VDTSGIYLNDTVKEALEYVDLVLLDIKCIDPEIYKDLTKVELEPTLKFARYLSDIKKPV
FT                   WIRHVLVPGITDREDLLEKLGDFIASLENVEKMEILPYHSLGEYKWEELGYEYELKGVE
FT                   PPTKEAVEKAKEIFRKKGVPIR"
FT   gene            168416..169942
FT                   /locus_tag="Ilyop_0154"
FT   CDS_pept        168416..169942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0154"
FT                   /product="sulphate transporter"
FT                   /note="COGs: COG0659 Sulfate permease and related
FT                   transporter (MFS superfamily); InterPro
FT                   IPR002645:IPR011547; KEGG: pha:PSHAa1403 sulfate permease
FT                   protein; PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; SPTR: A0Y669
FT                   Sulfate permease family protein; PFAM: Sulfate transporter
FT                   family; STAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81943"
FT                   /db_xref="GOA:E3H747"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E3H747"
FT                   /protein_id="ADO81943.1"
FT                   /translation="MSSFLKEKLSIKDDVLAGLTVAFALVPEVVAFAFVAGIDPIVGLN
FT                   SAVIIGLCTAIFGGRPGMISGAAGSIAVVFTALVALHGVEYLFATVVVMGIVQILVGVL
FT                   KFGKFARMIPHSVMLGFVNGLAVVIFLAQLSQFKVDGVWMSGIQLYAVLGLVALTMGII
FT                   HFLPKLTKAVPASLVAIGVTTGLSMWSNKMGIHIPNVLEFSKGGIAGGLPKFHIPEVPL
FT                   SFETLKIVLPFAVTAAMVGLIESLLTMSLIDDLTDTRGQANRESIGQGIGNFINGLMGG
FT                   TGGCAMIGQSMINLTSGGRGRISGVSTALALLSFVLFGSKIIGIIPLAALVGVMFMVVI
FT                   ETFAWESLKYRKRIPKKDFLIIVIVAIITIEHDLALAVIVGIIISALIFAWEKGKRISA
FT                   ETKVSESGTKTYILEGPLFFGSAANFKELFDVQNDPKVVAIDFCKSKVTDHSAIEAINN
FT                   ITDKYRQAGKKLKLKHLSSDCYELLKNAEEIIEINIVEDPKYFVADNELA"
FT   sig_peptide     168416..168514
FT                   /locus_tag="Ilyop_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            170580..171593
FT                   /locus_tag="Ilyop_0155"
FT   CDS_pept        170580..171593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0155"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="COGs: COG0533 Metal-dependent protease with possible
FT                   chaperone activity; InterPro IPR017861:IPR017860:IPR000905;
FT                   KEGG: fnu:FN0549 O-sialoglycoprotein endopeptidase; PFAM:
FT                   peptidase M22 glycoprotease; PRIAM: O-sialoglycoprotein
FT                   endopeptidase; SPTR: C6JLR2 O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; PFAM: Glycoprotease family; TIGRFAM: putative
FT                   glycoprotease GCP; metallohydrolase, glycoprotease/Kae1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81944"
FT                   /db_xref="GOA:E3H748"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:E3H748"
FT                   /protein_id="ADO81944.1"
FT                   /translation="MIILGIETSCDETSVSVVKDGKEILSNIISSQIEIHKEYGGVVPE
FT                   IASRHHIKNIAAIMEESLSEAKVTLDDIDYIAVTYAPGLIGALLVGLSFAKGISYAHDI
FT                   PIIPVHHIKGHIYSNFVENDVKLPLIALVVSGGHTNIVHIDENHKFTNLGGTLDDAVGE
FT                   SYDKVSRVMGLGYPGGPVIDKLAYLGDKDSIKMPEPKVGEYDFSFSGIKTSVINYVNKM
FT                   KMKGETFREEDLAAAFQHKVVEILCKKTIGAAVEKKVNNIVIAGGVAANSLLRKELKEK
FT                   AKKSGIEVYYPSMGLCTDNAAMIAVAGYYKVTYGDEKNKFGDLRLNGIATLPIDRD"
FT   gene            171602..172105
FT                   /locus_tag="Ilyop_0156"
FT   CDS_pept        171602..172105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q7RPJ4 Putative
FT                   uncharacterized protein PY01465"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81945"
FT                   /db_xref="GOA:E3H749"
FT                   /db_xref="UniProtKB/TrEMBL:E3H749"
FT                   /protein_id="ADO81945.1"
FT                   /translation="MRKKLGTSYTEVLIAISIFLVGVIPLLASLNLSFEATIYNRNFTK
FT                   ALEYNRQLMEEISSYLPTEVSGYDNLGTIYDEIEDICGERSESKSETKGIYTMPDWDDS
FT                   DFDFAESKLVDDSIYRTVEVGSFTEGTDESFDVTVTSYLTRNNEYLAKSILKINLVDET
FT                   KTSE"
FT   sig_peptide     171602..171685
FT                   /locus_tag="Ilyop_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            172121..172990
FT                   /locus_tag="Ilyop_0157"
FT   CDS_pept        172121..172990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GF24532 gene product from transcript
FT                   GF24532-RA; SPTR: B3M496 GF24532"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81946"
FT                   /db_xref="UniProtKB/TrEMBL:E3H750"
FT                   /protein_id="ADO81946.1"
FT                   /translation="MKKKKAYSMIELIMAIGSLLLVLGVFSVIVKTYLEEFSEGTLGER
FT                   KWADVQTFFTYVNRDLEELSEGMGSGETLEINSNGTIEIKSSEGTTTDSVVYSVDSTGN
FT                   ISRDGTAIVKVNKNFNIDGLGLKVYENTLVENSINSNWEYDELEDDPVIITSEDGSNYY
FT                   IEPVISLSEGSEITGGYALRFENVTTTTELTTEWTQTVTEADLSTITISDTGYVGEIRD
FT                   IMLTATYSSGNSNKINSVKYNGTTDTTTPYEWEGQSIGSTMEFIFNMANGANGSNKYIE
FT                   ITVTLSEP"
FT   sig_peptide     172121..172216
FT                   /locus_tag="Ilyop_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            173004..173522
FT                   /locus_tag="Ilyop_0158"
FT   CDS_pept        173004..173522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_08020 arabinose efflux permease
FT                   family protein; SPTR: A3USN1 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81947"
FT                   /db_xref="UniProtKB/TrEMBL:E3H751"
FT                   /protein_id="ADO81947.1"
FT                   /translation="MNRKAFILPLVLLILALMSGIAVVLGRLSSEKTLSLKNQERSYYA
FT                   EEITVILVDEETTDDSSGEDTGDESETEDLIGPKVYTLQLYGKNQGKTTVSIETIFDGV
FT                   AFEYGDYIVKIVSNSDKLSAVEVDTTSISLENDIFEGPANITAGSKLYLTNKSNALKTI
FT                   EITVTLTPN"
FT   sig_peptide     173004..173090
FT                   /locus_tag="Ilyop_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            173568..175136
FT                   /locus_tag="Ilyop_0159"
FT   CDS_pept        173568..175136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0159"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="InterPro IPR007813; KEGG: cpr:CPR_2269 type IV pilus
FT                   assembly protein PilM; PFAM: Fimbrial assembly family
FT                   protein; SPTR: B1V3F0 Type IV pilus assembly protein PilM;
FT                   PFAM: Fimbrial assembly protein (PilN)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81948"
FT                   /db_xref="GOA:E3H752"
FT                   /db_xref="UniProtKB/TrEMBL:E3H752"
FT                   /protein_id="ADO81948.1"
FT                   /translation="MKKRLSIELTENSIKFILGAQGKNGISIEDIHREAISSEQKGNIS
FT                   SSVEKIKEIIESKGWTRYKKVLLCRIDSMEHVMIELPNVPEEEMESIIRRKLENQKLVD
FT                   DADKIAYGAIGDFSPKMLQGVYTQVMTQEFLEKISLLKLHGIDFEPFAADRGMRKYANK
FT                   KENSFFIDIQDTHTIAAIYFKDKLSLYRKINVGRRDFVKSISEILNIEKEKADEYLKEH
FT                   SYVSNIKATELMERGVDIGPQLNMACESTLAKILRKAVQYIDYFQFKHSGEVLNTVYFS
FT                   GGELKTEDIRAALERELYIGNIYDYNVKSGFLESDLTQEIFSDNNWNLLAGTMQSEEGI
FT                   YRLKSKLKLPFKINKNPVYIFLAIVFVMFCSIKFGYYKMQELEQTKQIKMISEKNRELS
FT                   DYIKESDALEKKIKNVKKDTDYLSKRIGKNTIFNNFLYEVSEILPEEIYFEEIKYSGDR
FT                   VHLEGKAISDDDYAEVYINELLSSLEGITGSVRLLKTVKFQQNNRINDFSIEVKLSGGE
FT                   KNEKK"
FT   gene            175123..175644
FT                   /locus_tag="Ilyop_0160"
FT   CDS_pept        175123..175644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_1724 hypothetical protein; SPTR:
FT                   B2A556 Putative uncharacterized protein; PFAM: Pilus
FT                   assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81949"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="UniProtKB/TrEMBL:E3H753"
FT                   /protein_id="ADO81949.1"
FT                   /translation="MKKNEKQAVLLQLLVCLTFYILFQNIIMVNLKKRVESNKNTIIQQ
FT                   KQKYVEDVNKINSLEKRYRDYYKMKYQRDYMQAKLVGKGEERYLTEELTKLSKKNNIKL
FT                   SNINLAQNMSENDHKYIFNTEFETDFLTLKNFLDDIDNLEKNINLEDMNISRENFNLIV
FT                   KATFSIYTTN"
FT   sig_peptide     175123..175215
FT                   /locus_tag="Ilyop_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            175668..176141
FT                   /locus_tag="Ilyop_0161"
FT   CDS_pept        175668..176141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tye:THEYE_A0211 hypothetical protein; SPTR:
FT                   B5YHZ4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81950"
FT                   /db_xref="GOA:E3H7J6"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7J6"
FT                   /protein_id="ADO81950.1"
FT                   /translation="MRKKLDFQNLKTKATGIGKIHVIIAGIIIFLFMGLYLKFSEKDNF
FT                   NMLMEISPRHDFSGDKIKDEEWKKFQSSIEAENNEKKELTRNIFHSYGQGEDGKPELTG
FT                   IILGKKKSATFSDGQILQEGDSFNSLVVKSINRREVVLVDKKGEKKVLELWRQ"
FT   gene            176145..177809
FT                   /locus_tag="Ilyop_0162"
FT   CDS_pept        176145..177809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0162"
FT                   /product="type II and III secretion system protein"
FT                   /note="COGs: COG1450 Type II secretory pathway component
FT                   PulD; InterPro IPR011662:IPR004846:IPR001775; KEGG:
FT                   gme:Gmet_0975 type II and III secretion system secretin;
FT                   PFAM: type II and III secretion system protein;
FT                   Secretin/TonB short domain; SPTR: Q39X07 Type II and III
FT                   secretion system protein:NolW-like:Secretin/TonB,
FT                   short-like; PFAM: Secretin and TonB N terminus short
FT                   domain; Bacterial type II and III secretion system protein;
FT                   TIGRFAM: general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81951"
FT                   /db_xref="GOA:E3H7J7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7J7"
FT                   /protein_id="ADO81951.1"
FT                   /translation="MGETIKKGVRLITAFSILGSTIFGAGYNGEIIAPDQKVTVDYNKA
FT                   DLVNVLRTLSFSNDLNIVISDKVSGTVTMSVKDTQLDDLLEAILRSNGYTYVQSGNLVE
FT                   IMSLEEAKTMQESDRSVSKVFSLKKIDASEVAEDVKLFLKDGDTSVVNEGTNSITVRAK
FT                   KSELISVKSFLDERDGIKKEDAQKNVELIRVKHMTPQKAYEILGEIGYKIAGDIKYSES
FT                   LGGLLVIASSEEADTLKNIMDKIDVPDLQVVIEARILEVQEGTGRDWGMSWGYNSNNLT
FT                   EADSSDGSGGYLSGTDSYYDASSLSDGITLGLGLLGSDQFSAVYRNVVEDNTTEILAKP
FT                   VITTLNGKKATIELTEEVPYKELEYVSDSGDATSTSYEFKDVGITLEVTPVITDDGMIK
FT                   IEVTPEISEVTGYTDDGVPYVSSRKVETNVIVRNGQTLAIGGLIKDTKSTTDTKDPYLS
FT                   KIPILGYLFKSSSNEKSKTNLMIFITPKIIMSRDMSQRFNLVKGSSSSVLKTIKNPETM
FT                   VTEKTTKVKDDGDTLETTYEEKVTGIDKIQQKLSESN"
FT   sig_peptide     176145..176219
FT                   /locus_tag="Ilyop_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            177848..179581
FT                   /locus_tag="Ilyop_0163"
FT   CDS_pept        177848..179581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: C5U7K0 SMC domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81952"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7J8"
FT                   /protein_id="ADO81952.1"
FT                   /translation="MRFIYLFFMIISILSYGETEGRYELRNSKELTMFFPKSDSEYIDY
FT                   LSGKKDAEAYFELAVIYLKEGSKSKSKDYLNLYIKEENDPRKLLEYYNIEKNYKKIEEN
FT                   LDRIISSADDLESVQYKKKIYREIANKKLPISKEKYKVNKIKEFLSYEGKEEKQRHFFN
FT                   SNKWTKGDIRKIVDKLKKYKLKEKSPSKKLFDMFATKKDRLENKYHNIKNLEDVEGYYD
FT                   YFDFAKSEDIKADLKTPAEKLLYLKYEKNTEGYKAAKEKFVKEYLEKKNNRVLYTLWTV
FT                   TKDNNIIQYLKTQSEEYHHLYLKELLEKNKKSLFYSEGEKFLYLYPKSFYREEILKQLF
FT                   ALASESQKSNLVKTYTEVIDSRVLDRERIKSSDGPLKIKLMEKEILKGSSDYTEKLIEE
FT                   LEDQYIDREVAEKLKRMGNREPYAVYLIQNDLVVPAEYRGAAARYLYTEGEIDALYPYR
FT                   KYIGKSELKELSKSYPRYKEEYATRYPLEEGNTDSSKESYIYFSKNPVLQESIVKEIEN
FT                   KKIMEPHEMYYAALYYNQKKDYIKSYRLSDLLNEKYSFSEKIVKLHRDNIQKLKKINLK
FT                   K"
FT   sig_peptide     177848..177898
FT                   /locus_tag="Ilyop_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(179601..181163)
FT                   /locus_tag="Ilyop_0164"
FT   CDS_pept        complement(179601..181163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0164"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008969; KEGG: mst:Msp_0762 asn/thr-rich
FT                   large protein family protein; SPTR: C6JLS7 Predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81953"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7J9"
FT                   /protein_id="ADO81953.1"
FT                   /translation="MLKKVFAIIFVFLFSTILWAEDKKDGTASFYFNTPRGYIEFTDIS
FT                   DQSKYGINFTDSKALLDLKPGNYKFQFFSPSYFPVERVISISREYQSYNIDFSKKSGDF
FT                   FISVRKSGKNQLYFHNEPPNTPHILNDISILFYKEGELVKTVDSDSLLQKINLNFGQYD
FT                   IVIKELDKTLFRVQRFPVNERYGEYLNFFVQPIEVPVEGVLRINDMYLGGADIIFTDVK
FT                   NNSYTLTSDFSGKFSGNIPSKKYKLSVKKFGYFLKKENQLIYDFTDEDKKFTLNLELEE
FT                   APSFIEARIIDDKNLPVANAEVVIKSGDAEKKSFTDSFGRFRGTANPGLVMIKVNKDGF
FT                   FSQGLVRRVEKFSTISNLEIQLKRKLYKISGILSDGVKPIKSQKIDLINLKGKRIASTL
FT                   SGENGYFEFLDIPATATFKVSVNISDFKPYESSEMTLKEAISNFNIIMNRGSRQVILEI
FT                   TDASDTPVKNSLFDLDGKNITSDSNGIISYNTSSHEINITYKSQKKKYSLDKEKVVYQI
FT                   SIN"
FT   sig_peptide     complement(181104..181163)
FT                   /locus_tag="Ilyop_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            181357..181911
FT                   /locus_tag="Ilyop_0165"
FT   CDS_pept        181357..181911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0165"
FT                   /product="protein of unknown function DUF1694"
FT                   /note="InterPro IPR012543; KEGG: hor:Hore_17780
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF1694; SPTR: C6JLS8 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF1694)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81954"
FT                   /db_xref="InterPro:IPR012543"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7K0"
FT                   /protein_id="ADO81954.1"
FT                   /translation="MSFKNIIDEREKGKIRFAKSQVEKAYYLGEFKENIIVALHKNQLE
FT                   EDSVYMEIIEAMKEKDAVLMKMRRDVSLKKLKPYIDEAEKLGIKYQLVDGISYRGDVAL
FT                   VVVSEEAMENSDEDLVLRDMDQDFIDAGLGEDFSKARGKKICKSCFKDLEEKLPDYRGS
FT                   FKKMNIFDKIIGHKCPVCGKK"
FT   gene            181887..183188
FT                   /locus_tag="Ilyop_0166"
FT   CDS_pept        181887..183188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0166"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COGs: COG0766 UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase; InterPro IPR005750:IPR001986:IPR013792; KEGG:
FT                   fnu:FN1520 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); PRIAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; SPTR:
FT                   C6JLS9 UDP-N-acetylglucosamine 1-carboxyvinyltransferase;
FT                   TIGRFAM: UDP-N-acetylglucosamine 1-carboxyvinyltransferase;
FT                   PFAM: EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81955"
FT                   /db_xref="GOA:E3H7K1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7K1"
FT                   /protein_id="ADO81955.1"
FT                   /translation="MPCVREKIGGIMVEAFRINGGKELSGVLEVSGAKNAALPILIGTL
FT                   IEKGTYIINNVPDLRDIKTLIKLIESLGVQSERLDKNSYKFVNNGITNLTASYDLVKKM
FT                   RASFLVMGPMLAHEKKATVSLPGGCAIGARPVDLHLKGFEAMGVKIKIEHGYVEAEVEE
FT                   LTGSNVIFDFPSVGATENVIMAAVKAKGTTVLENAAREPEVDDLCKFLIAMGAKIEGVG
FT                   TGRLVIEGVEKLVPCEYTVMPDRIEAGTYIVASLMFDSKIQVKGVERVHIESFMMKLEE
FT                   MGAVFEIKDDLLKVTSKFEDLKPAKVTTMPHPGFATDLQSQMMTLMSLIEGHSEIKETI
FT                   FENRFMHVPELNRMGANIHIDGHVSLIDGVDKFSSAEVMASDLRAGASLVLAALKADGQ
FT                   SIVNRIYHVDRGYERLEEKLKKIGADIERIKAEA"
FT   gene            183269..183979
FT                   /locus_tag="Ilyop_0167"
FT   CDS_pept        183269..183979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0167"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro
FT                   IPR004441:IPR013123:IPR001537; KEGG: lba:Lebu_0387 RNA
FT                   methyltransferase, TrmH family, group 3; PFAM: tRNA/rRNA
FT                   methyltransferase (SpoU); RNA 2-O ribose methyltransferase
FT                   substrate binding; SPTR: C3WFR8 23S rRNA methyltransferase;
FT                   TIGRFAM: RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   SpoU rRNA Methylase family; RNA 2'-O ribose
FT                   methyltransferase substrate binding; TIGRFAM: rRNA
FT                   methylase, putative, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81956"
FT                   /db_xref="GOA:E3H7K2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7K2"
FT                   /protein_id="ADO81956.1"
FT                   /translation="MEKIIGLNPVTEALQNPETNIEKIEIFKGLKDDKIGRIKSLASKR
FT                   NIKIHFTDKRAENSQGVVAFISQYDYYVDLGAFLEKVAKDEKSIVLVLDGVQDPRNFGA
FT                   IVRSAEIFGVKGIIIPERNSVKINETVVKTSTGAIEHVDIIKVTNISEAIQKLKKLDYW
FT                   VYGAEGSGKKCYYDEKYPNRTALVMGGEGSGIRKKVKENCDILVNIPMYGKINSLNVSV
FT                   AGGILLSEIAKKIY"
FT   gene            184036..184647
FT                   /locus_tag="Ilyop_0168"
FT   CDS_pept        184036..184647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0168"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog;
FT                   InterProIPR014284:IPR016371:IPR013325:IPR016032:IPR
FT                   000943:IPR007627:IPR013249; KEGG: pjd:Pjdr2_5700 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; SPTR:
FT                   C6JLT1 RNA polymerase sigma-H factor; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: Sigma-70,
FT                   region 4; Sigma-70 region 2; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; RNA polymerase sigma-H factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81957"
FT                   /db_xref="GOA:E3H7K3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7K3"
FT                   /protein_id="ADO81957.1"
FT                   /translation="MAVEMITDEILTEAQNGDQEAVRKVFDYYKNFVFLKAKNYFLIGA
FT                   DRDDLVQEGMIGLLKAIRAYDTEKAASFKTFATICIKRQLITAIKSANSQKNFALNSSV
FT                   GIYNDSNEDREVPYARGLESYVTYNPEEMYLTKEQITGLKEHLQSTLSEFENEVFQYML
FT                   LGHTYKEISRKLDKKVKSVDNAIQRIKRKSEAWLETYRKA"
FT   gene            184754..187363
FT                   /locus_tag="Ilyop_0169"
FT   CDS_pept        184754..187363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0169"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="COGs: COG0495 Leucyl-tRNA synthetase;
FT                   InterProIPR002302:IPR014729:IPR009008:IPR009080:IPR
FT                   001412:IPR015413:IPR013155; KEGG: fnu:FN1517 leucyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase valyl/leucyl
FT                   anticodon-binding; tRNA synthetase class I (M); SPTR:
FT                   C6JLT2 Leucine-tRNA ligase; TIGRFAM: leucyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class I (I, L, M and V);
FT                   Anticodon-binding domain; TIGRFAM: leucyl-tRNA synthetase,
FT                   eubacterial and mitochondrial family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81958"
FT                   /db_xref="GOA:E3H7K4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7K4"
FT                   /protein_id="ADO81958.1"
FT                   /translation="MREYDFKSIESKWQEKWKQDNIFKSDNKVEGKENYYVLEMLPYPS
FT                   GKLHMGHVRNYTIGDVIARYKKMKGYNVLHPMGWDSFGLPAENAAIQNGAHPAVWTKSN
FT                   IENMTTQLKSLGFSYDWDREIASYRDDYYRWNQWIFKRMYEKGLVYKKKSSVNWCPDCQ
FT                   TVLANEQVEDGKCWRHSKTDVIQKELEQWYFKITNYADELLEGHKELKGGWPEKVITMQ
FT                   KNWIGKSYGTEVNFKVVENGEDLSVFTTRVDTLCGVTYCVIAPEHPMVNEIIKSNPSIK
FT                   EAVSAMTTEDVINRTAEGKEKNGVFTGWHVINPANNEKVQLWIGDYVLMGYGTGAVMAV
FT                   PCHDERDLMFAKKYDLPLRVVINPVNKKTKEEVILKEDEMTEAFTDYGIITNSGEFNGL
FT                   SSKEALVKIAEYLEEKKCGKRTINYRLKDWGVSRQRYWGTPIPALYCEKCGTVMEKDEN
FT                   LPVKLPGDVIFSGNGNPIETSEEFKNAVCPECGGKAKRETDTMDTFVDSSWYFLRYCDP
FT                   KNTDLPFDKDIADGWFPVDQYIGGVEHAVMHLLYARFFHKVLRDLGLLSTNEPFKRLLT
FT                   QGMVLGPSYFSANENRYLYSEEVEISGDKVLAKTTGEELVVKVEKMSKSKNNGVDPENI
FT                   VATYGADTARLFTMFASPPEKELEWNENGLAGSYRFLNRVWRMVSESKAFFEAGSINLE
FT                   NLNKADKAILRKLHQTIKKVTESIENDYHFNTSIASNMELINELQDYKVNVLEKGDITS
FT                   ESKKLFTEAVNKMVIMLSPFVPHICDELWSELGNEGFLFEEKWPEHVEELTVSDEVSIA
FT                   VQVNGKVRGAVQVTRGTSKDELEKMALEMENVKKHIQDKNIVKMIIIPEKIVNIVVK"
FT   gene            187408..188541
FT                   /locus_tag="Ilyop_0170"
FT   CDS_pept        187408..188541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0170"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="COGs: COG0263 Glutamate 5-kinase;
FT                   InterProIPR005715:IPR002478:IPR001048:IPR011529:IPR
FT                   015947:IPR019797:IPR001057; KEGG: fph:Fphi_0609
FT                   gamma-glutamyl kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein; PRIAM: Glutamate
FT                   5-kinase; SMART: PUA domain containing protein; SPTR:
FT                   B0U112 Glutamate 5-kinase; TIGRFAM: glutamate 5-kinase;
FT                   PFAM: PUA domain; Amino acid kinase family; TIGRFAM:
FT                   glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81959"
FT                   /db_xref="GOA:E3H7K5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7K5"
FT                   /protein_id="ADO81959.1"
FT                   /translation="MLDRKKHMKKIKRIVVKVGTSTLTHENGLLNIWRIEKLVRTLSDL
FT                   ANLDYEIILVTSGAVGAGMGVLKLDEKPKTLDEKQAVAAVGQVSLIHLYRKLFSEYGKN
FT                   IAQLLVNGEDISKRNRYINIRNTFSALFDKKVIPIVNENDAVAVEEIKVGDNDTLSAYA
FT                   ASAVDADLLILLSDIDGLYTSNPRQDKNAKFISVVEEIDESIYSIASGAGGSKFGTGGM
FT                   HTKIKAGEIATKLGVDMIIANGECPEIIRDILNGEEKGTLFLGEKDITAKKHWIWYGGK
FT                   IEGTIYIDNGAEKALCDKNSLLPVGVISVDGSFAEGDIIAIKNSEEELVAKGIVNYASS
FT                   EVELIIGKHSDEIEDILGYKGYDSVVHINNLHLLKEV"
FT   gene            188543..189790
FT                   /locus_tag="Ilyop_0171"
FT   CDS_pept        188543..189790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0171"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="COGs: COG0014 Gamma-glutamyl phosphate reductase;
FT                   InterProIPR000965:IPR016162:IPR016163:IPR012134:IPR
FT                   016161:IPR020593:IPR015590; KEGG: fph:Fphi_0608
FT                   glutamate-5-semialdehyde dehydrogenase; PFAM: Aldehyde
FT                   Dehydrogenase; PRIAM: Glutamate-5-semialdehyde
FT                   dehydrogenase; SPTR: C4C537 Glutamate-5-semialdehyde
FT                   dehydrogenase; TIGRFAM: gamma-glutamyl phosphate reductase;
FT                   PFAM: Aldehyde dehydrogenase family; TIGRFAM:
FT                   gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81960"
FT                   /db_xref="GOA:E3H7K6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7K6"
FT                   /protein_id="ADO81960.1"
FT                   /translation="MDNYMLEIGKKAKEASKILAGIDTRTKNKALMSVVDALLENSELI
FT                   KEENEKDLKAAREKGISESFIDRLTLTDERIKSMANGVWEIASFSDPVGEIVKGFPHEN
FT                   GMKISEVRVPLGVLAMIYESRPNVTVDAAALALKSGNAIILRGGSDASHSNGILEKIFV
FT                   DAITKEGVPEGAVQLIKNPDRALVNELVRLNDYVDVAIPRGGVGLKKAIIANATVPVIE
FT                   TGAGVCHLYIDSRAAIEKALNIAINAKTQRPGVCNAIETLLIHEESLGRILPFLAEGLV
FT                   ANGVEIRADEEALQFIPGAKAAVEEDWSTEYLSLVVSIKTVSGIAEAIRHIDKYGTKHS
FT                   EAIVTESYEMAEKFLNEVDAAAVYVNASTRFTDGGEFGFGGEIGISTQKLHARGPMGVR
FT                   ALTTTKYIIRGNGQIR"
FT   gene            190221..191730
FT                   /locus_tag="Ilyop_R0009"
FT   rRNA            190221..191730
FT                   /locus_tag="Ilyop_R0009"
FT                   /product="16S ribosomal RNA"
FT   gene            191940..194869
FT                   /locus_tag="Ilyop_R0010"
FT   rRNA            191940..194869
FT                   /locus_tag="Ilyop_R0010"
FT                   /product="23S ribosomal RNA"
FT   gene            194945..195060
FT                   /locus_tag="Ilyop_R0011"
FT   rRNA            194945..195060
FT                   /locus_tag="Ilyop_R0011"
FT                   /product="5S ribosomal RNA"
FT   gene            195072..195147
FT                   /locus_tag="Ilyop_R0012"
FT   tRNA            195072..195147
FT                   /locus_tag="Ilyop_R0012"
FT                   /product="tRNA-Asn"
FT   gene            195177..195292
FT                   /locus_tag="Ilyop_R0013"
FT   rRNA            195177..195292
FT                   /locus_tag="Ilyop_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            195493..195645
FT                   /locus_tag="Ilyop_0172"
FT   CDS_pept        195493..195645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0172"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="InterPro IPR001705:IPR018264; KEGG: dvl:Dvul_0446
FT                   50S ribosomal protein L33; PFAM: ribosomal protein L33;
FT                   SPTR: C6JIQ2 50S ribosomal protein L33; TIGRFAM: ribosomal
FT                   protein L33; PFAM: Ribosomal protein L33; TIGRFAM:
FT                   ribosomal protein L33, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81961"
FT                   /db_xref="GOA:E3H7K7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7K7"
FT                   /protein_id="ADO81961.1"
FT                   /translation="MRVNIQLECTECKRRNYSTAKNKKNTTDRLEMNKYCKWDKKVTLH
FT                   KETKK"
FT   gene            195675..195750
FT                   /locus_tag="Ilyop_R0014"
FT   tRNA            195675..195750
FT                   /locus_tag="Ilyop_R0014"
FT                   /product="tRNA-Trp"
FT   gene            195782..195964
FT                   /locus_tag="Ilyop_0173"
FT   CDS_pept        195782..195964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0173"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="InterPro IPR005807:IPR001901; KEGG: fnu:FN2042
FT                   protein translocase subunit SecE; PFAM: protein
FT                   secE/sec61-gamma protein; SPTR: C3WG80 Predicted protein;
FT                   TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   SecE/Sec61-gamma subunits of protein translocation complex;
FT                   TIGRFAM: preprotein translocase, SecE subunit, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81962"
FT                   /db_xref="GOA:E3H7K8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7K8"
FT                   /protein_id="ADO81962.1"
FT                   /translation="MKFIEEIKMEYAKVTWPNKEEVKHATIIVAAMSVALSVYLGVFDL
FT                   IASRLLDMLVSSFGG"
FT   gene            195968..196564
FT                   /locus_tag="Ilyop_0174"
FT   CDS_pept        195968..196564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0174"
FT                   /product="NusG antitermination factor"
FT                   /note="COGs: COG0250 Transcription antiterminator;
FT                   InterProIPR001062:IPR006645:IPR014722:IPR008991:IPR 015869;
FT                   KEGG: fnu:FN2041 transcription antitermination protein
FT                   NusG; PFAM: NGN domain protein; SMART: NGN domain protein;
FT                   SPTR: C3WG81 Transcription antitermination protein nusG;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG; PFAM: Transcription termination factor nusG; TIGRFAM:
FT                   transcription termination/antitermination factor NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81963"
FT                   /db_xref="GOA:E3H7K9"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7K9"
FT                   /protein_id="ADO81963.1"
FT                   /translation="MEKAIVKKWFMIHTYSGYEKKVKTDLEQKIETLEKGEIVTRILVP
FT                   EEESVELRRGKKKVVARKLFPGYVMVEMIVTREESADGINFKVDSDAWYIIRNTNGVTG
FT                   FVGVGSDPIPMEDEEVENIFRVIGLNDGDDKEVKETVQINFSVGDYVELLEGGLSGHGG
FT                   KVAEIDMEHKRVKVMVEMFGRMTPVEVGFDGVKKA"
FT   gene            196636..197061
FT                   /locus_tag="Ilyop_0175"
FT   CDS_pept        196636..197061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0175"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="COGs: COG0080 Ribosomal protein L11;
FT                   InterProIPR006519:IPR020784:IPR020783:IPR020785:IPR 000911;
FT                   KEGG: fnu:FN2040 50S ribosomal protein L11P; PFAM:
FT                   Ribosomal protein L11-like; SMART: ribosomal protein L11;
FT                   SPTR: C6JIQ5 Ribosomal protein L11; TIGRFAM: ribosomal
FT                   protein L11; PFAM: Ribosomal protein L11, RNA binding
FT                   domain; Ribosomal protein L11, N-terminal domain; TIGRFAM:
FT                   50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81964"
FT                   /db_xref="GOA:E3H7L0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7L0"
FT                   /protein_id="ADO81964.1"
FT                   /translation="MAKEVIGLIKLQLPAGKANPAPPVGPALGQHGVNIMEFCKAFNAK
FT                   TQDKAGWIIPVEISVYNDRSFTFILKTPPASDLLKKSAGIKSGAANSLKETAGTITKAQ
FT                   LKELAETKMPDLNAGTIEAAMNILAGSARSMGIKIVD"
FT   gene            197150..197857
FT                   /locus_tag="Ilyop_0176"
FT   CDS_pept        197150..197857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0176"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="COGs: COG0081 Ribosomal protein L1; InterPro
FT                   IPR005878:IPR016094:IPR002143; KEGG: fnu:FN2039 50S
FT                   ribosomal protein L1; PFAM: ribosomal protein L1; SPTR:
FT                   C3WG83 Ribosomal protein L1; TIGRFAM: ribosomal protein L1;
FT                   PFAM: Ribosomal protein L1p/L10e family; TIGRFAM: ribosomal
FT                   protein L1, bacterial/chloroplast"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81965"
FT                   /db_xref="GOA:E3H7L1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7L1"
FT                   /protein_id="ADO81965.1"
FT                   /translation="MAKRGKKYLEIAKLVEIGKLYDVNEALELVAKTKTAKFVETIEVA
FT                   LRLGVDPRHADQQIRGTVVLPHGTGKNVKVLAITSGDNVQKALDAGADYAGAEEYIEKI
FT                   QQGWFDFDVVIATPDMMPKLGKLGRVLGTKGLMPNPKSGTVTPNIAQAVSEFKKGKLAF
FT                   RVDKLGSIHVPIGKADFDGVKIEENFKAFMAEIQRLKPSAAKGQYLKTVAISLTMGPGI
FT                   KMDPLLVSKYLGA"
FT   gene            198036..198548
FT                   /locus_tag="Ilyop_0177"
FT   CDS_pept        198036..198548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0177"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="COGs: COG0244 Ribosomal protein L10; InterPro
FT                   IPR001790; KEGG: fnu:FN2038 50S ribosomal protein L10P;
FT                   PFAM: ribosomal protein L10; SPTR: C3WM57 LSU ribosomal
FT                   protein L10P; PFAM: Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81966"
FT                   /db_xref="GOA:E3H7L2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7L2"
FT                   /protein_id="ADO81966.1"
FT                   /translation="MATELKKQVIDQLSEKIKKSDSIVFIDYRGLKVNEETELRKQIRE
FT                   AGAEYIVAKNRLFKIALKEAGVEDSFDDVLEGTTAFAFGYGDVVAPAKVTYELGKELAL
FT                   KKRDIFKIKAGLLSGKRVDVSEVEALAKLPSREQLLSMVLNGMLGPIRKLAYAAVAVAD
FT                   KKESAGE"
FT   gene            198617..198979
FT                   /locus_tag="Ilyop_0178"
FT   CDS_pept        198617..198979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0178"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="COGs: COG0222 Ribosomal protein L7/L12; InterPro
FT                   IPR000206:IPR013823:IPR014719:IPR008932; KEGG: fnu:FN2037
FT                   50S ribosomal protein L12P (L7/L12); PFAM: Ribosomal
FT                   protein L7/L12; SPTR: C6JIQ8 Ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12 C-terminal domain; TIGRFAM: ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81967"
FT                   /db_xref="GOA:E3H7L3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7L3"
FT                   /protein_id="ADO81967.1"
FT                   /translation="MAFDREKFIADLEAMTVLELKDLVSTLEDHFGVTAAAPVAVAAEA
FT                   GAAAAEKTEFDVVITSAGAKKIAVIKELRAITGLGLKEAKDLAEAGGNVKEAVSKEEAE
FT                   EVKAKLEAAGATVEVK"
FT   gene            199209..202706
FT                   /locus_tag="Ilyop_0179"
FT   CDS_pept        199209..202706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0179"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0085 DNA-directed RNA polymerase beta
FT                   subunit/140 kD subunit;
FT                   InterProIPR010243:IPR007121:IPR007644:IPR007642:IPR
FT                   007645:IPR019462:IPR007120:IPR007641; KEGG: fnu:FN2036
FT                   DNA-directed RNA polymerase beta chain; PFAM: RNA
FT                   polymerase Rpb2 domain 6; RNA polymerase Rpb2 domain 3; RNA
FT                   polymerase Rpb2 domain 2; RNA polymerase beta subunit;
FT                   DNA-directed RNA polymerase, beta subunit, external 1
FT                   domain; RNA polymerase Rpb2 domain 7; PRIAM: DNA-directed
FT                   RNA polymerase; SPTR: C3WG86 DNA-directed RNA polymerase;
FT                   TIGRFAM: DNA-directed RNA polymerase, beta subunit; PFAM:
FT                   RNA polymerase Rpb2, domain 3; RNA polymerase Rpb2, domain
FT                   6; RNA polymerase beta subunit external 1 domain; RNA
FT                   polymerase Rpb2, domain 2; RNA polymerase beta subunit; RNA
FT                   polymerase Rpb2, domain 7; TIGRFAM: DNA-directed RNA
FT                   polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81968"
FT                   /db_xref="GOA:E3H7L4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7L4"
FT                   /protein_id="ADO81968.1"
FT                   /translation="MGKLVKRMNFGRIKERGAMPHFLEFQLNSYEDFLQAKKAPNTRED
FT                   KGLESAFREIFPIESSNGDIKLEYLSYELHEAEPPMNDELECKKRGKTYSASLKVRLRL
FT                   INKKSGNEIQETLVYFGELPRMTERGTFIINGAERVVVSQLHRSPGVSFNKEQNIQTGK
FT                   DLFSGKIIPYKGTWLEFETDKNDFLSVKIDRKKKVLATVFLKSVDFFQDNLEIMEEFFK
FT                   IKELDLTKYYEKYKEREELVSILRTKFEGSFVKEDIFDEETGEILAEEQTVIDEELIEK
FT                   IVDMKLESINYWEVRPEEKILANTLLADTSENKDEAVTEVFKKLRPGDLVTVDSARSLI
FT                   RQMFFNPQRYDLASVGRYKMNKRLRLDLPDDQVVLTREDLVASIKYVLGLHNGAGHTDD
FT                   IDNLSNRRVRGVGELLLMQIRSGLVKMGKMVKEKMTVQDAGTLTPQSLLNTRPLNALVL
FT                   DFFGSGQLSQFMDQSNPLAELTHKRRISALGPGGLSRERAGFEVRDVHDSHYGRICPIE
FT                   TPEGPNIGLIGSLAIYAKVNKYGFIETPYITVKDGKADFDDIKYLAADEEEGLFIAQAD
FT                   TVVGEDGNLVGEVVCRFGHEIVHVSGEKVDFLDVSPKQVVSVSAGLIPFLEHDDANRAL
FT                   MGSNMQRQAVPLLKAEAPFIGTGLERKVAVDSGAVVVSKVKGKVVTVDANKVVVLDEDK
FT                   KEHSYRLLNFERSNQAMCLHQKPLVDLGEEVEVGTILADGPATKGGDLALGRNILMAFM
FT                   PWEGYNFEDAILISDRLRKDDVFTSIHIEEYEIEARSTKLGDEEITREIPNVSEEALRN
FT                   LDDRGVIRVGAEVGPGDILVGKTTPKGETEPPAEEKLLRAIFGEKARDVRDTSLKMPHG
FT                   AKGTIVEILELSRENGDELKAGVNKLIRIFVAEKRKITVGDKMSGRHGNKGVVSRVLPA
FT                   EDMPFLANGTHLDVVINPLGVPSRMNIGQVLEVHLGLAMGDLDGGTYIATPVFDGGNEA
FT                   QVKDYLESSGFSRTGKVTLFDGRTGDKFDNPVTVGRMYMLKLHHLVEDKMHARAIGPYS
FT                   LVTQQPLGGKAQFGGQRLGEMEVWALEAYGAANILQEMLTVKSDDVAGRTKTYEAIVKG
FT                   EEMPEPDLPESFKVLLKEFQALALDVELFDTDKNIINVNEELNKEETITEFSLADLKN"
FT   gene            202784..206728
FT                   /locus_tag="Ilyop_0180"
FT   CDS_pept        202784..206728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0180"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0086 DNA-directed RNA polymerase beta'
FT                   subunit/160 kD subunit;
FT                   InterProIPR012754:IPR007080:IPR000722:IPR007066:IPR
FT                   007083:IPR007081:IPR006592; KEGG: fnu:FN2035 DNA-directed
FT                   RNA polymerase beta' chain; PFAM: RNA polymerase Rpb1
FT                   domain 1; RNA polymerase alpha subunit; RNA polymerase Rpb1
FT                   domain 3; RNA polymerase Rpb1 domain 4; RNA polymerase Rpb1
FT                   domain 5; SMART: RNA polymerase I subunit A domain protein;
FT                   SPTR: C3WG87 DNA-directed RNA polymerase; TIGRFAM:
FT                   DNA-directed RNA polymerase, beta' subunit; PFAM: RNA
FT                   polymerase Rpb1, domain 2; RNA polymerase Rpb1, domain 4;
FT                   RNA polymerase Rpb1, domain 1; RNA polymerase Rpb1, domain
FT                   5; RNA polymerase Rpb1, domain 3; TIGRFAM: DNA-directed RNA
FT                   polymerase, beta' subunit, predominant form"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81969"
FT                   /db_xref="GOA:E3H7L5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7L5"
FT                   /protein_id="ADO81969.1"
FT                   /translation="MGIKNFEKIRIRLASPEKIQDWSFGEVTKPETINYRTLNPEMDGL
FT                   FCEKIFGPTKDWECACGKYKRMRYKGLVCEKCGVEVTRAKVRRERMGHINLAAPVSHIW
FT                   YSKGTPNKMSLVLGISPKELESVLYFARYIVISTGDTNLKEVKILTEREYKLYRQQHGK
FT                   SFEAQMGAEAILKLLQKINLEELQVELEKELEDVTSSQKRKKIVKRLKIVRDFSESGNK
FT                   PEWMILKNVPVIPADLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLEIKAPEIVV
FT                   KNEKRMLQEAVDALIDNGRRGKPVVAQNNRELKSLSDMLKGKQGRFRQNLLGKRVDYSA
FT                   RSVIVVGPSLKMDQCGIPKKMALELYKPFIMRELVKRELASNIKTAKKLVEDADDKVWD
FT                   VIEDVIQDHPVLLNRAPTLHRLSIQAFQPVLIEGKAIRLHPLVCAAFNADFDGDQMAVH
FT                   LMLSPEAIMEAKLLMLAPNNIISPANGEPVAVPSQDMVMGCYYMTKDKPGAKGEGMVFS
FT                   SIDKVLTAYQLGMVETHAIVKVRINSELVESTPGRVLFNEMLPVENRMYNVTFGKGPLK
FT                   KLIAKLYEMHGFTITAELINDIKNFGYHYATFAGITVGIEDLEIPESKKSILEEADNMV
FT                   DQIEQDYRDGKIINEERYRKTVAVWSKATDDVTKAMMENLDQFNPVYMMANSGARGSIA
FT                   QMRQLGAMRGLMADTQGRIIEVPIKANFREGLTVLEFFMSSHGARKGLADTALRTADSG
FT                   YLTRRLVDISHEVIVNSEDCGTHEGIEVAELVSEGNVIEKLSERLNGRVLVEDVVHEGE
FT                   LVASRNTIIDKELINKIEELEIKKVKIRSPLTCSLEKGVCKKCYGMDLATHKEILLGEA
FT                   VGVIAAQSIGEPGTQLTMRTFHTGGVAMASAAATSIKAENSGRIAFREVKILETEDSDD
FT                   KVVVSQSAKLIIGNYDYEIPSGSILKVEEGQMVEAGDTLVVFDPYNIPIIADNDGVAEY
FT                   RELYVKESYDEKYDVTEYQAIKPVESGDINPRIILFDDDGNKVGVCYIPFGAFLMVKEG
FT                   DKVKKGQIVAKIIPEGAGTKDITGGLPRVQELFEARNPKGKATLSEIDGKVEITGKKKK
FT                   GMRVIIIKSTSDSDLFKEYLVPVGEHLVVTDGMLVKSGDKITDGAISPHDVLSIKGLVA
FT                   AEQFILESVQQVYRDQGVTVNDKHIEIIVKQMFKKVRIVDSGSSLFLEDEVVEKRLMDL
FT                   ENEVLRAAGKREIQYQPIIQGITKAAVNTGSFISAASFQETTKVLSNAAIEGKEDYLEG
FT                   LKENVIIGKMIPAGTGFTSYKTIEPKKLQD"
FT   gene            206866..207744
FT                   /locus_tag="Ilyop_0181"
FT   CDS_pept        206866..207744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0181"
FT                   /product="domain of unknown function DUF1732"
FT                   /note="COGs: COG1561 Uncharacterized stress-induced
FT                   protein; InterPro IPR005229:IPR013527:IPR013551; KEGG:
FT                   fnu:FN2034 hypothetical protein; PFAM: domain of unknown
FT                   function DUF1732; YicC domain protein; SPTR: C6JIR1
FT                   Putative uncharacterized protein; PFAM: YicC-like family,
FT                   N-terminal region; Domain of unknown function (DUF1732);
FT                   TIGRFAM: conserved hypothetical protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81970"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7L6"
FT                   /protein_id="ADO81970.1"
FT                   /translation="MRSMTGYSKELFENDDFRVKIEIKSVNNKNLNLKIKLPYILNFME
FT                   NKIKTEVASRVFRGSVDLRIDFEDKRELGDLFEYNSNLASSYMKVLEKLEEDFSEKFSN
FT                   KLDILIKQPNVVRKNELEIDEAEYSDIVKKTLHKAIDSFLEMKEGEGSRLKLYFEDRIK
FT                   SIEEKVVQIIEKKEEVAEDYREKLLERLEKVRRDIEFKEEDLLKEILLFTDKSDISEET
FT                   SRLESHLEQFKIELEKNESSIGKKLDFILQEMFRELNTTGVKCNLYDISKLVVECKNEV
FT                   EKIREQALNIE"
FT   gene            207756..207995
FT                   /locus_tag="Ilyop_0182"
FT   CDS_pept        207756..207995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0182"
FT                   /product="protein of unknown function DUF370"
FT                   /note="COGs: COG2052 conserved hypothetical protein;
FT                   InterPro IPR007169; KEGG: dtu:Dtur_1444 protein of unknown
FT                   function DUF370; PFAM: protein of unknown function DUF370;
FT                   SPTR: C6JIR2 Putative uncharacterized protein; PFAM: Domain
FT                   of unknown function (DUF370)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81971"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7L7"
FT                   /protein_id="ADO81971.1"
FT                   /translation="MRPINIGFGNMVIDERIIGIIAPDSAPSKRLKEEAKTQNKLIDAT
FT                   FGRKTRALIITDSDHVIMSAINPETIAVRIEKGE"
FT   gene            207998..208552
FT                   /locus_tag="Ilyop_0183"
FT   CDS_pept        207998..208552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0183"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COGs: COG0194 Guanylate kinase; InterPro
FT                   IPR017665:IPR008144:IPR020590:IPR008145; KEGG: fnu:FN2033
FT                   guanylate kinase; PFAM: guanylate kinase; PRIAM: Guanylate
FT                   kinase; SMART: guanylate kinase/L-type calcium channel
FT                   region; SPTR: C6JIR3 Guanylate kinase; TIGRFAM: guanylate
FT                   kinase; PFAM: Guanylate kinase; TIGRFAM: guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81972"
FT                   /db_xref="GOA:E3H7L8"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7L8"
FT                   /protein_id="ADO81972.1"
FT                   /translation="MKKGDLFVVSGPSGAGKSTVCKLVRRMLEINLAVSATTRAPRAGE
FT                   VDGREYYFLTMEEFQNKIKNNEFLEYANVHGNYYGTLKSEVEERLNEGKNIILEIDVQG
FT                   GIQAREEYPDVNLIFFKTPTKEDLEDRLRGRGTEDEETVRIRLENSLKELEFEKYYDKT
FT                   VINHSIEQACYDLIKIIKKEA"
FT   gene            208598..208810
FT                   /locus_tag="Ilyop_0184"
FT   CDS_pept        208598..208810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0184"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="InterPro IPR003716:IPR006110; KEGG: fnu:FN2032
FT                   DNA-directed RNA polymerase omega chain; PFAM: RNA
FT                   polymerase Rpb6; SPTR: C3WG91 Predicted protein; TIGRFAM:
FT                   DNA-directed RNA polymerase, omega subunit; PFAM: RNA
FT                   polymerase Rpb6; TIGRFAM: DNA-directed RNA polymerase,
FT                   omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81973"
FT                   /db_xref="GOA:E3H7L9"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:E3H7L9"
FT                   /protein_id="ADO81973.1"
FT                   /translation="MKKGITYDELLDKIPNKYVLATVAGKRCREIESGSESLVKGLKKD
FT                   TNVQKTFREILSDKIGYDIQETTGE"
FT   gene            208814..209806
FT                   /locus_tag="Ilyop_0185"
FT   CDS_pept        208814..209806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0185"
FT                   /product="ApbE family lipoprotein"
FT                   /note="COGs: COG1477 Membrane-associated lipoprotein
FT                   involved in thiamine biosynthesis; InterPro IPR003374;
FT                   KEGG: fnu:FN2031 thiamine biosynthesis lipoprotein ApbE;
FT                   PFAM: ApbE family lipoprotein; SPTR: A5TS51 Thiamine
FT                   biosynthesis lipoprotein ApbE; PFAM: ApbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81974"
FT                   /db_xref="GOA:E3H878"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:E3H878"
FT                   /protein_id="ADO81974.1"
FT                   /translation="MKKILFLLFLSVIGLFGCGNKRSQKIEKELFSFGTYIKITVYDED
FT                   SKKAEKAIEAAFKEIERIDSKLNTKKTGSIIDQINSSKDKKIKLDSEGKEIFSKVEELY
FT                   EVSNKKYDITISPLMDVWGFTTYESEKKLPSKKEIDKALSKIDYSKVSIKDDYLLFEKP
FT                   VEKIDTGSFLKGYAISRAKLIMKDMGIKSAFITSISSIETIGTKPGSKKWRIGLQNPSD
FT                   PTKILDVANLDDKAMGVSGDYQTFVEIDGKRYHHILDVKTGYPVSDKKMVVVICEDAFT
FT                   ADMLSTAFFSMPIKEILKYVEDKKNVDVFIVDADSKITTSTGFNYFLKK"
FT   sig_peptide     208814..208888
FT                   /locus_tag="Ilyop_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            209922..211913
FT                   /locus_tag="Ilyop_0186"
FT   CDS_pept        209922..211913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0186"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COGs: COG3808 Inorganic pyrophosphatase; InterPro
FT                   IPR004131; KEGG: fnu:FN2030 membrane-bound
FT                   proton-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase; PRIAM: Inorganic diphosphatase; SPTR:
FT                   C6JIR6 Pyrophosphate-energized proton pump; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H+
FT                   pyrophosphatase; TIGRFAM: vacuolar-type H(+)-translocating
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81975"
FT                   /db_xref="GOA:E3H879"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:E3H879"
FT                   /protein_id="ADO81975.1"
FT                   /translation="MEQFIYIGITGGLLALVASFFYSQKVLKYEIGNEKVAEITEAIRE
FT                   GAMAFLTAEYKILVWFVGGVAILLSTFLSIGVAATFILGAFTSAVAGNLGMRVATKANG
FT                   RTAIAAKEGGLAKALDVAFAGGAVMGLAVVGLGLIGVSVLTLVFNWDMGVITGFGMGAS
FT                   SIALFARVGGGIYTKAADVGADLVGKVEAGIPEDDPRNPATIADNVGDNVGDVAGMGAD
FT                   LFESYIGSIIATMALGATMAATTDMHGYMVAPILVASFGILASIIATLTVKTDDPKEVY
FT                   HKLENGTRIAGLLATIAAFMIVKFLGLPMGVFWAIVAGLVAGLVIAFFTGVYTDTGRKA
FT                   VNRIADAAETGAATTIIEGLAVGMESTVAPLIIISLAIIVAHSFAGLYGIAIAAVGMLA
FT                   TTGMVVAVDAYGPIADNAGGIAEMSELPPEVRECTDQLDAVGNSTAAVGKGFAIGSAAL
FT                   TALSLFAAYKEAVELKSGADLVIDVTNPKVIVGLFIGGMLTFLFSALTMTAVGKAAMEM
FT                   VAEVRRQFKEIPGIMDKTTKPDYKRCVEISTRSSLREMVIPGVLAVLAPVIVGMWSTEA
FT                   LGGLLAGALVTGILMAVMMANAGGAWDNAKKQIESGYKGDGKGSNRHKAAVVGDTVGDP
FT                   FKDTSGPSLNILIKLMSIVSLVLVPLFV"
FT   sig_peptide     209922..209978
FT                   /locus_tag="Ilyop_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            212209..214002
FT                   /locus_tag="Ilyop_0187"
FT   CDS_pept        212209..214002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0187"
FT                   /product="DNA primase"
FT                   /note="COGs: COG0358 DNA primase;
FT                   InterProIPR006295:IPR002694:IPR013264:IPR006171:IPR 006154;
FT                   KEGG: fnu:FN1319 DNA primase; PFAM: DNA primase catalytic
FT                   core domain; zinc finger CHC2-family protein; TOPRIM domain
FT                   protein; SMART: zinc finger CHC2-family protein; Toprim sub
FT                   domain protein; SPTR: C6JI11 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: Toprim domain; DNA primase catalytic core,
FT                   N-terminal domain; CHC2 zinc finger; DnaB-helicase binding
FT                   domain of primase; TIGRFAM: DNA primase, catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81976"
FT                   /db_xref="GOA:E3H880"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:E3H880"
FT                   /protein_id="ADO81976.1"
FT                   /translation="MRYNSEDVDKLIEELNIVEVVGEYVDLKRSGANFKGLCPFHKDNN
FT                   PSFVVSPSKNICKCFVCGAGGNSIKFYSDYNKVPFGQAIKDLSEKYKIKVKPVKGYDVL
FT                   RDTNKKYYEILNDALEYFCEKIFSNEGRDALEYLSKRKFKPDFISENKIGFAPRGWSNL
FT                   YDYLLNKGHELNDIVTLGLVKEGEKGHYDAFRDRIMFPIYSPSGSVIAFGGRSLEDRKD
FT                   IPKYINSPESPVFHKGQNLYGIKEKGNIIRRKAYSIVMEGYMDVLSAHSFGFDVTVASL
FT                   GTAFTEDQAKLLKRYTSNVILAFDMDNAGRVAAEKSGIILKSHGFNIRVLELENAKDPD
FT                   EFLKKYGKNEFLKSVKESKEIFDYLYEFYSKEYDLTNLMAKQNFVDRFKSFFQSVETDL
FT                   EKSLYIDKLSKSLEIDKELLNDILIINNKKSKKKIKSEIYKQKDFGEKRSEIIDKLEMD
FT                   TLKIILTKPEYYSYFQEKKIKSNLFHKIIVFFSEDHTSGNGVKMILNSDSFEEEEKKQI
FT                   IEIAASSIEYSDEKKLFKDFKEVYLGWFRREIKETLEKYKIHGDIVSFFKIRKISDNIE
FT                   KTDTDLEELKNLYREFKTFNI"
FT   gene            214020..215246
FT                   /locus_tag="Ilyop_0188"
FT   CDS_pept        214020..215246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0188"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="COGs: COG0568 DNA-directed RNA polymerase sigma
FT                   subunit (sigma70/sigma32);
FT                   InterProIPR014284:IPR012760:IPR011991:IPR013325:IPR
FT                   013324:IPR000943:IPR009042:IPR007627:IPR007624:IPR007630;
FT                   KEGG: fnu:FN1318 RNA polymerase sigma factor RpoD; PFAM:
FT                   sigma-70 region 3 domain protein; sigma-70 region 2 domain
FT                   protein; sigma-70 region 1.2; sigma-70 region 4 domain
FT                   protein; SPTR: D0BQ42 RNA polymerase sigma factor RpoS;
FT                   TIGRFAM: RNA polymerase sigma factor RpoD; RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: Sigma-70, region 4;
FT                   Sigma-70 region 3; Sigma-70 factor, region 1.1; Sigma-70
FT                   region 2; Sigma-70 factor, region 1.2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family; RNA polymerase
FT                   sigma factor RpoD, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81977"
FT                   /db_xref="GOA:E3H881"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3H881"
FT                   /protein_id="ADO81977.1"
FT                   /translation="MKDFIRNEKARALIRKSIEEKVITFEEVNEALQDDFPVDKIEFLI
FT                   NGMIDQGIKIIRREELEKVKSEDKDGKTSVKAATPKVAVKVDEKLDSEQVETNKKVKKV
FT                   EGDFNPAEIEEVTEEELSPEKLMTISSGVDVDEPIKMYLREIGQVPLLTHKQEIEHAKN
FT                   SAEGDEWATQQLVEANLRLVVSIAKKHTNRGLKLLDLIQEGNIGLMKAVEKFEYTKGYK
FT                   FSTYATWWIRQAITRAIADQGRTIRIPVHMIETINKIKKESRIYLQETGKDATPEVLAE
FT                   RLGMESEKIKAILEMNQDPISLETPVGSEEDSELGDFVEDNKMLSPYEQTNRNLLKEQL
FT                   DDVLQSLSEREEKVLRFRYGLDDGCPRTLEEVGKIFKVTRERIRQIEVKALRKLRHPSR
FT                   RKKLEDFKM"
FT   gene            215338..216327
FT                   /locus_tag="Ilyop_0189"
FT   CDS_pept        215338..216327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0189"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="COGs: COG0568 DNA-directed RNA polymerase sigma
FT                   subunit (sigma70/sigma32);
FT                   InterProIPR014284:IPR011991:IPR013325:IPR013324:IPR
FT                   000943:IPR007627:IPR007630; KEGG: fno:Fnod_0431 RpoD family
FT                   RNA polymerase sigma factor; PFAM: sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; SPTR: A7HK63 RNA
FT                   polymerase sigma factor; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70
FT                   region 2; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81978"
FT                   /db_xref="GOA:E3H882"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3H882"
FT                   /protein_id="ADO81978.1"
FT                   /translation="MSLNIKKLKKKIKEKVLLQKDFEEFVCQECSEEKDFQDLIDLIFK
FT                   ENIEIQENEENYEDNIGDGYYSEEILEQYFHDISLYTPIPKEKEKDIVKKAQDGDEEAR
FT                   EMLVTSNLKLVAKIAMKYSKSGVNYIDLIQDGTIGLIAAIDKYDLSKGHSFTSYSVWWI
FT                   KREIINSIANRINAIKIPSYVYLMNKKIRIFEDDFMERNNKKPSYQEISEALNLSLEEV
FT                   EKMKEASEIGVGGFADGNEPDLGDFNTVDQIDKELNLLEERSKISNLMRKISPEEQKVV
FT                   EMYYGLDDNKRLGFKEISKIMGVSVEKVKFLKERAILKLKCANERMWG"
FT   gene            216327..217394
FT                   /locus_tag="Ilyop_0190"
FT   CDS_pept        216327..217394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0190"
FT                   /product="protein of unknown function DUF34"
FT                   /note="COGs: COG0327 conserved hypothetical protein;
FT                   InterPro IPR002678; KEGG: cdl:CDR20291_1306 hypothetical
FT                   protein; PFAM: protein of unknown function DUF34; SPTR:
FT                   Q18BX9 Putative uncharacterized protein; PFAM: NIF3 (NGG1p
FT                   interacting factor 3); TIGRFAM: dinuclear metal center
FT                   protein, YbgI/SA1388 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81979"
FT                   /db_xref="GOA:E3H883"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017221"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:E3H883"
FT                   /protein_id="ADO81979.1"
FT                   /translation="MRLSEITKKLEKAFPKDIAESWDNVGLLVGEKNKDIKKIQISLDA
FT                   TEKVIEEAVKNNADLIITHHPLIFSPLKAINDSTLLGKKIMKLIKNDIALYSMHTNLDS
FT                   AENGLNKYVAEIIGARESKIIAENYRDVYKLAVYVPKENHKEVLKKVQETGVSLEGYDD
FT                   VSYSTECIERYRISGEDNAHTVDNIKVEVIGEKGKMFQLLNEIRKIHPYDQVPYEIFSV
FT                   ENRYLKGGIGRVFSLEKPVLFKEYVNLVKEKLSIENLRIVAENEEKSVKKVAVVNGSGM
FT                   SFFKKIKKLGVDVFVTGDIKYHEALDAAEEGLNLIDLGHYESEHFFNRLVVRELIELTD
FT                   VETYIMNEKPIFKYR"
FT   gene            217406..217966
FT                   /locus_tag="Ilyop_0191"
FT   CDS_pept        217406..217966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN1315 hypothetical protein; SPTR: C3WG21
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81980"
FT                   /db_xref="GOA:E3H884"
FT                   /db_xref="UniProtKB/TrEMBL:E3H884"
FT                   /protein_id="ADO81980.1"
FT                   /translation="MRKKILVLFILILSVVSFSQITDNLGSFSDEETKRIETKMEEISK
FT                   NSELDLYINTYKAGENTQLKVLEKSVIIDMVKVDNEHLNVKLSFSQDIDISSYQEELEN
FT                   VLGNLGNLITEGENEKYTLELLNSLEDIFKRMGEDKEIQKEKFSKRGNLNGVFLFLVFL
FT                   GIGVFVGKNKKVREFFSKIIKNR"
FT   sig_peptide     217406..217492
FT                   /locus_tag="Ilyop_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            217960..218300
FT                   /locus_tag="Ilyop_R0015"
FT   ncRNA           217960..218300
FT                   /locus_tag="Ilyop_R0015"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 285.21"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            218696..220205
FT                   /locus_tag="Ilyop_R0016"
FT   rRNA            218696..220205
FT                   /locus_tag="Ilyop_R0016"
FT                   /product="16S ribosomal RNA"
FT   gene            220415..223344
FT                   /locus_tag="Ilyop_R0017"
FT   rRNA            220415..223344
FT                   /locus_tag="Ilyop_R0017"
FT                   /product="23S ribosomal RNA"
FT   gene            223420..223535
FT                   /locus_tag="Ilyop_R0018"
FT   rRNA            223420..223535
FT                   /locus_tag="Ilyop_R0018"
FT                   /product="5S ribosomal RNA"
FT   gene            223675..224025
FT                   /locus_tag="Ilyop_0192"
FT   CDS_pept        223675..224025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0192"
FT                   /product="LSU ribosomal protein L19P"
FT                   /note="COGs: COG0335 Ribosomal protein L19; InterPro
FT                   IPR001857:IPR018257; KEGG: lba:Lebu_1512 ribosomal protein
FT                   L19; PFAM: ribosomal protein L19; SPTR: C6JL14 50S
FT                   ribosomal protein L19; TIGRFAM: ribosomal protein L19;
FT                   PFAM: Ribosomal protein L19; TIGRFAM: ribosomal protein
FT                   L19, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81981"
FT                   /db_xref="GOA:E3H885"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:E3H885"
FT                   /protein_id="ADO81981.1"
FT                   /translation="MKEKLIQLVEQNYIRTDVPQFKAGDTIVVHYRVKEGEKERIQLFE
FT                   GVVIRVNGGGVAKTFTVRKVTGGVGVERIIPVNSPMIEKIEVKRIGKVRRSKLYYLREL
FT                   SGKKARIKEIRK"
FT   gene            224301..224450
FT                   /locus_tag="Ilyop_0193"
FT   CDS_pept        224301..224450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vex:VEA_000618 hypothetical protein; SPTR:
FT                   A7VDM8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81982"
FT                   /db_xref="UniProtKB/TrEMBL:E3H886"
FT                   /protein_id="ADO81982.1"
FT                   /translation="MEKIKCPHCGNLSGEVDYERVTKHFVCNECSSMFHTIQENGKIKV
FT                   ELEV"
FT   gene            224572..225492
FT                   /locus_tag="Ilyop_0194"
FT   CDS_pept        224572..225492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0194"
FT                   /product="signal peptidase I"
FT                   /note="InterProIPR000223:IPR011056:IPR015927:IPR019757:IPR
FT                   019758:IPR019759; KEGG: fnu:FN0370 signal peptidase I;
FT                   PFAM: Peptidase S24/S26A/S26B, conserved region; SPTR:
FT                   C6JL15 Signal peptidase I; TIGRFAM: signal peptidase I;
FT                   PFAM: Peptidase S24-like; TIGRFAM: signal peptidase I,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81983"
FT                   /db_xref="GOA:E3H887"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E3H887"
FT                   /protein_id="ADO81983.1"
FT                   /translation="MEKEKIVINGIFYLFLTTCFLLLWIKEKEVVELIKEYRGAFSQKV
FT                   ISIFNIESPTTQKGVKKTVNFVETIGSALILVLIIQKFYLGNFLVPTGSMIPTIMPKDR
FT                   IFGNMVVYSFKQPKREDIIVFREPVENKVLYTKRVMGLPGEEVKIEFGHLYINNKRIDS
FT                   REYSNLGFIQYDTWTIPKKGDTVEIVPGADYTSEIKSEDIEEIQEFLLEKPGQLKEILP
FT                   DVDFYVNGKKTGMILDYIHDKDMLDDILEGKTVKTQIDENYYMVLGDNTDGSYDSRMWG
FT                   FVAENRIKGKAFVRFWPLNRMGLVK"
FT   gene            225502..225933
FT                   /locus_tag="Ilyop_0195"
FT   CDS_pept        225502..225933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0195"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="COGs: COG0456 Acetyltransferase; InterPro
FT                   IPR006464:IPR000182:IPR016181; KEGG: fnu:FN0369
FT                   ribosomal-protein-alanine acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: C6JL16
FT                   Ribosomal-protein-alanine acetyltransferase; TIGRFAM:
FT                   ribosomal-protein-alanine acetyltransferase; PFAM:
FT                   Acetyltransferase (GNAT) family; TIGRFAM:
FT                   ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81984"
FT                   /db_xref="GOA:E3H888"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3H888"
FT                   /protein_id="ADO81984.1"
FT                   /translation="MQIIQGMDTDNIEELYQLEKKYFPGNYYSRDSLFKMLENSRYYFW
FT                   GVWKKERLIGYVILLDSIDIFEIIKIAVNTSCRNQGIGEKMLRTILQNVEKNIHLEVRE
FT                   SNLAAIKLYEKMGFKNLFKRKDYYGDTGEDALVMALSKQ"
FT   gene            225997..227430
FT                   /locus_tag="Ilyop_0196"
FT   CDS_pept        225997..227430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0196"
FT                   /product="adenylosuccinate lyase"
FT                   /note="COGs: COG0015 Adenylosuccinate lyase;
FT                   InterProIPR004769:IPR008948:IPR020557:IPR000362:IPR 019468;
FT                   KEGG: fnu:FN0368 adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; Adenylosuccinate lyase-like; SPTR: C3WEX1
FT                   Adenylosuccinate lyase; TIGRFAM: adenylosuccinate lyase;
FT                   PFAM: Lyase; Adenylosuccinate lyase C-terminus; TIGRFAM:
FT                   adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81985"
FT                   /db_xref="GOA:E3H889"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:E3H889"
FT                   /protein_id="ADO81985.1"
FT                   /translation="MENNVYSNPLVERYGSKEMLENFSPDKKFSTWRKLWIALAEAEKD
FT                   LGLNITEEQLEEMRANVNNIDYELAKAKEREFRHDVMAHVHTFGTAAPKAMPIIHLGAT
FT                   SAYVGDNTDLIQIKDGLEILKSKMVNVIDSMAKFSIEYKDLPTLGFTHFQPAQLTTVGK
FT                   RSTLWLQSLLLDFEELEFRAETLRFRGVKGTTGTQASYLELFNGEFEKVKKLDEIVAEK
FT                   MGFSKSFLVTGQTYDRKVDSEILNLLSNIAQSAHKFTNDLRLLQHLKEIEEPFEKSQIG
FT                   SSAMAYKRNPMRSERISSLAKFVVAMQQSTAMTAATQWFERTLDDSANKRLSIPQAFLA
FT                   IDSILLIWQNIMDGLVVYPKMIEKRIMSELPFMATEYIIMEGVKSGGDRQELHERIRVH
FT                   SMEAAKTVKLEGKENDLIERIIKDDYFNIDKERLLEILDPKNFVGFSSEQTLEFIEKDV
FT                   NPIIKKYEAMIGIEAELRV"
FT   gene            227430..227945
FT                   /locus_tag="Ilyop_0197"
FT   CDS_pept        227430..227945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0197"
FT                   /product="Heptaprenyl diphosphate synthase component I"
FT                   /note="COGs: COG4769 membrane protein; InterPro
FT                   IPR014535:IPR010898; KEGG: fnu:FN0367 integral membrane
FT                   protein; PFAM: Heptaprenyl diphosphate synthase component
FT                   I; SPTR: C6JL18 Trans-hexaprenyltranstransferase; PFAM:
FT                   Heptaprenyl diphosphate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81986"
FT                   /db_xref="GOA:E3H890"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:E3H890"
FT                   /protein_id="ADO81986.1"
FT                   /translation="MLKNKREGYLIALVLIALYFSLLENLIPKPFPWMKIGLANLATII
FT                   ALEKFDKKMAFEVVGLRIIIQGLMLGTLFTPGFFVSLTAGTASTVVMVFLYNFRKNLSL
FT                   MAISSFSAVVHNITQLFVVYFLMFRNIDVYTKSILSFVLLFLALGWLSGMVTGYLGERL
FT                   NLRRRIRN"
FT   gene            227942..229297
FT                   /locus_tag="Ilyop_0198"
FT   CDS_pept        227942..229297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0198"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR006352:IPR016055:IPR016066:IPR005844:IPR
FT                   005845:IPR005846:IPR005843:IPR005841; KEGG: fnu:FN0366
FT                   phosphoacetylglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase; PRIAM:
FT                   Phosphoglucosamine mutase; SPTR: C3WEX3 Phosphoglucosamine
FT                   mutase; TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I; TIGRFAM: phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81987"
FT                   /db_xref="GOA:E3H891"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E3H891"
FT                   /protein_id="ADO81987.1"
FT                   /translation="MRKYFGTDGIRGEANKELTVDIALRLGYAIGHYLRKKNPNKKLKV
FT                   IMGTDTRISGYMLRSALFAGMTSMGVDIDFVGVIPTPGVSYLTRKLSADAGIMISASHN
FT                   PAKDNGIKIFASNGYKLPDEVELELENLMDRFEEISKECMPGDKVGKFKYADNEYYLYR
FT                   DYMISTVKGDFSGMKIILDTANGAAYRIARQVFLALGAEIVVINDAPNGTNINVKCGST
FT                   HPEILAKVVTGYEADLGLAYDGDADRLMAVDKNGNVIDGDKIIAILAKEMKSKGELNDN
FT                   RVVTTVMSNMGFENYLDKNGIGLIRANVGDRYVLEKMKVNGLNIGGEQSGHIILLDYNT
FT                   TGDGVLTSLKLVEALRDSEKSLDEHVVDIRDWPQVLINIKVSNDKKNLWNKNKKIMDII
FT                   QKKEEEMSGMGRVLVRTSGTEPIVRVMVEGKNQEMVDSVAIEISEVVKKELS"
FT   gene            229624..230337
FT                   /locus_tag="Ilyop_0199"
FT   CDS_pept        229624..230337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0199"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: eel:EUBELI_00500 hypothetical protein; PFAM:
FT                   Methyltransferase type 11; SPTR: C3WEX4 Putative
FT                   uncharacterized protein; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81988"
FT                   /db_xref="GOA:E3H892"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E3H892"
FT                   /protein_id="ADO81988.1"
FT                   /translation="MYQEFAKVYDKFMELADYDEWHDFVSYVIEGNNPGGKTLLDLGCG
FT                   TGEVLKRFLEEYECTGVDISEDMLLVTREKLNDLGKDVPLLCQDMKELSLDKKYDIVIS
FT                   LFDTVNHLVSIGDLEKLFERIKIHLNTKGIYIFDVVDRNFMDEMFPDGFFIDQREDMTV
FT                   IWEHYFEDQLDCIETTFFVEEKEGLYKKYREKHIKKIYTHKEIQEAAEKSGLHVENIYE
FT                   ESSLAGERFFYVIKK"
FT   gene            230611..230994
FT                   /locus_tag="Ilyop_0200"
FT   CDS_pept        230611..230994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0200"
FT                   /product="ATP synthase I"
FT                   /note="InterPro IPR008413; KEGG: fnu:FN0365 ATP synthase
FT                   protein I, sodium ion specific; PFAM: ATP synthase I; SPTR:
FT                   Q8KRV5 I-protein; PFAM: ATP synthase I chain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81989"
FT                   /db_xref="GOA:E3H893"
FT                   /db_xref="UniProtKB/TrEMBL:E3H893"
FT                   /protein_id="ADO81989.1"
FT                   /translation="MNQEIKKVLKNSIITTIIVLIYGILIRSPIIYIGMFGGCVISCMG
FT                   FYSICLEAEAAVRNNNPFKVTVTGYLKRYLIYGIYLGLLIKFLGIPTFLGGAIGLLNIK
FT                   FNIALMAILTVIKKIQSRLKKLK"
FT   gene            231024..231890
FT                   /locus_tag="Ilyop_0201"
FT   CDS_pept        231024..231890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0201"
FT                   /product="ATP synthase F0 subcomplex A subunit"
FT                   /note="COGs: COG0356 F0F1-type ATP synthase subunit a;
FT                   InterPro IPR000568; KEGG: fnu:FN0364 ATP synthase A chain,
FT                   sodium ion specific; PFAM: H+transporting two-sector ATPase
FT                   A subunit; SPTR: Q8KRV4 ATP synthase subunit a; TIGRFAM:
FT                   ATP synthase F0, A subunit; PFAM: ATP synthase A chain;
FT                   TIGRFAM: ATP synthase subunit 6 (eukaryotes),also subunit A
FT                   (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81990"
FT                   /db_xref="GOA:E3H894"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:E3H894"
FT                   /protein_id="ADO81990.1"
FT                   /translation="MKKFGPVILAAIIAVFTFAMKMLGIVQFETPPLVEGPKIMFYVPL
FT                   PQSMHDFPFALKMAEGSYGFPVTITIISTWCVMLFLILIFRWASQNLEIMPGKKQAFFE
FT                   TVYAFFDALIGQMLGAWKKKYFTYISTLFLFILISNIVSFFPIPGFSFEGGLLKIAPAL
FT                   RTPTADLNTTVGLALITTYSFMAASFRVSGFFGFFKGLFEPMPLMFPINLAGEFAKPTN
FT                   ISIRLFGNMFAGMVILGLLYKAAPALIPAPMHLYFDLFSGIVQSFVFIMLTMVYIQGSI
FT                   GDAEYVD"
FT   sig_peptide     231024..231107
FT                   /locus_tag="Ilyop_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            231934..232203
FT                   /locus_tag="Ilyop_0202"
FT   CDS_pept        231934..232203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0202"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /note="InterPro IPR005953:IPR002379:IPR020537:IPR000454;
FT                   KEGG: fnu:FN0363 F0F1 ATP synthase subunit C; PFAM:
FT                   H+transporting two-sector ATPase C subunit; SPTR: Q8KRV3
FT                   ATP synthase subunit c, sodium ion specific; TIGRFAM: ATP
FT                   synthase F0, C subunit; PFAM: ATP synthase subunit C;
FT                   TIGRFAM: ATP synthase, F0 subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81991"
FT                   /db_xref="GOA:E3H895"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E3H895"
FT                   /protein_id="ADO81991.1"
FT                   /translation="MDMLLAKTVVLAASAVGAGTAMIAGIGPGVGQGYAAGKAVESVAR
FT                   QPEAKGDIISTMVLGQAVAESTGIYSLVIALILLYANPFVGLLG"
FT   sig_peptide     231934..232038
FT                   /locus_tag="Ilyop_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            232306..232812
FT                   /locus_tag="Ilyop_0203"
FT   CDS_pept        232306..232812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0203"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="COGs: COG0711 F0F1-type ATP synthase subunit b;
FT                   InterPro IPR005864:IPR002146; KEGG: fnu:FN0362 ATP synthase
FT                   B chain, sodium ion specific; PFAM: H+transporting
FT                   two-sector ATPase B/B' subunit; SPTR: Q8KRV2 ATP synthase
FT                   subunit b, sodium ion specific; TIGRFAM: ATP synthase F0, B
FT                   subunit; PFAM: ATP synthase B/B' CF(0); TIGRFAM: ATP
FT                   synthase, F0 subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81992"
FT                   /db_xref="GOA:E3H896"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="UniProtKB/TrEMBL:E3H896"
FT                   /protein_id="ADO81992.1"
FT                   /translation="MATQNMPAVSIDINMFWQIINFLILMFFFKKYFQKPISKMLDARK
FT                   EKIANELKQAETDRKMAAEANEETQGILKAAKAEANEILLRAEKKADERKETILKEANA
FT                   QREKTIKSAELEVEKMKKQARKELQSEVTALAVSLAEKMINERLDSKLGENLLNDFIEE
FT                   VGEDR"
FT   gene            232809..233333
FT                   /locus_tag="Ilyop_0204"
FT   CDS_pept        232809..233333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0204"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /note="COGs: COG0712 F0F1-type ATP synthase delta subunit
FT                   (mitochondrial oligomycin sensitivity protein); InterPro
FT                   IPR000711:IPR020781; KEGG: fnu:FN0361 ATP synthase delta
FT                   chain, sodium ion specific; PFAM: H+transporting two-sector
FT                   ATPase delta (OSCP) subunit; SPTR: Q8KRV1 ATP synthase
FT                   subunit delta, sodium ion specific; TIGRFAM: ATP synthase
FT                   F1, delta subunit; PFAM: ATP synthase delta (OSCP) subunit;
FT                   TIGRFAM: ATP synthase, F1 delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81993"
FT                   /db_xref="GOA:E3H897"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:E3H897"
FT                   /protein_id="ADO81993.1"
FT                   /translation="MIEAQVGKRYAEAIYEMSESNKKVKELYEELNLVMELYKGDKEFK
FT                   NLVDHPLIKVEEKKEFIGKIFSKFEDFSLNVLFYLVEKKRLSYIKSIVAEYLKIYYTKN
FT                   QIVDVEAIFAIEPSEEQKTKLIKKLEKKTEKKVNLVVSIDKSIIAGGIIKIGDEIIDGS
FT                   VRRQLDTVANN"
FT   gene            233370..234872
FT                   /locus_tag="Ilyop_0205"
FT   CDS_pept        233370..234872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0205"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="COGs: COG0056 F0F1-type ATP synthase alpha subunit;
FT                   InterProIPR005294:IPR000793:IPR018118:IPR020003:IPR
FT                   004100:IPR000194; KEGG: fnu:FN0360 F0F1 ATP synthase
FT                   subunit alpha; PFAM: H+transporting two-sector ATPase
FT                   alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; PRIAM:
FT                   Sodium-transporting two-sector ATPase; SPTR: P29706 ATP
FT                   synthase subunit alpha, sodium ion specific; TIGRFAM: ATP
FT                   synthase F1, alpha subunit; PFAM: ATP synthase alpha/beta
FT                   family, beta-barrel domain; ATP synthase alpha/beta chain,
FT                   C terminal domain; ATP synthase alpha/beta family,
FT                   nucleotide-binding domain; TIGRFAM: proton translocating
FT                   ATP synthase, F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81994"
FT                   /db_xref="GOA:E3H898"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:E3H898"
FT                   /protein_id="ADO81994.1"
FT                   /translation="MKIRPEEISSIIKTEIENYKKSLDIKTSGSVVEVGDGIARIYGLS
FT                   NAKAGELLEFPNGIRGMVLNLEENNVGAVLLGDPTGVKEGDEVRATGEVAAVPAGEGLL
FT                   GRVVNALGEPIDGKGDIKTERMMTLERKAHGIIARKPVHEPLQTGIKSIDGMVPIGRGQ
FT                   RELIIGDRQTGKTAVALDAIINQKGTGVKCIYVAIGQRRSTVAQIVKKLENAGAMEYTI
FT                   VVAATASEPAPLQYMAPYCGVSMGEYFMDKGEHVLIVYDDLSKHAVAYREMSLLLKRPP
FT                   GREAYPGDVFYLHSRLLERAAKLSDDLGAGSITALPIIETQAGDVSAFIPTNVISITDG
FT                   QIFLDSELFNSGFRPAINAGISVSRVGGSAQIKAMKQVAAKVKLELAQYSELLTFAQFG
FT                   SDLDKATKAQLERGHRIMEVLKQDQYKPYRVEEQVVSFFMVLNGYVDDTPIEEVRRFEE
FT                   ELITHLKDNTEVLKEILEKKALSDEIEAKLRKAIEDFKKNFS"
FT   gene            234887..235735
FT                   /locus_tag="Ilyop_0206"
FT   CDS_pept        234887..235735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0206"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /note="COGs: COG0224 F0F1-type ATP synthase gamma subunit;
FT                   InterPro IPR000131; KEGG: fnu:FN0359 ATP synthase gamma
FT                   chain, sodium ion specific; PFAM: H+transporting two-sector
FT                   ATPase gamma subunit; SPTR: Q8KRU9 ATP synthase gamma
FT                   chain; TIGRFAM: ATP synthase F1, gamma subunit; PFAM: ATP
FT                   synthase; TIGRFAM: ATP synthase, F1 gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81995"
FT                   /db_xref="GOA:E3H899"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:E3H899"
FT                   /protein_id="ADO81995.1"
FT                   /translation="MAGGKELKGRIKSVQSTHQITKAMEIVSSTKFKRFSALVNQSKPY
FT                   SESMDNVLKNIAAGIKSERHPLFDGKKDVKKIGVIVMTSDRGLCGGFNNATLKKMEILI
FT                   AENPDKEVSIIGVGKKARDYCNKRNYDLKAEYIQLIPETMFVKAKEISENIVEYFYEDI
FT                   FDEVYMIYNEFISAMQTELIVKKVLPIERVEVQENTTYIFEPSVEGILSSLLPKYLNIR
FT                   IYQAILENTASEHSARKNAMKNATDNAEEMIADLNLQYNRERQAAVTQEISEIVSGASA
FT                   L"
FT   gene            235786..237189
FT                   /locus_tag="Ilyop_0207"
FT   CDS_pept        235786..237189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0207"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="COGs: COG0055 F0F1-type ATP synthase beta subunit;
FT                   InterProIPR005722:IPR000793:IPR018118:IPR020003:IPR
FT                   004100:IPR000194:IPR003593; KEGG: fnu:FN0358 F0F1 ATP
FT                   synthase subunit beta; PFAM: H+transporting two-sector
FT                   ATPase alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; PRIAM:
FT                   Sodium-transporting two-sector ATPase; SMART: AAA ATPase;
FT                   SPTR: Q8KRU8 Subunit beta; TIGRFAM: ATP synthase F1, beta
FT                   subunit; PFAM: ATP synthase alpha/beta family, beta-barrel
FT                   domain; ATP synthase alpha/beta chain, C terminal domain;
FT                   ATP synthase alpha/beta family, nucleotide-binding domain;
FT                   TIGRFAM: ATP synthase, F1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81996"
FT                   /db_xref="GOA:E3H8A0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E3H8A0"
FT                   /protein_id="ADO81996.1"
FT                   /translation="MENKGILTQIIGPVVDVSFDSELPKIYNSLRIDRGNGEVLIAEVQ
FT                   QHLGNSVVRAICMDGSEGLQRGMEVIDTGAPITVPVGKAVLGRILNVLGEPIDQAGEVK
FT                   AEEYSSIHREAPAFEDQGTEVEIFETGIKVIDLLAPYVKGGKIGLFGGAGVGKTVLIME
FT                   LINNIAKGHGGLSVFAGVGERTREGRDLFDEMTESGVLSKTSLVYGQMNEPPGARLRVA
FT                   LTGLTMAENFRDKEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATDMGAL
FT                   QERITSTKTGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRRIASLGIYPAVDPL
FT                   DSTSTALQPGITGHEHYTAAREVQSVLQRYKELQDIIAILGMDELSDEDKIAVNRARKI
FT                   ERFFSQPFHVAEQFTGMEGKYVTVKETIRGFKEILEGKHDDLPEQAFLYVGTIDEAIAK
FT                   ARELMKGDA"
FT   gene            237192..237596
FT                   /locus_tag="Ilyop_0208"
FT   CDS_pept        237192..237596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0208"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="COGs: COG0355 F0F1-type ATP synthase epsilon subunit
FT                   (mitochondrial delta subunit); InterPro
FT                   IPR001469:IPR020546:IPR020547; KEGG: fnu:FN0357 ATP
FT                   synthase epsilon chain, sodium ion specific; PFAM: ATPase,
FT                   F1 complex, delta/epsilon subunit-like; SPTR: Q8KRU7
FT                   Subunit epsilon; TIGRFAM: ATP synthase F1, epsilon subunit;
FT                   PFAM: ATP synthase, Delta/Epsilon chain, beta-sandwich
FT                   domain; ATP synthase, Delta/Epsilon chain, long alpha-helix
FT                   domain; TIGRFAM: ATP synthase, F1 epsilon subunit (delta in
FT                   mitochondria)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81997"
FT                   /db_xref="GOA:E3H8A1"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:E3H8A1"
FT                   /protein_id="ADO81997.1"
FT                   /translation="MATFKLEVITPIKKILEKEVEMIILRTTEGDMGVLANHAPFVAEL
FT                   AIGEMKIKSSDEEVAYFVSGGFIDISRERTTILADEALDAREIDVARAKKDAEVAQAKL
FT                   TKLKEDRDIAATQKALQDALTKVRIAEQYR"
FT   gene            complement(237630..240983)
FT                   /locus_tag="Ilyop_0209"
FT   CDS_pept        complement(237630..240983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cff:CFF8240_0312 hypothetical protein; SPTR:
FT                   A0RMT1 Putative uncharacterized protein; PFAM: Domain of
FT                   Unknown Function (DUF748)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81998"
FT                   /db_xref="GOA:E3H8A2"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:E3H8A2"
FT                   /protein_id="ADO81998.1"
FT                   /translation="MKPNKKIIITSVVLTLMLFFFLVKFPVYIKNTAIKKLEETLGRKI
FT                   NSGKFKYNHLTATIYLEDFQIMEADEKDIFLSFDSFNINIDPTKFIVKTLYFKEISLIN
FT                   PTFRYEVSDKGKNFDDILKKMSSGKNIESKENDMFFKKIGVGNILVDRYTLYYSDRTIK
FT                   GDSMVKFKSPKFQYENNTVNFSSGLELSKKDSIALSLEADTSTGDFKGVFNAENITLDE
FT                   NSFIIKKIKGYDSLTGNIKAEIPFSGNFKNKVYLLKGDVYSENFNIKNKTQSISFKSGD
FT                   ININEISFPKLSINIDKINLDNFVADYKQSPEDKKTKSNKSFEIPDFKIREINLSDSVI
FT                   LTSNSSLTKIGLSGKNISNEKNSESDIQLYFSLDEKTSISTDSTLRLKETLKNPKDLLQ
FT                   LITIEGKLNANGGDLDFLKYIKNLPYKMSSKDFSIGGDFLFKYPNISAAADISMKSLEG
FT                   FNDKESSFSMDQIEMSNKIHYHIENKKLDVSGPGEIKNMFFKSDKEKNLFEGDFSFLSK
FT                   ELSKESFILDSINLKNAKLDLTTKPKETENKEILEKEKNKIPWIKVANFDIQNSQILSD
FT                   NFSLTEIKGLFENLSTKKGEGKVNLAGKLNDKTSLAIKGDILLDKDLEFTEDVKDIGYR
FT                   GKVSLDSLGIEDLEPFLKEIPYKIEGVATLDSDISYSKGSLSSQNSLSIDNLNLYASES
FT                   TDEFSTKKIISSFLIQIKDKKYNITKGKFNLDEFKGIFGKNKYLSFSGNNISLILNRLN
FT                   KDEFNADELIISNPDVVINKKTENIEKTKKSEKSKMRIDIKKLNISDGYLDLLTKSSSY
FT                   PIDKLLLKLNDFSTSKNKKTDIILDSVIKTGGTLSAKGSYSLRKDWEFSPKTMDINGEF
FT                   TLNNLDLTPYKNILELYFPNYLNSGKTDWKASYKIEKGKLNGTNDITFKNISLGQSTGN
FT                   NTSIPLKTAVGILSDKSGNFNLKIPISGDLNNPQFKLRDIFIQSLKSILIKTVTSPLNI
FT                   ITKTIESEEISKINFIFLSDNLALTEIQKLEKISKMLKEREELNVKFILYTDFFRETEL
FT                   LRLKSIKDIILMSSKDSKDLESQVNELMNSRKEKIITYFREKSLDNRISVEVSTGKRIY
FT                   PQADVIFISP"
FT   sig_peptide     complement(240897..240983)
FT                   /locus_tag="Ilyop_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            241761..241958
FT                   /locus_tag="Ilyop_0210"
FT   CDS_pept        241761..241958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wbr:WGLp108 hypothetical protein; SPTR: A8SN20
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADO81999"
FT                   /db_xref="UniProtKB/TrEMBL:E3H8A3"
FT                   /protein_id="ADO81999.1"
FT                   /translation="MTKEEFLKSINITEETLRAEGKEVVKFDDGDPECLGWEVRYVDKE
FT                   NIEVILGCKCSDTGSIHTKM"
FT   gene            242172..243329
FT                   /locus_tag="Ilyop_0211"
FT   CDS_pept        242172..243329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0211"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="COGs: COG0683 ABC-type branched-chain amino acid
FT                   transport systems periplasmic component; InterPro
FT                   IPR001828; KEGG: ppd:Ppro_1970 extracellular ligand-binding
FT                   receptor; PFAM: Extracellular ligand-binding receptor;
FT                   SPTR: C6PUC6 Extracellular ligand-binding receptor; PFAM:
FT                   Receptor family ligand binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82000"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3H8A4"
FT                   /protein_id="ADO82000.1"
FT                   /translation="MKKVIVILIVVLSGLFLCKEISNRNTISIGVITTLSGEESSLGIS
FT                   VLNGIAMAAEEFNKDKKFYEKKVILTIKDDKNDFEESKKSAEELIDAGVVAILGPALSE
FT                   AGIAVSEVGNKREKLIISPTVATKKLSGKDDYFIRVTPSVDRNAVSLAEVSRDYMGMKK
FT                   ILLIYNEKNLAYTESFKDKYIEKFTENSNYENFVYIKKSSEKIASYFTKIKDEIDGVVI
FT                   IASPIDTAEITQKIKKIKRDIKILASDWAYHQNFITYGGKYAEGVYIAVNYDDAYFKKE
FT                   KGYLDERFKNFKKNYINKFKEDPNNGSLNGYESFNILVYAIRRNKGNSENLKREVLSTE
FT                   SEKYFLQPGKFDKYGDCERDTFVFQVKNKKFKRWNFRKTEISGKI"
FT   sig_peptide     242172..242225
FT                   /locus_tag="Ilyop_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            243355..245646
FT                   /locus_tag="Ilyop_0212"
FT   CDS_pept        243355..245646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0212"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain;
FT                   InterProIPR000014:IPR000160:IPR000700:IPR013656:IPR 001610;
FT                   KEGG: sse:Ssed_2182 diguanylate cyclase with PAS/PAC
FT                   sensor; PFAM: GGDEF domain containing protein; PAS fold-4
FT                   domain protein; SMART: GGDEF domain containing protein; PAS
FT                   domain containing protein; PAC repeat-containing protein;
FT                   SPTR: Q2BPZ7 Sensory box/GGDEF domain protein; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box; diguanylate
FT                   cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82001"
FT                   /db_xref="GOA:E3H929"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E3H929"
FT                   /protein_id="ADO82001.1"
FT                   /translation="MKKKSLKEFLFKKIIIMVILPMFILSCASILISVNSIRKRIERKN
FT                   IAVINMVNHFVDHYEELIMQVGEVFYEKHVVESEKNNYLNTLVKTHHILGKIEILNLKG
FT                   VIKYSSQGSEKIGYDMSNFEFVEKAIENDEYHWSEVMQSSSDGTQEIMLAKRLGENILV
FT                   GYVNIENLNIILKESLKNTGSKMVVLDNIGNIIFYDIDGMDSERKSEIKYKYISALENN
FT                   NSKNENFIKGRDTIIENYGRIGKTGWDILLVEDVSKGFIFLWDFYRQIVFGIGLFTLII
FT                   IYISYSGLDKLLKDMNKLKLISEKVSAGELPETLNYEISETEDLAGKFRLMGKVVLERE
FT                   KNIKEKAAFLQNLLDTIPSPVFYKDKNHVYLGCNKAFAEYIGVKKGELPGKGVYDVSPK
FT                   DKADIYKEADDKLLESGEEQVYHSKLMDKDGKIKDVKFYKSVFRDLNGQKNGIIGVILD
FT                   ITNLKEAIRTAEKKERMIEILLDTVPLPIYYQDKDGKYINCNKAFEELVGMKKDKIKGN
FT                   LQESVWGEKLAGCSAKRDMDLLKNKKHLKSENNIIDKNSEARIVVFDKTLFYTEEGEIG
FT                   GIIGAISDITDIRHMQEELKVLSIKDSLTGIYNRRGFEEMSERIFKESLRNKKNVSIIM
FT                   LDIDKFKLYNDHYGHQAGDECLKKIAEKLEKSCKRPSDIVGRYGGEEFIIFLPDTTLEG
FT                   ARTVAEKIRKNIENMEIEHVKSRHGGVVTVSLGISATVPNNEYEMEKLIGKADKMLYQA
FT                   KELGRNRVEG"
FT   sig_peptide     243355..243453
FT                   /locus_tag="Ilyop_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            245763..246341
FT                   /locus_tag="Ilyop_0213"
FT   CDS_pept        245763..246341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0213"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; InterPro
FT                   IPR001977; KEGG: fnu:FN1932 dephospho-CoA kinase; PRIAM:
FT                   Dephospho-CoA kinase; SPTR: C3WC42 Dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82002"
FT                   /db_xref="GOA:E3H930"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3H930"
FT                   /protein_id="ADO82002.1"
FT                   /translation="MIIGLTGGIASGKSTVSKILSKMGIIVVDADIVAREVMESKEVIK
FT                   RISDEFGENILDKKGKLDRSKLREVVFSSKKSVGKLNSIVHPTVIERFENERKKSIITG
FT                   EMLVFDIPLLFEAKMEDLCDKVIVVYVDIETQIKRVMERDGSKRETAINIIKNQMPLSE
FT                   KLERADIKIKNDGTIEELEKKIKDVFSKV"
FT   sig_peptide     245763..245852
FT                   /locus_tag="Ilyop_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            246525..248690
FT                   /locus_tag="Ilyop_0214"
FT   CDS_pept        246525..248690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0214"
FT                   /product="peptidase U32"
FT                   /note="COGs: COG0826 Collagenase and related protease;
FT                   InterPro IPR001539; KEGG: fnu:FN1931 protease; PFAM:
FT                   peptidase U32; SPTR: C6JQ35 Protease; PFAM: Collagenase;
FT                   Peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82003"
FT                   /db_xref="GOA:E3H931"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:E3H931"
FT                   /protein_id="ADO82003.1"
FT                   /translation="MNIVAPAGNMERFYAAVKAGADEIYMGIKGFGARRNAENFTLSEY
FT                   MEALDYAHERGVRIFLTLNTVMRDKEIEALYENIKVLYEQGLDAVIVQDLGLFRFIKDN
FT                   FPDICIHGSTQMTVANHIEANYLKKIGFSRVVLSRELSFKEIKSVKENTEIELEIFVSG
FT                   ALCISYSGNCYLSSFIGGRSGNRGLCAQPCRKEYTNSQGEKGYFLSPKDQLMGQEEIKK
FT                   LKEIGIESIKLEGRMKSPHYVFETVSYYRGLIKEIGVTERTSHLFNRGYSKGYFYDEKN
FT                   KIINSKFSSDFGKFIGSIEGKELKIAEDLMLGDGISYVSKDYEKLGGENVSKIKIKGKT
FT                   ENQKSAQARDRVLLDKVPREAKYVYKNYSKSLNDEISRGIKQNKKTIDIDGVFYGKIGE
FT                   RATLELICKNNKGENISVIENSEIFLEEASKRVISSEYIKIKLSETGETTFSINNLKVN
FT                   FDGKAFIPLSLIKKMRRNATEVLREKLILSHRRQAKKDIKKIDYSRSNNKNMKFSVIVS
FT                   NSSQRDTAVRYGIEKIYEKGLDVAKESQLGRIDLESKLAWNLYQLLENKNNAVTVNWNL
FT                   NITNTYALEEISKIPGADTVIISPELNLDRIKEIGETGIRKGLMIYGKLKGMFIEVPIF
FT                   QENKVTITNDQGDQFDVIKNSIGNSELYLETPMNLIPNLEKLLDAGIDELVLLFTDESE
FT                   EETEKILNSLKTKTGEYNPYNFQKGVY"
FT   gene            248703..249200
FT                   /locus_tag="Ilyop_0215"
FT   CDS_pept        248703..249200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0215"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /note="COGs: COG1267 Phosphatidylglycerophosphatase A and
FT                   related protein; InterPro IPR007686; KEGG: fnu:FN1930
FT                   phosphatidylglycerophosphatase A; PFAM:
FT                   phosphatidylglycerophosphatase A; SPTR: C6JQ36
FT                   Phosphatidylglycerophosphatase A; PFAM:
FT                   Phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82004"
FT                   /db_xref="GOA:E3H932"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:E3H932"
FT                   /protein_id="ADO82004.1"
FT                   /translation="MKKKTVKNLATCFGLGDLPKAPGTFGTLGGIPIFIGLTFIRRFFP
FT                   NNMVYNSFYFMFLITLFAVAVYVSDICEREIYREKDPQNVVIDEVLGFLTTLFLVNPVG
FT                   VVQNIGAIFLGFVIFRILDITKIGPIYKSQMFGHGVGVVLDDFLAGIIGNFIMVCIWSF
FT                   FF"
FT   gene            249219..250427
FT                   /locus_tag="Ilyop_0216"
FT   CDS_pept        249219..250427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0216"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="COGs: COG1058 nucleotide-utilizing enzyme related to
FT                   molybdopterin-biosynthesis enzyme MoeA; InterPro
FT                   IPR008135:IPR008136:IPR001453; KEGG: fnu:FN1929
FT                   competence-damage protein CinA; PFAM: CinA domain protein;
FT                   molybdopterin binding domain; SPTR: C6JQ37
FT                   Competence-damage protein CinA; TIGRFAM:
FT                   competence/damage-inducible protein CinA; PFAM: Probable
FT                   molybdopterin binding domain; Competence-damaged protein;
FT                   TIGRFAM: competence/damage-inducible protein CinA
FT                   N-terminal domain; competence/damage-inducible protein CinA
FT                   C-terminal domain; molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82005"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/TrEMBL:E3H933"
FT                   /protein_id="ADO82005.1"
FT                   /translation="MKAFIILVGTELLSGMTVDTNSLFMAEELNKYGIEISSKITVGDN
FT                   IKEIIKAIEFGKSQSDLIIMSGGLGPTMDDLTKEAIAKYLGKELVVDPEEYRELKKKFD
FT                   KLGIEFLDNNVKEVEKPEGAVSFGNGAGMAPGIYIDRIAAFPGIPRELYNLFPKFMDYY
FT                   AKENKLEDEIYIKDILVWGIPESHLEKRIKNFFDEKDIFYEFLAKDYGIVVRLQGKESS
FT                   KNLVEKIVEKIYNEIGHYVIGEDGKRVQDSVVSHLKTLGYNISLAESCTGGQIASMLVE
FT                   VSGVSKVFFEGIVCYSNDSKINRLKVSPETLKVYGAVSEETAREMLAGLKGDVAIATTG
FT                   IAGPQGGTKEKPVGTVYIGVRILDEYYIKKYEFKGDRKRIRRYSSMTALFKLLKMLEKR
FT                   VEY"
FT   sig_peptide     249219..249263
FT                   /locus_tag="Ilyop_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            250427..250975
FT                   /locus_tag="Ilyop_0217"
FT   CDS_pept        250427..250975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0217"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="InterPro IPR001387:IPR014710:IPR011051:IPR013096;
FT                   KEGG: fnu:FN1928 MerR family transcriptional regulator;
FT                   PFAM: Cupin 2 conserved barrel domain protein;
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: C3WC46 Transcriptional regulator;
FT                   PFAM: Cupin domain; Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82006"
FT                   /db_xref="GOA:E3H934"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3H934"
FT                   /protein_id="ADO82006.1"
FT                   /translation="MSLGERIKKNRNEKGLSLRDLAGRVDLSASFLSQIEQGKASPSIE
FT                   NLKKIANCLDVRVSYLIEDDEVKKNTDIIRKGERHFIESIDSNTKISLLTSSDIEKNME
FT                   PILYEIYPGGESGRDYYTHPGEEFIFILEGTLEIYINDMVHSLNEGDSLYFKSSQKHRF
FT                   VNNGDKVARALWVVTPPSF"
FT   gene            251004..251525
FT                   /locus_tag="Ilyop_0218"
FT   CDS_pept        251004..251525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0218"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="COGs: COG1778 Low specificity phosphatase (HAD
FT                   superfamily); InterPro IPR010023:IPR006549:IPR005834; KEGG:
FT                   fnu:FN0213 N-acylneuraminate-9-phosphatase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; PRIAM:
FT                   3-deoxy-manno-octulosonate-8-phosphatase; SPTR: C6JKS9
FT                   N-acylneuraminate-9-phosphatase; TIGRFAM:
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; HAD-superfamily hydrolase, subfamily IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82007"
FT                   /db_xref="GOA:E3H935"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3H935"
FT                   /protein_id="ADO82007.1"
FT                   /translation="MREKARKVKIIVLDVDGTLTDGKLYTDNNGVETKAFNAKDGMAIA
FT                   QGIKYGMKFAIVTGKNSQIVKARAQELGIEEVYQKVSNKIKVLDEILEKYKLTYEETAY
FT                   MGDDINDIPAIMRVGMSGAPFDSSNDILQMVDFKSSSKGGKGAVREFVEYILREKGIWN
FT                   KVLEDYRNKR"
FT   gene            251547..254066
FT                   /locus_tag="Ilyop_0219"
FT   CDS_pept        251547..254066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0219"
FT                   /product="DAK2 domain fusion protein YloV"
FT                   /note="COGs: COG1461 kinase related to dihydroxyacetone
FT                   kinase; InterPro IPR019986:IPR003797:IPR004007; KEGG:
FT                   fnu:FN1927 DegV protein; PFAM: Dak phosphatase; DegV family
FT                   protein; SPTR: C6JQ39 DEGV protein; TIGRFAM: DAK2 domain
FT                   fusion protein YloV; degV family protein; PFAM: DAK2
FT                   domain; Uncharacterised protein, DegV family COG1307;
FT                   TIGRFAM: EDD domain protein, DegV family; DAK2 domain
FT                   fusion protein YloV"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82008"
FT                   /db_xref="GOA:E3H936"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E3H936"
FT                   /protein_id="ADO82008.1"
FT                   /translation="MKIEVKVLNVQRLTKLFIASSRWLSKYADVLNDLNVYPVPDGDTG
FT                   TNMSMTLQSVENELVKLNHEPDMEEFCEIVSEAILLGARGNSGTILSQIIQGFLSGISH
FT                   TENVTVDDAVVAFKKAKEKAYQSVTEPVEGTILTVIRVVSEEAEKYQGPKDDFILFLAH
FT                   LKNVAGKAVEETPNLLPKLKEAGVVDAGGKGMFYILEGFEKSVTDPEMLKDLERIVQSQ
FT                   SNRRERLEHSVTSLEKINFKYCTEFIIESGDFDLEKYKSDIINLGDSVICAQTSKKTKT
FT                   HIHTNNPGKVIEIAGSLGDLNHIKIENMKIQHRNVLTKDARYQSEKSMKSKTVFKNENS
FT                   RPIAYFAVADNLQMGELFINSGASAVLIGGQTQNPSVSDLEKTLDHIKAEKIIILPNNK
FT                   NIISAAKIVAERSIKEITVIETKSMLEGHYILKNKMETLNYLVKGVKRNISVEITKAVR
FT                   ETKSEDMMIKKGDHIALVNGKIMKKSDKIETLIEDVYGSYISEDTLSVFAVMGKESTEE
FT                   GNKVLKPGLDVRYSDYPGMQDNYSYYIYIENRDPELPEIAVVTDSTSDLSEEFVADMNI
FT                   DIIPLKLKFESDKYYKDGIDISKEDFWRTVLSKNVIPKTSQPSPGEFKDLYERLFNKGY
FT                   KKIISIHISSKLSGTQQAAKVARGMLGREKDVAIVDSKSVTLGLGHLALESARLVKEGH
FT                   SFNEILEWIDEAQNKIKVYFVVKELSFLEKGGRIGKASSVIGDVFQIKPVLTIENGEVC
FT                   TEKKPIGEIGAMRYMEKIIKNESKNGSIILYTGWGGTQDELDSADQLRSIGDKQKKADY
FT                   RGRFEIGAAIGSHSGPVYGMVIFPKIR"
FT   sig_peptide     251547..251630
FT                   /locus_tag="Ilyop_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            254383..255306
FT                   /locus_tag="Ilyop_0220"
FT   CDS_pept        254383..255306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0220"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR002178:IPR000644:IPR016152; KEGG: fnu:FN1926 nitrogen
FT                   regulatory IIA protein; PFAM: CBS domain containing
FT                   protein; phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; SPTR: C6JQ41 Nitrogen
FT                   regulatory IIA protein; PFAM: CBS domain;
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82009"
FT                   /db_xref="GOA:E3H937"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E3H937"
FT                   /protein_id="ADO82009.1"
FT                   /translation="MKLSSYLDPKLIFTDLEVETKEEAIKLLIEKSAQEDKKIASMKKD
FT                   IIKSVLERENEISTAMGQGIAIPHARIEGLDDFIIIIGLLKNPIKCQVAALHKEDDVKM
FT                   VILLVSEVLRNKRMLKVMSGIMKIAVKHPKVLEEIKSSSNSNILFDFIKNAEVEIDGKI
FT                   VAEDVQSPELMPVHPNDTLDKVAKRLIIEDRTGLPVVKDGYFLGEITERELIEFGMPKY
FT                   TSVMQDLNFLTVGEPFEEYLVNEKIATIEELYRKIDVITVDKKTPIMEICFLMVNKGKT
FT                   RIYVVENGKYYGMIQRSDIIKKVLHI"
FT   gene            255319..256599
FT                   /locus_tag="Ilyop_0221"
FT   CDS_pept        255319..256599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0221"
FT                   /product="possible tyrosine transporter P-protein"
FT                   /note="COGs: COG1055 Na+/H+ antiporter NhaD and related
FT                   arsenite permease; InterPro IPR004680:IPR000802; KEGG:
FT                   fnu:FN1925 arsenical pump membrane protein; PFAM: Citrate
FT                   transporter; SPTR: C3WC49 Arsenical pump membrane protein;
FT                   PFAM: Citrate transporter; (TC 2.A.45.2.1)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82010"
FT                   /db_xref="GOA:E3H938"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:E3H938"
FT                   /protein_id="ADO82010.1"
FT                   /translation="MLQLIVGLLIFIFVFFLIITEKVPSVLATMGGGLAMALVGLLNEE
FT                   QALEAVASRLEIIFLLIGMMIVVHLISETGVFQWFAIRVAQIVRGEPFALIVLLSVVTA
FT                   ICSAFLDNVTTILLMAPVSILLAEQLKQKPFPFIMTEIMAANIGGSATLIGDPTQLIIG
FT                   NEGKLGFNDFIINTAPVSILAFISLMVTVYILYGRKMIVSRDLKARIMDLDASRSLRNM
FT                   SLLKQSGTIFVLIITGFIMNNFIDKGLAIIALSGATALIILAKKKPEDIFKHVEWDTLF
FT                   FFIGLFIMIKGVEETHLIDLLGEKIVNITEGNFNFAVMLITWVSALFTSVIGNVANAAT
FT                   VSKIIHVMTPSFQSLGDVKVFWWGLSLGSCLGGNATILASATNVVAVAAAAKAGCKISF
FT                   VEFVKFGAIISIQTLVIASAYIWLRYL"
FT   sig_peptide     255319..255402
FT                   /locus_tag="Ilyop_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            256742..257464
FT                   /locus_tag="Ilyop_0222"
FT   CDS_pept        256742..257464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0222"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="COGs: COG0340 Biotin-(acetyl-CoA carboxylase)
FT                   ligase; InterPro IPR004408:IPR004143; KEGG: fnu:FN1921
FT                   biotin operon repressor; PFAM: biotin/lipoate A/B protein
FT                   ligase; SPTR: C6JQ43 Biotin-[acetyl-CoA-carboxylase]
FT                   ligase; TIGRFAM: biotin/acetyl-CoA-carboxylase ligase;
FT                   PFAM: Biotin/lipoate A/B protein ligase family; TIGRFAM:
FT                   birA, biotin-[acetyl-CoA-carboxylase] ligase region"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82011"
FT                   /db_xref="GOA:E3H939"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:E3H939"
FT                   /protein_id="ADO82011.1"
FT                   /translation="MRVFRFGEIDSTNSFLKRENKLENYDLAMAKNQTEGRGRRGNSWV
FT                   SKEGAALFSFVLKENSKLPMEEYRKLPLVVGVAVLRALKKFQSLDYKFKWTNDIYVNEK
FT                   KISGILVEKINENFIIGIGINVNNEDFGDLKNSATSLKIESNKEFNIEELILTVVEEFK
FT                   NCFEEFLNGGWELILKEINEKNYLLDKPVTIKIIDKITRGIGGKVLDDGTLEVDVEGIK
FT                   KSFDIGEVHISFKDKAVK"
FT   gene            257494..258564
FT                   /locus_tag="Ilyop_0223"
FT   CDS_pept        257494..258564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0223"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="COGs: COG0482
FT                   tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
FT                   contains the PP-loop ATPase domain; InterPro
FT                   IPR004506:IPR014729:IPR018318; KEGG: lba:Lebu_0523
FT                   tRNA(5-methylaminomethyl-2-thiouridylate)-methyl
FT                   transferase; PFAM: tRNA methyl transferase-like; SPTR:
FT                   C7NES3 tRNA(5-methylaminomethyl-2-thiouridylate)-methyl
FT                   transferase; TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   PFAM: tRNA methyl transferase; TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82012"
FT                   /db_xref="GOA:E3H940"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E3H940"
FT                   /protein_id="ADO82012.1"
FT                   /translation="MKKKVVVGMSGGVDSSVAAYLLKEEGYEVIGVTLKHLSDEDSENT
FT                   NTKTCCSLDDIYDAKMACFKLGIPHYVVDAVEPFKKDVIDYFIGEYSKGITPSPCVVCD
FT                   EKIKIKKLAETADKLGADYISTGHYCDVSYSQELGSHLLKLSKNSAKDQTYMLYRIGEN
FT                   ILKRMLFPLKNFEKKKVRGIAKEAGISVHDKKDSQGICFAPEGYKELLKRILGEKIKPG
FT                   NFITRDGHILGQHEGYQLYTIGQRRGLGINLSKVYFITGIDSDKNEIILGDFEELMKKE
FT                   VELTDTVFLADIEKLEKIKLFGRPRFSSIGLPGRLKKIDNRIFFIYDEENAKNSPGQHM
FT                   VIYYKDLVVGGGKIIF"
FT   gene            complement(258603..260858)
FT                   /locus_tag="Ilyop_0224"
FT   CDS_pept        complement(258603..260858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0224"
FT                   /product="aconitate hydratase domain protein"
FT                   /note="COGs: COG1048 Aconitase A;
FT                   InterProIPR015931:IPR015932:IPR015928:IPR001030:IPR
FT                   003006:IPR000573; KEGG: cpy:Cphy_2458 hypothetical protein;
FT                   PFAM: aconitate hydratase domain protein; SPTR: B0A7I2
FT                   Putative uncharacterized protein; PFAM: Aconitase
FT                   C-terminal domain; Aconitase family (aconitate hydratase)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82013"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:E3H941"
FT                   /protein_id="ADO82013.1"
FT                   /translation="MIKLSEAGVYLVNGKEIIPADSGKNLGTTPEEARKNTIAYSILKS
FT                   HNKSDNMEKLNIKFDCMASHDITYVGIIQTARASGLKKFPIPYVLTNCHNSLCAVGGTI
FT                   NEDDHMFGLSAAKKYGGIYVPAHQAVIHQYMREEMAGCGKMILGSDSHTRYGALGTMAI
FT                   GEGGGELAKQLLNKTYDINCPEVVGVYLTGKPKKGIGPQDIALAIIGAVFKNGYVKNRV
FT                   MEFVGDGISDLDVEFRNGIDVMTTETTCLSSIWVTDDKVKNYLDTHSRIKDYKELKPGN
FT                   IAYYDRMIQVDLSEVESMIALPFHPSNVYTIKELNANLEEILTKVEKEAAEQGLKIDLK
FT                   SKIIDGKLHAEQGIIAGCAGGTYDNLMDVADILDNKAVSSHDFSLSVYPSSQPTALSLV
FT                   KNGSTAKFMAAGAIVRTAFCGPCFGAGDTPANNQLSLRHTTRNFPSREGSKPGEGQISS
FT                   VALMDARSIAATAINGGILTPATDLDIEYTKPEYKFDSTVYKNRVYYGYEHPLDSELTF
FT                   GPNIVDWPAMPKLTDNLLLKVTAFIKDPVTTTDELIPSGEASSFRSNPLKLAEFTLSRR
FT                   VPEYVEKSKAVQIFEKEREDGKDPVALDINLKKVFDKIKTIPGLENIDPKATGIGSTIY
FT                   ANKPGDGSAREQAASCQKVLGGWANISKEYATKRYRSNLINWGMVPFTIEGEVPFENED
FT                   FILIRDIKNSIAEKKDTIKAYVIGDEIKEFDLTLTDLTDEERETIIEGCLINYYKKS"
FT   gene            complement(260942..261973)
FT                   /locus_tag="Ilyop_0225"
FT   CDS_pept        complement(260942..261973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0225"
FT                   /product="Isocitrate dehydrogenase (NAD(+))"
FT                   /EC_number="1.1.1.41"
FT                   /note="COGs: COG0473 Isocitrate/isopropylmalate
FT                   dehydrogenase; InterPro IPR001804:IPR019818; KEGG:
FT                   amt:Amet_1319 isocitrate dehydrogenase (NAD(+)); PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; PRIAM: Isocitrate
FT                   dehydrogenase (NAD(+)); SPTR: C4BW37
FT                   Isocitrate/isopropylmalate dehydrogenase; PFAM:
FT                   Isocitrate/isopropylmalate dehydrogenase; TIGRFAM:
FT                   isocitrate dehydrogenase, NAD-dependent, mitochondrial
FT                   type; isopropylmalate/isohomocitrate dehydrogenases;
FT                   isocitrate dehydrogenase, NADP-dependent, prokaryotic type"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82014"
FT                   /db_xref="GOA:E3H942"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E3H942"
FT                   /protein_id="ADO82014.1"
FT                   /translation="MHKITLIPGDGIGPEVTGSTVKILEAAGFKVEWEVVNAGSEVFEK
FT                   TGVLVPDEVFQSIERNKIALKGPIATPIGKGFRSINVQLRKKYDLYSNIREVKNIPGVK
FT                   SKYENVDLVIFRENTEGLYIGIEEMQDEDTAVAKKVVTRKGSMRIAKSAFEYAVQQGKT
FT                   KVAAVHKANILKLADGLFLDCVREVAKDYPNIELSEVIVDNMCMQMVMNPSQFEVIVAP
FT                   NLYGDLLSDLAAGLVGGLGLVPGANIGNDIAIFEAVHGSAPDIAGKDLANPIAVLLCAV
FT                   HMMKFLGDFDRAELVFRAIIEVMEDGKHLTRDMGGNATTTEITQAIIDKINHIKSFSSR
FT                   IVK"
FT   gene            262846..263910
FT                   /locus_tag="Ilyop_0226"
FT   CDS_pept        262846..263910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0226"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000994:IPR001131:IPR000587; KEGG: lba:Lebu_0529
FT                   peptidase M24; PFAM: peptidase M24; creatinase; SPTR:
FT                   C4BZ55 Xaa-Pro aminopeptidase; PFAM: Metallopeptidase
FT                   family M24; Creatinase/Prolidase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82015"
FT                   /db_xref="GOA:E3H943"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E3H943"
FT                   /protein_id="ADO82015.1"
FT                   /translation="MILNKIMKELDAQGILITNMINVRYFTGFTGTTGVALILGDKRYF
FT                   LTDFRYEEQGKKEVVPKGFQLVREDKDPVGKAGELIKESKIKKLAIEDGSVTLSQYRSF
FT                   EKNFGNLEYTGIEDKFLKARMVKTEEEIKLIKEATKIADKAFENIKSLIKEGISEERLA
FT                   TELEYEMKKLGAEGPSFDTIIASNYRSAMPHGVASEKKLQKEGFVKFDFGCFYKGYVSD
FT                   MTRTVYLGINPTERHYEIYNTVKEAQKKAIDAVKAGITTRELDKIARDYITEKGYGDCF
FT                   GHGLGHGIGLEIHEYPYLSYKAEDLVLEENMVVTIEPGIYIEGFGGVRIEDDVVVKKDG
FT                   CEVLNKTTKEFVKL"
FT   gene            264130..264777
FT                   /locus_tag="Ilyop_0227"
FT   CDS_pept        264130..264777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0227"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1802 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011991:IPR011711; KEGG: chy:CHY_0189 GntR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   GntR HTH; GntR domain protein; SMART: regulatory protein
FT                   GntR HTH; SPTR: C6PSW8 Transcriptional regulator, GntR
FT                   family; PFAM: Bacterial regulatory proteins, gntR family;
FT                   FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82016"
FT                   /db_xref="GOA:E3H944"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3H944"
FT                   /protein_id="ADO82016.1"
FT                   /translation="MIIQKNKPMRERVYEILKKMIIDGEISPEEKIVETEYAEKFQISR
FT                   TPLREAIRMLELEGYVEAHSRGGVIVKNCTKEDVEEIYKIRIALEGIILEEVIKKSSQS
FT                   DIKKLEKIIKETKEIMVENKNNGDIFKLFSKFNNTLYSIAKMSRVEDLIKNMNLYLKRF
FT                   RKMAVEDFERKKQASDDHVELVNAIKEKDINKALEINKIHLERSKNFIISEI"
FT   gene            265032..266003
FT                   /locus_tag="Ilyop_0228"
FT   CDS_pept        265032..266003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0228"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="COGs: COG0502 Biotin synthase;
FT                   InterProIPR002684:IPR013785:IPR007197:IPR010722:IPR 006638;
FT                   KEGG: cbb:CLD_2316 biotin synthase; PFAM: biotin and
FT                   thiamin synthesis associated; Radical SAM domain protein;
FT                   PRIAM: Biotin synthase; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: B1IHH9 Biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: Radical SAM superfamily; Biotin and Thiamin
FT                   Synthesis associated domain; TIGRFAM: biotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82017"
FT                   /db_xref="GOA:E3H945"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:E3H945"
FT                   /protein_id="ADO82017.1"
FT                   /translation="MNIRDFIDREITKEEALELCKIKGSKMMELFSVANEVREKYCGNT
FT                   LHTCTISNAKSGECEEDCKFCAQSAHYKTSLSTYDLKEKDTLMSEYKRAEKLGSTKFGV
FT                   VTSGRSIKKGSEEYDNIKDFVKDAKKEDITTNICCSIGLLDEEELKELKDIGVTRFHSN
FT                   MQTSINAYNKIVATTHKIDDRLATIKAAKKIGMEVCSGGIIGMGETWEDRIDMAFTLKD
FT                   LNVDGIPVNILNPIEGTPLGDREHLSMDEIIKTIAIYRIIFKDKVIKIGAGREGILKDF
FT                   MGMAFMSGANGMLVGGYLTVKGRTSEEDFVFMENVKKMWERD"
FT   gene            266007..266813
FT                   /locus_tag="Ilyop_0229"
FT   CDS_pept        266007..266813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0229"
FT                   /product="Methyltransferase type 12"
FT                   /note="COGs: COG4106 Trans-aconitate methyltransferase;
FT                   InterPro IPR013217; KEGG: cth:Cthe_0024 biotin biosynthesis
FT                   protein BioC; PFAM: Methyltransferase type 12; SPTR: A3DBD7
FT                   Biotin biosynthesis protein BioC; PFAM: Methyltransferase
FT                   domain; TIGRFAM: biotin biosynthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82018"
FT                   /db_xref="GOA:E3H9W1"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/Swiss-Prot:E3H9W1"
FT                   /protein_id="ADO82018.1"
FT                   /translation="MAIIDKKRVNQNFSRGAKTYDNYAQVQKHMADKLEIFVHGSKKQY
FT                   NILEVGCGTGIFSQKILKRFPNSKIDLLDISPAMVETAKEKLGDSPNLNFIVEDVENYN
FT                   PEKKYDLIFSNATFQWIDDQMRLFNHLYSLLDYGGKIAFSTFGNKTYFELRESLSTLDP
FT                   ELKYSQKFVKLDEMTEITNKNFRILAADEDFFIEKFENVMAFLKAIKGIGSNSALSNKR
FT                   NFTREKFKALDKIYRDKFGDKNIINVTNHLLYMVLEKVKMRDENLK"
FT   gene            complement(266889..268208)
FT                   /locus_tag="Ilyop_0230"
FT   CDS_pept        complement(266889..268208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0230"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /note="COGs: COG1160 GTPase;
FT                   InterProIPR005225:IPR016484:IPR015946:IPR002917:IPR 006073;
FT                   KEGG: fnu:FN0170 GTP-binding protein; PFAM: GTP-binding
FT                   protein HSR1-related; SPTR: C3WA97 GTP-binding protein;
FT                   TIGRFAM: ribosome-associated GTPase EngA; small GTP-binding
FT                   protein; PFAM: GTPase of unknown function; TIGRFAM:
FT                   ribosome-associated GTPase EngA; small GTP-binding protein
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82019"
FT                   /db_xref="GOA:E3H9W2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:E3H9W2"
FT                   /protein_id="ADO82019.1"
FT                   /translation="MKPIVAIVGRPNVGKSTLFNKLVGDRIAIVDDQPGVTRDRLYRET
FT                   DWLGTEFVIVDTGGLEPRNKDFMMTKIKQQAEVAINEADVILFVVDGKAGVTALDEEVA
FT                   YILRKKNKPVILCVNKVDNFQRQSDDVYDFWSLGFEFLLPISAEHKLNLGDMLDTIVQN
FT                   INQLELPEEEEEGLKLAIIGKPNAGKSSLVNRLSGKERAIVSDIAGTTRDAIDTTFEYN
FT                   YNKYILIDTAGIRRKSKVEESLEYYSVLRAIKTIKRSDVCMLMLDAQEGITEQDKKIAG
FT                   IAYDEKKPIIVVMNKWDALKKETNTMKDMKALILSELPFLNYAPVEFVSALTGQRTLKL
FT                   LDLADTVYDEYTKRISTGILNTVLKEALILNAPPTRKGRLVKINYATQISTAPPRFVLF
FT                   CNYPDLIHFSYLRYLENKFRDAFGFEGSPIDIILQKKGES"
FT   gene            complement(268277..270049)
FT                   /locus_tag="Ilyop_0231"
FT   CDS_pept        complement(268277..270049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0231"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR013704:IPR006638; KEGG: fnu:FN0734 Fe-S oxidoreductase;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: C6JJH8 Fe-S oxidoreductase; PFAM:
FT                   Radical SAM superfamily; Radical SAM N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82020"
FT                   /db_xref="GOA:E3H9W3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:E3H9W3"
FT                   /protein_id="ADO82020.1"
FT                   /translation="MFLVTTKEEMDKLGWDSLDIILVSGDTYIDSSYNGTAVIGKWLLR
FT                   YGFKVGVIAQPDISSPDDITRLGPPELFWGVSAGCVDSMVANYTATKKRRKSDDFTPGG
FT                   INNKRPDRASIVYTNLIKRYFKNNKVPVVLGGIEASLRRIVHYDFWSDKLRKSILFNAK
FT                   ADILSYGMGEKSMLELALAMKRGEPWENIRGIAYISKEPRKGYLELPSFEECIGDKKLF
FT                   IKAFETFYLNCDPLTAKGIFQKQDTRYFVQNPPSMPFSSEEMDSIYGMDFEREVHPYYR
FT                   SLGEVKALETIRNSITTHRGCYGECNFCAIAVHQGRTVTCRSEESIISEANTILSSPKF
FT                   KGYISDVGGPTANMYGIECEKKLKSGACKDKKCMYPKTCPVLKPDHSKQVSLLKKLERL
FT                   DGVKKVFIASGLRYDLILSDEKCGNLYLKDLIKNHVSGQLKIAPEHTEDKILSLMGKQE
FT                   KSILKEFKEKFYSINNSLGMKQFLTYYLIAAHPGCNEKDMENLKKFASRELNTNPEQVQ
FT                   IFTPTPSTYSTLMYYTEMDPYTGKKLFVEKDTGKKQKQKDILVSKESHKKSFRRSTFSE
FT                   NKTKKNKNNRWKNR"
FT   gene            complement(270188..270607)
FT                   /locus_tag="Ilyop_0232"
FT   CDS_pept        complement(270188..270607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0232"
FT                   /product="heat shock protein Hsp20"
FT                   /note="COGs: COG0071 Molecular chaperone (small heat shock
FT                   protein); InterPro IPR002068:IPR008978; KEGG: phe:Phep_2899
FT                   heat shock protein HSP20; PFAM: heat shock protein Hsp20;
FT                   SPTR: C6Y1V5 Heat shock protein Hsp20; PFAM: Hsp20/alpha
FT                   crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82021"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:E3H9W4"
FT                   /protein_id="ADO82021.1"
FT                   /translation="MTEKKRGILSSDFMDDFMEEDDPLFKHGGKVPASNILDKADAYEI
FT                   EVAAPGLKKEFFKVTIESNRLVVLAEIDDTENKEKNYYSQEFGHSALERSFNLPSDVDQ
FT                   NSISSCYNDGVLFIRLPKQESQESAADIIAEIKVD"
FT   gene            complement(270870..272486)
FT                   /locus_tag="Ilyop_0233"
FT   CDS_pept        complement(270870..272486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0233"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COGs: COG1227 Inorganic
FT                   pyrophosphatase/exopolyphosphatase; InterPro
FT                   IPR000644:IPR004097; KEGG: fnu:FN1824 putative
FT                   manganese-dependent inorganic pyrophosphatase; PFAM: DHHA2
FT                   domain protein; CBS domain containing protein; PRIAM:
FT                   Inorganic diphosphatase; SMART: CBS domain containing
FT                   protein; SPTR: C6JQ52 Manganese-dependent inorganic
FT                   pyrophosphatase; PFAM: DHH family; DHHA2 domain; CBS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82022"
FT                   /db_xref="GOA:E3H9W5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E3H9W5"
FT                   /protein_id="ADO82022.1"
FT                   /translation="MDSVLVLGHKNPDTDSICSAIAYAELKNKLGQQSKAVRLGQLSRE
FT                   TEFVLNHFNLVAPELINTVRPQISDLTHLEKEVIYVDDSLKSALDLMIKENFSSLPVVD
FT                   EERRLVGMIHVSDIANTYLEMDHTKLFNNYSTLYKNLKSMLKGEIISGEYPTGIIQGSL
FT                   KAASEMDSVKQGDIVVTTTLVENAVENAIDAGAGLVILCVNEGDEIPKPTSTKTPVMKV
FT                   EKGLFKTFRLITQSVSISSIMSHSKKFYQFKEEDFLHEIKDIMKEADQTNFPVVDKEGK
FT                   IYGTIRSKNLINFTRKKVILVDHNEKSQSVDGIDDAKILEVVDHHKFGNFETNEPLQIR
FT                   AETVGCSSTIIFNLYKEAGLSPSKEVAGVMLSAILSDTLLFKSPTCTEKDIKAAKELAE
FT                   FLGFDYEKYGMEMLIAGTSLGDKSPMEIITMDMKEFRMSGLSVAVAQVNTVDVKGTLNK
FT                   QKELESVMDKMISEKGYDAFILAITDIINAGSQVIALGQWASLVENGFNTELENNSAWL
FT                   EGVVSRKKQLVPFLMAASQSI"
FT   gene            complement(273209..274123)
FT                   /locus_tag="Ilyop_0234"
FT   CDS_pept        complement(273209..274123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_1513 TonB-dependent receptor;
FT                   SPTR: A0KVC8 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82023"
FT                   /db_xref="UniProtKB/TrEMBL:E3H9W6"
FT                   /protein_id="ADO82023.1"
FT                   /translation="MKKRLIVTLAGLLTLGVMAPAATGWIRNWAELTEERPTNNDTGSN
FT                   SQGVEWTLAEGSIGITDKLAVTFDVEKNYDNITNGKDLETYWDNRFGFSYDLGKSGDWD
FT                   LSTGIDYYYDTNGSDDVTKSQYSPWFEASTALTDNTKLTFWGAMYYNDGNANQYDDDGN
FT                   KTGKVHGDDYELDILLDTGKVAFFDYTGTWLYLYHNTSGGSGSNESTSAELEAEAFTTV
FT                   YTHDSGVYAGIEYYFDGEAGDKAEEWMDSHIGPRIGYSTKLDDGVTAWVYTSYEVLSVN
FT                   YKEGGDWYSDNEFQVVAGLKATF"
FT   sig_peptide     complement(274061..274123)
FT                   /locus_tag="Ilyop_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            274415..274861
FT                   /locus_tag="Ilyop_0235"
FT   CDS_pept        274415..274861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0235"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="InterPro IPR000835:IPR011991; KEGG: cbe:Cbei_0348
FT                   MarR family transcriptional regulator; PFAM: regulatory
FT                   protein MarR; SPTR: A6LQA6 Transcriptional regulator, MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82024"
FT                   /db_xref="GOA:E3HAF0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAF0"
FT                   /protein_id="ADO82024.1"
FT                   /translation="MDIKDSVIGEACALGIIRHISEEFGDYLGKELRRRKMPIQVKHAG
FT                   LFMILFSKGEKIEFKELARIWRKSKSTLCDITSKYADEKLIKKTNCCSDKRNVYVEITE
FT                   EGLKYKKDFNEISEAFLKKATSNLSDQQVEDLKFILDKMIKAFI"
FT   gene            275298..275510
FT                   /locus_tag="Ilyop_0236"
FT   CDS_pept        275298..275510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q4DT53 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82025"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAF1"
FT                   /protein_id="ADO82025.1"
FT                   /translation="MKKTILGLMLIVGSLSLANDRLDRGEQKFFEWQNSNLAKQERVAD
FT                   ENLSRKVKELKVETNEIMNERGSNR"
FT   sig_peptide     275298..275351
FT                   /locus_tag="Ilyop_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            275604..275816
FT                   /locus_tag="Ilyop_0237"
FT   CDS_pept        275604..275816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Kinesin motor domain containing protein; SPTR:
FT                   Q237L2 Kinesin motor domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82026"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAF2"
FT                   /protein_id="ADO82026.1"
FT                   /translation="MKKTILGLMLIVGSLSLANDRLDRGEQKFFEWQNSNLAKQERVSD
FT                   ENLSRKVKELKIETNEIINERGSNR"
FT   sig_peptide     275604..275657
FT                   /locus_tag="Ilyop_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            275921..276133
FT                   /locus_tag="Ilyop_0238"
FT   CDS_pept        275921..276133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Kinesin motor domain containing protein; SPTR:
FT                   Q237L2 Kinesin motor domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82027"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAF3"
FT                   /protein_id="ADO82027.1"
FT                   /translation="MKKTILGLMLIVGSLSLANDRLDRGEQKFFEWQNSNLAKQERVSD
FT                   ENLSRKVKELKIETNDIINERGSSN"
FT   sig_peptide     275921..275974
FT                   /locus_tag="Ilyop_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            276374..278407
FT                   /locus_tag="Ilyop_0239"
FT   CDS_pept        276374..278407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0239"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="COGs: COG0272 NAD-dependent DNA ligase (contains
FT                   BRCT domain type II);
FT                   InterProIPR001679:IPR001357:IPR012340:IPR010994:IPR
FT                   016027:IPR018239:IPR013839:IPR004150:IPR004149:IPR013840:I
FT                   PR003583; KEGG: fnu:FN1717 NAD-dependent DNA ligase; PFAM:
FT                   NAD-dependent DNA ligase adenylation; NAD-dependent DNA
FT                   ligase OB-fold; zinc-finger NAD-dependent DNA ligase
FT                   C4-type; BRCT domain protein; PRIAM: DNA ligase (NAD(+));
FT                   SMART: NAD-dependent DNA ligase; Helix-hairpin-helix
FT                   DNA-binding class 1; SPTR: C6JQ53 DNA ligase; TIGRFAM: DNA
FT                   ligase, NAD-dependent; PFAM: NAD-dependent DNA ligase
FT                   OB-fold domain; NAD-dependent DNA ligase adenylation
FT                   domain; BRCA1 C Terminus (BRCT) domain; NAD-dependent DNA
FT                   ligase C4 zinc finger domain; TIGRFAM: DNA ligase,
FT                   NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82028"
FT                   /db_xref="GOA:E3HAF4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAF4"
FT                   /protein_id="ADO82028.1"
FT                   /translation="MENILEKATKIKEKIDKYNYYYYVKNESLVSDIEYDKLLKELEEI
FT                   EKKHPEIKDELSPTRQVGSSLSDTKFQKVEHKKPMLSLSNTYNIKDVEDFHQRIDKILG
FT                   KLKEDESKKITDYALELKLDGVSISVHYKNGKLVKGVTRGDGTVGEDVTENIMEIKSIP
FT                   KYLKENIDIEARGEIVLPLSEFKKLNQIRYDKGEDLFANPRNAASGTLRQLDSKIVAER
FT                   NLDCYFYFLADCDKLGIEKHSESMEFLEKVGLKTTGVCDLCSSIEELEDRIRYWENNRG
FT                   VLDYETDGLVIKVNMVELWDKLGATTKSPRWAISYKFPAKQVTTTLKNITWQVGRTGKV
FT                   TPVAELEEVEVSGSKVKRASLHNFDEIIRKDVKIGDRVFIEKAAEIIPQVVKVVKEART
FT                   GEEKEIMPPSVCPECGTELGREEGLIDLRCPNEKCPAKVRGQIEYFVSRDAMNINGLGK
FT                   KIVEKFIEIGKIKDVSDIYDLHLYKDELKSLEKMGAKSVENLLKSIEDSKKREYPKSLY
FT                   SLGIPHVGKFLASLLAKESKNIDKLAQMSIEDLLEIDGVGKKVAESVYGVFRNKKFLER
FT                   LEKLKNYGVNFKIKEVEDTAEFFNEEFKDKTFLATGKLKHFTREGIKEYIESLGGKNLS
FT                   GVSKKLDYLIVGEKAGSKLKKAEELKTVKILTESEFLEMTEK"
FT   gene            278773..279423
FT                   /locus_tag="Ilyop_0240"
FT   CDS_pept        278773..279423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0240"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR000595:IPR014710:IPR018490; KEGG:
FT                   cjj:CJJ81176_0491 putative transcriptional regulator; PFAM:
FT                   cyclic nucleotide-binding; SPTR: C4BX88 Cyclic
FT                   nucleotide-binding protein; PFAM: Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82029"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAF5"
FT                   /protein_id="ADO82029.1"
FT                   /translation="MERIQSLLKKLGIENLVDDKLMKEFKINKFKKHSLVLGSGDSSEK
FT                   VMVILQGEVKVHVYSDEGGVFYGMLKKGEFFGLISTILNRPVLPDFITTKDSEILIFPL
FT                   KKIMTTRKDIMNLIWDKIAIKTAEESVSIISKTLSRATSSNELFFIKYIEKNKGELSYS
FT                   STSELSENLNINIRTLQRIIKKLSEKEIIEKSKGLIRIKKYDLFKKHKQSLLG"
FT   gene            279613..282300
FT                   /locus_tag="Ilyop_0241"
FT   CDS_pept        279613..282300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0241"
FT                   /product="protein translocase subunit secA"
FT                   /note="COGs: COG0653 Preprotein translocase subunit SecA
FT                   (ATPase RNA helicase);
FT                   InterProIPR000185:IPR014018:IPR011116:IPR011130:IPR
FT                   011115:IPR004027; KEGG: fnu:FN1718 preprotein translocase
FT                   subunit SecA; PFAM: SecA DEAD domain protein; SecA
FT                   preprotein cross-linking region; SecA Wing and Scaffold;
FT                   SEC-C motif domain protein; SPTR: C6JQ54 Protein
FT                   translocase subunit secA; TIGRFAM: preprotein translocase,
FT                   SecA subunit; PFAM: SecA DEAD-like domain; SecA preprotein
FT                   cross-linking domain; SEC-C motif; SecA Wing and Scaffold
FT                   domain; TIGRFAM: preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82030"
FT                   /db_xref="GOA:E3HAF6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAF6"
FT                   /protein_id="ADO82030.1"
FT                   /translation="MIGSLMKKVFGTKNDREIKRIMKIVDEINKLEPQFEGFSDEELKG
FT                   KTVEFRERISNGETLDDILVEAFAVVRETSKRVLGMRHYDVQLVGGVVLHEGKITEMKT
FT                   GEGKTLVATCPVYLNALVDNVHLVTVNDYLAKRDRELMGRIYEFLGLTSGVILNAMPVP
FT                   ERKKAYECDIVYGTNSEFGFDYLRDNMVSKIEEKVQRNLHFCIVDEVDSILIDEARTPL
FT                   IISGPAEDTAKWYKIFYQVSQMLVRSYETEDIKDPKKKKEMNIPDEKWRDYEVDEKSHN
FT                   ITLTEKGIKRIEEIMKIDNLYSPENVELTHYMNQALRSKELFKRDRDYLVREGEVIIID
FT                   EFTGRAMEGRRYSDGLHQALEAKEGVTIAGENQTLASITLQNYFRMYDKLSGMTGTAET
FT                   EASEFMHTYGLEVVVIPTNQPVIRKDSPDLVYKTHAEKVNAIFEKIEELHKNGQPVLVG
FT                   TISISSSEMLSSHLQKRGIPHNVLNAKFHAKEAEIVAQAGRYGAVTIATNMAGRGTDIM
FT                   LGGNPEFMALEDIPSREDEGYEELLKKYKIQCEEEKHEVLEAGGLFILGTERHESRRID
FT                   NQLRGRSGRQGDPGASEFYLSLEDDLMRLFGSDRVKNMMEKLGLPEGEPITHNMISKAI
FT                   ANAQKKVESRNFGIRKSLLEFDDVMNKQREAIYKSRNDALAKDDLKSNIAEMIRRTIES
FT                   IAIEKLVGEYKEDWDINGFAEKINDLYEYKIEDLEEYKALTVESYSEKIYNEVMEKYKE
FT                   RETIFGSDMMRKLEKYMLFEVVDSRWRENLKTLDSLREGIYLRSYGQKDPIVEYKLLSG
FT                   ELYHQMLNTIDEETTSFLFKIRIRDEEEELEMKRKETPKNVKYNAGETPEKETENQRHS
FT                   SKVGRNDLCPCGSGKKYKKCCGRL"
FT   gene            282326..283060
FT                   /locus_tag="Ilyop_0242"
FT   CDS_pept        282326..283060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN1719 hypothetical protein; SPTR: C3WAT4
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82031"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAF7"
FT                   /protein_id="ADO82031.1"
FT                   /translation="MKKLLFLPILLIMVSCSSLFAPKTDLAEKYSVDKEAVKNWDKTIS
FT                   ETVKGEALIEDWYGNDEPIFYLRKSGIMKEKEYNFLTSLKKKEAITQEDTEEFNTLLNK
FT                   YNKKLKREFWLKDENLKDPKGLAEKIVKEANLRMKNPSNYILNNVATGKEKDLLSSYAK
FT                   KKDLTEKETKKLKKMLNSFLKREEFFLAENWYNREISSRLIEIVEISKKDKVSKFERNN
FT                   INAKALYIAYPEYFSELEKWKD"
FT   sig_peptide     282326..282388
FT                   /locus_tag="Ilyop_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            283213..283410
FT                   /locus_tag="Ilyop_0243"
FT   CDS_pept        283213..283410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_0259 hypothetical protein; SPTR:
FT                   Q48A87 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82032"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAF8"
FT                   /protein_id="ADO82032.1"
FT                   /translation="MKNKNGICPLCGKENHCATVAGSDPYSCWCMTTKVPEELLERIPK
FT                   DIRGKACVCKECVEKYLKEK"
FT   gene            283421..284257
FT                   /locus_tag="Ilyop_0244"
FT   CDS_pept        283421..284257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0244"
FT                   /product="PHP domain protein"
FT                   /note="COGs: COG0613 metal-dependent phosphoesterase (PHP
FT                   family); InterPro IPR016195:IPR004013:IPR003141; KEGG:
FT                   chy:CHY_2227 phosphotransferase domain-containing protein;
FT                   PFAM: PHP domain protein; SMART: phosphoesterase PHP domain
FT                   protein; SPTR: C6JQ56 Phosphotransferase domain-containing
FT                   protein; PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82033"
FT                   /db_xref="GOA:E3HAF9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAF9"
FT                   /protein_id="ADO82033.1"
FT                   /translation="MVDMHLHTTVSDGALSPTELVEKAYEKGIKVLAITDHDTVDGLEE
FT                   GRKKALELGIEFINGIEISCDWLGKEVHILGYFINCEDEKFQSEIMALREIRENRNKKM
FT                   LEKLEKNGIYITLEELQEEAKGDILSRSHMANIIMKKGYAYSKKEAFSRYLGQHGIAYV
FT                   PKSNLSPDRAVRIIKENGGLVSLAHPKLITRDRGQILKIINGLKKVGLDALEAYHGKFQ
FT                   INDVKYYMDLAKETALLWTGGSDFHGNERDIIEIGDGEVPMYVYEALLIYYEGRKI"
FT   gene            284254..284673
FT                   /locus_tag="Ilyop_0245"
FT   CDS_pept        284254..284673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0245"
FT                   /product="nucleoside 2-deoxyribosyltransferase"
FT                   /note="InterPro IPR007710; KEGG: similar to putative
FT                   c-Myc-responsive; PFAM: nucleoside
FT                   2-deoxyribosyltransferase; SPTR: B9ZDQ6 Nucleoside
FT                   2-deoxyribosyltransferase; PFAM: Nucleoside
FT                   2-deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82034"
FT                   /db_xref="GOA:E3HAG0"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="InterPro:IPR028607"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAG0"
FT                   /protein_id="ADO82034.1"
FT                   /translation="MKKIYFAGSIRGGRENMEIYAELIEFLSNYGTVLTEHVGYKDLEE
FT                   TMESEKSDFAIYDQDIAWLRECDLVVAEVSQPSIGVGYEIGIAESLGKKILCLYNEEAP
FT                   KRLSAMLAGNEKISTCFYNSIEHAKRCIEGALKNL"
FT   gene            284747..285745
FT                   /locus_tag="Ilyop_0246"
FT   CDS_pept        284747..285745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0246"
FT                   /product="ADP-glyceromanno-heptose 6-epimerase precursor"
FT                   /EC_number="5.1.3.20"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR011912:IPR016040:IPR001509; KEGG:
FT                   fnu:FN1703 ADP-L-glycero-D-manno-heptose-6-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; SPTR: C6JQ57
FT                   ADP-glyceromanno-heptose 6-epimerase; TIGRFAM:
FT                   ADP-L-glycero-D-manno-heptose-6-epimerase; PFAM: NAD
FT                   dependent epimerase/dehydratase family; TIGRFAM:
FT                   ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82035"
FT                   /db_xref="GOA:E3HAG1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAG1"
FT                   /protein_id="ADO82035.1"
FT                   /translation="MILVTGAAGFIGSALVWKLNEDGINDIVVSDKLRTEDKWLNLRKR
FT                   DYADWVDRDELFEWLSVYENARKLTAVVHMGACSATTEQNGDFLMKNNYEFSKKLWEFC
FT                   TNRNIKYIYASSAATYGIGEQGYNDDVSSEELKKLMPLNKYGYSKKYFDDWAFKQEESP
FT                   KEWIGLKFFNVYGPQEYHKGRMASLVFHAFNQYKENDIVKLFKSHKEGYEDGWQLRDFV
FT                   YIKDVVNVIKFFLDNDTKSGVYNLGTGKARSFYELALNTVRAAEDNYDIKGEDVIEFIP
FT                   MPEDLRGRYQYFTQAEMNKLKKIGYTEEFHTLEEGVKDYVQNYLVKEDSYL"
FT   gene            285760..286563
FT                   /locus_tag="Ilyop_0247"
FT   CDS_pept        285760..286563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0247"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="COGs: COG1968 Uncharacterized bacitracin resistance
FT                   protein; InterPro IPR003824; KEGG: fnu:FN1702 undecaprenyl
FT                   pyrophosphate phosphatase; PFAM: Bacitracin resistance
FT                   protein BacA; PRIAM: Undecaprenyl-diphosphatase; SPTR:
FT                   C6JQ58 Undecaprenol kinase; TIGRFAM: undecaprenol kinase;
FT                   PFAM: Bacitracin resistance protein BacA; TIGRFAM:
FT                   undecaprenyl-diphosphatase UppP"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82036"
FT                   /db_xref="GOA:E3HAG2"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAG2"
FT                   /protein_id="ADO82036.1"
FT                   /translation="MNSLLIVIILGIVEGLTEFIPVSSTGHMILVEQFVNNPQLSKEFM
FT                   DTFLIVVQLGAILAVVIIFWKDISPFVKDRKKVEEKLTLWSKIAVGVLPAAVLGLLLDD
FT                   YISEYFFGNVIIVSVMLILYGFIFMKEKNFEKENCIEDIKQLTYKTAFLVGWFQCLAMI
FT                   PGTSRSGVTIIGGILLGLSRGVAAEYSFFLAIPIMAGATLLKVLKNGLDFSPEEWKLTL
FT                   VGTAVSFFVAYIVIKWFMSYIKSRDFKVFGVYRIVLGILVLISIF"
FT   sig_peptide     285760..285804
FT                   /locus_tag="Ilyop_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            286611..287660
FT                   /locus_tag="Ilyop_0248"
FT   CDS_pept        286611..287660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0248"
FT                   /product="pilus retraction ATPase PilT"
FT                   /note="COGs: COG2805 Tfp pilus assembly protein pilus
FT                   retraction ATPase PilT; InterPro
FT                   IPR006321:IPR001482:IPR003593; KEGG: ate:Athe_1883
FT                   twitching motility protein; PFAM: type II secretion system
FT                   protein E; SMART: AAA ATPase; SPTR: B9MKW3 Twitching
FT                   motility protein; TIGRFAM: twitching motility protein;
FT                   PFAM: Type II/IV secretion system protein; TIGRFAM: pilus
FT                   retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82037"
FT                   /db_xref="GOA:E3HAG3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAG3"
FT                   /protein_id="ADO82037.1"
FT                   /translation="MNITDILVAAKDAEASDIHLVAGKPPTFRIHGVLEDMPGCEEKLM
FT                   PLAVKELAYSILNEDQEKSFEKNKELDFSFGISGVGRYRVNVHVQRGTIGVSIRSLSTE
FT                   IPDFSKLGLPEVVRSFTEYENGLILVTGPTGSGKSTTLASLIDKINKEKAHHIITVEDP
FT                   IEYLHTHKRALVEQRELKADTESFSTALKYALRQDPDVILIGEMRDLETITAALTAAET
FT                   GHLVFGTLHTNSAAKTIDRIIDVFPMDQQSQIRIQLSTSLRAVLAQQLVPSTDRKRKVA
FT                   CEIMVGTPAIGNLIRENKTYQIPSMIETGMRHGMISMDAFLEKLLKQGKITTQEFEKRS
FT                   SVKKNKIDL"
FT   gene            287671..288879
FT                   /locus_tag="Ilyop_0249"
FT   CDS_pept        287671..288879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0249"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR001992:IPR018076:IPR003004; KEGG:
FT                   hor:Hore_05990 Tfp pilus biogenesis protein PilC; PFAM:
FT                   Type II secretion system F domain; SPTR: B8D2C9 Tfp pilus
FT                   biogenesis protein PilC; PFAM: Bacterial type II secretion
FT                   system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82038"
FT                   /db_xref="GOA:E3HAG4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAG4"
FT                   /protein_id="ADO82038.1"
FT                   /translation="MPKYKYRARDKNGHLIDGEMEAANESELNVELDNLGHFLISVEKP
FT                   DAILGGDILAPFKKVKIKEMTQFTTELSTLIEAGISIVSALEIEAKQLKDGVLKTAISK
FT                   AIEDIKGGESFSDALSKHPKVFKKIYTGLVKSGEVSGQLDNILLDLAKYLDVSYKNRSK
FT                   VKSAIIYPCVMFIVALAVSVFLLVVVLPSFVSVFENAGVDLPLPTRILLNLSLFMKTKW
FT                   YLMLGGIAFIIALIRLWYTTVDGRYNIDGYKLKVPIFGSLMKKSVVSRFTRTFGALMKS
FT                   SVPMLHALDILKESIENAVIEEVVDKMKVVVSEGGKVSKELEESKYFPAMVARMVSVGE
FT                   NTGELDKMLLKISDHYDNELENDIKGLTSIIEPILIVFMGVVVGSIVLAVMLPMFDMIK
FT                   LVK"
FT   gene            288897..290291
FT                   /locus_tag="Ilyop_0250"
FT   CDS_pept        288897..290291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0250"
FT                   /product="Coproporphyrinogen dehydrogenase"
FT                   /EC_number="1.3.99.22"
FT                   /note="COGs: COG0635 Coproporphyrinogen III oxidase and
FT                   related Fe-S oxidoreductase; InterPro
FT                   IPR013785:IPR007197:IPR006638; KEGG: fnu:FN1612
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; PRIAM: Coproporphyrinogen dehydrogenase; SMART:
FT                   Elongator protein 3/MiaB/NifB; SPTR: C6JJF3 Iron-sulfur
FT                   dehydrogenase; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82039"
FT                   /db_xref="GOA:E3HAG5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAG5"
FT                   /protein_id="ADO82039.1"
FT                   /translation="MILDTDFDITENSMDEFLRILVPEARGRDIKIRTIEEGENISLLI
FT                   ETNGFKKQFTYKNHIDRIDDQKIVMAKTSLLEIYGKDYAWGSLKGVRPTKLVRRLLALN
FT                   YDYLEIKDILEGLFKVSEKKSSLIIEVVKKEMEYLNREYINMYIGIPFCPTKCRYCSFA
FT                   SYEINSGVGRHYNAFVDTLIEEIKLTGEHLKENGYKLGSVYIGGGTPSILTETDIERVL
FT                   ASVKNNVDLSSVKEFTFEAGRVDTLTKKKLEIMKNYGVDRISLNPQTFNEETLKNLNRT
FT                   FSRDKFDEMYSLSKNMGFIINMDLIIGLPGEGTKEILNTMKELEKYQMENLTVHVLALK
FT                   KASVLFKEGHQEEKIDRQAVENGIEELTKKKSLKPYYMYRLKNSTQWGENLGYAIEGKE
FT                   SIFNIEMIEENQSTIGLGGGAITKKISAESPVRDHIDRLVGPKEPATYVREMRERLKKK
FT                   LDLFKK"
FT   gene            290317..290865
FT                   /locus_tag="Ilyop_0251"
FT   CDS_pept        290317..290865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN1611 competence protein; SPTR: C6JJF4
FT                   Competence protein ComEA; TIGRFAM: competence protein ComEA
FT                   helix-hairpin-helix repeat region"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82040"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAG6"
FT                   /protein_id="ADO82040.1"
FT                   /translation="MSENRKFLLLILLILGIFAGEKLYKNFNTEKNKKESKYELTVTRN
FT                   AYKDKNKPLDINKATVDTMLKNGINLRYAEGIDEYREITGGFQNIEELRRIKGIGAKTL
FT                   EKISGKVKVYEKAKRNKLYINEASDKILLYFGFTKKEIKKIRKKQKENFKINSNIEFRE
FT                   LLDDERYYYFKDFVQYERY"
FT   sig_peptide     290317..290397
FT                   /locus_tag="Ilyop_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            290982..291869
FT                   /locus_tag="Ilyop_0252"
FT   CDS_pept        290982..291869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0252"
FT                   /product="Hsp33 protein"
FT                   /note="COGs: COG1281 Disulfide bond chaperones of the HSP33
FT                   family; InterPro IPR016153:IPR016154:IPR000397:IPR018247;
FT                   KEGG: fnu:FN1610 33 kDa chaperonin; PFAM: Hsp33 protein;
FT                   SPTR: C3WB36 Chaperonin; PFAM: Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82041"
FT                   /db_xref="GOA:E3HAG7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAG7"
FT                   /protein_id="ADO82041.1"
FT                   /translation="MARLIRGASKNARFFIVDSKDVVQKAQDIHKCSPTAIAAFGRLLT
FT                   AGIIMGAGLKGDDLMTLRTDTDGSLNHMVVTSDSLGGIKGYLSNPEAELPLKSNGQPDV
FT                   GGVVGKGMLRVIKDMGLKEPYVGISNIQTGEIAEDIAYYYYTSEQTPTVLALGVSLNDD
FT                   MSIKNAGGYMIQLLPDSEDQFIDKLEAKIGAIRPVTELFDGGMNLERIAKLLYEDMEDE
FT                   NAEKLVEDYEVYEEIETKYSCNCDKDRFYKGLVALGKNQLEEIFSEKDTLEVECHFCKS
FT                   KYSFSKQEFENLMN"
FT   gene            complement(292011..292901)
FT                   /locus_tag="Ilyop_0253"
FT   CDS_pept        complement(292011..292901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0253"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="COGs: COG0179 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1 7-dioic acid hydratase
FT                   (catechol pathway); InterPro IPR011234:IPR002529; KEGG:
FT                   ckr:CKR_2096 hypothetical protein; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase; SPTR: C6PQ62
FT                   5-carboxymethyl-2-hydroxymuconate Delta-isomerase; PFAM:
FT                   Fumarylacetoacetate (FAA) hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82042"
FT                   /db_xref="GOA:E3HAG8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAG8"
FT                   /protein_id="ADO82042.1"
FT                   /translation="MKFVYYLENDEKKIGIMKNAQSIVDISDFYSSKNIKKPKDINELL
FT                   DSWDELFLEDLKKFITENKATSNLTDVKLLAPIEYPKRNLLCLGKNYLDHAKEIKGLKG
FT                   AEDVIPKFPIYFSKIADPAIGDGDIILNHKDITDKIDYEVELGIVIGKEGINIKPEKVE
FT                   DHIFGYTIVNDVSARNIQRKHGQWFKGKCLETFCPMGPVIVHKSEIPFPVELDIKCSVN
FT                   DELRQNSNTNMMIFDIPTIISDLSKGMKLHKGDIIITGTPSGVGLGFKPFKFLKSGDKV
FT                   VCEIEKIGTLTNIVE"
FT   gene            293145..294593
FT                   /locus_tag="Ilyop_0254"
FT   CDS_pept        293145..294593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0254"
FT                   /product="sodium/proline symporter"
FT                   /note="COGs: COG0591 Na+/proline symporter; InterPro
FT                   IPR011851:IPR019900:IPR001734; KEGG: fnu:FN0107
FT                   sodium/proline symporter; PFAM: Na+/solute symporter; SPTR:
FT                   A5TVX5 SSS family proline:sodium (Na+) symporter; TIGRFAM:
FT                   sodium/proline symporter; SSS sodium solute transporter
FT                   superfamily; PFAM: Sodium:solute symporter family; TIGRFAM:
FT                   sodium/proline symporter; transporter, SSS family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82043"
FT                   /db_xref="GOA:E3HAG9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAG9"
FT                   /protein_id="ADO82043.1"
FT                   /translation="MAGFETLFTFGIYMIFLIGVGVYFYNKTNNVEDYLIGGRGMGSWV
FT                   TALSAQASDMSGWLLMGLPGAVYLSGINQAWIAIGLLVGTYLNWKFVAPKLRVQTEETD
FT                   TMTISTFLEKKLGDNTGLIRNFSAIVTLFFFTIYSSSGLVAAGKLFESMLGIDYKIAVI
FT                   IGALTIVTYTFMGGYLASCWTDFFQGALMFGAIILVPLMALNISGGTQGVIDAMTAKNI
FT                   SMDIFSSGSGKLGPVAIISSLAWGLGYFGQPHILVRFMSINSVKDLKKSRLIAMIWVVI
FT                   SLAGAIAVGLAGIAMFANPADMGGDSEKLFIYMISKLFNPWFGGILLAAILSAIMSTID
FT                   SQLLVSSTTLTEDFYKYIKKDVNDKELMWVGRICVIGISIVSVLMALNPSAKVLALVSY
FT                   AWGGFGAVFGPAIIATLYFKNMNWKSVFTGMVAGMLVLVTWKHLGYGSFMYEIVPGFMA
FT                   NALVTLIGEKVFFKEKSQETNELA"
FT   gene            294781..296508
FT                   /locus_tag="Ilyop_0255"
FT   CDS_pept        294781..296508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0255"
FT                   /product="alpha-phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR016055:IPR016066:IPR005844:IPR005845:IPR
FT                   005846:IPR005841; KEGG: lba:Lebu_2089
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; SPTR: C6JIC6
FT                   Phosphoglucomutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82044"
FT                   /db_xref="GOA:E3HAH0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAH0"
FT                   /protein_id="ADO82044.1"
FT                   /translation="MDANIWKKFENWSSSDYIDAEDREELKQIKDNTKEVEDRFYTDLE
FT                   FGTGGMRGIRGVGTNRINKYIVKKAAQGIANYMLKMDAEAAVDRGVVIAYDCRIGSYEY
FT                   SLNMALVFAANGIKTNLFESLRSTPELSFAVRELGTMVGVMVTASHNPKEYNGFKVYWE
FT                   DGGQVVEPHATEIVKEVYAVESFDDIKAMTQKEAEEKGLLKFVGKSVDDKYIEAIKKEV
FT                   INTDIPGKKEFKIVYSPLHGTGKRPVQRVMKEIGFDSLYTVAEQEEPDGTFPTCDYANP
FT                   EDPAVFKLGIELAEKMGSKLCMANDPDADRIGIAVKRKNGEWVYPNGNQVGLLLMNYIL
FT                   ENKKDIPENGAVISTVVSTPMLDVVAADKGVKMFRTLTGFKYIGEKILEFETGKIDGTY
FT                   LFGFEESYGYLVGTHARDKDAIVSTMLIAEMAAYYESKGTSVIEELEKLYDKYGWYKEG
FT                   IQAITMSGKEGAEKIQNIMKSLRENMPVEVLGKKVKKVRDFQLQKDYDKEAGKEYPIEL
FT                   PKSNVIQMILEDDTHITARPSGTEPKIKYYYGINAKTEAESEKKLENTMKGFSEFLEK"
FT   gene            296692..297732
FT                   /locus_tag="Ilyop_0256"
FT   CDS_pept        296692..297732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0256"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1840 ABC-type Fe3+ transport system
FT                   periplasmic component; InterPro IPR006059:IPR001188; KEGG:
FT                   ctc:CTC00274 iron(III)-binding periplasmic protein
FT                   precursor; PFAM: extracellular solute-binding protein
FT                   family 1; SPTR: C4DYP0 ABC-type Fe3+ transport system,
FT                   periplasmic component; PFAM: Bacterial extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82045"
FT                   /db_xref="GOA:E3HAH1"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAH1"
FT                   /protein_id="ADO82045.1"
FT                   /translation="MKNIKFSNLLLLILLIIFGVSCGKAEDKAEDKGSLTFYAGLQEDH
FT                   AAMIAKEFEQETGIKTSFVRMSSGEVLARLKAEKNNMSASVWYGGPIDAFVAANEEGLI
FT                   EKYESPEGENIKPEFKSTDNTWNGIYVGYLGFVGNEEILAEKGLEMPTSWEDLLKPEYK
FT                   GEIVVAHPGSSGTAYTMLATVVQLMGEDDAMEYFKKFNGQVRQYTKSGTAPGRMVGQGE
FT                   ATIGITFLHDAIKYKKEGYKDIIISAPSEGTGFEIGGVSLLKNGPNPDEAKQFIDWVLT
FT                   KEVQEKGQTVGSFQFLTNKNAIPPEEAMAIKDTKLIDYNFDWAGQNRVRLVERFSKETS
FT                   TTAPTK"
FT   sig_peptide     296692..296766
FT                   /locus_tag="Ilyop_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            297809..299530
FT                   /locus_tag="Ilyop_0257"
FT   CDS_pept        297809..299530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0257"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1178 ABC-type Fe3+ transport system
FT                   permease component; InterPro IPR000515; KEGG: ctc:CTC00275
FT                   iron(III)-transport system permease protein SfuB; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C4DYN9 ABC-type Fe3+ transport system,
FT                   permease component; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82046"
FT                   /db_xref="GOA:E3HAH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAH2"
FT                   /protein_id="ADO82046.1"
FT                   /translation="MNDIRLKIDQELKHIKKITNDPTLLITVLFSIFVVSFFVLVPLSN
FT                   ILKESFTSQGDINLDNYRAAFTRSGNVVVIFNTIKLGLVTATLALIIGFFFAYTTSYMT
FT                   IKGKRLFDFIAMLPIISPPFVVALSAILLFGRQGLITRGLLGIRDYEIYGFHGLVLVQV
FT                   LSFFPIAYLMLVGLLQKIDPSVEEASRDLGANRLKVFTSVTFPLVVPGIGNAFLLVFIQ
FT                   SIADFANPVVIGGNFTTIAVKIYQEGIGNFQLGIATALAMILLSLSISMFVIQRFYINK
FT                   KSYITVTGKISRKRELISDRIVTVPVTVLLVTMTLFVIGMYILIPVNSFVKLWGINYTP
FT                   TLDHYKYIFKFGMDPVLQTTILSVIATFITGFFSMIIAFLIVRKRFIGKTFIEFTTVMA
FT                   MAIPGTIIGLGYVISYNKTYYIPFTNITLIPPLTGTALIIIVAFIIRSLPVGVRSGMSS
FT                   LQQIDPSIEEAASILGASSQKIFFSVTLPMIKEAFFSGLIYSFARSMTLVSTIIFLISA
FT                   KWKLLTPAVMENIDTGRIGIASAYCTMLIIIVSIVMVFMKIVTSKLGIQNENSGDV"
FT   gene            299530..300600
FT                   /locus_tag="Ilyop_0258"
FT   CDS_pept        299530..300600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0258"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3842 ABC-type spermidine/putrescine
FT                   transport systems ATPase components;
FT                   InterProIPR003439:IPR008995:IPR017871:IPR013611:IPR 003593;
FT                   KEGG: ctc:CTC00276 iron(III)-transport ATP-binding protein
FT                   SfuC; PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; SPTR: C4DYN8
FT                   Spermidine/putrescine ABC transporter ATP-binding subunit;
FT                   PFAM: ABC transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82047"
FT                   /db_xref="GOA:E3HAH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAH3"
FT                   /protein_id="ADO82047.1"
FT                   /translation="MKEFKKVEIKNLTKIFISGKNKVKAVDNLDLTIEPGEFVCLLGPS
FT                   GCGKTTMLRMLAGFEVPTTGNIFIGNKDVANLTPDKRDTAMVFQNYALFPHMNVFDNIA
FT                   YGLKVQKRPKAEINERVEKILKLMKMDDFATRVPSQMSGGQQQRVSLARALIMNSGVLL
FT                   FDEPLSNLDAKLRLHMRDEIRKLQKEVGITSIYVTHDQAEAMSLSDKVVIMKDGKIMQV
FT                   GSPIEIYQRPNSEFVAKFIGRANILKAKLIPEDGNSATINIFGHEYPSKEDLNGKSKEV
FT                   DIVVRPETIKFDKKTHEGTVLKSVFMGENHEYEIEVNGQIIEAVLSNPHGKDIKSVGER
FT                   IGFTFDHEALHIIDNN"
FT   sig_peptide     299530..299604
FT                   /locus_tag="Ilyop_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            300890..301969
FT                   /locus_tag="Ilyop_0259"
FT   CDS_pept        300890..301969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0259"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /note="COGs: COG0635 Coproporphyrinogen III oxidase and
FT                   related Fe-S oxidoreductase;
FT                   InterProIPR004559:IPR013785:IPR007197:IPR010723:IPR 006638;
FT                   KEGG: fnu:FN0560 oxygen-independent coproporphyrinogen III
FT                   oxidase; PFAM: Radical SAM domain protein; HemN domain
FT                   protein; PRIAM: Coproporphyrinogen dehydrogenase; SMART:
FT                   Elongator protein 3/MiaB/NifB; SPTR: C6JIC5
FT                   Oxygen-independent coproporphyrinogen III oxidase; TIGRFAM:
FT                   oxygen-independent coproporphyrinogen III oxidase; PFAM:
FT                   Radical SAM superfamily; HemN C-terminal region; TIGRFAM:
FT                   putative oxygen-independent coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82048"
FT                   /db_xref="GOA:E3HAH4"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAH4"
FT                   /protein_id="ADO82048.1"
FT                   /translation="MCDAIYIHIPFCINKCQYCDFLSFKSTPYKRREYVEYLKKEIKLY
FT                   PEFEYDTVYFGGGTPSLLDPFEVKEILELLQIREDSEVTLEVNPKSVDLEKLRAFRNAG
FT                   INRLSIGVQSFDPYYLKLIGRLHTGIEAEEIYRDARKAGFENVSLDLMFSLPGQSIEDV
FT                   RKDLVKIAKLRPEHISIYSLIWEEGTPLYEKLLKGDLEETDNEIEAEMYELIIDFLKSK
FT                   GYIHYEVSNFSLPGKEARHNTKYWENKEYLGAGLGASGYIGNQRYKNAVNFEDYYGKID
FT                   NNEKPYEEVEVLKEKEKEEYRYILGLRLLEKGVEADKEYIDKCVELEKKGYLMKKSGRY
FT                   ILTHKGLMIANDVFEEFIS"
FT   gene            301989..302669
FT                   /locus_tag="Ilyop_0260"
FT   CDS_pept        301989..302669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0260"
FT                   /product="alanine racemase domain protein"
FT                   /note="COGs: COG0325 enzyme with a TIM-barrel fold;
FT                   InterPro IPR011078:IPR001608; KEGG: fnu:FN0561 proline
FT                   synthetase associated protein; PFAM: alanine racemase
FT                   domain protein; SPTR: C6JIC4 Proline synthetase associated
FT                   protein; PFAM: Alanine racemase, N-terminal domain;
FT                   TIGRFAM: pyridoxal phosphate enzyme, YggS family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82049"
FT                   /db_xref="GOA:E3HAH5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAH5"
FT                   /protein_id="ADO82049.1"
FT                   /translation="MGSIKNNIQEISEDIKKYSPCPEKVKLVAVTKYVGTEEMTDVLAS
FT                   GVNIVGENRVQVLKDKKEKFDQSELGSKIKWHFIGNLQKNKVKYISDYIELIHSVNKLS
FT                   LAKEINKRAEATDRIIEVLLEINIAGEESKEGYKIEKLYKELPEILKLKNIKVTGLMTM
FT                   APFTEDTDLVRRIFRELRKLKDDLSRDYFQGELKELSMGMSGDYKIALEEGATLIRIGS
FT                   KIFS"
FT   gene            302685..303215
FT                   /locus_tag="Ilyop_0261"
FT   CDS_pept        302685..303215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0261"
FT                   /product="protein of unknown function DUF552"
FT                   /note="COGs: COG1799 conserved hypothetical protein;
FT                   InterPro IPR007561; KEGG: fnu:FN0562 putative cytoplasmic
FT                   protein; PFAM: protein of unknown function DUF552; SPTR:
FT                   C6JIC3 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF552)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82050"
FT                   /db_xref="GOA:E3HAH6"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAH6"
FT                   /protein_id="ADO82050.1"
FT                   /translation="MKEMLRGLKFKDILGINDATDDETEELGKVIDSVEEIREEKPALK
FT                   TEFLSTGETGKTDEKTKSKIEIPVKSPDEPKVKTPPMGIKDYQTVFVDPKKFSECKKIA
FT                   NYIRDDKIVTVNLEYVDSPTAQRIIDFLSGAMSIKEAQFIEVSKKVYMAVPKKVQVLYD
FT                   GKTEAVNTGLLEI"
FT   gene            303231..304160
FT                   /locus_tag="Ilyop_0262"
FT   CDS_pept        303231..304160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0262"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="InterPro IPR011642; KEGG: chu:CHU_3560 hypothetical
FT                   protein; PFAM: nucleoside recognition domain protein; SPTR:
FT                   Q11P70 Putative uncharacterized protein; PFAM: Nucleoside
FT                   recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82051"
FT                   /db_xref="GOA:E3HAH7"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAH7"
FT                   /protein_id="ADO82051.1"
FT                   /translation="MKLLKDSVNISCKLLKIMLPVSILVKILSHFGIIETISRGISPVM
FT                   GIMGLSGEMGIVWATAMTTNIYAGILTLFTLTENTSVTVAEITILSTIILVAHSLPVEL
FT                   KVISETGAKPSKILGIRVFCAIIAGVFLNIVFKLFNLYQENANFSFIPEKAKPGIFYWI
FT                   QGEAKKYMMIFFIIFILLAVMEILQKIGVIDWINLKFSPMMKLFGIESGLSFTCIVGLT
FT                   MGISYGSGFIIKESREGKYSKRSFFLVAVFMSLCHGLIEDTLLMVSIGAKMIGIFWFRL
FT                   IFAIVVTVIFNKLMPYEKLEKIGKGIEE"
FT   gene            304234..305223
FT                   /locus_tag="Ilyop_0263"
FT   CDS_pept        304234..305223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0263"
FT                   /product="Queuosine synthesis"
FT                   /note="COGs: COG0482
FT                   tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
FT                   contains the PP-loop ATPase domain; InterPro IPR018317;
FT                   KEGG: fnu:FN0563 tRNA (5-methylaminomethyl-2-thiouridylate)
FT                   -methyltransferase; PFAM: Queuosine synthesis-like; SPTR:
FT                   C3WBQ6 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   PFAM: Thiamine biosynthesis protein (ThiI)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82052"
FT                   /db_xref="GOA:E3HAH8"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAH8"
FT                   /protein_id="ADO82052.1"
FT                   /translation="MRALALFSGGLDSALAIKVVVDQGIEVIALNFVSHFFGGKNEKAE
FT                   KMAEQLGVRLEYVDFSKIHTEILKESPSGRGKNMNPCIDCHALMFEVAAKLLEKYDANF
FT                   IISGEVLGQRPMSQNYIALGKVMELSGVEDLIVRPLSAKLLPPTKPIREGWVDREQLLD
FT                   IQGRSRKRQMALMEEYGIVEYPSPGGGCMLTEPNYSYRLKTLENDGFLEDNYSFLFHLA
FT                   KYGRFFRMESGKYLFVGREHDDNLKISEYKDFGSLYIVGAGTPGPAVVGYGDLTKEEII
FT                   FGKELFARYSKSKGKSNTEMVVNGVIEEIEALDEKSINEKIKKYQVIL"
FT   sig_peptide     304234..304281
FT                   /locus_tag="Ilyop_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            305544..306032
FT                   /locus_tag="Ilyop_0264"
FT   CDS_pept        305544..306032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0264"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: dat:HRM2_29110
FT                   acetyltransferase (GNAT family protein); PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: C0QJX3 Acetyltransferase (GNAT
FT                   family protein); PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82053"
FT                   /db_xref="GOA:E3HAQ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAQ2"
FT                   /protein_id="ADO82053.1"
FT                   /translation="MELKIRNGKVEDLEESFILERRTFLECEAASKENIKIRLSEFSDG
FT                   FIVGEIGGKIVAHINSGSTNKDDITDEEFKGLIGHESGGKNIVIFSVAVDPQYQKQGIA
FT                   SEMMREFIEVSKKIKKKNILLLCKENLIGMYEKMGYENNGISASTHGNAVWYEMVYSL"
FT   gene            complement(306301..306591)
FT                   /locus_tag="Ilyop_0265"
FT   CDS_pept        complement(306301..306591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN0762 hypothetical protein; SPTR: C6JKJ7
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82054"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAQ3"
FT                   /protein_id="ADO82054.1"
FT                   /translation="MENKEIDLLKLLLSGEVFSEDEIMENMNINTKELENLFDILEDEG
FT                   YLEVDNGYFEKTCDNCSKGGNCTSPTYKPSDKVKKIRVITWKAIEEYGQHP"
FT   gene            306828..307676
FT                   /locus_tag="Ilyop_0266"
FT   CDS_pept        306828..307676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0266"
FT                   /product="PP-loop domain protein"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR014729:IPR012089:IPR011063; KEGG: fnu:FN0868 PP family
FT                   ATPase; PFAM: PP-loop domain protein; SPTR: C3WD69 PP
FT                   family ATPase; PFAM: PP-loop family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82055"
FT                   /db_xref="GOA:E3HAQ4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAQ4"
FT                   /protein_id="ADO82055.1"
FT                   /translation="MKEKKVYEDIDERIKEEGISRGKIATESIRTTYRKKIWSKFIKAI
FT                   KDFELIEDGDRIAVGVSGGKDSLLMCKLFQELKKDRTKNFEVVFISMNPGFEAMDVDQF
FT                   KHNLTELDIPCEIFDSNVWEVAFEQDPENPCFLCAKMRRGVLYKKVEELGCNKLALGHH
FT                   FDDAVETALINMFYAGTVKTMIPKVKSTSGKLGLIRPMIYIKEIDIINYTHKNGISPMT
FT                   CGCPIESGKTDSKRKEIKNLLADMEQKNPNIKQSIFNSMKNINLDYVIGYTRGNKKDRG
FT                   V"
FT   gene            307679..308638
FT                   /locus_tag="Ilyop_0267"
FT   CDS_pept        307679..308638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0267"
FT                   /product="PP-loop domain protein"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR014729:IPR011063; KEGG: tex:Teth514_1810 PP-loop
FT                   domain-containing protein; PFAM: PP-loop domain protein;
FT                   SPTR: C6JKJ5 ATPase; PFAM: PP-loop family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82056"
FT                   /db_xref="GOA:E3HAQ5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAQ5"
FT                   /protein_id="ADO82056.1"
FT                   /translation="MAIKINDLNELQGVKHENYLFSIEGDRIKAFNSKEKTEIYFDLNV
FT                   KRRFKTAEAIEKHTGLKIELENLSDRELLAFIESKGFNKTLWNPIGKAMHKYNMIEAGD
FT                   SIAVGVSGGKDSLTTINALVRIKKIVNFDFEIIPIHIHPSTDSSSYNKTEDYCKKMGLE
FT                   LQVFETDLQNLLFEEKKEKNPCFLCGRIRRGMLYRIMKEQNINKLALGHHKDDIIETFL
FT                   MNVFYQGNMNVMKPAYYSKDYGVMVIRPLSFVEEKNIIRYVRKTNLPILKSECAYETNE
FT                   NSRRLRVKNIITDLSKENSEIRSVMLNSIKDLLEEKDL"
FT   gene            complement(308715..309407)
FT                   /locus_tag="Ilyop_0268"
FT   CDS_pept        complement(308715..309407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0268"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR011006:IPR001867; KEGG:
FT                   aoe:Clos_0388 two component transcriptional regulator;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; SPTR: A8MLN3 Two component transcriptional
FT                   regulator, winged helix family; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82057"
FT                   /db_xref="GOA:E3HAQ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAQ6"
FT                   /protein_id="ADO82057.1"
FT                   /translation="MKSYKVLLVDDDIEICQMIKKALDPENIETLTISTGREARNVINS
FT                   QAFDLIILDIMLDDTDGFQLLKKIQAEDIEIPVIFLSGKQQDYDKILALGMGADDYITK
FT                   PFSMSVLIAKIKAHLRRSDKIKELQTSSRKITKAPFVLNIDTYQLFKDGEEIFLSSKEI
FT                   MLMKFFMENPNRVFTKEQLYEKVWNNTIIDNNSIMVYIRHLRKKIEDDSKNPEYIQTVW
FT                   GIGYKFNI"
FT   gene            309574..311799
FT                   /locus_tag="Ilyop_0269"
FT   CDS_pept        309574..311799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0269"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR005467:IPR001789:IPR003594:IPR011006:IPR
FT                   009082:IPR004010:IPR003661:IPR004358; KEGG: aoe:Clos_0389
FT                   integral membrane sensor signal transduction histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Cache domain protein;
FT                   response regulator receiver; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   response regulator receiver; SPTR: C6Q0M6 Sensor protein;
FT                   PFAM: Cache domain; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Response regulator receiver domain; His
FT                   Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82058"
FT                   /db_xref="GOA:E3HAQ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAQ7"
FT                   /protein_id="ADO82058.1"
FT                   /translation="MGKIKLKVLPVIAIAFVILVVGNISYRSFLNYQNIIVEQQMEHLM
FT                   TISKSIGRSLELYVQEKEKGLRDLGNNIEYRIKEQENNLIDEVILNSLETFYLSQNKEI
FT                   DNLIYININDNSFHSYPEDMQEEKFITERDQFSKEISYVKRTQESYAGNPYLDRDNTFS
FT                   FNILEPVVVKDEIVGIILGKIKVMNMYELLVKPVKAGKFGYAMVKDKDGLILMHPVKEQ
FT                   VGYDVIKSRMQKYPGLDYDDLEKLLEKQMSGVEGSYVYYSYWWPQDKLEKVKKLNAFSP
FT                   AKVSEDFWIVAVVMSYDEISEPIINYLLSNIVIAIVVIMIFSWVIFLSVRMIKNKEAYE
FT                   METRYLKEINKSTEELRIKDAELHHKRKLETIGRLTGGIAHEFNNVLTPIMGYSEMVLR
FT                   NLDPELDSYDYVKTIHKSSKRAQEIIDQIRMFSGDKNIKIKYEIISINKILDDAISFAE
FT                   SVSPSNIKVIKNIDKNCGNVYANETQIHQVVLNLCTNAFNAMKETDIGNLKITAKNVKN
FT                   KKLHNMEENIVDKKEYVKISFEDNGCGMDSETQEKIFDPFFTQKLSRKSSGLGLAIVQG
FT                   IITKHGGSIEVYSEKGKGSRFDIYIPIAQNIESGKEQVYEDEILRGNEKVLVVDDDEFI
FT                   AEMLEKGLVDLGYKAESMTDGIEILKKFDYIKNNFKIVITDLTMPEINGIQLAKKIKEN
FT                   NPEIKVILMTAYSEEPLEEYMRLGIIDSYLIKPVSAAQISRSIRELV"
FT   sig_peptide     309574..309654
FT                   /locus_tag="Ilyop_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            312094..313407
FT                   /locus_tag="Ilyop_0270"
FT   CDS_pept        312094..313407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0270"
FT                   /product="Citrate carrier protein"
FT                   /note="COGs: COG3493 Na+/citrate symporter; InterPro
FT                   IPR004679; KEGG: ppr:PBPRA2296 putative citrate-sodium
FT                   symporter; PFAM: Citrate carrier protein; SPTR: Q6LPU4
FT                   Putative citrate-sodium symporter; PFAM:
FT                   2-hydroxycarboxylate transporter family; TIGRFAM: citrate
FT                   carrier protein, CCS family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82059"
FT                   /db_xref="GOA:E3HAQ8"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAQ8"
FT                   /protein_id="ADO82059.1"
FT                   /translation="MSTLAFSSEKKKSGIKVFGMSIQLFLLPLVAVLLVHFTDSLPKGL
FT                   AGAVVFSMVFGTVFGEIGDRLPIFKEYIGGAPVLIFLAAAFFVQQGWFTDREIAVVTDF
FT                   MKDSKFLTLYIIVLMTGSIFAVNRKLLLKSIVGYIPTILVGVIGASIMGILGGFIFGIT
FT                   PKEIMMLYVLPTMGGGNGAGAVPLSEIYEAATGNSKETYYSYAIAVLTIANIWAIVVAA
FT                   VLSRLGKKYPQFSGEGELVRAGNLELEEDEKVEVTPRDMAIGLLVGLTAYTLGTFLNKN
FT                   VAILSGIHTYALTVLLLVAFNGLGIIPLSIKQGAGKFQSFFSKQLTWVLMVGVGVAYTD
FT                   LGEIIAAITPANLIIALMIVIGATVGAGVMGHLVGFYAIESSITAGLCMANRGGSGDIE
FT                   VLGASKRMNLISYAQISSRLGGGIILIIASIIFKILAG"
FT   sig_peptide     312094..312213
FT                   /locus_tag="Ilyop_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(313626..314750)
FT                   /locus_tag="Ilyop_0271"
FT   CDS_pept        complement(313626..314750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0271"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647:IPR012287:IPR009057; KEGG:
FT                   fnu:FN0813 TetR family transcriptional regulator; PFAM:
FT                   regulatory protein TetR; SPTR: Q8RFA3 Transcriptional
FT                   regulator, TetR family; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82060"
FT                   /db_xref="GOA:E3HAQ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAQ9"
FT                   /protein_id="ADO82060.1"
FT                   /translation="MSKGRDKLIESSIQLFSNNTYENVSVSKICKLGKVSNGLFYKHFK
FT                   NKEEIFKHLLEETSNRIQNYFNDITGNTVQDRLESFIEINFKLTKDQLPLIRVYREGQY
FT                   KFTEFEQRLREVYLEALNVIFNKNLDEFEYLFIMSGIRYINVNFVLRGIENNPKFLAER
FT                   LMNGIFSEGNLDINNLKEKDLYLRVLFNSENIRHQLLKEGEILFGSKGVYETKINDIVN
FT                   SVGAGVGSFYYYYKTKEEFLKEIAINTKNTLLFFLKDNSQNDLSPIDQHIFLLYLMHEY
FT                   FKKSTYKYQILRELEFIEYDVSIDYFRALEEYYIHTLSKTHYTFEEKRIISAFLIGLSH
FT                   YMGIEFFFTKNLNDKDNFLKKMNYFLSHGIKDSL"
FT   gene            314988..316562
FT                   /locus_tag="Ilyop_0272"
FT   CDS_pept        314988..316562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0272"
FT                   /product="propionate CoA-transferase"
FT                   /EC_number="2.8.3.1"
FT                   /note="COGs: COG4670 Acyl CoA:acetate/3-ketoacid CoA
FT                   transferase; InterPro IPR014388:IPR004165; KEGG: fnu:FN0814
FT                   propionate CoA-transferase; PFAM: coenzyme A transferase;
FT                   SPTR: C6JJW1 Propionate CoA-transferase; PFAM: Coenzyme A
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82061"
FT                   /db_xref="GOA:E3HAR0"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAR0"
FT                   /protein_id="ADO82061.1"
FT                   /translation="MSRVKFVSANEAVDLIKDGSCVANGGFVGIGVAEEVLERLENRYR
FT                   NTGGPRDLSLIYTAGQGDGKTKGLNHFGQEGMVKKVIGGHWGLAPSLGKLANEEKLQGY
FT                   NLPQGVISHIFRDLAAGKPGTLTHVGLGTFVDPEISGGKINLSTTEDVVEKMKIGKKDY
FT                   LFYNIEKIVPKIDYAIIRGSSADENGNISMEKEALTLETLSIAMATRNTGGKVIVQVEK
FT                   KVKSGSIDPKLVKIPGILVDYVVVSEVPAENHMQTFSEIFNESYVNSAISISEGSLDFP
FT                   LNERKVIARRCAMLLSEETRILNYGIGMPEGIAAVLNEEGMEKNFIPTVEPGAIGGTPV
FT                   GGLSFGAAITPEAIIDQSYQFDYYNGGGLDMAFLGLAQCDEHGNINVSKFGPKIAGCGG
FT                   FIDITQNAKQVVFCGTFTAGGLKVEAKNGKLDITNEGKFSKFLKDVEQITFSGELANKQ
FT                   NKNIFYVTERAVFKLKKEGLELIEIAPGVDLEKDILENMDFKPMISDDLKLMDERIFKD
FT                   ELMGLNF"
FT   gene            316600..317973
FT                   /locus_tag="Ilyop_0273"
FT   CDS_pept        316600..317973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0273"
FT                   /product="Citrate transporter"
FT                   /note="COGs: COG2610 H+/gluconate symporter and related
FT                   permease; InterPro IPR004680; KEGG: ctc:CTC00709 integral
FT                   membrane permease; PFAM: Citrate transporter; SPTR: Q1ZB14
FT                   GntP family transporter; PFAM: Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82062"
FT                   /db_xref="GOA:E3HAR1"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAR1"
FT                   /protein_id="ADO82062.1"
FT                   /translation="MGIGILGIVLSLILLMFFAYRGVSVIILAPLLACLAAVLSGDFPA
FT                   IVAYTEVFMKGVGGFVIKYFPIFLTGAIFGKLMGVSGASKTISHFFVDKLGKERAILAV
FT                   VMATALLVYGGVSLFVVVFAIYPIGASLYREAGIPKRLLPATIAFGAFTFAMTALPGTP
FT                   QYINTMPIQYFNTNIYAAPVLGIVGSLVMGTLGIAWLNGRAKKLMASGEGYGDHVENFV
FT                   SDDDNLPGFGLSIMPIFTIFALNYYFTNFYFKSYGERYSGAMEKLGSSGINGIWPVIIS
FT                   LGAAIIVCMILFRPYIKDMKKEMADGALGSLLPIMNTGSEVGYGAVIKSLAAFLIIKDG
FT                   ILSIPGTPLIKVAASTTALAGMVGSSSGGTAIALGALGDTFMKLAAATGVNPEAMHRIA
FT                   IMAAGGLDTFPHCGAVITLLAVCGLTHKESYKDIAVCTMVIPLIATTVCIVLAAMGMN"
FT   sig_peptide     316600..316662
FT                   /locus_tag="Ilyop_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            318002..318721
FT                   /locus_tag="Ilyop_0274"
FT   CDS_pept        318002..318721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0274"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR016040:IPR002198:IPR002347;
FT                   KEGG: acl:ACL_0504 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase; PFAM: short-chain dehydrogenase/reductase SDR;
FT                   SPTR: A9NFJ2 3-oxoacyl-[acyl-carrier-protein] reductase;
FT                   PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82063"
FT                   /db_xref="GOA:E3HAR2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAR2"
FT                   /protein_id="ADO82063.1"
FT                   /translation="MRLEEKVCIVTGGAKGIGAEMAQLFAKEGAKVIAADMSDLDYSVE
FT                   NIEGYKLNVADTNQCEELFKYASEKYGRIDVLVNNAGITRDGLTHKITDDMWNMVIDVN
FT                   LKGVFNLTKHVGPYMMKQGNGSIINISSVVGEYGNIGQANYAATKAGVIGLAKTWAKEF
FT                   ARKGAAVRANAIAPGYIMTDILKTVPQPLLDDFAKLTMLGRLGQPEEIAKAALFLASDD
FT                   SSYVTGHVLSVNGGMRL"
FT   gene            318746..319951
FT                   /locus_tag="Ilyop_0275"
FT   CDS_pept        318746..319951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0275"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR002155:IPR016038:IPR016039; KEGG: fnu:FN0495 acetyl-CoA
FT                   acetyltransferase; PRIAM: Acetyl-CoA C-acetyltransferase;
FT                   SPTR: C3WHI0 Putative uncharacterized protein; TIGRFAM:
FT                   acetyl-CoA acetyltransferase; PFAM: Thiolase, C-terminal
FT                   domain; Thiolase, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82064"
FT                   /db_xref="GOA:E3HAR3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAR3"
FT                   /protein_id="ADO82064.1"
FT                   /translation="MRKVYVISAKRTPVGTFLGGLSSVSPAELGGAVIRNIVEETGIDP
FT                   KNLDEVVIGNVLPAGHGQGIGRQAAVAGGVPYEVPAYSLNIICGSGMKSVISAYSNIKS
FT                   GEANLIIAGGTESMSQAGFVLPAAVRGGHKMADIKMIDHMIKDALTDSFNDYHMGITAE
FT                   NIVEKYGLTREAQDKFSMESQKRAIAAVDSGRFKDEIVPVEVKSRKGSVVVDQDEHPNR
FT                   KTTPEILAKLRPAFKKDGSVTAGNASGLNDGASMLLLASEEAVEKYNLKPIAEIISTGQ
FT                   GGVDPSIMGMGPVPAINNALGKLEMKLEDIELLELNEAFAAQSLGVMTELSKQHNVDLS
FT                   WFSERTNVNGGAIAIGHPVGASGNRIITTLIHEMIKRDVKTGLASLCIGGGMGTAVILN
FT                   KI"
FT   sig_peptide     318746..318838
FT                   /locus_tag="Ilyop_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            320082..320861
FT                   /locus_tag="Ilyop_0276"
FT   CDS_pept        320082..320861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0276"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.55"
FT                   /note="COGs: COG1024 Enoyl-CoA hydratase/carnithine
FT                   racemase; InterPro IPR018376:IPR001753; KEGG:
FT                   cdl:CDR20291_0913 3-hydroxybutyryl-CoA dehydratase; PFAM:
FT                   Enoyl-CoA hydratase/isomerase; SPTR: C9YK12
FT                   3-hydroxybutyryl-CoA dehydratase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82065"
FT                   /db_xref="GOA:E3HAR4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAR4"
FT                   /protein_id="ADO82065.1"
FT                   /translation="MKYKNLIIEINKNICIIKINRPQALNALNIETITEIHNCFKELEK
FT                   NDNVDIIIIMGEGKAFVAGADISYMKNLNAVEAKEFGLSGINAFNAIENSKKIVIAALN
FT                   GFTLGGGCELAMACDIRIASTKVKIGQPEVSLGITPGFGGTQRLPRLVGVAKAKELIYT
FT                   GNIIDAQEAESIGLVNKVVEPEFLMEEVLGMANKILENAKFAVRYSKEAIDKGLQVDKT
FT                   TGMFIESSLFGLCFSTDDQQEGMLSFLEKRKAVFKDK"
FT   gene            320929..321333
FT                   /locus_tag="Ilyop_0277"
FT   CDS_pept        320929..321333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0277"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="COGs: COG2030 Acyl dehydratase; InterPro IPR002539;
FT                   KEGG: fnu:FN0816 dehydrogenase; PFAM: MaoC domain protein
FT                   dehydratase; SPTR: C3WB09 Dehydratase; PFAM: MaoC like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82066"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAR5"
FT                   /protein_id="ADO82066.1"
FT                   /translation="MKYSELKLGMKSSITKTITETDVILYSGVSLDTNPAHLNEEYAKT
FT                   TMFKKRIAHGMLTAGLISAVLGTRLPGEGSIYMGQELKFKAPVYMGDTITAEVEIIELI
FT                   DEKNQIILKTVCTNQDGKVVIDGTARIMKK"
FT   gene            321378..322523
FT                   /locus_tag="Ilyop_0278"
FT   CDS_pept        321378..322523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0278"
FT                   /product="butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase;
FT                   InterProIPR013786:IPR006091:IPR013764:IPR009100:IPR
FT                   009075:IPR006089:IPR006092:IPR006090; KEGG: fnu:FN0783
FT                   acyl-CoA dehydrogenase; PFAM: acyl-CoA dehydrogenase domain
FT                   protein; PRIAM: Butyryl-CoA dehydrogenase; SPTR: C3WB10
FT                   Acyl-CoA dehydrogenase; PFAM: Acyl-CoA dehydrogenase,
FT                   C-terminal domain; Acyl-CoA dehydrogenase, middle domain;
FT                   Acyl-CoA dehydrogenase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82067"
FT                   /db_xref="GOA:E3HAR6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAR6"
FT                   /protein_id="ADO82067.1"
FT                   /translation="MNFELPKTHVLFRQMIREFVENEVKPIAAEIDEEERFPIETVKKM
FT                   NEIGLMGIPVPKEYGGAGGDNLMYAMAVEELSKACATTGVIVSAHTSLGMAPILEFGTD
FT                   AQKKKYLPKMTTGEWLGAFGLTEPNAGTDAAGQQTTAHFDEKTNEWVLNGSKIFITNAG
FT                   YAHVYIIFAMTDKSKGLKGITAFILEADTPGFSVGKKEKKLGIKGSATCELIMEDCRIP
FT                   KENLLGAIGKGFKIAMMTLDGGRIGIASQALGISQGALDESINYVKERKQFGRSIAAFQ
FT                   NTQFQLADMHTKTEAARMLVYSAACKKSSKKPYSQDAAMAKLLAAETAMEVTTKAVQLH
FT                   GGYGYTREYPVERMMRDAKITEIYEGTSEVQKMVISAGLLK"
FT   gene            322570..323352
FT                   /locus_tag="Ilyop_0279"
FT   CDS_pept        322570..323352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0279"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="COGs: COG2086 Electron transfer flavoprotein beta
FT                   subunit; InterPro IPR014729:IPR012255:IPR014730; KEGG:
FT                   bhy:BHWA1_01910 electron transfer flavoprotein beta
FT                   subunit; PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; SPTR: C3WB11 Electron transfer
FT                   flavoprotein beta subunit; PFAM: Electron transfer
FT                   flavoprotein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82068"
FT                   /db_xref="GOA:E3HAR7"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAR7"
FT                   /protein_id="ADO82068.1"
FT                   /translation="MKIVVCVKQVPDTTEIRLDPVTGTLIRDGVPSIINPDDKAGLEEA
FT                   LKLKDKFGAHVTAITMGPPQAQEALRETLAMGADRAILLTDRKFAGADTLATSNALAAA
FT                   IKELDYDMIIAGRQAIDGDTAQVGPQIAEHLGMPQVSYVKDIECDEDKTLTIKRAVEDG
FT                   YYLLQVKMPCLVTVLTEANKPRYMSVKGIVEAYDTDVEVWDTTNITVDLEKLGLKGSPT
FT                   KVRKSFTKGAKQAGKVYELESKEAAKLIVEKLKESFVI"
FT   gene            323386..324396
FT                   /locus_tag="Ilyop_0280"
FT   CDS_pept        323386..324396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0280"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="COGs: COG2025 Electron transfer flavoprotein alpha
FT                   subunit; InterPro IPR014729:IPR001308:IPR014730:IPR014731;
FT                   KEGG: bhy:BHWA1_01909 electron transfer flavoprotein alpha
FT                   subunit; PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; SPTR: C6JJW5 Electron transfer flavoprotein alpha
FT                   subunit; PFAM: Electron transfer flavoprotein domain;
FT                   Electron transfer flavoprotein FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82069"
FT                   /db_xref="GOA:E3HAR8"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAR8"
FT                   /protein_id="ADO82069.1"
FT                   /translation="MNLDDYRGILVFAEQREGEIQNVGLELLGKAKELASEINEEVTAI
FT                   LLGYQVEHLSKELISYGADKVVVVDKEELKFYDTEAYAQAFSSVIKDKKSEIVLVGATT
FT                   IGRDLGPRVSARVVTGLTADCTKLEISEERELLMTRPAFGGNLMATIICPDHRPQMSTV
FT                   RPGVMQKFSKDEARTGEVEKFDVEFDKSKMKVKIIEIIKEEKEKIDITEANVLISGGRG
FT                   VGSADNFKKLEGLAEEIGGTVSASRAIIDSGWIDHDRQVGQTGKTVRPDIYFALGISGA
FT                   IQHVAGMEESEYIIAINKDKGAPIFNISDLGIVGDVSKIVPMITEEIKLLKSQKS"
FT   gene            complement(324635..326863)
FT                   /locus_tag="Ilyop_0281"
FT   CDS_pept        complement(324635..326863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0281"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR005467:IPR001789:IPR003594:IPR011006:IPR
FT                   009082:IPR003661:IPR004358; KEGG: aoe:Clos_0389 integral
FT                   membrane sensor signal transduction histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SPTR: C6Q0M6
FT                   Sensor protein; PFAM: Cache domain; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; Response regulator
FT                   receiver domain; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82070"
FT                   /db_xref="GOA:E3HAR9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAR9"
FT                   /protein_id="ADO82070.1"
FT                   /translation="MKKNKLKFLSIIAIIFIALIVSRISYRSYIKYQDIVMTQQIKHLM
FT                   TISKSIGRSLNLYIGEKEKALKILSDDLAHHMESSPEENHRDYILKAMETFYLNQDEEM
FT                   ANLNYMETKNRFFLSYPKGDFIVTGDDFYDEISYVKARKDSYIGFPYHDRYDTLSINIV
FT                   EPVIIKSKLVGIIFGKIKLENMNELLLKPVKIGEFGYAVVKDSTGKILMHPSKGQVGDF
FT                   VITSRKKKYPNLDYSGIASLFKKQLSQNDGFHIYHSYWWPQDTLVLTKKINVFSRIDFS
FT                   SDFWIVSVVSSYDEITEPIKDYLYGSIFISIIIIVISSCIVFWIVRMIKNKEAYEMETN
FT                   YLREINKSSEELRKKDAELHHRRKLETIGTLTGGIAHEFNNVLTPIMGHSEMLLRNLDP
FT                   DLDNYEDAEAIYNSSKRAQEIIDQIRMFSGDKNIKIKYDIISVNKVLEDALKFSEFVLP
FT                   SNMTIIKEIKENCGNIYANETQIHQVILNLCTNACNAMKNKQQGILKISLNISKYLEKE
FT                   GQDENIHSGREYVKISFEDNGCGIEEDIVDKIFDPFFTKKLSDKSSGLGLSIVQGIVTK
FT                   HGGMIKLSSKKNIGSRFEVYIPKAKKNETLDSIEPQSSDIKGKERVLIIDDDKNIAEML
FT                   KRGLNELGYSVSSIVECDEILRKFNYIKDHFDIIVTDLTMPEISGIQIAKKIKRNQSSV
FT                   KTILITAYSDEPLEEYMKDKTLDDYLIKPVSAAQVSRSIRKIMDNKDT"
FT   sig_peptide     complement(326783..326863)
FT                   /locus_tag="Ilyop_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            327011..327712
FT                   /locus_tag="Ilyop_0282"
FT   CDS_pept        327011..327712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0282"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR011006:IPR001867; KEGG:
FT                   aoe:Clos_0388 two component transcriptional regulator;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; SPTR: A8MLN3 Two component transcriptional
FT                   regulator, winged helix family; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82071"
FT                   /db_xref="GOA:E3HAS0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAS0"
FT                   /protein_id="ADO82071.1"
FT                   /translation="MNGYKVLLVDDDAAICKVIKRALKLENIEIIYASNGEEAYSLVRT
FT                   QIFDLVILDVSLGDTDGFQVLKKIRTEGNDVPIIFLSGNQHENDKILALGMGADDYITK
FT                   PFSIFLLVAKIKAHLRRGDKIKEHQTSLKKIIQGPFILNTETFQLFKNEKEVFLSSKEI
FT                   MLMKFFMENPNIVFSKDQIYEKVWNNSIVDDNTIMVYMRHLRKKLEDDPKNPKFFQTVW
FT                   GIGYKFNNFIK"
FT   gene            327996..329006
FT                   /locus_tag="Ilyop_0283"
FT   CDS_pept        327996..329006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: bwe:BcerKBAB4_0813 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: C2URJ1
FT                   Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82072"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAS1"
FT                   /protein_id="ADO82072.1"
FT                   /translation="MKKRNLFLTLALILGLAFTGCGGKEETTKADGSFPTAKTLEIIAP
FT                   ANPGGGWDATARALKKVIDDNDIAPEVNIIVTNKPGGKGSIAWNSLIQRKDSHIVAMDS
FT                   AYIYLNQLLGVQGAQKLDDLRPVATLTNEWIGYFVKGDSDIETITEITEKLKKDPSSVV
FT                   VAVAPGKGNDDHLSIMNVAKTAGVDIAEFDKNIVATSTGELIPGVLGGFYEVIVTGAAD
FT                   GIEFMKSGDLKCIAITADERLGGEFADVPTVKESGIDVVFPHWRGIVAHPGMTDEEAAY
FT                   WETIIEKAMATDDWKQIMENNSWLPYYKNSADTRKMWEEEFKVYKDLTDAVGLTK"
FT   sig_peptide     327996..328085
FT                   /locus_tag="Ilyop_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            329107..329559
FT                   /locus_tag="Ilyop_0284"
FT   CDS_pept        329107..329559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mms:mma_1292 small permease component of
FT                   tripartite tricarboxylate transporter; SPTR: C1TQ43
FT                   Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctB family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82073"
FT                   /db_xref="GOA:E3HAS2"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAS2"
FT                   /protein_id="ADO82073.1"
FT                   /translation="MTQNKVIGIFGALLTAIYGFSTFSATGAGATFLSGTKIFPMMVII
FT                   LTAVLSAVIFLQDHLGKEKGKKIDIDKKVLITIGKSTLIFVVYTLIFEHLGYILSTVVL
FT                   LMGLLSILNKGKLKQNIIISVAFSVIAYFVFSKLLAISLPPGIINF"
FT   sig_peptide     329107..329196
FT                   /locus_tag="Ilyop_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            329575..331086
FT                   /locus_tag="Ilyop_0285"
FT   CDS_pept        329575..331086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0285"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: bhy:BHWA1_02095 hypothetical
FT                   protein; PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: C0QVQ2 Putative uncharacterized
FT                   protein; PFAM: Tripartite tricarboxylate transporter TctA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82074"
FT                   /db_xref="GOA:E3HAS3"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAS3"
FT                   /protein_id="ADO82074.1"
FT                   /translation="MLDIFSYLMGGFREILTFTNVMWIFFGGIFGSIVGMLPGLGPATG
FT                   IAVLLPLTFGMNPVTALSTLTAIYYGAMFGGSRASILINTPGDGGAIAATFDGYPMTKN
FT                   GKAGEALAMSAIASFIGGVIATILMTFLAVSISKVAIKFGPPQYFTLMIFALIATSAIS
FT                   RGNVIKGLFATSLGLMVSTIGADRLTGTVRYTMGIPELYEGIDFLILIIGFYAIGEVYN
FT                   NYGKILFNHDPSSDAKDSHYDISRVWVSKSEFKECLMPILRSTPLGFFIGILPGAGATI
FT                   SSMLAYSTEKSMSKDPDSFGKGNIVGLAAPEAANNATAVGAMIPMLTLGIPGSGTTAVM
FT                   LGALMMLGIKPGPMLFTSQPDVAWGVLASMYISNLILAVINIPLASQLVKVLKTPEKIL
FT                   LPLVVALGFIGTYALSFATTDFFIIALCGVIAFFVKKLNIPISSFILALILGSKIETSF
FT                   RQSMVLSKGSMGIFASDSITIFFIILAVLSLFGPLLLNKMLSNNK"
FT   gene            331125..331484
FT                   /locus_tag="Ilyop_0286"
FT   CDS_pept        331125..331484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amr:AM1_1452 RDD domain-containing protein;
FT                   SPTR: C7GG26 Sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82075"
FT                   /db_xref="GOA:E3HAS4"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAS4"
FT                   /protein_id="ADO82075.1"
FT                   /translation="MIFNKKLRLIWGVLFTVALIAVLSFGRGAMYAIMFGVASGFVFIA
FT                   DFYILSREYKKSGVMEGKYRKRWHIFSKFTQWLFWTALLYVPFQPQFSTGYKIFMLVDF
FT                   FLVSTFAFYKFSRSN"
FT   sig_peptide     331125..331202
FT                   /locus_tag="Ilyop_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(332021..334276)
FT                   /locus_tag="Ilyop_0287"
FT   CDS_pept        complement(332021..334276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0287"
FT                   /product="aconitate hydratase domain protein"
FT                   /note="COGs: COG1048 Aconitase A; InterPro
FT                   IPR015931:IPR015932:IPR015928:IPR001030; KEGG:
FT                   eel:EUBELI_01974 aconitate hydratase; PFAM: aconitate
FT                   hydratase domain protein; SPTR: B0A7I2 Putative
FT                   uncharacterized protein; PFAM: Aconitase family (aconitate
FT                   hydratase)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82076"
FT                   /db_xref="GOA:E3HAS5"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAS5"
FT                   /protein_id="ADO82076.1"
FT                   /translation="MIKLYDSGVYVKNGSEIVPAGTDLGVSIEDAKKGTMAYSILEAHN
FT                   TTDDMKDLTLKFDAMASHDITFVGIIQTAKASGLKKFPLPYVLTNCHNSLCAVGGTINE
FT                   DDHMFGLSAAKKYGGIYVPAHQAVIHSYMRENYAGCGKMILGSDSHTRYGALGTMAIGE
FT                   GGGELVKQLLEKTYDVPYPKVVGIKLTGKPKPGIGSHDVALAIIGKVFKNGYVKNSVME
FT                   FFGDGIKNLNVEFRNGIDVMTTETTCLTSIWETDEQVKNFLDIHHRVEDYKELKPADVA
FT                   YYDGMVEINLEEIESMIALPAHPSNVYSIRELYENLDEILTETEANCKKLGMDIDLKSK
FT                   VVNGKLRAEQGVIGGCSGGTFDNIVGALDVLKGHAIAEEFTLSIYPGSQPAYMMFNEMG
FT                   LNIEAMKSGAIMRTAFCGPCFGAGDTPANNQLSIRHNTRNFPSREGSKPGLGQTSSVAL
FT                   MDAKSIAATALNGGFITAATDLDVEYTDTTATYKYDDTPYKNKVHNYGKTPVAEPEVEL
FT                   IEGPNIKPWPEMPELTENVLFKVTAFIDDPVTTTDELIPSGETSSFRSNPYGLSEFTLS
FT                   RRVPEYVGKSKAVREFEYAREKGENPFEKFDELKPVYEKVKTLVEVDPTEIGIGSLVYA
FT                   NKPGDGSAREQAASCQKVLGGWGNICHEYATKRYRSNVINWGMLPFTMEEDAPFGDEAY
FT                   LLVTDVRKALKEGIEDITAYVLGDEIKKFNLKLTNLTQDERQVLLDGCLINYYRKNN"
FT   gene            334594..335973
FT                   /locus_tag="Ilyop_0288"
FT   CDS_pept        334594..335973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0288"
FT                   /product="YidE/YbjL duplication"
FT                   /note="COGs: COG2985 permease; InterPro IPR006512; KEGG:
FT                   aoe:Clos_0433 YidE/YbjL duplication; PFAM: YidE/YbjL
FT                   duplication domain protein; SPTR: A8MLS8 YidE/YbjL
FT                   duplication; TIGRFAM: YidE/YbjL duplication; PFAM:
FT                   Predicted Permease Membrane Region; TIGRFAM: AspT/YidE/YbjL
FT                   antiporter duplication domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82077"
FT                   /db_xref="GOA:E3HAS6"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAS6"
FT                   /protein_id="ADO82077.1"
FT                   /translation="MKFDIFKFITNSYTLIFLTLSTGMLLGKVKIGKFKLGISGSLFTG
FT                   LFLGWGVLKLARRIPEGASDYKRASEIIHHALISHELSHLFLVLFIAAVGLMAAETLAS
FT                   VLRNYGVKFVSLGIIITLAGCAYSYGFSKLNPNAKMYESAGIYTAALTSSPGLATALET
FT                   TERSAKTLIERYETLDNGAKDKVLGVIDPTGELNHENTQVLTDDQKEVFIKESRVNTGV
FT                   ANAIGFPFGVLVVILTVNLIPKLFRVDLEKEGKNFKRELKEMTEKDLEIETKKVHRVGF
FT                   DIPAFAFACFFGFIIGGFKIPLGPLGYFSLGTTGGVLIGSLTLGHIGKLGMMTFRMNPK
FT                   KLEVIKELGLSSYVGAVGLTYGEKVVAALAGDGVYLVFQVVIIAFLCMVTGFLVGKYLL
FT                   NINWYMLSGAICGGMTSTPGMGAAVDAIGTNDPASGYAATYPFALICMVLFTIILNNIP
FT                   L"
FT   gene            complement(336166..336810)
FT                   /locus_tag="Ilyop_0289"
FT   CDS_pept        complement(336166..336810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0289"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1802 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011991; KEGG: drm:Dred_0095 GntR family
FT                   transcriptional regulator; PFAM: regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; SPTR: A4J0P2
FT                   Transcriptional regulator, GntR family; PFAM: Bacterial
FT                   regulatory proteins, gntR family; FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82078"
FT                   /db_xref="GOA:E3HAS7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAS7"
FT                   /protein_id="ADO82078.1"
FT                   /translation="MIKPRTNTSDNIYDTIKEEILSGELSFGDRIVEIDYSKKLNVSRT
FT                   PLREAIKKLEIEGIVERLANGRVKIIDITPERIKEIFKIRIALENILLESISQNPEVIS
FT                   LLEENLILTEHYIKLKKWKETRKLFLEFNKIFYQKSELEFTIKILKQYDFILSKLRLSS
FT                   LNSKERIISACEEHSLIVKYLKNSQLELAKAVNTTHLLSAETSLLNSIDFD"
FT   gene            337393..338421
FT                   /locus_tag="Ilyop_0290"
FT   CDS_pept        337393..338421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: bhy:BHWA1_02093 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: B8KBN4
FT                   Secreted protein; PFAM: Tripartite tricarboxylate
FT                   transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82079"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAS8"
FT                   /protein_id="ADO82079.1"
FT                   /translation="MNRRFKNLSKIFIAALSILALVLTGCGKKDEGTAANTAGGYPSKP
FT                   MNFVAPGGAGGGWDTTIRTVAKTLKDTKLVNVPMPVTNKPGGGGGVALAYLQELEGDDK
FT                   TISVYSPPLLLIHLNGSSKLSYKDVTPIARLITDYGAFVVKKGSKYNNIGEIMDALKKD
FT                   PKSVKFGGNSSAGSMDHIQFLMIAKAAGVKNIRDIDYISYQNNEGAAQLLGGHIDLLST
FT                   GLGDVSALLESGQLVGLAQTADERVGDGALADIPTCKESGIDAVFYNWRGLFGAPDMPE
FT                   EALTYWEDTLAKMVETPEWDEAVKKNGWSKSFANSADFDAFLEKTNEEYKEILADIGML
FT                   KQ"
FT   sig_peptide     337393..337491
FT                   /locus_tag="Ilyop_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            338728..339219
FT                   /locus_tag="Ilyop_0291"
FT   CDS_pept        338728..339219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0291"
FT                   /product="putative tricarboxylate transport protein TctB"
FT                   /note="KEGG: tle:Tlet_0039 putative tricarboxylate
FT                   transport protein TctB; SPTR: A8F377 Putative
FT                   tricarboxylate transport protein TctB"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82080"
FT                   /db_xref="GOA:E3HAS9"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAS9"
FT                   /protein_id="ADO82080.1"
FT                   /translation="MNIKVKTTMAFTVFGLLYTVVALMMPKAAVGNPFAPKVFPLILGI
FT                   GLTVMGALYTVKEYKHWKEEQASGVEEEISPKKQEIENKTNKLITITAVAGIVYAAIFE
FT                   HAGYVISTSLFIGAIMFAINGKKKWMLNLAVAIIFSVAVYFVFSTLLAIPLPKIPGLEI
FT                   "
FT   sig_peptide     338728..338811
FT                   /locus_tag="Ilyop_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            339238..340740
FT                   /locus_tag="Ilyop_0292"
FT   CDS_pept        339238..340740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0292"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: bhy:BHWA1_02095 hypothetical
FT                   protein; PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: C0QVQ2 Putative uncharacterized
FT                   protein; PFAM: Tripartite tricarboxylate transporter TctA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82081"
FT                   /db_xref="GOA:E3HAT0"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAT0"
FT                   /protein_id="ADO82081.1"
FT                   /translation="MMEILQNLMHGFSVAATPMNLLWVTIGGTLGTIVGMLPGLGPATG
FT                   VAVLLPLTFTMGPTAALITMCGIYYGAMFGGSRSSILINTPGDGAALAATFDGYPMAMN
FT                   GRAEAALAMSAVASLIGGIISAVLITFVATPVSMFALKFGPAEYFLLMVAALSMTASMS
FT                   KGNMIGGFVSMFVGLIIATVGLDAQSGVPRFTFGIMELQQGIDFLILIIGIYALGEVFK
FT                   SFKSINEGQKDMQKKFGKIWFTKEDWKECLMPILRSTPLGFIVGALPGAGGTMASLMSY
FT                   NNEKQLSKDPDSFGKGNIVGLAAPEAANNAASVGALIPMLTLGIPGSGTTAVMMGALLM
FT                   LGLQPGPMLFVQHPDIAWGLIASMFIGNIVLAIVNIPLAGLLVRVLAIPPKILYPIVLG
FT                   LAFIGTYAIGNSAMDFYLLVIFGVMGLFMSKAKVPTAPMILGVIVGGTMEQSFRQAIVL
FT                   SDGSLSIFTGSPLAITLIALTVGSVIFPLIKEAMKNKKLASA"
FT   sig_peptide     339238..339282
FT                   /locus_tag="Ilyop_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            340799..341002
FT                   /locus_tag="Ilyop_0293"
FT   CDS_pept        340799..341002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0293"
FT                   /product="CopG/DNA-binding domain-containing protein"
FT                   /note="KEGG: npu:Npun_F5803 CopG/DNA-binding
FT                   domain-containing protein; SPTR: B2J985 CopG domain protein
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82082"
FT                   /db_xref="GOA:E3HAT1"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAT1"
FT                   /protein_id="ADO82082.1"
FT                   /translation="MKNISINIEDKIYEEIQDVCKELNETIEDFVAAALSNHLEERMKL
FT                   ADSKKTDEILEKVQGEGEDEWI"
FT   gene            341691..343073
FT                   /locus_tag="Ilyop_0294"
FT   CDS_pept        341691..343073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0294"
FT                   /product="Pyruvate carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /note="COGs: COG5016 Pyruvate/oxaloacetate
FT                   carboxyltransferase; InterPro
FT                   IPR000891:IPR013785:IPR003379; KEGG: efa:EF3317
FT                   oxaloacetate decarboxylase; PFAM: Conserved carboxylase
FT                   region; pyruvate carboxyltransferase; PRIAM: Pyruvate
FT                   carboxylase; SPTR: C6PSX5 Conserved carboxylase region;
FT                   PFAM: HMGL-like; Conserved carboxylase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82083"
FT                   /db_xref="GOA:E3HAT2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAT2"
FT                   /protein_id="ADO82083.1"
FT                   /translation="MKKLKITETALRDGHQSLIATRLKTEEILPILEKMDQAGYYSLEV
FT                   WGGATFDACIRFLNEDPWERLREMRKRVKNTKLQMLLRGQNLLGYRHYADDVVDKFIEK
FT                   SLKNGIDIIRVFDALNDYRNLETAIKSIIKYNGHCQGCIAYTTSEIHTVDYFVEKVKEL
FT                   EKLGAHSICIKDMAGILLPEVAYELIKKIKSVTDLPIELHTHCTSGIASMLYMRAIEAG
FT                   VDIIDTGISPFSGGTAQPATEVFAHVLKGSDRDPELDLGLLSEIADYFKPIKEKYRSEG
FT                   ILNPKVMDVEPKTLSYQVPGGMLSNLLSQLEGQGASDRYEEVLEEVPRVRKDLGYPPLV
FT                   TPLSQMVGTQAVFNVLVGERYKFVPKEIKDYVRGKYGQSPAPISQEIKEKIIGDETPIT
FT                   HRPADDIAPEFEKLKAEIGELAQSDEDVLMYALFPENAKEFLKKKFEELEEENEYIMTV
FT                   YV"
FT   gene            343132..343401
FT                   /locus_tag="Ilyop_0295"
FT   CDS_pept        343132..343401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0295"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /note="COGs: COG3052 Citrate lyase gamma subunit; InterPro
FT                   IPR006495; KEGG: fnu:FN1378 citrate lyase subunit gamma;
FT                   PFAM: Citrate lyase acyl carrier protein CitD; SPTR: C6JMJ9
FT                   Citrate lyase acyl carrier protein; TIGRFAM: citrate lyase
FT                   acyl carrier protein; PFAM: Malonate decarboxylase delta
FT                   subunit (MdcD); TIGRFAM: citrate lyase acyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82084"
FT                   /db_xref="GOA:E3HAT3"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAT3"
FT                   /protein_id="ADO82084.1"
FT                   /translation="MIGICGNEKASDALVTVDLNTVGISVEVISKLKGMFGNLMEKSVM
FT                   EALAEMKAENAKVTVQDFGALDFIIKARTKTAVRRAMSAAGGVK"
FT   gene            343401..344297
FT                   /locus_tag="Ilyop_0296"
FT   CDS_pept        343401..344297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0296"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="COGs: COG2301 Citrate lyase beta subunit; InterPro
FT                   IPR015813:IPR011206:IPR005000; KEGG: amt:Amet_3224 citrate
FT                   (pro-3S)-lyase; PFAM: HpcH/HpaI aldolase; PRIAM: Citrate
FT                   (pro-3S)-lyase; SPTR: C6JMK0 Citrate (Pro-3S)-lyase; PFAM:
FT                   HpcH/HpaI aldolase/citrate lyase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82085"
FT                   /db_xref="GOA:E3HAT4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAT4"
FT                   /protein_id="ADO82085.1"
FT                   /translation="MKKLRRTMLFAPASNPKLLFNTAIYKPDCILFDLEDAVRYDEKDA
FT                   ARDLLVEAFKSIDYGQCEVFVRTNPLRKPTGEKAPFGELDIRALVPAGMRRMRLPMCEK
FT                   PEHIEELSALLDEVEKEHGIEPGSVKVQASLETPIGVMNALAIAQSSDRITSISFGAED
FT                   FTRTLGTDRTKAATELFYARSQVVMAAAVAGVDAIDTVWADVSDTEGFIKEVESAKNLG
FT                   FSGKSCIHPSQVKEVHNIFTPSMAEVEKSVEILKAAADANIQDGGVITVKGKMVDIPVI
FT                   AKAERIVSLAKGAGLIK"
FT   gene            344318..345877
FT                   /locus_tag="Ilyop_0297"
FT   CDS_pept        344318..345877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0297"
FT                   /product="citrate lyase, alpha subunit"
FT                   /EC_number="4.1.3.6"
FT                   /note="COGs: COG3051 Citrate lyase alpha subunit; InterPro
FT                   IPR006472; KEGG: bhy:BHWA1_02092 citrate lyase, alpha
FT                   subunit; PFAM: Citrate lyase alpha subunit; PRIAM: Citrate
FT                   (pro-3S)-lyase; SPTR: C6JMK1 Citrate lyase; TIGRFAM:
FT                   citrate lyase, alpha subunit; PFAM: Citrate lyase, alpha
FT                   subunit (CitF); TIGRFAM: citrate lyase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82086"
FT                   /db_xref="GOA:E3HAT5"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAT5"
FT                   /protein_id="ADO82086.1"
FT                   /translation="MELKTLVNKLGREMPSFIEGYGEVKPYAGPFATKASGRKYAPLKS
FT                   SSKPGDLKLLGSLKEALEKVEIKDGMTISFHHHLRNGDYVLNMVVEEIASMGIKDITIC
FT                   SSSLTSAHEPLIDHIKNGVITGLQTSGLRGKIAKEVATNNILGKPVVFRTHGGRARAVE
FT                   AGEVKIDVAFIAAPSCDPMGNMNGKEGKSAFGAMGYPMVDAEYAEKVVAITDNLMPFPL
FT                   AKVSIPMTLVDHVVEVESIGDPAKIATGATRVTKNPMDLLIAENAAKVLIASGLVKEGF
FT                   SFQAGSGGASLAVCKFIREYMEENEIKGSFAAGGVTAYLVELLEAGLFNALLDTQTFDG
FT                   AAADSFNRNPNHIEMSASMYANPHNKSCSAHQLDMMILSATEIDTEFNLNSMTGSTGMI
FT                   MGAQGGAPDTAAGAKLTVCVAPTMRKRIPILLDKVTNIVTPGETVDVLVTERGTCVNPL
FT                   RTDLIEKFTAAGIDLMTIEELKSEVEKLTGVPERVQYEDKVVGIIEYRDGTVTDVIKQV
FT                   KK"
FT   gene            345984..346319
FT                   /locus_tag="Ilyop_0298"
FT   CDS_pept        345984..346319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0298"
FT                   /product="sodium pump decarboxylase, gamma subunit"
FT                   /note="InterPro IPR005899; KEGG: eel:EUBELI_00921
FT                   hypothetical protein; PFAM: sodium pump decarboxylase gamma
FT                   subunit; SPTR: O54029 Oxaloacetate decarboxylase gamma
FT                   chain; TIGRFAM: sodium pump decarboxylase, gamma subunit;
FT                   PFAM: Oxaloacetate decarboxylase, gamma chain; TIGRFAM:
FT                   sodium pump decarboxylases, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82087"
FT                   /db_xref="GOA:E3HAT6"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAT6"
FT                   /protein_id="ADO82087.1"
FT                   /translation="MNITELMTLFSNPENIKTLDMGDKMMGVGVTVILGMGITVTALIF
FT                   IQFLIGMMTKLMAEKPKPAAVTEETPKAPLKPDVNDPELMAAISAAVAAKMGISNDKIV
FT                   KTVVEKR"
FT   gene            346373..346768
FT                   /locus_tag="Ilyop_0299"
FT   CDS_pept        346373..346768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0299"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="COGs: COG4770 Acetyl/propionyl-CoA carboxylase alpha
FT                   subunit; InterPro IPR000089:IPR011053:IPR001882; KEGG:
FT                   aoe:Clos_0442 biotin/lipoyl attachment domain-containing
FT                   protein; PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; SPTR: O54030 Methylmalonyl-CoA decarboxylase,
FT                   gamma-subunit; PFAM: Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82088"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAT7"
FT                   /protein_id="ADO82088.1"
FT                   /translation="MKTFKVVVNGNEYEVGVQEVKAGTAAPAPRAAAPAPAAPKPAAPK
FT                   PAAPKPVTTAAGAGAGVNTVTAPMPGTIINVGCHAGAKVSKGDILVVLEAMKMENEIMA
FT                   PHDGTVTEVKVQQGASVNAGDILVVLS"
FT   sig_peptide     346373..346483
FT                   /locus_tag="Ilyop_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            346790..347977
FT                   /locus_tag="Ilyop_0300"
FT   CDS_pept        346790..347977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0300"
FT                   /product="glutaconyl-CoA decarboxylase beta subunit"
FT                   /EC_number="4.1.1.70"
FT                   /EC_number="4.1.1.3"
FT                   /note="COGs: COG1883 Na+-transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase beta subunit;
FT                   InterPro IPR005661; KEGG: aoe:Clos_0443 sodium
FT                   ion-translocating decarboxylase, beta subunit; PFAM:
FT                   Na+transporting methylmalonyl-CoA/oxaloacetate
FT                   decarboxylase beta subunit; PRIAM: Oxaloacetate
FT                   decarboxylase; SPTR: O54031 Methylmalonyl-CoA
FT                   decarboxylase, beta-subunit; TIGRFAM: sodium
FT                   ion-translocating decarboxylase, beta subunit; PFAM:
FT                   subunit; TIGRFAM: sodium ion-translocating decarboxylase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82089"
FT                   /db_xref="GOA:E3HAT8"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAT8"
FT                   /protein_id="ADO82089.1"
FT                   /translation="MLQALMDFYTSTGFYGINIGSILMMIVACIFLYLAIVKGFEPLLL
FT                   VPISFGMLLTNLPFAGMMAEPLMEVKEHITASGAVQYVVHTAEPGGLLYYLFQGDHLGI
FT                   FPPLIFMGVGAMTDFGPLIANPKSLLLGAAAQFGIFVTFLGAIGSGLFTAQEAASIGII
FT                   GGADGPTAIFLSSKLAPHLMGPIAVAAYSYMALVPIIQPPIMTALTSEKERKIKMSQLR
FT                   MVTKKEKVIFPIVVTIIVSLIVPPAATLIGMLMLGNLFRECGVVGRLEDTAKNALINII
FT                   TIFLGVTVGATATAEAFLKVETLAILALGVVAFGIGTGSGVLLAKLMNKMSKTPINPLL
FT                   GSAGVSAVPMAARVSQVVGQKADPSNFLLMHAMGPNVAGVIGSAVSAGVLLSLFG"
FT   sig_peptide     346790..346906
FT                   /locus_tag="Ilyop_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(348132..349544)
FT                   /locus_tag="Ilyop_0301"
FT   CDS_pept        complement(348132..349544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0301"
FT                   /product="carbon starvation protein CstA"
FT                   /note="COGs: COG1966 Carbon starvation protein predicted
FT                   membrane protein; InterPro IPR003706; KEGG: cbl:CLK_2726
FT                   carbon starvation protein CstA; PFAM: carbon starvation
FT                   protein CstA; SPTR: B1L1Z0 Carbon starvation protein CstA;
FT                   PFAM: Carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82090"
FT                   /db_xref="GOA:E3HAT9"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAT9"
FT                   /protein_id="ADO82090.1"
FT                   /translation="MITFLLALAALIGGYFIYGKIVENIFGINENRPTPAVSLADGVDF
FT                   CEISWGRAFLIQFLNIAGLGPIFGAVAGALWGPVAFLWIVFGCIFAGSVHDYLAGMLSV
FT                   RHNGSTIAEIVGKYLGNGPKNFMRVFSVVLLVLVGVVFVVGPAGILTNIVPSVGKMTWV
FT                   GIIIIYYIIATILPVDKLISKIYPIFGLSLIIMGLGIGLGLFIKGYQIPELTLQNLNPK
FT                   GTPFYPFLFITIACGAISGFHATQSPLMARCLKNEKEGRRVFFGSMIAEGVIALIWAAA
FT                   AMTFFGSTEGLAQAGAAGVVVNTISNSMLGRVGGALALLGVVACPITSGDTAFRSARLA
FT                   IADATNLKQGPIKNRFLIAIPLFIVGIALCFMDFGIIWRYFAWSNQTLATIVLWAGAVY
FT                   LANNRKNFWIAAIPGTFMTGVVTTYIIIAPEGLRMSTAIGYPFGILAAISALIFFLKKK
FT                   KNQSALDVEEIL"
FT   sig_peptide     complement(349488..349544)
FT                   /locus_tag="Ilyop_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(349627..350421)
FT                   /locus_tag="Ilyop_0302"
FT   CDS_pept        complement(349627..350421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lba:Lebu_2298 hypothetical protein; SPTR:
FT                   C9MZF2 Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82091"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAU0"
FT                   /protein_id="ADO82091.1"
FT                   /translation="MLNRILVVFVEEKDVEYLTKYTKMIKENYPEVDIVGMFIHSVVDK
FT                   DEFKEFMAADDLYRLKIKNIDKEYQRITQAEKERSERIEKTFLSIIKEANFYNMVGDSS
FT                   KILLEELKFFDLAILAKSNELTHEEKVLLNTHHKPVILVPELEDYSLEKVMLADDLEIK
FT                   SNKALFNFMEIFSSVTEFTAITVSEDKTNDEEDLNLYMKKAEKNFKREFSSGEVHKIIL
FT                   EYSKDYDLIIMGDLKHSIMLEKTIREPGVKIIESAKKPIFIA"
FT   gene            complement(350499..351676)
FT                   /locus_tag="Ilyop_0303"
FT   CDS_pept        complement(join(350499..351389,351389..351676))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Ilyop_0303"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: pca:Pcar_1348 transposase
FT                   and inactivated derivatives; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: C4C830 Transposase; PFAM: Integrase
FT                   core domain; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82092"
FT                   /db_xref="GOA:E3H6A0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E3H6A0"
FT                   /protein_id="ADO82092.1"
FT                   /translation="MMEEKRRYARFSEEKQKQIAELSFLKIKTKVELSNEYGITTNTVA
FT                   AWEKKYFGGPKKDMELSAQDKEIIRLKNLLKEKEEDIEILKKATAIFSRKKKITKRELF
FT                   IFVEIHRNVHSISQICRALEVSRSGFNKFQNNKTTERKKKDQGILDSILEVRKNRHKRS
FT                   YGAPRLKVELKDEYGIITSERRINRIMKENDISVNSTKKFKTGNEKSKRENITGNIVKR
FT                   KFKVGRKNEVWVTDITYIWTSEGWLYLSTIMDLFSRRIIAYDIGKRMTSELVIDTLTRS
FT                   FLLEEPEEELIIHSDQGSQYSSREYSNLVKKLGLIQSMSRRGNCYDNAVIESFHASLKK
FT                   EMIYVEGLVTKRYMKAMVFDYIEFYNKERRHSFLGNVSPVEFEKIQKKLVLG"
FT   gene            complement(352189..353013)
FT                   /locus_tag="Ilyop_0304"
FT   CDS_pept        complement(352189..353013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0304"
FT                   /product="Nucleoside-specific channel-forming protein, Tsx"
FT                   /note="COGs: COG3248 Nucleoside-binding outer membrane
FT                   protein; InterPro IPR003055:IPR018013; KEGG: csa:Csal_0110
FT                   nucleoside-specific channel-forming protein, Tsx; PFAM:
FT                   Nucleoside-specific channel-forming protein, Tsx-like;
FT                   SPTR: Q1R1D4 Nucleoside-specific channel-forming protein,
FT                   Tsx; PFAM: Nucleoside-specific channel-forming protein,
FT                   Tsx"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82093"
FT                   /db_xref="GOA:E3HAU2"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAU2"
FT                   /protein_id="ADO82093.1"
FT                   /translation="MKKMFGILFLMVNITSFGSYEPWNYNYTSVSVFQGNNSADGYGES
FT                   IDDRYVEFEGFHRYNLLDMYWFVDFFDAFDSGSSDVHGQDPNLYGEINPRISLDGLLGK
FT                   DLSFGNFKEWFISYQYDFDDSSYGGGLKRHQIGIGNDVYIKGFDYVRMNLLARYHKEAY
FT                   DGSIEDKWDGYLLNAAYGRKLHTFKNGWNIYFSGWVDYVFGANESKDKTDWSGNNIGTD
FT                   HSLQWFNQLKLQMKYIDLSYSYKINDSFTEVKKSSYNSSDSNQHILGVHYVF"
FT   sig_peptide     complement(352960..353013)
FT                   /locus_tag="Ilyop_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            353431..354246
FT                   /locus_tag="Ilyop_0305"
FT   CDS_pept        353431..354246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0305"
FT                   /product="Aldehyde reductase"
FT                   /EC_number="1.1.1.21"
FT                   /note="COGs: COG0656 Aldo/keto reductase related to
FT                   diketogulonate reductase; InterPro
FT                   IPR020471:IPR001395:IPR018170; KEGG: bsu:BSU33400
FT                   glyoxal/methylglyoxal reductase; PFAM: aldo/keto reductase;
FT                   PRIAM: Aldehyde reductase; SPTR: Q2BA91 YvgN; PFAM:
FT                   Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82094"
FT                   /db_xref="GOA:E3HAU3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAU3"
FT                   /protein_id="ADO82094.1"
FT                   /translation="MKKVLLNNGVEVPIIGLGTFRAKGEEVYMAVKTAIDNGYTHIDTA
FT                   MIYGNEKEINRAIKDSGVKRENLFITTKLWNSDQGYESTKKAFQKSLDDLGLDYIDLYL
FT                   IHWNKGVEKAAESWKAMEELYKDGKIKAIGVSNFTMYHIEKLLETALVKPAVNQVECHI
FT                   GLPQYDLQKYCESKGIKLTAYAPMQAGKIFESEELKAIADKHGKSVAHVALKFLVDRGI
FT                   IVIPKSVKTERIINNKDIFDLELDSEDLKVIKSLWNGKRLYTDPDNCYF"
FT   gene            354380..354856
FT                   /locus_tag="Ilyop_0306"
FT   CDS_pept        354380..354856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0306"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="InterPro IPR000595:IPR018490:IPR014710; KEGG:
FT                   app:CAP2UW1_2477 cyclic nucleotide-binding protein; PFAM:
FT                   cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding; SPTR: C6JK86 Putative uncharacterized
FT                   protein; PFAM: Cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82095"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAU4"
FT                   /protein_id="ADO82095.1"
FT                   /translation="MSEKQLEDKIIELLPKTSLFGGVDLKEIHFFVESLVEKRCKAGEI
FT                   ILKEGESPGDSYLLLEGEVKLTVRDRRVDKFGPGTVFGIDSTIGIQKQITTAIAATDII
FT                   LAIIPKMSLYTLSQKNPDLFSKLILNVARDLARALKGMERIIEDYVLLEEKHLL"
FT   gene            354999..355223
FT                   /locus_tag="Ilyop_0307"
FT   CDS_pept        354999..355223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0307"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167; KEGG: cdl:CDR20291_1326 putative
FT                   ferrous iron transport protein; PFAM: FeoA family protein;
FT                   SPTR: C6JNP2 Predicted protein; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82096"
FT                   /db_xref="GOA:E3HAU5"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAU5"
FT                   /protein_id="ADO82096.1"
FT                   /translation="MSHPVTYGQLNKKFVIKGINGNDKTKARLIERGFCIGENLCILKD
FT                   TDENLIIEVNKSRYVVNFGLANKIIVDEA"
FT   gene            355311..355532
FT                   /locus_tag="Ilyop_0308"
FT   CDS_pept        355311..355532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0308"
FT                   /product="FeoA family protein"
FT                   /note="COGs: COG1918 Fe2+ transport system protein A;
FT                   InterPro IPR007167; KEGG: tye:THEYE_A0965 hypothetical
FT                   protein; PFAM: FeoA family protein; SPTR: C6JNP3 Ferrous
FT                   iron transporter B; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82097"
FT                   /db_xref="GOA:E3HAU6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAU6"
FT                   /protein_id="ADO82097.1"
FT                   /translation="MKLTDLKRGEKAKIVKIGKIGDLKKRLVDMGVTSGEIIKLERDAP
FT                   LGDPQQYIIKGTGIAIRKEDAKNIEVER"
FT   gene            355566..357779
FT                   /locus_tag="Ilyop_0309"
FT   CDS_pept        355566..357779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0309"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterProIPR002917:IPR011619:IPR011642:IPR011640:IPR
FT                   005225:IPR003373; KEGG: gsu:GSU3268 ferrous iron transport
FT                   protein B; PFAM: GTP-binding protein HSR1-related; Ferrous
FT                   iron transport protein B domain protein; nucleoside
FT                   recognition domain protein; Ferrous iron transport B domain
FT                   protein; SPTR: C6JNP4 Ferrous iron transporter B; TIGRFAM:
FT                   ferrous iron transport protein B; small GTP-binding
FT                   protein; PFAM: Ferrous iron transport protein B; Ferrous
FT                   iron transport protein B C terminus; Nucleoside
FT                   recognition; TIGRFAM: ferrous iron transporter FeoB; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82098"
FT                   /db_xref="GOA:E3HAU7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAU7"
FT                   /protein_id="ADO82098.1"
FT                   /translation="MIKIAFAGNPNVGKSALINSIAGSKLKVGNWPGVTVEKKEAEFEF
FT                   EGKKIKMIDLPGVYSLSPYTIEEKITRDYILNENPDVVINVVDSTNLERNLYLTMLLKE
FT                   LGKPMIMALNFLDEFENLNYKLDLKKFQTHLEMEAIHTSAVKNKGIKELLEKALLVAEK
FT                   HRKQSHIKYELRFDNTIENEIQNIRCKIKEDEKFVPVLQKYAEDFVCIKLLEQDSYFAE
FT                   ILEREYGIEIDSVTKENVDRVEKKFDEDAETVIAEGRYGALKGILAQTFTTSLKSRLDF
FT                   TDKVDKILLNKYLGLPIFFFIISGIMGVVFNGSGPFIDWVDGFIGGYIGKYVAIAVEGT
FT                   PDWLYSLVTDGIIGGVGGVLVFVPLMLFLYFFLALLEESGYMSRVAFLMDKIMRRLGLN
FT                   GKAFVPMVLGFGCTVPAIYATRTLEDEPSRRLTALMAPFMSCGARLPVYGLFTAAFFGA
FT                   RAGMIVMSLYVMGIVVAVLTGMFFKNNPRFKAEDKALLLELPPYRVPSFKMIWSSTMTR
FT                   TGSYLKKATTVILGILILLWGLIYFPNNGDASNSYMAKFGKVIAPIMKPTGFGNRWEAV
FT                   AAIAPSIAAKEVVVGFMAQVLPQEKEAISVSEGEIQEETTTFAQDTMEQLRGFAVASKE
FT                   SVISMVSFDVASLFTPPSADEVEDEGAGVVGATAKLWEGDPLGPLRAYSFMVFILLVVP
FT                   CVVTLAAIKQEFGQKFMWFTVMVMLIVPYIASTVIFQIGRLFI"
FT   gene            357803..357964
FT                   /locus_tag="Ilyop_0310"
FT   CDS_pept        357803..357964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eel:EUBELI_01465 hypothetical protein; SPTR:
FT                   C6JNP5 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82099"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAU8"
FT                   /protein_id="ADO82099.1"
FT                   /translation="MKTIIVIGVVAVIAFFSLRSVIKMLKGENGCGCSKDNNCAMKDHC
FT                   SSKNKNKK"
FT   sig_peptide     357803..357883
FT                   /locus_tag="Ilyop_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            358093..358380
FT                   /locus_tag="Ilyop_0311"
FT   CDS_pept        358093..358380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eel:EUBELI_00569 hypothetical protein; SPTR:
FT                   C4Z498 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2325)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82100"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAU9"
FT                   /protein_id="ADO82100.1"
FT                   /translation="MIAIIGGIKGIEREYKNLMDEYNLRCRIYNKTCPSFQKKIKNCEA
FT                   CILFTNTVSHKLSLSCTKICKKNNIKLIRVHSSSLNKLKESLCEICKGCS"
FT   gene            358355..358732
FT                   /locus_tag="Ilyop_0312"
FT   CDS_pept        358355..358732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0312"
FT                   /product="Domain of unknown function DUF2023"
FT                   /note="InterPro IPR018594; KEGG: mac:MA2700 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF2023; SPTR:
FT                   C6JQG4 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2023)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82101"
FT                   /db_xref="InterPro:IPR018594"
FT                   /db_xref="InterPro:IPR036780"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAV0"
FT                   /protein_id="ADO82101.1"
FT                   /translation="MKYAKGAANQKEVLKMEVFVHHIYEFEKGLRNLVLHTTEKENLKM
FT                   IMNKLNNRKINYEIYEIEGNRINIFFGAKECVEVIRSIGKQSLREYTFEEDFILGIMLG
FT                   YDRRKQCERYLSFKEKNARTA"
FT   gene            359098..359265
FT                   /locus_tag="Ilyop_0313"
FT   CDS_pept        359098..359265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0313"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR001450:IPR017896:IPR017900; KEGG:
FT                   apr:Apre_1124 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: C6JMD8 Predicted protein; PFAM: 4Fe-4S
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82102"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAV1"
FT                   /protein_id="ADO82102.1"
FT                   /translation="MYVIDKEACIACGACEGTCPVSAISAADGKYEISDACIDCGACAG
FT                   VCPVECITAQ"
FT   gene            359307..359474
FT                   /locus_tag="Ilyop_0314"
FT   CDS_pept        359307..359474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0314"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR001450:IPR017896:IPR017900; KEGG:
FT                   apr:Apre_1124 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: C6JMD8 Predicted protein; PFAM: 4Fe-4S
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82103"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAV2"
FT                   /protein_id="ADO82103.1"
FT                   /translation="MYVIDKEACIACGACEGTCPVSAISAADGKYEISDACVDCGACAG
FT                   ACPVDAIAAG"
FT   gene            359883..360668
FT                   /locus_tag="Ilyop_0315"
FT   CDS_pept        359883..360668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lba:Lebu_2298 hypothetical protein; SPTR:
FT                   C9MZF2 Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82104"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAV3"
FT                   /protein_id="ADO82104.1"
FT                   /translation="MLNRVLIKLDNQEEVKHLAKYANMIKKNYPEAEIVGIFIHPSIGE
FT                   HSFREFRGVGGDYDIGEAKSEHKAKIEKIMEDENKIREEFLSLVENSSFYAKIGDIPEV
FT                   LMDELRLFDLAVISKTDKIGHDLREIFKNHNKPIILVPELENYSLDRILVADDQGLEVN
FT                   KSVFKFMGVFEKTREFKAVTVGVSQEEVKDLNFYLEKIDKKIDYKFEEGAVDKIILNYA
FT                   KDCDMLIMGNLKRSFMVEKLIGTGGIRALEEVKKPIFIG"
FT   gene            361067..362185
FT                   /locus_tag="Ilyop_0316"
FT   CDS_pept        361067..362185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0316"
FT                   /product="protein of unknown function DUF453"
FT                   /note="COGs: COG2828 conserved hypothetical protein;
FT                   InterPro IPR007400; KEGG: bay:RBAM_031870 YraM; PFAM:
FT                   protein of unknown function DUF453; SPTR: A7Z941 YraM;
FT                   PFAM: PrpF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82105"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAV4"
FT                   /protein_id="ADO82105.1"
FT                   /translation="MRKFPCTILRSGTSKGVFFNEKDMPKDKEKWEDFLLDVMGSPDKK
FT                   QIDGLGGANSLTSKVAIIKKSEREGFDVDYTFAQVSLTARKIDMKGNCGNISSGVGPFA
FT                   IDNGLVEAIEPTTKVRIYNTNTGKTIESEVKVSNGMYDPDGDTKIPGVPNTGSVGYLSF
FT                   YAPEGSVTGKLLPTGKAVDTIETSVGTIDISIVDAANPLVFIKAEDVGLKGTELHYEFS
FT                   QEKLDLLEEIRSIAAELCGFAKKEDATKNSPAVPKTTVISAPQDYKDEPGTLYRSDEMD
FT                   LVIRMMSMQKPHQALAITGAVCTSLAAATEGTLVSKIASPDENGKLRLGHPGGVMNAYS
FT                   GKGDNEDVYVKVERTARRIMEGIVYTRGDYEI"
FT   gene            362234..363229
FT                   /locus_tag="Ilyop_0317"
FT   CDS_pept        362234..363229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: ebr:ECB_03721 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: C0D966
FT                   Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82106"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAV5"
FT                   /protein_id="ADO82106.1"
FT                   /translation="MKRIALLVVGIITALAMVGCGGQPGGKDGGDTAAYPKKPIEMIIP
FT                   FGEGGASDTFARKFADIMAKDMPQPIQAINKKGSSGLVGMVYAAQKKNDGYTILEVTPS
FT                   MVIADALEVSESIKFMKDFEPLARIQSDIYVLCLPGDSRFSSFQELVEYGQNNPVTFAG
FT                   VSPGGLDDLTLNALADATGVDIKFIPYKSGSEVKAAVLGGEVDIYLDKIVSAVNYIKDG
FT                   KVKPVVVLNEERIDKIDVFKSVPTTVELGYDVTIGSWRGFVVKNGTPQEIKDYLIDKME
FT                   KAYATQEYQDFAALNLVDIRPGYLDAEGFYKQWESEYEKFDAVAKKVGLK"
FT   sig_peptide     362234..362311
FT                   /locus_tag="Ilyop_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            363295..363774
FT                   /locus_tag="Ilyop_0318"
FT   CDS_pept        363295..363774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0318"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR003016; KEGG: dtu:Dtur_0299 hypothetical
FT                   protein; SPTR: B8DYZ5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82107"
FT                   /db_xref="GOA:E3HAV6"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAV6"
FT                   /protein_id="ADO82107.1"
FT                   /translation="MGEIIFHIFLLVVMGAFYKQSLDINTARMTDPIGPAGFPKTIIYV
FT                   AVILIVISLVSNIKNYKANKPKEKEKIKELDPGFLALLGIIVFFVLAVNYIGFWFGGII
FT                   IISSTMWILNQRKISKLVIITLVGSLVFTFVFGKILSIPLPRGYGIFETISYYIY"
FT   sig_peptide     363295..363339
FT                   /locus_tag="Ilyop_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            363789..365303
FT                   /locus_tag="Ilyop_0319"
FT   CDS_pept        363789..365303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0319"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: jan:Jann_1159 hypothetical
FT                   protein; PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: Q28T86 Putative uncharacterized
FT                   protein; PFAM: Tripartite tricarboxylate transporter TctA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82108"
FT                   /db_xref="GOA:E3HAV7"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAV7"
FT                   /protein_id="ADO82108.1"
FT                   /translation="MDTSLLIEALKTIFMPTNFLLVLAGMTLGVFFGALPGISSSMGIV
FT                   LMIPFTYYMGIIPSIVLLVALYAGSAYGGSITAILFNTPGTAESVATTFDGYPMAQQGK
FT                   AGKALGLAMSGSAIGGIFSVLVMLLLAPLLSKIALKIQSAEYFALTLLGIACISSVGSK
FT                   NLSKALVTGLLGIIIAMVGMDPMTGVSRLTFGQINFLNGIEYIPIMIGSFAMAEVFKQV
FT                   INRKSEEKTMDMGDSVSMESIKLKDLLVYKVTIIKSAIIGTAVGILPGTGGSIASIVSY
FT                   GEAARSRKDKARFGNGAEEGVLAPETANNAAGGGAMIPTLVLGIPGSPTTAIILAALVL
FT                   QGLQPGPQLMTEQPLLLYCIFFSMLIASTVVFLSGRYAVKAFAAVLKLPYGIIAPMIVM
FT                   FSIIGAYARSNDMFQIWVMLTFGVFGYFMKKYQFSAASLILGIVLGNMMEESFRRQLLI
FT                   SNGSYMSFLQRPIAVAIFIAVAFVLFFPIVAGMMEKKKATAAAQNL"
FT   sig_peptide     363789..363911
FT                   /locus_tag="Ilyop_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            365653..368067
FT                   /locus_tag="Ilyop_0320"
FT   CDS_pept        365653..368067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0320"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003661:IPR003594:IPR004358:IPR009082:IPR
FT                   005467:IPR000014; KEGG: amt:Amet_0602 integral membrane
FT                   sensor signal transduction histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SPTR: A6TKW1
FT                   Sensor protein; TIGRFAM: PAS sensor protein; PFAM: Cache
FT                   domain; Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82109"
FT                   /db_xref="GOA:E3HAV8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAV8"
FT                   /protein_id="ADO82109.1"
FT                   /translation="MSFIREIIKYKKSILIFFTGLIFAVSLAFTILKNYKDLRDALVLN
FT                   EQKHLLTIADTTAKSIESYFLEEERSMRILARDTGFLRDFEYLKDKDERYLGESLKIYY
FT                   KIGAPRIKSIQLLDFKGIILDEYPTKSKDNISKDISDLKDVKKIIKNKEQVLSSVYFEN
FT                   RDPFIYILQPIFNRGKFQGIIRCKLSIDNIYKRFIENIRSGSKGYASVKTKDGIFLMHP
FT                   KKSQISGHVMQLRKSKYPNYDWSELEKLFEKQRSGEKGVEIYRSVWVTDDDSKMVKKFN
FT                   GYSQAYIGDTFWIVTVASDYDEVVKIIKKNYYYTVAIATLIVLSISLLAAYIYSIREKK
FT                   AKLEMKSLHLNEVKKLNSELEEDIEKRKLLAKELVKSKNKYEAMFNSINDCVFVADFEN
FT                   NSFEDIVEVNEKVYKRLKYTREELLKMKYSDIDVGLSVNEGKKILEKMLDKRSVMYETE
FT                   IKTKFNKKIPVEVSGRLFKMENKYRAILISRDITLRKIQEETVKRSEARFFNIVNKLAS
FT                   DIEGENSDTTKIKLGKDINNQKILLKLEKINIELEKMFKKEMDENKKKEALMIYQSRYA
FT                   AMGEMVGNIAHQWRQPLSSLSLIISNIEDSFFYGDVDKEDVESLFKKSRMLINKMSETI
FT                   DDFRYFFKPKTNKEEFHVKNVVTSTVELFNERMRYNGIECNVETENDVKIWGYPNQLSQ
FT                   VILNFINNAVDALLENREKERKIDILISEEKNSAIVEVQDNGGGIPEGVMEKIFEPYYS
FT                   TKEKKNGTGIGLYMSQMIVEKNFDGKIYVINKNNGACMKIIIPMGGENENA"
FT   sig_peptide     365653..365742
FT                   /locus_tag="Ilyop_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            368054..368833
FT                   /locus_tag="Ilyop_0321"
FT   CDS_pept        368054..368833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0321"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG4753 Response regulator containing
FT                   CheY-like receiver domain and AraC-type DNA-binding domain;
FT                   InterPro IPR001789:IPR011006; KEGG: amt:Amet_3227 response
FT                   regulator receiver protein; PFAM: response regulator
FT                   receiver; SMART: response regulator receiver; SPTR: A6TT47
FT                   Response regulator receiver protein; PFAM: Response
FT                   regulator receiver domain; Uncharacterized conserved
FT                   protein (DUF2294)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82110"
FT                   /db_xref="GOA:E3HAV9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAV9"
FT                   /protein_id="ADO82110.1"
FT                   /translation="MKMLDKTNLLIKYKVLYVEDDEMQRENLKIFLKRRVGKLYMAENG
FT                   KEGLKVFEEQNPDIIITDLKMPIMDGIEMSKKIREKNKKSGIVITTAFSDVETVLSAMD
FT                   VGIDKYILKPVDTGKLIEAMEEIALRLTGEESGNLVLDDKIISDKKEKLEYESKIQIKI
FT                   AYFIKSNTGKGPKSVKAFIKGSLIEIEANDPLTIYEKKLLEQSKNKSLVNFSREAFYND
FT                   RKNEIEKIIFEILGVKGNLERVTIDFKNNRDILVISV"
FT   gene            369513..370259
FT                   /locus_tag="Ilyop_0322"
FT   CDS_pept        369513..370259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0322"
FT                   /product="protein of unknown function DUF152"
FT                   /note="COGs: COG1496 conserved hypothetical protein;
FT                   InterPro IPR011324:IPR003730; KEGG: lba:Lebu_0469 protein
FT                   of unknown function DUF152; PFAM: protein of unknown
FT                   function DUF152; SPTR: C6JMH3 Putative uncharacterized
FT                   protein; PFAM: Multi-copper polyphenol oxidoreductase
FT                   laccase; TIGRFAM: uncharacterized protein, YfiH family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82111"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAW0"
FT                   /protein_id="ADO82111.1"
FT                   /translation="MYVKHNEYFEIEEFENKGIKAIFTGKKSGDVKENFFLSPEKEKNI
FT                   EEFMKKFSIEGKKLVAAKQTHSKNIADIKDESPLYFDNVDGFITARRDVVLFTVHADCL
FT                   PIYFYDMEKKVIGLCHSGWKGSYLQIGEEVIKKMKASYGSLEKDILVGIGIGAGKCCYQ
FT                   VGDEFYRDFKEKFPLDVIEASFEKKADSWYFDNGEFNFQMFIKRGILEKNIVKSRQCTV
FT                   CNRELFSYRREGKDAGRNGAFIYFKD"
FT   gene            370231..370710
FT                   /locus_tag="Ilyop_0323"
FT   CDS_pept        370231..370710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN1716 hypothetical protein; SPTR: D0BSE9
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82112"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAW1"
FT                   /protein_id="ADO82112.1"
FT                   /translation="MVHLSTLKIKVIIFFMIAVTGCSALPEGRKWEDVSFVMYQTDRLK
FT                   TGDIIVKNKKWDPLSWYGHAAVMIDDMNIGDYPKFGVGYYEIDSYSWLYEERKVMVFRY
FT                   KNFDEKFKDVFLKNLEGLKDKGYWVPLNKKTPRVFTVHSLYGIFTGKRLRILGII"
FT   sig_peptide     370231..370299
FT                   /locus_tag="Ilyop_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            370837..371268
FT                   /locus_tag="Ilyop_0324"
FT   CDS_pept        370837..371268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0324"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A5Z5V6 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82113"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAW2"
FT                   /protein_id="ADO82113.1"
FT                   /translation="MKKIIFIIFFIFSTALFGRNYTELQEWRQKKLPVDIKKGVRVEVY
FT                   DFESRHGVKYEYPAINIRVHNRGSSAVTDLVITIWFWKNEGVYVKELVLIGEEGEYRKK
FT                   LFSGKEKYIPSERRYYNFKDIKFKEIERLEIQITRIKTK"
FT   sig_peptide     370837..370890
FT                   /locus_tag="Ilyop_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            371375..372388
FT                   /locus_tag="Ilyop_0325"
FT   CDS_pept        371375..372388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0325"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR010982:IPR001761; KEGG: cpf:CPF_2817 LacI
FT                   family transcription regulator; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; regulatory protein
FT                   LacI; SMART: regulatory protein LacI; SPTR: Q0TMF9
FT                   Sugar-binding transcriptional regulator, LacI family; PFAM:
FT                   Bacterial regulatory proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82114"
FT                   /db_xref="GOA:E3HAW3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAW3"
FT                   /protein_id="ADO82114.1"
FT                   /translation="MKMSDIAEKAGVSIATVSRVINEDKNVKDSTREKILKIIEEYDYT
FT                   PSAIARNLSRKDNNTIGVVVPDISNPYFSEMVEGISEVIDKENLNILIYNTNDKIEKEQ
FT                   KSLQMLLEQRIKGLVITVTSESYEKGKNYLDKFVKEKIPVVLADRDIKYSSMDCVFIDN
FT                   IGGAYKGVSVLIENDHKDIAIITGPLKSKPGRDRLRGYRNALSENGIEVIDENIYEGDF
FT                   QMESGYKLGKEILNRKKRPTSVFISNNQMTLGFFKAMNEMKLSTPKDIAVLSFDRVEIL
FT                   DIFDIKLTTVSASVRELGVRSAEMLLEKIRNKDKYISQKMILQTNLDIKGSEKKLS"
FT   gene            372423..373340
FT                   /locus_tag="Ilyop_0326"
FT   CDS_pept        372423..373340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0326"
FT                   /product="ribokinase"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002139:IPR011611:IPR002173:IPR011877; KEGG:
FT                   bbe:BBR47_44370 ribokinase; PFAM: PfkB domain protein;
FT                   SPTR: C6JQU1 Ribokinase; TIGRFAM: ribokinase; PFAM: pfkB
FT                   family carbohydrate kinase; TIGRFAM: ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82115"
FT                   /db_xref="GOA:E3HAW4"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAW4"
FT                   /protein_id="ADO82115.1"
FT                   /translation="MGKILVVGSINMDLVTKVSKSPKTGETVLGKDFKQIPGGKGANQA
FT                   VAMARLGSDVAMIGMLGKDSFGDTLLSVIKKDGVDISGIGRCKDISTGIATIVVDDDAN
FT                   NSIIVVPGANFEIEKKDIDANIKLYENSEIVVHQLETPLDIVEYSLKISKKLGKTTILN
FT                   PAPAKSMSDEIIKNVDYLIPNETELELLAGVPVKNKEDILKACRKIMAKGVKKLIVTLG
FT                   SKGAIYVDEKGSKEFGVYKVDAVDTTAAGDSFIGGLTAAISKGEPLEKAMEFAAKVGAI
FT                   TVTREGAQTSLPTLDEVINFEGVV"
FT   gene            373341..373748
FT                   /locus_tag="Ilyop_0327"
FT   CDS_pept        373341..373748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0327"
FT                   /product="ribose transport protein RbsD"
FT                   /note="COGs: COG1869 ABC-type ribose transport system
FT                   auxiliary component; InterPro IPR007721; KEGG: rba:RB3491
FT                   D-ribose pyranase; PFAM: RbsD or FucU transport; SPTR:
FT                   C6JQU0 High affinity ribose transporter rbsD; PFAM: RbsD /
FT                   FucU transport protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82116"
FT                   /db_xref="GOA:E3HAW5"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAW5"
FT                   /protein_id="ADO82116.1"
FT                   /translation="MKKMRLLNSEISYEVAKLGHTDHICIGDAGLPIPAGVKRIDLALE
FT                   RNIPTFMGTLDVILDEMQVEEAIIASEMKELSPKLYTELLDLLNKKCQGIKIEEIPHSQ
FT                   LKKTSRESKAVIRTGECTPYANIILKSGVAF"
FT   gene            373766..375268
FT                   /locus_tag="Ilyop_0328"
FT   CDS_pept        373766..375268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0328"
FT                   /product="ribose ABC transporter ATP-binding protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro IPR003593:IPR003439:IPR017871; KEGG:
FT                   vvu:VV2_0062 D-ribose transporter ATP binding protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   C6JQT9 Ribose ABC transporter; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82117"
FT                   /db_xref="GOA:E3HAW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAW6"
FT                   /protein_id="ADO82117.1"
FT                   /translation="MKKKILELQEMVKIFPGVKALNGANLNLYEGRVMALLGENGAGKS
FT                   TLIKVMTGIYKRDSGKMTLYEEDVEFQGPRESQNAGIAIIHQELNLISNLTIAENIFLG
FT                   REKTSFGKIDWKGMYSDADKLLKKLKVKHSSKELVGNLSVGEQQMVEIAKAMSQNAKII
FT                   VMDEPTDALTDKETESLFSVIRELIGENKSIVYISHRLKEIFEICDDVTIMRDGKFISE
FT                   KEVKDITEDQIIESMVGRKLEDQMPRVEVEPGPVSLEVKNLKGDYVNNVSFTLHEGEIL
FT                   GVAGLMGSGRTELAKTIYGFYKMTSGSILIGGKKVKINSPEEGLKNKIAYVPEDRKKEG
FT                   LILGLSVKENMSISSLEKFESNLKTLNKNDEKDMVDSYISRFNIKTPGMAQIIKNLSGG
FT                   NQQKVAIAKALMTEPKILILDEPTRGVDVGAKKEIYDLINELKKHGMSILMISSEMVEV
FT                   IGLSDRIMVMHENSVTGVFTAEDASQEKIMRCAVGLKEDNDE"
FT   gene            375261..376229
FT                   /locus_tag="Ilyop_0329"
FT   CDS_pept        375261..376229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0329"
FT                   /product="ribose ABC transporter membrane protein"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: vpa:VPA1085 ribose ABC transporter
FT                   permease protein; PFAM: inner-membrane translocator; SPTR:
FT                   C3WFV8 Ribose ABC transporter permease; PFAM:
FT                   Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82118"
FT                   /db_xref="GOA:E3HAW7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAW7"
FT                   /protein_id="ADO82118.1"
FT                   /translation="MNNQTTLEPSQKKSFILLRNKPFIGLLIFAVLVSFMNPRFLSASN
FT                   MLNVLRQTSINAIISAGMTFVILTGGIDLSVGSILAFCGAISASLMASGQNAFLAIAVS
FT                   LVIGGILGMLSGMFISYGKLQAFITTLVTMTLMRGATLVFTDGKPISIGFGDNTSLFGS
FT                   IGAGNILGIPTPIYIMAVVYGVSYYVLNHTKFGRYVYAVGGNEEATKLSGINVDKVKTK
FT                   VYAISGVLSALAGIVVTARLFSAQPTAGSGYELDAIAAVVLGGTSLAGGIGRITGTITG
FT                   ALIIGVLGNALNLLNVSSYYQLMIKALVILAAVLMDRKSKK"
FT   sig_peptide     375261..375389
FT                   /locus_tag="Ilyop_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            376246..377139
FT                   /locus_tag="Ilyop_0330"
FT   CDS_pept        376246..377139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0330"
FT                   /product="ribose-binding protein"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR001761; KEGG:
FT                   vvy:VVA0571 D-ribose transporter subunit RbsB; PFAM:
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   SPTR: C3WFV9 Ribose ABC transporter; PFAM: family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82119"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAW8"
FT                   /protein_id="ADO82119.1"
FT                   /translation="MKKIITLITVLLMVVLTGCGEKKAPEAESTGRVGLVVSTLNNPFF
FT                   VTLKEGAEAKANEMGMEIIILDSQNDPAKELANVEDLVVKGVDVILINPTDSDAVARAV
FT                   MAANNSKIPVITLDRGANGGDVVTHIASDNVAGGKMAGEFIVEKIGKDGKVVELQGIPG
FT                   TTAARDRGKGFNEAAANNITVVAQQAADFDRTKGLDVMENILQAVPEIDAVFAHNDEMA
FT                   LGALKAIEGSGRDILVVGFDATDDAVNAVEAGTLAATVAQQPSMIGAMGVETASKVING
FT                   ETAPEFIPVELKLVTK"
FT   sig_peptide     376246..376326
FT                   /locus_tag="Ilyop_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            377507..378220
FT                   /locus_tag="Ilyop_0331"
FT   CDS_pept        377507..378220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0331"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="COGs: COG0846 NAD-dependent protein deacetylase SIR2
FT                   family; InterPro IPR003000; KEGG: ckr:CKR_3362 hypothetical
FT                   protein; PFAM: Silent information regulator protein Sir2;
FT                   SPTR: B9DXH0 Putative uncharacterized protein; PFAM: Sir2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82120"
FT                   /db_xref="GOA:E3HAW9"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAW9"
FT                   /protein_id="ADO82120.1"
FT                   /translation="MYEELKNIIKKSNNIVFFGGAGVSTESNIPDFRSATGLYAHSPEY
FT                   LLSRTYFDSNTEEFYKFYKENLIFKDAEPNDAHYALAKLEELGKLKAVITQNIDGLHQK
FT                   AGSKKVYELHGSVIRNYCMKCNEYHDLDYIISFKETVPRCRKCGGLVKPDVTLYEEMLD
FT                   MDVFGGAIDCISKADVLIVGGTSLVVYPAASLVEYYKGSKLVLINKGATSYDNKASLVI
FT                   DARIGEVLKEVTREL"
FT   gene            complement(378305..378499)
FT                   /locus_tag="Ilyop_0332"
FT   CDS_pept        complement(378305..378499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0332"
FT                   /product="Protein of unknown function DUF2196"
FT                   /note="COGs: COG4895 conserved hypothetical protein;
FT                   InterPro IPR019240; KEGG: mmq:MmarC5_0903 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2196; SPTR:
FT                   C2WCT9 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized conserved protein (DUF2196); TIGRFAM:
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82121"
FT                   /db_xref="InterPro:IPR019240"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAX2"
FT                   /protein_id="ADO82121.1"
FT                   /translation="MDGKKRANIKPGIKVKIVLKKDQRTGKLTEGIVKDLLTNSSTHPH
FT                   GIKVRLTSGDVGRVQEIID"
FT   gene            complement(378663..379304)
FT                   /locus_tag="Ilyop_0333"
FT   CDS_pept        complement(378663..379304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asa:ASA_2278 hypothetical protein; SPTR:
FT                   O32469 Aeromonas caviae phaC PHA synthase,complete cds"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82122"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAX3"
FT                   /protein_id="ADO82122.1"
FT                   /translation="MKKFITILIGFLLLSFSAFAASAQISVPGKNIPNEENVSGVRLSL
FT                   LHGETAIVKGLDISVLGLSDMDNFTGLELGLFFGANRVKNEFKGLSLGLVNWHEGYDKG
FT                   ANLGFVNYVNDVNGVNFAFANYSTGDSMINLASVNYVEYDSMVNFGFVNITQGTSLVDV
FT                   GVINYAEATSFQFGIVNATKALDGLQIGFVNYAENGVFPVLPIVNFKKSL"
FT   sig_peptide     complement(379236..379304)
FT                   /locus_tag="Ilyop_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(379428..380108)
FT                   /locus_tag="Ilyop_0334"
FT   CDS_pept        complement(379428..380108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vcj:VCD_001704 hypothetical protein; SPTR:
FT                   C0A8K6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82123"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAX4"
FT                   /protein_id="ADO82123.1"
FT                   /translation="MILKKITFFLMFSLVFFNALGEEKPFELSLFSPDIQLNSPYDDIS
FT                   GIRLGGIYSENRNVSGLDVNLVASRTRGDFKGFSVLSFYDKTDGDFTGVRIPWWFFVSY
FT                   NHVGGNFKGVQFGGLNIVERDFLGAQFGLLNINNGNSIGAQAGWVNLDHNFKGVRLGGL
FT                   NMADSFVGGELGIANFNKYTRGVQLGLFNYTENLQGVQVGLLNMAANSELFEILPIVNF
FT                   NLNF"
FT   sig_peptide     complement(380046..380108)
FT                   /locus_tag="Ilyop_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            380711..381421
FT                   /locus_tag="Ilyop_0335"
FT   CDS_pept        380711..381421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0335"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   fnu:FN0802 amino acid ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C3WE58 Amino acid ABC transporter
FT                   permease; TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component; TIGRFAM: amine acid ABC
FT                   transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82124"
FT                   /db_xref="GOA:E3HAX5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAX5"
FT                   /protein_id="ADO82124.1"
FT                   /translation="MAYLSVLKGIFIEGNRYMYIVNGLSFSVGVTLLAALIGLTVGVLL
FT                   AVMRLSHFYPFKNTEKYKKTNPLNLIALWYIDIIRGTPAVVQLMVLANVVFVGNLRNTP
FT                   IFVVAALAFGLNSSAYVAEIIRAGIEGLDKGQTEASRALGMNYFLTMKEIIIPQAIKNI
FT                   LPALVSEFITLLKETSIVGFIGGVDLLRSANIITSQTYRGIEPLLAVGLIYLIMTSIFT
FT                   KFMRKVEKGLKVSD"
FT   gene            381414..382142
FT                   /locus_tag="Ilyop_0336"
FT   CDS_pept        381414..382142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0336"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: bhy:BHWA1_01565 amino
FT                   acid ABC transporter, ATP-binding protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: C6JR11 Amino
FT                   acid transport ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82125"
FT                   /db_xref="GOA:E3HAX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAX6"
FT                   /protein_id="ADO82125.1"
FT                   /translation="MIKVVDLHKHFGDLEVLKGINKEIKKGDVVAVIGPSGSGKSTFLR
FT                   CLNRLEEPTKGHVYIAGEDVMDKKVDLNRLREKVGMVFQHFNLFPHKTVLENLMLAPTK
FT                   VKGMTSEEAKKKAMILLEKVGLKDKAEAYPNQLSGGQKQRIAIARALAMEPHLMLFDEP
FT                   TSALDPEMVKEVLDVMRSLVDEGMTMVIVTHEMGFAKNVASRVFFMDQGTVLEDGEPTQ
FT                   IFNNPKHDRTREFLEKVLNH"
FT   gene            382169..382903
FT                   /locus_tag="Ilyop_0337"
FT   CDS_pept        382169..382903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0337"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR001638; KEGG: fnu:FN0800 amino acid-binding protein;
FT                   PFAM: extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3; SPTR: C6JR12
FT                   Amino acid-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82126"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAX7"
FT                   /protein_id="ADO82126.1"
FT                   /translation="MKKFLNILLILVMLVSLAACGGKKEEEKTVIHIGTNAEFPPFEYL
FT                   EDGKITGFDMDLIKEIAKESQLEIKIEDMSFDGLLPALQSKKVDVVIAGMTANEERKKA
FT                   VNFTSPYYTASQVIVVKEGDSSINSFDDLKGKKVGVMLGFTGDLVVSEIEGVNIERYNA
FT                   AYAGIMSLQSGKVDAVVLDSEPAKNYVEKNEGLAIAKADAAEEEYAIAVRKEDKELLLK
FT                   LENGLKTVKDNGTYEELLKKYF"
FT   sig_peptide     382169..382231
FT                   /locus_tag="Ilyop_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            383086..383841
FT                   /locus_tag="Ilyop_0338"
FT   CDS_pept        383086..383841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0338"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR001320:IPR001638; KEGG: lba:Lebu_0813 extracellular
FT                   solute-binding protein family 3; PFAM: extracellular
FT                   solute-binding protein family 3; SMART: extracellular
FT                   solute-binding protein family 3; ionotropic glutamate
FT                   receptor; SPTR: C4C133 Amino acid ABC transporter
FT                   substrate-binding protein, PAAT family; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82127"
FT                   /db_xref="GOA:E3HAX8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAX8"
FT                   /protein_id="ADO82127.1"
FT                   /translation="MRKMMLIVSLLMLVVLGGCGKKETAQEEKKVLFVGTNAEFKPFEY
FT                   LEDGKIVGFDAELMEKILENLGYEMEWKNMSFDGLIPALQSEKIDLIIAGMTPTEERKK
FT                   AVDFSDSYLTTKQSFVIIEKNNELKTMDDLKNKKLGAQLGTAQETIARGIEGAKITPYT
FT                   SITAAILDLKSEKLDAVVLENLVALPYIKNNEGLKKIDMEELPKADVAIAINKGNEELL
FT                   EKINKELQNLKENGFYDEIFNKYFVDTQN"
FT   sig_peptide     383086..383160
FT                   /locus_tag="Ilyop_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            383850..385238
FT                   /locus_tag="Ilyop_0339"
FT   CDS_pept        383850..385238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0339"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="COGs: COG0165 Argininosuccinate lyase;
FT                   InterProIPR003031:IPR000362:IPR008948:IPR020557:IPR 009049;
FT                   KEGG: lba:Lebu_1184 argininosuccinate lyase; PFAM: fumarate
FT                   lyase; SPTR: C7NA96 Argininosuccinate lyase; TIGRFAM:
FT                   argininosuccinate lyase; PFAM: Lyase; TIGRFAM:
FT                   argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82128"
FT                   /db_xref="GOA:E3HAX9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAX9"
FT                   /protein_id="ADO82128.1"
FT                   /translation="MKLWGGRFKKETSSLLEKFNASINFDKRMYKEDIEGSIAHSKMLA
FT                   KQDIISHEEQKTIEKGLLQVKEEIESGNFVFSIKDEDIHMAIEGRLIALVGEAGKKLHT
FT                   ARSRNDQVLVDTRLYTKRRAEEIGSGLLELMDALIEVSEKNIGVIMPGYTHLQRAQPIL
FT                   FSHHVMAYFQMFKRDLERLESAVERIDVLPLGAGALAGTTYPIDREYVRELLGFAKVSE
FT                   NSLDTVSDRDFIIEMNFVLAMIAMHMSRFSEEIIMWSTKEFSFVQLDDGYSTGSSIMPQ
FT                   KKNPDIPELVRGKCGRVYGNLVSIMTVMKGLPLAYNKDTQEDKEGFFDSVDNMGMSLEI
FT                   FKEMLLTMSVNEENMKKGIYGGFINATDVADYLAKKGIPFREAHHITGSMVAYCEEKNT
FT                   SLEELSLEEFKQFSDAFESDVLTLITVEACIEGRDSYGGTSTNQVKRQISEGKKLLEKY
FT                   KGEL"
FT   gene            385239..386435
FT                   /locus_tag="Ilyop_0340"
FT   CDS_pept        385239..386435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0340"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COGs: COG0137 Argininosuccinate synthase; InterPro
FT                   IPR001518:IPR018223:IPR014729; KEGG: lba:Lebu_0418
FT                   argininosuccinate synthase; PFAM: argininosuccinate
FT                   synthase; PRIAM: Argininosuccinate synthase; SPTR: C9MYX2
FT                   Argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; PFAM: Arginosuccinate synthase; TIGRFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82129"
FT                   /db_xref="GOA:E3HAY0"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAY0"
FT                   /protein_id="ADO82129.1"
FT                   /translation="MEKVVLAYSGGLDTSIIIPWLKENYSLDVIAVCVDVGQDDDMEEV
FT                   KKKAIASGAAKVFVVDAKEEFLTEYAFKALKAGAMYENRYLLGTSFARPLMAKKLVEIA
FT                   HQEGATYICHGCTGKGNDQVRFEVGVAAFDPMMKIIAPWREWDIESREDAIDYAEAKGI
FT                   KLTVTKEKIYSRDQNMWHISHEGGDIETLSNEHKEEMYMMVTPPKLAKDEESFVSVTFE
FT                   KGFPVAVDGDAMGPVELLQKLNKIAGENGIGVIDIVENRLVGMKSRGIYETPGGTLLYK
FT                   ALTDLESVCLDKDSWALKRSLSEKYADLAYNGLWFTSLREAIDSFVDTLHENVTGTIKM
FT                   KLYKGNVKVAGRITENALYDEEISSFGASDLYSHSDAEGFIKIFSLPTKIKKLKEDRK"
FT   gene            386604..386936
FT                   /locus_tag="Ilyop_0341"
FT   CDS_pept        386604..386936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A2FBH3 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82130"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAY1"
FT                   /protein_id="ADO82130.1"
FT                   /translation="MSNYNWVKIGEMMQKLIEDNTIDFNEEATYCIMRRYNPELPFSFD
FT                   RYIKTYKEELGVDFVQRKDVLGKIFLNYDVDTRLKLLNYLLYYFHKSKVNRIKLKELEN
FT                   YLDDNR"
FT   gene            387138..388493
FT                   /locus_tag="Ilyop_0342"
FT   CDS_pept        387138..388493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0342"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528:IPR002345; KEGG: gbm:Gbem_3948 MATE
FT                   efflux family protein; PFAM: multi antimicrobial extrusion
FT                   protein MatE; SPTR: B5EFI5 MATE efflux family protein;
FT                   TIGRFAM: MATE efflux family protein; PFAM: MatE; TIGRFAM:
FT                   putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82131"
FT                   /db_xref="GOA:E3HAY2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAY2"
FT                   /protein_id="ADO82131.1"
FT                   /translation="MDLTKGDIGQAVKKVAIPSSVGFLFNTLFNVVDSMYTGYIGPDAL
FT                   AGLAMSFPVFFILISLGSGIGTGVTAILSNFIGEKSCEKARVTGRDALTLGVIFAFFIT
FT                   FVGIGVDGPLFKYMGGAETSVFYGEKYTTWIFIGSVFFVMNMVFNGILSSQGDTKSYRN
FT                   FLIIGFFVNIVLDPFFIFILKMSTDGVAIATVIVQIMGNFYLYKKVKMSQLFSGHGYKL
FT                   CKPHMENYKNILSQGIPASLNMMTIALGIFVINYFVIKNGGDMAVAAYGISMRIEQMAL
FT                   LPAIGLNIAALSIAGQSYGAGETERVMHVYKKTLKYGIVIMTIAMFIILPLSGYLLRIF
FT                   TRNSEIIRYGMGYFRVEILVFNSYILLNISVSVLQGLKRPKFAIIIGIYRQFLMPILLF
FT                   PVFTNITGDVTGIWWGIFTINWSAALVAVLYVNRVYKKILVLKEKKSRITKM"
FT   gene            388572..389336
FT                   /locus_tag="Ilyop_0343"
FT   CDS_pept        388572..389336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0343"
FT                   /product="hydrolase, TatD family"
FT                   /note="COGs: COG0084 Mg-dependent DNase; InterPro
FT                   IPR001130:IPR018228:IPR012278:IPR015991; KEGG: fnu:FN1343
FT                   seC-independent protein TatD; PFAM: TatD-related
FT                   deoxyribonuclease; SPTR: C6JJF6 SeC-independent protein
FT                   TATD; TIGRFAM: hydrolase, TatD family; PFAM: TatD related
FT                   DNase; TIGRFAM: hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82132"
FT                   /db_xref="GOA:E3HAY3"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAY3"
FT                   /protein_id="ADO82132.1"
FT                   /translation="MKLIDSHCHLDNEKFQGDRDEIIEKIGKELEFAVNIGYDLKSSEE
FT                   SIKLAEKHDFIYAVAGIHPTDISGYNQEMENALEKLARHPKVLAVGEIGLDYHWMTEPK
FT                   EKQQEVFKRLIEVARRVEKPIVVHTRDAMHDTLEILKKYPDVTGILHCYPGSYESALEV
FT                   MDNFYFGVGGVVTFKNAKKLVEAIKKIPLEKLLVETDSPYLTPEPYRGKRNEPSYVEYV
FT                   ARKIAEVKNVDYEEVVRVTNQNTKLAYKMIKG"
FT   gene            389341..390177
FT                   /locus_tag="Ilyop_0344"
FT   CDS_pept        389341..390177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0344"
FT                   /product="rRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="InterPro IPR013216:IPR000408:IPR016718; KEGG:
FT                   cbe:Cbei_3998 rRNA (guanine-N(1)-)-methyltransferase; PFAM:
FT                   Methyltransferase type 11; PRIAM: rRNA
FT                   (guanine-N(1)-)-methyltransferase; SPTR: C3WB39 Ribosomal
FT                   RNA large subunit methyltransferase A; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82133"
FT                   /db_xref="GOA:E3HAY4"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAY4"
FT                   /protein_id="ADO82133.1"
FT                   /translation="MGLLVCPICKEELLKIERSFRCKNNHNYDMAKQGYLNLLLSSKKK
FT                   SKNPGDDREMVESRKRFLEAGFYKKISEKVNIMVAESAAKEKELKILDIGCGEGYYTNR
FT                   LKSFLEEKNKTVEMLGIDISKEAVLAASKSYKEISWFVASGGELPIKDNALDFVLCMFS
FT                   RIVPEEYNRVIKDKGYLVVASTGGKHLLEMKQVLYKDVKTDFYRPEKHLADFFQLEKTV
FT                   NVKYTETIKGNENIKSLFDMTPYKWRSPKEGVDRLYLLDELKVTIDVNLDLFRKKV"
FT   gene            390212..390583
FT                   /locus_tag="Ilyop_0345"
FT   CDS_pept        390212..390583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0345"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="COGs: COG0736 Phosphopantetheinyl transferase
FT                   (holo-ACP synthase); InterPro
FT                   IPR008278:IPR004568:IPR002582; KEGG: lba:Lebu_2207
FT                   holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; SPTR: C4C4B6
FT                   Phosphopantethiene--protein transferase; TIGRFAM:
FT                   holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase superfamily; TIGRFAM:
FT                   phosphopantethiene--protein transferase domain;
FT                   holo-[acyl-carrier-protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82134"
FT                   /db_xref="GOA:E3HAY5"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAY5"
FT                   /protein_id="ADO82134.1"
FT                   /translation="MEITGIGNDIVEIDRIKKAIVKNSRFKDRVYTSNEIDYLEKKSDP
FT                   YPGYAGRFAAKEAVSKAMGTGVRGFNLCDIEVVNNSLGKPEVKFYGALEEKYKDFKVML
FT                   TISHSREYATAMAILFKCF"
FT   gene            391080..391544
FT                   /locus_tag="Ilyop_0346"
FT   CDS_pept        391080..391544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0346"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="COGs: COG1905 NADH:ubiquinone oxidoreductase 24 kD
FT                   subunit; InterPro IPR012336:IPR002023:IPR012335; KEGG:
FT                   cbb:CLD_2791 putative [Fe] hydrogenase, electron-transfer
FT                   subunit; PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; SPTR: C3WB41 NADH dehydrogenase; PFAM:
FT                   Respiratory-chain NADH dehydrogenase 24 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82135"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAY6"
FT                   /protein_id="ADO82135.1"
FT                   /translation="MITKEFYQNLENFIGEMEDKRNEVQVLNFVMKEIGYIPLEVQEFI
FT                   ADKTGLFLVTIQNAIDFFPRYKTSIDNTVEIKVCTGLGCTGKGGLLILEELEKKLGIEA
FT                   GETTKDKKYRLTTQRCFGKCAKGPNLSIGGVLYNNVNIENLEKLIKTNVK"
FT   gene            391618..392739
FT                   /locus_tag="Ilyop_0347"
FT   CDS_pept        391618..392739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q7RHQ1 Putative
FT                   uncharacterized protein PY03933"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82136"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAY7"
FT                   /protein_id="ADO82136.1"
FT                   /translation="MRGLKLFNIIIFLTLSLHVAAVQEKIEILCQGQGRDGFLKLKETA
FT                   PLIYEKLKIRGFTLDKIDVIKYFAEVDSDKDFFAEFYMKPYSLEKLRYIEGYEKDNFSL
FT                   DGKNYSVRYLIDDENTIILFNSEEAFISNNLAKAYEKISEKNYFEKKISHLLGSDSGAY
FT                   FRYIFSEKGTNIYGDYKMKALEYKGNDLIETYFYEKIDGNENMNAIPVKGRLTPIMKYE
FT                   DLASILLEEIPEIKLSSEKIKNILENKLKGAFLLDRNGEKGVVLIMKKNNDRNALLKKI
FT                   YTQDIFEKVGVDLKVDHNGVKYFGFPFFKIKKYIVEFDGGVLLTSDENLIEEKKSDLEK
FT                   ESYYKIDNKRITLKYKGDTNGYFGVKKRAFSAY"
FT   sig_peptide     391618..391680
FT                   /locus_tag="Ilyop_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            392696..393794
FT                   /locus_tag="Ilyop_0348"
FT   CDS_pept        join(392696..392767,392769..393794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Ilyop_0348"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /note="KEGG: Ppig; peptidyl-prolyl isomerase G (cyclophilin
FT                   G); K09566 peptidyl-prolyl isomerase G (cyclophilin G);
FT                   SPTR: P0C348 Peptide chain release factor 2; PFAM: PCRF
FT                   domain; RF-1 domain; TIGRFAM: peptide chain release factor
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82137"
FT                   /db_xref="GOA:E3HAY8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAY8"
FT                   /protein_id="ADO82137.1"
FT                   /translation="MDILELKREHSQHIEKIEEIRGSLDLEGKENKVKELEKETLKDGF
FT                   WNDKRESEKLIKEMNALKEIIGEYRSIEKLSDEVSVLLEFVEMGEDEFLEELETKHRGL
FT                   DKVIGAFDVKLLLDGEFDANNAIVTIHSGAGGTEACDWADMLYRMYSRWCNNRGYKITE
FT                   LDFMPGEMVGIKSITILVEGMRAYGYLKNEKGIHRLVRISPFDANKKRHTSFASVDVMP
FT                   EVDETTDIEINTGDLKIDTYRASGAGGQHVNTTDSAVRITHLPSGVVVTCQRERSQLQN
FT                   RETAMKLLRSKLLELEMKKREEELKKIQGEQSDIGWGSQIRSYVFQPYTLVKDHRTLVE
FT                   SGNIKAVMDGDIDDFINGHLRWLKR"
FT   gene            393861..395372
FT                   /locus_tag="Ilyop_0349"
FT   CDS_pept        393861..395372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0349"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="COGs: COG0008 Glutamyl- and glutaminyl-tRNA
FT                   synthetase;
FT                   InterProIPR020060:IPR008925:IPR020058:IPR001412:IPR
FT                   020061:IPR020751:IPR004527; KEGG: fnu:FN1340 glutamyl-tRNA
FT                   synthetase; PFAM: Glutamyl/glutaminyl-tRNA synthetase,
FT                   class Ic, catalytic domain; SPTR: C6JJG1 Glutamate-tRNA
FT                   ligase; TIGRFAM: glutamyl-tRNA synthetase; PFAM: tRNA
FT                   synthetases class I (E and Q), catalytic domain; TIGRFAM:
FT                   glutamyl-tRNA synthetase, bacterial family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82138"
FT                   /db_xref="GOA:E3HAY9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAY9"
FT                   /protein_id="ADO82138.1"
FT                   /translation="MERRVRTRIAPSPTGDPHVGTAYIGLFNLAFAKKNGGDFILRIED
FT                   TDQGRSTRESEKMIFETLKWLDINYSEGPDEGGEYGPYRQSERFHLYGDYARQLVEKGE
FT                   AYYCFCTRDRLDKLRERQKAMGKAPGYDGHCRSLSEDEIKAKLEAGDEYVIRLKMPYEG
FT                   TTVIKDRLRGDVVFENDKIDDQILLKGDGFPTYHLANVVDDYLMQITHVIRAEEWIAST
FT                   PKHIQLYKAFGWETPEFIHMPLLRNSDRTKISKRKNPVSLNWYKEQGYLKEGLINFLGL
FT                   MGYSFPDNREIFTIDEFMDNFDINHVSLGGPVFDLVKLGWVNNQHMRMKDLDELTELAI
FT                   PFFKDQNYIGENVSEKEYKTVKRIVEILREGTHFLKELAEGAAIYYNDDYELPVVNEDM
FT                   NKKERKSIERMHNAINDETGKASIKNFIGKIENSKEDLTEEEAKALLNETLDEIGEGPG
FT                   KVLMPLRVVITGQARGAELYQVISIIGRDRTLDRIKNMVKKYNLF"
FT   gene            complement(395422..396348)
FT                   /locus_tag="Ilyop_0350"
FT   CDS_pept        complement(395422..396348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0350"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: cbf:CLI_1248 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: C1FKP2 UAA transporter family; PFAM:
FT                   EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82139"
FT                   /db_xref="GOA:E3HAZ0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAZ0"
FT                   /protein_id="ADO82139.1"
FT                   /translation="MKENNNSTCLGSIKSILDKNIMVISSIFFSGAFIAGKFSIMEFPV
FT                   FSLTFFRFLIASVILFLIMHFRGENLKISKSEIPHVIVLSLLGMVGYHLFFFTALKYTS
FT                   SVNTSLIAASNPIMTTVLASIFLKERVSLKAAFGIVISFIGVAVIVTNGSYEVLKNMNF
FT                   NIGDLYMLIAVLSFSCYFILLKNVLSRIPPMKLTAYVFLFCVLILLPAVIIENPASYMG
FT                   SVTIKGWGSLLYMATFASVIAYMLQQVSVKRIGPSKTSLYINLIPLFSMVMAYFILGEK
FT                   ITIQKILAAAMIISGVIITLKSKNISK"
FT   gene            397191..398168
FT                   /pseudo
FT                   /locus_tag="Ilyop_0351"
FT   gene            398165..398836
FT                   /locus_tag="Ilyop_0352"
FT   CDS_pept        398165..398836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0352"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="COGs: COG4565 Response regulator of citrate/malate
FT                   metabolism; InterPro IPR001789:IPR011006; KEGG:
FT                   cpr:CPR_0501 two-component response regulator; PFAM:
FT                   response regulator receiver; SMART: response regulator
FT                   receiver; SPTR: Q0SVM1 Response regulator; PFAM: HTH
FT                   domain; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82140"
FT                   /db_xref="GOA:E3HAZ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAZ1"
FT                   /protein_id="ADO82140.1"
FT                   /translation="MKKVLIVEDDPMVAMINKKYVDSFEGFGVTGCVSKREDFFDILSN
FT                   KDVDLIIMDVYMPGKSGLELLKEMRELGYTTDVVMVTAANSVKEVKKAFAYGVVDYLIK
FT                   PFEFERLKEALEKYEARSVVFSEKENFQQNEIDKLYTSESIEEELPKGIQSKTLNKIII
FT                   LMENEEKEKVWTIKELSEKLMISGVTIKKYLDFLEKNERIRASVFHGQRGRPEYRYRLM
FT                   G"
FT   gene            398906..399898
FT                   /locus_tag="Ilyop_0353"
FT   CDS_pept        398906..399898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0353"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="COGs: COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductase;
FT                   InterProIPR011032:IPR016040:IPR013154:IPR013149:IPR 014188;
FT                   KEGG: bwe:BcerKBAB4_0695 quinone oxidoreductase putative
FT                   YhdH/YhfP; PFAM: Alcohol dehydrogenase GroES domain
FT                   protein; Alcohol dehydrogenase zinc-binding domain protein;
FT                   SPTR: C6JM96 Putative uncharacterized protein; TIGRFAM:
FT                   quinone oxidoreductase, YhdH/YhfP family; PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase; TIGRFAM: putative quinone oxidoreductase,
FT                   YhdH/YhfP family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82141"
FT                   /db_xref="GOA:E3HAZ2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAZ2"
FT                   /protein_id="ADO82141.1"
FT                   /translation="MEKFRAVRIFEEDGKFVKKLVERDIAELPEGEVLIKVKYSSLNYK
FT                   DALSCIGNKGITRKFPHTPGIDAAGIVADSKSEEFKKGDEVLAIGYDLGMNTDGGFGEY
FT                   IRVPADWVVKRPEKLSLKEAMIYGTAGYTAGQSVYELVTSGVKPEDGEVLISGATGGVG
FT                   SHSVRFLSKLGYDVVAVVNGETEENTALAMGAKRVISREEALDNSGKALLSQKWAGAID
FT                   TVGGATLSTMVRSIKFGGAVTTCGNVTGAEMPGITVFPFILRAVKLIGIASAYSSKERR
FT                   RIVWEKLADEWKSDKLQMGIKEVGIDGILQEVDNMLDAKLVGRVILAHE"
FT   gene            complement(400354..401652)
FT                   /locus_tag="Ilyop_0354"
FT   CDS_pept        complement(400354..401652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0354"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro
FT                   IPR000160:IPR001633; KEGG: nis:NIS_1205 hypothetical
FT                   protein; PFAM: EAL domain protein; GGDEF domain containing
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; SPTR: A8MM18 Diguanylate cyclase/phosphodiesterase
FT                   with PAS/PAC sensor(S); TIGRFAM: diguanylate cyclase; PFAM:
FT                   EAL domain; GGDEF domain; TIGRFAM: diguanylate cyclase
FT                   (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82142"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAZ3"
FT                   /protein_id="ADO82142.1"
FT                   /translation="MCIYETKKKNIATKNKIINLNEMDHLTKTFNRNKGLEILENTIKK
FT                   DNLQDSPVSLCLVDIQNLAHINNKLGIAAGDKLIKIVGNILSSNFRKTDAVVRFEGDKF
FT                   IVILKGCKANCRAALIKSLQNRLSLFNTSNKKNYYLKLHMLFCAYKGETAQEFIEKSFH
FT                   QLNLHKKKQSTKDAIIQEEIIDGLNRNEFRTFFQPKVFIREKQIEFEALIRWFHPEKGL
FT                   IPPDKFIPISEKSFVIHNLTKKVLKDAVDFSQKTNTKVSVNISPVVFQNPNFSKEIRKI
FT                   LNTREIAELIVLEITEGIALDNFKVAVNKMKDLNKIGVEFSIDDFGIGYSSLSYLEKLP
FT                   IAELKIDKLFVRNIHTDKINPLIIDFVIKVGKISGFKVIAEGVETKDHIKTLTSLGCHN
FT                   FQGYYFDKPQSADIIYEKYSSYFYHNMIENLKR"
FT   gene            complement(401619..402290)
FT                   /locus_tag="Ilyop_0355"
FT   CDS_pept        complement(401619..402290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAa2294 hypothetical protein; SPTR:
FT                   A4C7K4 Putative orphan protein; putative EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82143"
FT                   /db_xref="GOA:E3HAZ4"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAZ4"
FT                   /protein_id="ADO82143.1"
FT                   /translation="MKKDYISFLKKLRSPILLALLGFVIYISLSITHMERQLLKNIDLQ
FT                   LLTAAQNIKYYVGEDYVTKDINETTYSKEEIINKGALLDSIAKKTEIDYLYMLVKKEND
FT                   IRYALMSDLLDELIENPTPYYWLSLKDAQDDSYLLTSETFGKDEPVFLNSTDKWDSYRS
FT                   VYLPQISSDGTPYIAGADITISHLRKNVISWLVLGAFRSLIFLALSLPLICAFMRLKKK
FT                   I"
FT   sig_peptide     complement(402201..402290)
FT                   /locus_tag="Ilyop_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            402591..403526
FT                   /locus_tag="Ilyop_0356"
FT   CDS_pept        402591..403526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0356"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="COGs: COG0042 tRNA-dihydrouridine synthase; InterPro
FT                   IPR001269:IPR018517:IPR013785:IPR004652; KEGG: fnu:FN0692
FT                   nitrogen regulation protein NifR3; PFAM: dihydrouridine
FT                   synthase DuS; SPTR: C6JNK3 Dihydrouridine-tRNA ligase;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   Dihydrouridine synthase (Dus); TIGRFAM: putative TIM-barrel
FT                   protein, nifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82144"
FT                   /db_xref="GOA:E3HAZ5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAZ5"
FT                   /protein_id="ADO82144.1"
FT                   /translation="MKIYVAPMAGVTDYTYRRIMKEFHPDLMFTEMVSVNAVEMANEKT
FT                   INKMLRLLPDDAVQIFGKDIEIMKNSAKYVENLGVKHIDVNMGCPVPKIVKNGYGSAML
FT                   EDPEHARKMMLELRKSLKPETCLSMKIRIGYKNHKDPLKFAKIAEEAGCEHITIHGRTK
FT                   EQMYSGTADWDVIKDVKSQVNIPVIGNGDIFTPEDAYEKAMYSKVDGVMLARGIYGNPW
FT                   LIKQVREIFQEGTVKTIPTAEDKIDMAIKHVKYAREDHPDRDFYFEIRKHLCWYIKGLK
FT                   NATHGKNLINRSESYEEILEILENLRKANI"
FT   gene            403548..406157
FT                   /locus_tag="Ilyop_0357"
FT   CDS_pept        403548..406157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0357"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="COGs: COG0249 Mismatch repair ATPase (MutS family);
FT                   InterProIPR007696:IPR000432:IPR016151:IPR007860:IPR
FT                   007695:IPR007861:IPR005748; KEGG: fnu:FN0693 DNA mismatch
FT                   repair protein MutS; PFAM: MutS III domain protein; DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS IV domain protein; SMART: DNA mismatch repair
FT                   protein MutS domain protein; MutS III domain protein; SPTR:
FT                   C6JNK4 DNA mismatch repair protein mutS; TIGRFAM: DNA
FT                   mismatch repair protein MutS; PFAM: MutS family domain IV;
FT                   MutS domain II; MutS domain V; MutS domain I; MutS domain
FT                   III; TIGRFAM: DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82145"
FT                   /db_xref="GOA:E3HAZ6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAZ6"
FT                   /protein_id="ADO82145.1"
FT                   /translation="MSNETPLMKQYREIKEENRDSILFFRLGDFYEMFFDDAVIASKEL
FT                   GITLTSRNKEKGQNVPLAGIPYHSSASYMAKLVRKGYKVAVCEQVEDPKTAKGIVKREV
FT                   VKVITPGTVIDTDYLDDKSNNYLLCVYIKGDRAGIAYVDITTGEFKTTELEGDDIISKA
FT                   LNEVHKISPNEIIVEEKSYENYADKFKNYAAISELTMQKVSFVKNSEEILKDYFRVISL
FT                   DSYGLQGKKEAVAAGAMALEYILELQKCNELPINKISYENSEEHMELNLTTQKNLELIH
FT                   NQREKSNLGTLLWVLDSCKTSMGTRMLKSYIKNPLLKVEEIEKRQEDIGYFIDEVLIRE
FT                   EIREILKNIYDIERLIGKVIMGTENGRDLIALKKSIRGALEILKILGNRQLFDSDLEKL
FT                   IEVYNLIEKSINEEPPFSVREGGMIKGGYNSELDDLHDISKSGKNYILDIETREREKTG
FT                   IKNLKVKYNKVFGYFIEVTRANSALVPEEYIRKQTLTNAERYITPELKDYESKVLNAKE
FT                   KIEALEYQIFKDISSEIKEENRVFQELAQNLAYLDVVTSLSDVAIKNNYVKPEVFEGFS
FT                   MEIKGGRHPIVEKLVGPGEFVKNDILLDDDKSIIILTGPNMAGKSTYMKQLALIILMAQ
FT                   IGSYVPAEFAKIGIVDKIFTRVGASDDLVSGQSTFMVEMSEVANIVNNATEKSFVILDE
FT                   VGRGTSTFDGISIASSITEYIHDKIGSKTVFATHYHELTELEGKLEKAENYRIEVKETE
FT                   NDVVFLREIVKGGADKSYGIEVARLAGLPREILNKSKATLKSLEAKRALIEKKMKGEQL
FT                   SLFGGVIEAEEIPLEEEKRVLTLEEEKAIEIICDTDLNSLTPLDALVKLSELKKMLK"
FT   gene            406167..406577
FT                   /locus_tag="Ilyop_0358"
FT   CDS_pept        406167..406577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: C6JNK5 S-layer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82146"
FT                   /db_xref="GOA:E3HAZ7"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAZ7"
FT                   /protein_id="ADO82146.1"
FT                   /translation="MLKKGIYILAGILVIVLGYLNYFKEEKAIEVKTDNKIETSDVNYE
FT                   SEGYRIEAGTQIDDLDTKETSFKLAKAFFEDMSLKGDNVFIDSLKNLVLNGNIEGVSVN
FT                   GWKFNAENAKYNNDLSKIRSDTGVTASNDEKK"
FT   sig_peptide     406167..406250
FT                   /locus_tag="Ilyop_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            406607..408865
FT                   /locus_tag="Ilyop_0359"
FT   CDS_pept        406607..408865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0359"
FT                   /product="OstA family protein"
FT                   /note="InterPro IPR005653; KEGG: fnu:FN0694 S-layer
FT                   protein; PFAM: OstA family protein; SPTR: C6JNK5 S-layer
FT                   protein; PFAM: OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82147"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAZ8"
FT                   /protein_id="ADO82147.1"
FT                   /translation="MKMSYVNLDGDILMESEKIKVSADKIRYSDDTKIADIIGNIKVKG
FT                   ENLSEDTPGSLEGSFKNARYNLESKVLEAWDPFVIDYNGIKLYGDKLIYYEETGNFLVS
FT                   ENVHAEKDGFTLYMDSIEHKSAENTVIFHCEIQGGDDIYSIKGKNGYYDTLKKQVELKG
FT                   DVVVSSKDGKELKADRGIYETETKVLYAYGDTKDVIYKSPDGKVTSKEIVYKSETEELF
FT                   LNKKYTFSNQEYTSKGEKFYYNNLTGAGKAEKGDIKSKEFYGKGNLLEFNTQEKYYEAV
FT                   GDAYFENSDYSVESSKLTYDQNSGQVTVPGKYTARGKNKNEIFKGLEATYNTQSGDFVS
FT                   PGKFSGENSDYNFEGVDLTYNKISGIGKIDRDIIITGKRNGTKITGDRGNFKNGEFADI
FT                   IGNIIVESKDITATGNKATYKQQEDKVYIPGNIKLKGKTSDFNGIMRDGVFDTEKSVYT
FT                   GKAFEGKSDTATASGDFIKYYTEKDSFELTGNVVLKDPETEIRGSQAEYFIDSNEMQAK
FT                   QPFKVFYDNLVINSAKGKFNMDSKSLDGNKVVITSNNDEKLQGDHVFGSFADKKVDFVG
FT                   NVKASMYQTDKKTGKKEPVNFEGNSARVYFIEDNGYKANRSEIKDNGVFRYSGMTLHSD
FT                   YLELDLVRNLALGREGSRLIMENGTEVTSDIVDVNLTTEVANLINNVEITNFSQESGYT
FT                   KATADKGIIRNKEKIAELEGNVKAESATATIEADKGIYDMNTNKFKAIGNVFINYKTN"
FT   gene            408880..409605
FT                   /locus_tag="Ilyop_0360"
FT   CDS_pept        408880..409605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0360"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1137 ABC-type (unclassified) transport
FT                   system ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: fnu:FN0695 ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: C3WCX1 ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82148"
FT                   /db_xref="GOA:E3HAZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAZ9"
FT                   /protein_id="ADO82148.1"
FT                   /translation="MKSIIAQDLCKSYKKRRVVNGVSLEVKKGEIVGLLGPNGAGKTTT
FT                   FYMMTGIVKPESGKVWCNEMDITGLPMYKRANMGMGYLAQEPSVFRNLTVEENIYAILE
FT                   MRNISKPEMKETMEKLLEEFKLSHVSKSLGYSLSGGERRRVEIARTIANNPDFILLDEP
FT                   FAGVDPIAVEDIQQIIRYLKEKGLGILITDHSVRETLSITEKAYIMAQGQVLISGTPKE
FT                   ITENEMARKIYLGEGFKLD"
FT   gene            409829..412435
FT                   /locus_tag="Ilyop_0361"
FT   CDS_pept        409829..412435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0361"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="COGs: COG0013 Alanyl-tRNA synthetase;
FT                   InterProIPR018164:IPR018162:IPR018163:IPR012947:IPR
FT                   003156:IPR018165:IPR002318; KEGG: fnu:FN0697 alanyl-tRNA
FT                   synthetase; PFAM: Alanyl-tRNA synthetase, class IIc-like;
FT                   Threonyl/alanyl tRNA synthetase SAD; phosphoesterase DHHA1;
FT                   PRIAM: Alanine--tRNA ligase; SPTR: C3WCX2 Alanyl-tRNA
FT                   synthetase; TIGRFAM: alanyl-tRNA synthetase; PFAM: DHHA1
FT                   domain; Threonyl and Alanyl tRNA synthetase second
FT                   additional domain; tRNA synthetases class II (A); TIGRFAM:
FT                   alanine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82149"
FT                   /db_xref="GOA:E3HB00"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB00"
FT                   /protein_id="ADO82149.1"
FT                   /translation="MLTGNEIRQRFVEFFKEKEHKHYESASLIPDDPTLLLTVAGMVPF
FT                   KPFFLGQKEAPNSRVVTYQKCIRTNDLENVGKTARHHTFFEMLGNFSFGDYFKEEAIAW
FT                   SWEFITEVLGLEKEKMWISVFTTDDEAEKIWIEKCNIPKERIVRLGEEDNWWSAGPTGS
FT                   CGPCSEIYVDMGIEYGGDENSKPGDPEADDRFLEIWNLVFTEWNKKEDGTLEPLPKKNI
FT                   DTGAGLERIASVVQKKINNYETDLILPIIEEAGRLTSSEYGKTEKTDFSLKVIADHIRG
FT                   ISFLINDGVLPSNEGRGYVLRRVLRRAVRHGRLLGTSENFLYKLVDKVVEIMKGAYPEI
FT                   LENMEHIKKIIKIEEEKFSHTLGQGMQMVNDEIEKAKESGENKLSGEITFKLYDTYGFP
FT                   YELTEEICEEKDVEVYLEEFTAKMEEQKKRARSAREVVMEKGQDSFVEEFYDKYGKTVF
FT                   EGYEKLQNKSIVYHVENIDENKVMLIFNKTPLYAESGGQASDHGTVTADGLKGKIIDVQ
FT                   KQKEIFMHTVVVDEGMDLLKKGLEVTLTVDDERRRDIMRNHTATHLLHKALKDVLGSHV
FT                   QQAGSLVDADRLRFDFTHYEAVTRDQLEEVEKIVNRQIFKNTSLKVQHMTLDEAKESGS
FT                   TALFGDKYGDLVRVVNVPGYSSELCGGIHVDRTGEIGLFNILTETGVAAGTRRIEATTG
FT                   VASYKTVNQMERLILSVSDALKTDPKHLEEKIEKTIEAFRETNKELEALKSKLASYEAN
FT                   SLFDNIEEINNVKVLIKAFEGKEAGSLREIVDKAKDKLGSCIIVLGTDNEKAVFAVGVT
FT                   KDLMSKVKAGDLVKEIAKIAGGNGGGRPDFAQAGGKDGKKVPEALDHARKILTEKL"
FT   gene            412497..412916
FT                   /locus_tag="Ilyop_0362"
FT   CDS_pept        412497..412916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0362"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="COGs: COG0816 endonuclease involved in recombination
FT                   (possible Holliday junction resolvase in Mycoplasmas and B.
FT                   subtilis); InterPro IPR006641:IPR012337:IPR005227; KEGG:
FT                   fnu:FN0698 DNA integration/recombination/invertion protein;
FT                   PFAM: Holliday junction resolvase YqgF; SMART: Resolvase
FT                   RNase H domain protein fold; SPTR: C6JNK8 DNA
FT                   integration/recombination/inversion protein; PFAM:
FT                   Uncharacterised protein family (UPF0081); TIGRFAM: RNAse
FT                   H-fold protein YqgF"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82150"
FT                   /db_xref="GOA:E3HB01"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB01"
FT                   /protein_id="ADO82150.1"
FT                   /translation="MFKKYLALDVGDVRIGVARSDAMGMFAHPLEVIDRTKTKAVKRVQ
FT                   ELCRQENTKSIVVGIPKSLDGQEKRQAEKVREFIEKLNKSIEGLEIIEIDERLSTISAE
FT                   RMLNETTNKDARGKRKVVDKIAAAIILQTYLDMKK"
FT   gene            412939..414159
FT                   /locus_tag="Ilyop_0363"
FT   CDS_pept        412939..414159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0363"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="COGs: COG0342 Preprotein translocase subunit SecD;
FT                   InterPro IPR001036:IPR003335:IPR005791; KEGG: fnu:FN0699
FT                   protein translocase subunit SecD; PFAM: SecD/SecF/SecDF
FT                   export membrane protein; SPTR: C6JNK9 Translocase subunit
FT                   SecD; TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   Protein export membrane protein; SecD/SecF GG Motif;
FT                   TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82151"
FT                   /db_xref="GOA:E3HB02"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB02"
FT                   /protein_id="ADO82151.1"
FT                   /translation="MRKGTIVKLLFILAILIGAGWLSFVKPTRLGLDLKGGVYVVLEAK
FT                   PEKDQVIDDEAMTRLIEVLDRRINGLGVAESVVQRAGEKRVIVELPGITNSEEAVDLIG
FT                   KTALLEFKIVQEDGTLGETLLTGGSLKKAAVSYDKLGRAEIQFEMNQEGAVKFAEITRN
FT                   NIGKKLAVTLDGEVQTAPTINTEIPSGNGVITGSYTVDEAKAMATLLNAGALPVRAEIL
FT                   ETRSVGASLGDESIAKSTMAAKVAVALIGIFMIIFYRLPGLVANLALVVFGIIAFGTLN
FT                   FLDATLTLPGIAGLILSAGMAVDANVIIFERIKEELSFGNTILSAIDAGFKKAFGAIFD
FT                   SNITTLIITMILFTLGTGPVKGFAITLTIGILASMFTAITITKILLKGFVGIFKIKRPE
FT                   LFGVRGN"
FT   sig_peptide     412939..413013
FT                   /locus_tag="Ilyop_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            414162..415052
FT                   /locus_tag="Ilyop_0364"
FT   CDS_pept        414162..415052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0364"
FT                   /product="protein translocase subunit secF"
FT                   /note="COGs: COG0341 Preprotein translocase subunit SecF;
FT                   InterPro IPR003335:IPR005665; KEGG: fnu:FN0700 protein
FT                   translocase subunit SecF; PFAM: SecD/SecF/SecDF export
FT                   membrane protein; SPTR: C6JNL0 Export membrane protein
FT                   SecD; TIGRFAM: protein-export membrane protein SecF;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   Protein export membrane protein; SecD/SecF GG Motif;
FT                   TIGRFAM: protein-export membrane protein, SecD/SecF family;
FT                   protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82152"
FT                   /db_xref="GOA:E3HB03"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB03"
FT                   /protein_id="ADO82152.1"
FT                   /translation="MKIDIINHTTKWLGVSAFVVIFAVVGLLFKGLNFGIDFSGGNLYQ
FT                   FKFEKNVTLGEVNSFFDEVSKDYPQLDGKSRKVQVSGENTVILRTSEMDENQKNDFLNT
FT                   VENFGKYDLQKADKVGATIGEELKSSAFYALILGCILIVLYITIRFEFKFAMAAVIALF
FT                   HDVIISVGGIALLGYEVNTPFIAAVLTILGYSINDTIVVFDRIRETLKRKKSPELGEAI
FT                   NISINQVMTRSINTSLTTFLAVIAILVFGGESLKTFITTLLIGVVAGTYSSIFVASPLV
FT                   YLLEKNKDKEAILEK"
FT   gene            415153..416286
FT                   /locus_tag="Ilyop_0365"
FT   CDS_pept        415153..416286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0365"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COGs: COG0787 Alanine racemase; InterPro
FT                   IPR000821:IPR009006:IPR001608:IPR011079; KEGG: fnu:FN0406
FT                   alanine racemase, biosynthetic; PFAM: alanine racemase
FT                   domain protein; PRIAM: Alanine racemase; SPTR: C6JNL1
FT                   Alanine racemase; TIGRFAM: alanine racemase; PFAM: Alanine
FT                   racemase, C-terminal domain; Alanine racemase, N-terminal
FT                   domain; TIGRFAM: alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82153"
FT                   /db_xref="GOA:E3HB04"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB04"
FT                   /protein_id="ADO82153.1"
FT                   /translation="MRAWADINLDNLIYNLNIIKEFAGSKKIMCVIKADGYGMGAVECA
FT                   RILSENGVENFGVACYEEGYELYKAGIKGEILLLGATPFENIADAVKCGFQITISSFEQ
FT                   IDFLRRNNLHPEVHIKVDTGMGRLGFSHEEALKAIKIIRDENIADIVGVYSHLSVADMP
FT                   EKDQFTLDQIEKFKVFEKMESIKYKHILNSSGLLRFADATESNLVRVGIILHGVVPFES
FT                   ELQKKFKPVFSFKTKIIFLNKITEKTYVSYGNTETAEPGDLIATMAVGYADGFVREFSN
FT                   GGIVEIDGVGCRVIGKICMDMTMIKIPEELKDKVQVGTEVTIIGKDILKKAECIGTIPY
FT                   EIMIGLGRRVARFYIKNGKVLKFKSLQESEAKEFQKG"
FT   gene            416291..417472
FT                   /locus_tag="Ilyop_0366"
FT   CDS_pept        416291..417472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0366"
FT                   /product="SAM-dependent methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG1092 SAM-dependent methyltransferase;
FT                   InterPro IPR002478:IPR016065; KEGG: fnu:FN1033
FT                   methyltransferase; PFAM: Protein of unknown function
FT                   methylase putative; SMART: PUA domain containing protein;
FT                   SPTR: C3WCX7 Methyltransferase; PFAM:
FT                   S-adenosylmethionine-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82154"
FT                   /db_xref="GOA:E3HB05"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB05"
FT                   /protein_id="ADO82154.1"
FT                   /translation="MTRVILKNGKEKKIRNFYPNVFKDEIQSIMGEAKTGDIVDVCKGD
FT                   LTFVGRGYVTEGTSAFVRVLTTKEEPIDKKFILNKIKKAYDKRKHLEEETNCTRIFFSE
FT                   GDGLPGLIIDKFDKYLSIQFRNSGIEKFRQEIINAVKKVVKPKGIYERSDVENRTHEGV
FT                   EQKTGVIFGDIPERTIMKDNGLKYVIDIIDGQKTGFFLDQRDSRKFIRPYLSQNTRFLD
FT                   VFSSSGGFSVAALKEGCKKVVAIDKNAHALKLCHENYELNNFDGNFETVEGDAFMLLKI
FT                   MAERGDKYDVITLDPPSLIKKKIDVRRGRDFFYDLCDQSFKMLENDGILGIITCAYHIS
FT                   LQDLIEVTRMAASNNGKRLQVMGINYQPEDHPWILHVPETLYLKALWVKVLED"
FT   gene            417488..418027
FT                   /locus_tag="Ilyop_0367"
FT   CDS_pept        417488..418027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0367"
FT                   /product="Colicin V production protein"
FT                   /note="InterPro IPR003825; KEGG: fnu:FN1032 hypothetical
FT                   protein; PFAM: Colicin V production protein; SPTR: C6JNL3
FT                   Predicted protein; PFAM: Colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82155"
FT                   /db_xref="GOA:E3HB06"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB06"
FT                   /protein_id="ADO82155.1"
FT                   /translation="MYLDILIAVILIMTVIKGYLNGFFIEVLSFFGMLINLIFTKTLTP
FT                   ILILNFAIKPENPFYSGVYAITFLVVYTLMGMFIMFIKKALKKAFKGKLNTLAGSILGL
FT                   FKGLLISFVIMVFYSLLSMNLDFIQKYGEGSYSQKAFISSLPVLREYFPDEYGERLQNL
FT                   AHKEKVEEYLNNILKE"
FT   sig_peptide     417488..417553
FT                   /locus_tag="Ilyop_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            418031..419104
FT                   /locus_tag="Ilyop_0368"
FT   CDS_pept        418031..419104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0368"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="COGs: COG0795 permease; InterPro IPR005495; KEGG:
FT                   fnu:FN1031 hypothetical protein; PFAM: permease YjgP/YjgQ
FT                   family protein; SPTR: C6JNL4 Putative uncharacterized
FT                   protein; PFAM: Predicted permease YjgP/YjgQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82156"
FT                   /db_xref="GOA:E3HB07"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB07"
FT                   /protein_id="ADO82156.1"
FT                   /translation="MKIIHRYILKEMRMPIIFGISLFTFIFLIDIMVQMMENIIVKGVS
FT                   LLDVVRILSFYLPPILSQTIPMGFFLGVMITYSKLTSTSESTAMNSMGMSLNSIIKPTF
FT                   MLALGITAFVFFLQESIIPNSFVKLQQLTLKIAYEKPAFQLKENMYIDEVDDYSIYIDK
FT                   VGGDGSAENILIFKKEKDNSFPTVLTAKKAMWKDAAMILEDAEFYNLNPDGSEKLRGEF
FT                   SRQKIPINSFFENVKMKVSEIETMSVRQLLKESKDKDDEEKLPYIVEMNKKLAIPLSAI
FT                   MLGILGVLFSVGHHRSGKGVSYGISLGVIFLYIASLNVGVVMANRGKISPFIGIWTPNF
FT                   VLLGLTIYMYLLKKRRG"
FT   gene            419105..420181
FT                   /locus_tag="Ilyop_0369"
FT   CDS_pept        419105..420181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0369"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="COGs: COG0795 permease; InterPro IPR005495; KEGG:
FT                   fnu:FN1030 hypothetical protein; PFAM: permease YjgP/YjgQ
FT                   family protein; SPTR: C6JNL5 Putative uncharacterized
FT                   protein; PFAM: Predicted permease YjgP/YjgQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82157"
FT                   /db_xref="GOA:E3HB08"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB08"
FT                   /protein_id="ADO82157.1"
FT                   /translation="MKKIDRYITMNFIKSIVLSLFGFINIFILSQLFKVIRYVTEGRFG
FT                   GVDAIYYIISLLPDIIIKVMPLAVLLGGLMTINKMASSLEIIALKTSGISFKRIITFPI
FT                   LIAFIISCGVYYMNDKIYPESIKKSREIKRGGYEDMELPESRKKAFLRGKDNYVYYAES
FT                   INRITSTAVNIEILELDSEFEKLTKIITAEKGIYHRENKLWKFENVTVNNLEKKSSYTL
FT                   PVMQDVRYDDEPERFLAPSVNPKLLTIKEMRSTLGAIKQTGGNSREILMELGDRTSFSF
FT                   ASFVVSFLGLSLGSRYVRGASAVSVAMSVGLGYSYYIVQASMEAISMGGVIHPFIGAWI
FT                   PNILFLILGIYAMYKAEY"
FT   gene            420203..421426
FT                   /locus_tag="Ilyop_0370"
FT   CDS_pept        420203..421426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0370"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase;
FT                   InterProIPR011249:IPR011765:IPR007863:IPR001431:IPR 011237;
FT                   KEGG: fnu:FN1029 zinc protease; PFAM: peptidase M16 domain
FT                   protein; SPTR: C6JNL6 Zinc protease; PFAM: Peptidase M16
FT                   inactive domain; Insulinase (Peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82158"
FT                   /db_xref="GOA:E3HB09"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB09"
FT                   /protein_id="ADO82158.1"
FT                   /translation="MKIEILKLKNGIPVLIENIENLNSVALGIFVKTGAKNELPGEEGV
FT                   SHLLEHMMFKGTKNKSSKEISETIDNEGGIINAYTSKEMTVYYVQLLSHKLRVGTDILT
FT                   DIFLNSTFTEESLEREKNVVIEEIKMYEDIPEEKVHDENVRFAVSGSQSNIVLGSMESV
FT                   KNITREKLVSYFEERYVPSKMVISVAGRVDKDEIMNLLNEGIGNLERDEFEREYDGKMS
FT                   INSGENIIKRDTNQMHLCFNTKGVSTTDKIRYSVSIISNILGGNMSSRLFQKIREEKGL
FT                   AYSVYSYNSSFEEGGLFTVYAGTTKENYREVIDMIKDEFEEIKKDGITEEELRKAKNQF
FT                   LSMLTFGLETSKSRMNRMASSYLIYERVRDLDEIIKEIEGISLEDIKNAASKIFDEKYY
FT                   SWTILGDL"
FT   gene            421439..421882
FT                   /locus_tag="Ilyop_0371"
FT   CDS_pept        421439..421882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0371"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="COGs: COG0756 dUTPase; InterPro IPR008180:IPR008181;
FT                   KEGG: fnu:FN1028 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase; PFAM: deoxyUTP pyrophosphatase; SPTR:
FT                   Q7P582 Deoxyuridine 5'-triphosphate nucleotidohydrolase;
FT                   TIGRFAM: deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut; PFAM: dUTPase; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase (dut)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82159"
FT                   /db_xref="GOA:E3HB10"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB10"
FT                   /protein_id="ADO82159.1"
FT                   /translation="MEKIEVKILKENGVTLPKYMTEGASGMDVCAYMDEPVTLKPLERD
FT                   LIPTGIKMEIPYGYEVQVRPRSGLAIKHGITLLNTPGTIDSDYRGEIKVIVVNLSNEEY
FT                   KIEPGERIGQLVLQKVYQMKFNQVDSLGETERSGGGFGHTGKK"
FT   gene            421904..423010
FT                   /locus_tag="Ilyop_0372"
FT   CDS_pept        421904..423010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0372"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="COGs: COG0772 Bacterial cell division membrane
FT                   protein; InterPro IPR001182:IPR018365:IPR011923; KEGG:
FT                   fnu:FN1027 rod shape-determining protein RodA; PFAM: cell
FT                   cycle protein; SPTR: C6JNL8 Rod shape determining protein
FT                   FtsW; TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   Cell cycle protein; TIGRFAM: rod shape-determining protein
FT                   RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82160"
FT                   /db_xref="GOA:E3HB11"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB11"
FT                   /protein_id="ADO82160.1"
FT                   /translation="MKNNRDIRVILKRMKKMNKSLFINTILIVAVSLFSVFSATYQKTY
FT                   GFFYRELVWTGIGLGVYLVFSFFNYRNYAKYSKVIYLFNIVLLVSVFIFGETRLGAQRW
FT                   IPLGPINLQPSEFSKLFIVLTLSELLTNKYKNNFRGMKHIVLSGLHIVPIFLLIAKQPD
FT                   LGTSLVLIFLYCILIFIHGIDWKSIFIIAGAGAAFVPVSYFFLLKDYQKQRILTFLNPE
FT                   ADMLGSGWNVIQSMIAVGSGGMMGKGFFQGTQSKLRFLPESHTDFIGAVFLEETGFMGG
FT                   LLLLALYLALIIQIARIGSTSSDTYGKLVCYGIASIIFFHAVVNIGMIMGVMPVTGLPL
FT                   LLMSYGGSSFLFTFMMLGIVQSVKIYKD"
FT   sig_peptide     421904..422017
FT                   /locus_tag="Ilyop_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            423020..423889
FT                   /locus_tag="Ilyop_0373"
FT   CDS_pept        423020..423889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0373"
FT                   /product="pseudouridine synthase"
FT                   /note="COGs: COG0564 Pseudouridylate synthase 23S
FT                   RNA-specific; InterPro
FT                   IPR002942:IPR020103:IPR006145:IPR006224; KEGG: fnu:FN1026
FT                   tRNA pseudouridine synthase A; PFAM: pseudouridine
FT                   synthase; RNA-binding S4 domain protein; SMART: RNA-binding
FT                   S4 domain protein; SPTR: C6JNL9 Pseudouridine synthase;
FT                   PFAM: RNA pseudouridylate synthase; S4 domain; TIGRFAM:
FT                   pseudouridine synthase, RluA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82161"
FT                   /db_xref="GOA:E3HB12"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB12"
FT                   /protein_id="ADO82161.1"
FT                   /translation="MEHKIDKNFHDTRLDKYIRKKYEGINLTEIFKLIRKGRIKVNGKK
FT                   VKQNYRLQDGDIVKVFYMGGETAVKKFIDLSPKETEYIKKGIVYEDEDVLLFNKSPNMV
FT                   MHKGSGHDYGLSEMLKSYYQREDFTFINRIDKATSGLIIGAKNLPMTRKLSEDMRDGNI
FT                   NKRYYILVEGRVDREEFQIKSYLKKTDTHVVELEKYEKGAKESISYFKVVQRGKNRTIL
FT                   EGTLGTGRTHQLRVHLANLGHPIVGDAKYGENTRGEMCLFSHYTEILSLGIKVDLPLPE
FT                   VFKNKLTK"
FT   gene            424801..425040
FT                   /locus_tag="Ilyop_0374"
FT   CDS_pept        424801..425040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dau:Daud_0504 hypothetical protein; SPTR:
FT                   B4DB61 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82162"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB13"
FT                   /protein_id="ADO82162.1"
FT                   /translation="MKTKNFKSRLIYSIEYIFSEKLLVVELNKGGIYKYFGVPFSEYLK
FT                   LRFSKSPGHYYTNLIKNNGKYRFEKHDIIPLKIR"
FT   gene            complement(425152..425517)
FT                   /locus_tag="Ilyop_0375"
FT   CDS_pept        complement(425152..425517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0375"
FT                   /product="CFEM domain protein"
FT                   /note="KEGG: CFEM domain protein; SPTR: Q4WLB9
FT                   Uncharacterized protein AFUA_6G14090"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82163"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB14"
FT                   /protein_id="ADO82163.1"
FT                   /translation="MQFINKKKIFLIISGIFLMLSTVAIAADNDSSGDSSSGGNSEVSS
FT                   PSTSTGGTSTGSGGGLGASFSSAFGMSSDSSTSTGSGNQSSSGNSSAGALAAGTSIATS
FT                   TASNQVTGPFTPYSYQN"
FT   sig_peptide     complement(425419..425517)
FT                   /locus_tag="Ilyop_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(425539..426384)
FT                   /locus_tag="Ilyop_0376"
FT   CDS_pept        complement(425539..426384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all2869 hypothetical protein; SPTR: C3WFN4
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82164"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB15"
FT                   /protein_id="ADO82164.1"
FT                   /translation="MKLLRNTLVSTLIISSVAMAQGDNFSRSSAALAELKSKAEMTETK
FT                   SESDKLFYLVDDFSQLKTVPGFTFGAPSGLVPGWGVGFAALSGVHKDSDTDGATAFGFG
FT                   FGDPFESLGGAASLSIGSIDPSDGGAFNRGSLNLSVGHTFPEYGVGVAVGMSNFDIWHD
FT                   SSEDELDESFYAAATKLFPNNTAPMILTAGFGNESFVDINTDDDRDSKIDPFISGAVYL
FT                   HPQMSLILDYTTGITTFGTSLVPFPDYPVTLGLALTDLFKEADEDAIGFIGSLAVGFTF
FT                   "
FT   sig_peptide     complement(426286..426384)
FT                   /locus_tag="Ilyop_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(426830..427477)
FT                   /locus_tag="Ilyop_0377"
FT   CDS_pept        complement(426830..427477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q384N7 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82165"
FT                   /db_xref="GOA:E3HB16"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB16"
FT                   /protein_id="ADO82165.1"
FT                   /translation="MYSFFKKSIQVAQESLCDTLWPESFDFFFYIFFAHRVTQSLKHEL
FT                   HRENLFIDIIYKCLLVFLRETLSYPPCPLWPESFDFFFYIFFAHRVTQSLKHELHRDNL
FT                   FIDIIYKCLLVFLRETLSYPPCPLWPESFDFFFYIFFAHRVTQSLKHELHRENLFIDII
FT                   YKCLLVFLRETLSILRALCGQNLLISFFIYFLLTELHRVLNMSCTEKIFLLT"
FT   gene            427659..428402
FT                   /locus_tag="Ilyop_0378"
FT   CDS_pept        427659..428402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0378"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="COGs: COG3944 Capsular polysaccharide biosynthesis
FT                   protein; InterPro IPR003856; KEGG: tte:TTE0733 capsular
FT                   polysaccharide biosynthesis homolog YwqC; PFAM:
FT                   lipopolysaccharide biosynthesis protein; SPTR: C3WFM8
FT                   Predicted protein; PFAM: Chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82166"
FT                   /db_xref="GOA:E3HB17"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB17"
FT                   /protein_id="ADO82166.1"
FT                   /translation="MFKKSRYEEDINTHWMEEDDEIELMDLLFILIRRWKMIIAIAVPV
FT                   IIIGLTYAVLKPAMYKAETTLMVSSGQIYSVEKLDSSEISKNQKLVSSYTEVARSKSIM
FT                   KNVIKRLGLEAEPEEIAKLVKVTPVDETEFIKISYTDINARKATLMVNEVSKEFMLKIR
FT                   DLMNFENLKIVEKAEIPTKPESRKRVLIVAISGVLGIMLGVFGAFLVEFLHSNIRKPED
FT                   LQNIMGCKIIANVPDFEKIEAEVKR"
FT   sig_peptide     427659..427784
FT                   /locus_tag="Ilyop_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            428402..429115
FT                   /locus_tag="Ilyop_0379"
FT   CDS_pept        428402..429115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0379"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR005702; KEGG: cno:NT01CX_1523
FT                   capsular polysaccharide biosynthesis protein Cap1B; PRIAM:
FT                   Non-specific protein-tyrosine kinase; SPTR: C3WFM9
FT                   Tyrosine-protein kinase ywqD; TIGRFAM: capsular
FT                   exopolysaccharide family; PFAM: CobQ/CobB/MinD/ParA
FT                   nucleotide binding domain; TIGRFAM: capsular
FT                   exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82167"
FT                   /db_xref="GOA:E3HB18"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB18"
FT                   /protein_id="ADO82167.1"
FT                   /translation="MTERKLYFKLDGQSPVAESLRVLRTNIHFIDEKEKKTVVVTSAIP
FT                   KEGKSFIAANYAMSEAMVGKKVLLLDCDLRRPRAHSTFGVEGRHGLSEVLMGERNVEEL
FT                   IVKEVEKNLDLLPTKPMEQNVTELLQSKKMESLVEEVQEKYDLVVIDTAPLMVATDAAI
FT                   LSKISDGVIFVNGYDMVSKKELLYAKEILSSAGANIYGMVVNKIDNSGYGYGYKSHGYY
FT                   NNNYRYYQDYIKEDK"
FT   gene            429115..429888
FT                   /locus_tag="Ilyop_0380"
FT   CDS_pept        429115..429888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0380"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="COGs: COG4464 Capsular polysaccharide biosynthesis
FT                   protein; InterPro IPR016195:IPR004013:IPR016667; KEGG:
FT                   cac:CAC3045 PHP family hydrolase; PFAM: PHP domain protein;
FT                   PRIAM: Protein-tyrosine-phosphatase; SPTR: C3WFN0
FT                   Phosphotyrosine protein phosphatase Wzh; PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82168"
FT                   /db_xref="GOA:E3HB19"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB19"
FT                   /protein_id="ADO82168.1"
FT                   /translation="MIDLHCHIIPGIDDGSHNLEESIEMARSAYKLGYKEICCTSHYAN
FT                   GKYENIGYQEKFYELSKALEKEKILIKIHTGNELYLDPEGLKAVAEGKVNPMGNSNYLL
FT                   VEAAVGMTSESLIKAIEKIIQLGYKPVLAHVERYFFLTINDVKKIEKLGVVLQVNLSSF
FT                   SNSLKKRTRALLDKNVIHIVASDSHGSVKRNYENAATGLHELEKIAGKNRTKLLTEINP
FT                   KRILEDCQIEGGGHEKEQDINSSFFSSFFGKFFRR"
FT   gene            429890..431080
FT                   /locus_tag="Ilyop_0381"
FT   CDS_pept        429890..431080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0381"
FT                   /product="outer membrane efflux protein"
FT                   /note="COGs: COG1538 Outer membrane protein; InterPro
FT                   IPR003423; KEGG: fnu:FN1273 outer membrane protein TolC;
FT                   PFAM: outer membrane efflux protein; SPTR: C3WFN1 Predicted
FT                   protein; PFAM: Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82169"
FT                   /db_xref="GOA:E3HB20"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB20"
FT                   /protein_id="ADO82169.1"
FT                   /translation="MDLDAVLQEIDKNNPEMRIQNLETKVTDLEKKKFLKDLLPKVNLS
FT                   IDKDFVEDSEDEKNEWHMEEGLGPQSIGVEIPIYTGGELRAYYNKAKISHEISKKQLNL
FT                   VKYQIEEEAIKKYFQILNLRKQKEIAQMVIDNLNKQGERLEKLFNNGMLVPKSEVLKVK
FT                   SNIISNEVIKMRRAEEQRSAEEELLLLLGKSVESQIELDEYLYDDINIDIYNPEKDSQI
FT                   AIESGSAAIKEELLVDRSKADLKISKSEYLPKIYLDSEYRLKKDDDEYSDYQVSLVADW
FT                   EIFNWGRTGDDVLQKSTVLEQAEILRDRNLEEIKLNIRNKYRDIKTLYAEVDSQKTKLD
FT                   LEKENMRIDNLRYVNGMVSSLDYLDSVNRLKSAEEEYYSLQRELVLAVREYENLLK"
FT   gene            431299..432627
FT                   /locus_tag="Ilyop_0382"
FT   CDS_pept        431299..432627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0382"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="InterPro IPR011053:IPR006143; KEGG: cth:Cthe_1762
FT                   RND family efflux transporter MFP subunit; PFAM: secretion
FT                   protein HlyD family protein; SPTR: C3WFN2 Predicted
FT                   protein; TIGRFAM: RND family efflux transporter, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82170"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB21"
FT                   /protein_id="ADO82170.1"
FT                   /translation="MKKKLIIGGAVFLMVLGVAGFALDGKSDEKKVRLEKIVKGDMEES
FT                   LVFEGIVEPKETMPIYIEASAVVDKILVDEGSEVSAGDSLLEFSAGSKLELERELQMLD
FT                   LDMKSVEMQIEDLNSGSTKLELDNKQLEIKSLEEEIKGMNRNLKVVSFEAQTFRQQADV
FT                   KMDLLKQQGVSSVEANEALSDANRKEMELEDLKTSLDLSRQKYELMVLSYDRLKRELNL
FT                   QENNIKGNLKKFALKRDDLAEKLAKVGEPLKSPIDGIITGIYIEQGTPVRAGSRLMEIS
FT                   KMGENKIKMEIPVYQAKWVIPGQKATITMRESAEDVTYDGKVESVSKTAKVVKTGNYED
FT                   RIIEVEVSLENSQGLKPGYATTVEIAGNSKDQVKLVDSIAVMEENGKNYVYVYEGDTVK
FT                   KTLVEIGAKTLSKYEVLNLAEGTEIVLNSYQVQDGDKVEVLQD"
FT   sig_peptide     431299..431379
FT                   /locus_tag="Ilyop_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            432706..433086
FT                   /locus_tag="Ilyop_0383"
FT   CDS_pept        432706..433086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3619 hypothetical protein; SPTR:
FT                   A3J572 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82171"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB22"
FT                   /protein_id="ADO82171.1"
FT                   /translation="MELNELTQKIIGCAIEVHKTLGPGMLESTYEECLKFELEKKGIKV
FT                   EQQKELPLIYKGLLIENAYKLDLIIEDKIILELKSVEKIKGVHKAQLLTYLKLSNKELG
FT                   LLINFNVDLLKDGITRLKNRGK"
FT   gene            433247..434335
FT                   /locus_tag="Ilyop_0384"
FT   CDS_pept        433247..434335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0384"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG4591 ABC-type transport system involved in
FT                   lipoprotein release permease component; InterPro IPR003838;
FT                   KEGG: dat:HRM2_05830 putative macrolipide-specific ABC-type
FT                   efflux carrier (MacA conjunction protein); PFAM: protein of
FT                   unknown function DUF214; SPTR: C3WFN3 Predicted protein;
FT                   PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82172"
FT                   /db_xref="GOA:E3HB23"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB23"
FT                   /protein_id="ADO82172.1"
FT                   /translation="MSFWMAWKMIWENKKRSLFSLCGVLMGISSIIVIFSLAEGGKDLI
FT                   KSDLSSLAENRVMIGGENLSVRDGNLLEDIPFVKYAFFPDAKRDTGELILTGYSQKSLL
FT                   AMGYPSNLKDREILLEENTSKKLYGDADPSGKEIELGERKEKYIIQGVYREKNPLESVN
FT                   DRETGITSLSNLANMTGLNRFSKVVVSFYEEEDGEKLAPLIIDRLKNVHGGRGDYIIME
FT                   NSGKYKKVEKIKNTLNIFLAAIGLVALIMGGLGISNLMAAMVRERTPHIGILRAMGAGK
FT                   NFIMTTFLIEAACISVTGGIIGIIAGVNGSKVIGKLIEVPPIFMGKHIVMTLVVSGLLG
FT                   VAFGILPAKKAADMDTVEALRV"
FT   sig_peptide     433247..433360
FT                   /locus_tag="Ilyop_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            435278..436564
FT                   /locus_tag="Ilyop_0385"
FT   CDS_pept        435278..436564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0385"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /note="COGs: COG2148 Sugar transferase involved in
FT                   lipopolysaccharide synthesis; InterPro IPR003362:IPR017475;
FT                   KEGG: lba:Lebu_2164 exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase; SPTR: C4C0Y7 Exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; TIGRFAM:
FT                   exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; PFAM: Bacterial sugar
FT                   transferase; TIGRFAM: exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82173"
FT                   /db_xref="GOA:E3HB24"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB24"
FT                   /protein_id="ADO82173.1"
FT                   /translation="MRHLKNAGMRSVYISILFLISLILFDHYGLKRNIVFYGGFLLISI
FT                   FYYLFDLFNFDVQKYRVSSLITSGLINILGIIISYIFTKNLGYIKFFVSFYFIHHIIRY
FT                   ILLLVFTKKIRVAIIGNRDKTGSIIEYLRISDKYKYMGSFNVGTETGEGTTYWDIKNLN
FT                   KIVKEEKINKIIVADTRHDKEISKQLLKIKLNGVKVVDHLTFNQEVKGKIEIEHVDDNW
FT                   LLYDYGFHIFHNNIQKRVKRLFDIIFTIIIFIPAFPIMVMSALIIKYESPGPIFFKQKR
FT                   IGLGNEPFEMLKFRSMKLHDPNEHSKYAGENDDRITKYGKFMRKMRIDELPQLWNVIRG
FT                   DMSFVGPRAEWDELCYAYMEKIPYYNVRHSVQPGLTGWAQVMYPYGAGIEDAKRKFEYD
FT                   LYYIKHQSFITDLLIFFKTIKTVVFGRGR"
FT   gene            436598..437704
FT                   /locus_tag="Ilyop_0386"
FT   CDS_pept        436598..437704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0386"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: abu:Abu_0679 glycosyltransferase; PFAM:
FT                   glycosyl transferase group 1; SPTR: A8ESM0
FT                   Glycosyltransferase; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82174"
FT                   /db_xref="GOA:E3HB25"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB25"
FT                   /protein_id="ADO82174.1"
FT                   /translation="MKKLMFVANTSWYLYNFRHGILERLIKDGYTVQILAPEDKYSKNL
FT                   VEMGCEFYHIDTDGKTKNPLKDLGLLINYYKMLKKLKPDMIFNSTIKPNIYASMAASIL
FT                   KIDVINNVSGLGNIFINNNLTTKLVKILYRIAFRNSKKVFFQNDDDMKLFLDNKLVTED
FT                   FCGRLPGSGVNTEKFKPMEKKPSDKIKFILIARMLWDKGIGEYVETARVLNKKYNNLEF
FT                   QLLGHLNFDNPTAISKEQMDKWVEEGIVSYLGLSDDVREQIKEADCVVLPSKYREGVPK
FT                   TLIEAAAMEKPIITTDNVGCRDIVEDGHNGFLCKPKSVESLVRKIEYFLKLSEENRDVL
FT                   GKNGRIKVEREFDEKIVIEKYFEEINRG"
FT   gene            437706..438590
FT                   /locus_tag="Ilyop_0387"
FT   CDS_pept        437706..438590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bca:BCE_5388 hypothetical protein; SPTR:
FT                   C2QK14 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82175"
FT                   /db_xref="InterPro:IPR029465"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB26"
FT                   /protein_id="ADO82175.1"
FT                   /translation="MRLKRMLKNVIRDSLRMVMPKLWYLKLRFYLTHGYRLNLKKSKTW
FT                   NEKIQYRKLNCDSEFLSNFTDKIVVRDYVKEIIGEEYLIPLLGYYEKITPKDIENLPKS
FT                   FVIKTSNGSGGENIKVIWDKNKEDIIKLCKQFNKYLDMKIGHKIDELYYDVKRPRILVE
FT                   KLMLDENGNIPMDLKFHTFVNGGKPSYIIQVDLSRFEDHSRDWYGENWELLDLKQTYKR
FT                   SNEILSEPKKFNQMKEIAHKLVKNFNYCRVDLYNLDGEIYFGELTFCHGSGWEKIEPRE
FT                   WDYKMGEMWYEDR"
FT   gene            438577..439650
FT                   /locus_tag="Ilyop_0388"
FT   CDS_pept        438577..439650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_5061 hypothetical protein; SPTR:
FT                   A9VRB1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82176"
FT                   /db_xref="GOA:E3HB27"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB27"
FT                   /protein_id="ADO82176.1"
FT                   /translation="MKIDNNFILYLVIFLVFYMFTVFKERYPIKISILKFFNFLILILL
FT                   FGFTHEMGTDNTLYERHYYSANYQDLFNLGRSGLGLKILNLLANSLKIEYELFKAFTTT
FT                   SILILFFKSFNFFFKKQYFYAVFMFLGIGMTQLTQNIIKQGIAASILALSMIYILKKKP
FT                   KKYIGLICLASVFHNTVILFLPFYKILKNPLKLKTKKKLFVFSLVVGLFLGNVFLTKVI
FT                   SYLPESDYYMMYLRQDELLGIKFNILNFIEYYVPFIVVILNRKKFNRLDKFIFEYYFYL
FT                   ILLTNLLLNYKYIFVRITPYFVIPIIWSYIFITFKSIKMKKVCKLIMIMFIFVIYALRT
FT                   INNSALEYSNYILEVLF"
FT   gene            439662..440708
FT                   /locus_tag="Ilyop_0389"
FT   CDS_pept        439662..440708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0389"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: bfs:BF3687
FT                   putative glycosyltransferase protein; PFAM: glycosyl
FT                   transferase family 2; SPTR: Q5L964 Putative
FT                   glycosyltransferase protein; PFAM: Glycosyl transferase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82177"
FT                   /db_xref="GOA:E3HB28"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB28"
FT                   /protein_id="ADO82177.1"
FT                   /translation="MELVSVVMAVFNGEKYLKEALESILRQSYKNFEFVIIDDGSTDDS
FT                   VKIIESYNEKRIILIKNNKNLGLPTSLNKGIEAAKGKYIARMDADDICKKDRLKLQVEF
FT                   LEKNEDIDVLAGGVEIFVGGNKWVKKKLYPPECHKEIEKRLLYENCLTHPTIMMRKSFL
FT                   LKNNLKYNVECKFAQDWALWLEATRYGKFYGLNKVLLEYRIHKKSITSNTNNKYVERIK
FT                   VLSVVLKRELEARGFYFSEEEIEGIKEFGSISALKGKTFKSKTFIENTVKKLHLENDSK
FT                   GYFDKRIFKNITKEKYIKYLSFTGDFKDYKESIFYEGESSFLFYKFFYKAKLKYIIKNK
FT                   IWVRHKSK"
FT   gene            440838..441719
FT                   /locus_tag="Ilyop_0390"
FT   CDS_pept        440838..441719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0390"
FT                   /product="glycosyltransferase"
FT                   /note="KEGG: cpy:Cphy_1205 glycosyltransferase; SPTR:
FT                   C3WFM3 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82178"
FT                   /db_xref="GOA:E3HB29"
FT                   /db_xref="InterPro:IPR029465"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB29"
FT                   /protein_id="ADO82178.1"
FT                   /translation="MLKKKIKLILRKNLSDEIFIKISGLYHLGYLMNLKKPKTFNEKIQ
FT                   YRKLYDKNPLYSLCSDKYRAREYVKEKIGEDYLIPLHLVTKKLTEKQWNNLPNKFVAKA
FT                   NHNSGPVQIVKDKSKTYYENVAKELHRQLNEKFGILTIEYYYEEIKPLIIIEDLLMTKK
FT                   GLVDDYKFHCFNSKGEFKCIFMYDYGKENDMKDYPRQMFDENFNKLPFELSRRDDGKEL
FT                   EKPKNFDKMISLAKKLSKDFDYVRVDFFEVDDNIYFNELTFCHACGFQSFNPREWDYKL
FT                   GSYWDQKINNDN"
FT   gene            441752..442876
FT                   /locus_tag="Ilyop_0391"
FT   CDS_pept        441752..442876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0391"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: pat:Patl_1085 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A9D4J8
FT                   Glycosyltransferase; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82179"
FT                   /db_xref="GOA:E3HB30"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB30"
FT                   /protein_id="ADO82179.1"
FT                   /translation="MRLMLLTIREHPGTQGGIQTFLRTLKKYFNEDAFFVTTVIPKKED
FT                   ILFNIIDLKNISAFQNNKYFHLIGRTFSKISREAFKKDVLNLIYKKQLKSFDGISILAS
FT                   PKDIKIVNKKCKKILVQHTNVSNLIKSKSNFFNSNKLIEKAEKELDVFVALSPKDKELI
FT                   ENTFKLEKGKVVCIRHSCELPLLEEKKEKSKNLIMISRLDNTSKRFDLAMKAMKKLPNY
FT                   NLNIYGDGKDRKILETLRAKLALKNVIFHGKTNKVKEKLDENGIFIMTSDYEGYGITNI
FT                   EAMRRGLPIILRDTYEAASDIVQGNGVLLEKEWNEDKFVKAVYEVYKNYEEYSLKSIEL
FT                   GKRHNPKTIKVHWEKLFEELTNSFRECQGEEGVI"
FT   gene            442880..444007
FT                   /locus_tag="Ilyop_0392"
FT   CDS_pept        442880..444007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0392"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: pat:Patl_1085 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A9D4J8
FT                   Glycosyltransferase; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82180"
FT                   /db_xref="GOA:E3HB31"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB31"
FT                   /protein_id="ADO82180.1"
FT                   /translation="MKILFLMDITHPSVQGGIESFGRFLKSCFPSKLTFVCHDKSHKKN
FT                   ELFRVEDVITVFGFSNIIFIKLRSRLFKYIKLLFKIDLTMKIYRNKISKLDKDICILKT
FT                   PQSLKVLEGGCKKILVQHTQIDEWIKCKGYFNNERNLIDNLEFTVDKVVALSPENKKKI
FT                   QNKLNLSEKKVVCIRHSSELPLLEEEKEKKKNLIMIARVENDSKRFDLAINAMKKLPEY
FT                   TLNIYGDGKDRKVLEALRAGLGLQNVIFHGKTNQVKEKLDESGIFIMTSDFEGYPISSI
FT                   EAMRRGLPIILRDTYEAASDIVQGNGVLLEKEWNEDKFVEAVHGVYKNYEEYSLKSIEL
FT                   GKRHNSEVIKKQWEKLLEKLYKSKKLEEYNVIENN"
FT   gene            444013..444474
FT                   /locus_tag="Ilyop_0393"
FT   CDS_pept        444013..444474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0393"
FT                   /product="Serine acetyltransferase"
FT                   /note="COGs: COG1045 Serine acetyltransferase; InterPro
FT                   IPR011004:IPR001451:IPR018357; KEGG: vcj:VCD_003411 serine
FT                   acetyltransferase; SPTR: B6VZQ5 Putative uncharacterized
FT                   protein; PFAM: Bacterial transferase hexapeptide (three
FT                   repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82181"
FT                   /db_xref="GOA:E3HB32"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB32"
FT                   /protein_id="ADO82181.1"
FT                   /translation="MAFYTKKIKILPGIIKRLIRIIYSCEISGQTKIGKGFILMHKGIG
FT                   VVINKDSKIGDYVTIAQGCTIGGKSGENPPQLLNNVFIGPGAKVLGNVKVGPNSIVGSN
FT                   AVVVKDVPPFTIVGGIPAKKIGEINCENYEQYKDYFSNPNIKEILLNQK"
FT   gene            444578..445582
FT                   /locus_tag="Ilyop_0394"
FT   CDS_pept        444578..445582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0394"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   ccv:CCV52592_1235 sugar transferase; PFAM: glycosyl
FT                   transferase family 2; SPTR: C3WCW1 Sugar transferase; PFAM:
FT                   Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82182"
FT                   /db_xref="GOA:E3HB33"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB33"
FT                   /protein_id="ADO82182.1"
FT                   /translation="MQDIKISVIIPVYNTERYLKKCLDSLIGQSLKEVEIIIINDGSPD
FT                   NSQEIIKEYAQIDDRIVSVEKENGGLSSARNTGIKIAKGEYILHIDSDDWVEGEYLKDL
FT                   YEEAKKNSLDIVITDFYCDYNGKSIIYTDEININEEEVLTGKKYLENYLFKEKGYFAVW
FT                   NKMFKTSLYHENDIFHPEKLTLGEDLATVAQLAFYGKRIGKINKAYVHYMQRDDSITGS
FT                   INLKKANDLYLVYEELNNFYSNKDINVELKLLIAKQLSFLFLTSKYKISEYNKEVLRYL
FT                   NFLKKTKFKFKLNRHSSYLIILQSSNNLLTTKLIQKYDKFYMLLKRLLKNLIT"
FT   gene            445654..447138
FT                   /locus_tag="Ilyop_0395"
FT   CDS_pept        445654..447138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0395"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="InterPro IPR002797; KEGG: sec:SC2092 putative 12
FT                   transmembrane segment protein; PFAM: polysaccharide
FT                   biosynthesis protein; SPTR: C6JQJ2 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82183"
FT                   /db_xref="GOA:E3HB34"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB34"
FT                   /protein_id="ADO82183.1"
FT                   /translation="MKNIYINLFFTLVIGVFQFVINKYFVKYLGMETLGLMRFFNQMVA
FT                   YLNLADLGIASASAYALYGPLAEKDTTQISIVMNTLKSFYKKISLIILILGAASFFLIP
FT                   HLLENSNFGFWTYIYWSIYIINLALNYRFAKYSILFTADQNYSYVRRVQGSCKLLVKVA
FT                   QLLILIYFKSFFWFLFVITLENILSGIFYVRKYKRNYVYIKKVNLIEKQIFKDMKNLFW
FT                   HKIGSVVVFNTDFIVLTKFTSLNTVAVYSTYLIVYTMVVTVTGVISPAISPGIGKYIAE
FT                   STNDKIYIKWEKVYQGYVLVSSVIVSCCYILFQPFIRLWMGDEFLLPGLTLSLILINLF
FT                   IQMTRQPIEIFKNNSGFYDDIYVPILESFINLFLSLILVQKLGLNGVIIGTLISNLIII
FT                   LLLKPILVFKRCFAKGAIEYLKVFIINVLRSVLIFILIVTVDNKLCFAVNFWSDFIFKG
FT                   FYLSVVGLTIALLVFQSSSSFRSIQIQLLRKLNIIK"
FT   sig_peptide     445654..445707
FT                   /locus_tag="Ilyop_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            447378..448481
FT                   /locus_tag="Ilyop_0396"
FT   CDS_pept        447378..448481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0396"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR008089:IPR016040:IPR001509; KEGG:
FT                   fba:FIC_02510 UDP-N-acetylglucosamine 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; SPTR: C4C279
FT                   Nucleoside-diphosphate-sugar epimerase; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82184"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB35"
FT                   /protein_id="ADO82184.1"
FT                   /translation="MKTYLMTGASGFIGSHLVEKLLKEGNRVICVDNFNDYYDLSIKVE
FT                   NTLESTGNVQCTIDNVQLEKVKRLKGLKETVDSENYILEVVDIRDLESLEKIFSENKID
FT                   TVVHLAARAGVRPSIEDPILYQEVNGRGTQNILECCRKYGVKNIVAASSSSVYGNNKVV
FT                   PFKETDVVDYAISPYAATKKSNEVMGHVYHSLYKINMAFLRFFTVYGPRQRPDLAINKF
FT                   TSLILAGEEIPVYGDGSTSRDYTYIADIVDGICRSIDYVENNENVYEIFNIGSNSPVSL
FT                   AEMIKTIEKVVGIKAKINRLPMQPGDVDRTYADVTKLKEMTGYNPSLTFEEGIRKFVDW
FT                   YKKSSLEMIEHREQSKKSIHCSLLIIN"
FT   gene            448501..449667
FT                   /locus_tag="Ilyop_0397"
FT   CDS_pept        448501..449667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0397"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COGs: COG1004 UDP-glucose 6-dehydrogenase;
FT                   InterProIPR016040:IPR008927:IPR014027:IPR001732:IPR
FT                   014026:IPR017476; KEGG: esi:Exig_2624 nucleotide sugar
FT                   dehydrogenase; PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; PRIAM: UDP-glucose
FT                   6-dehydrogenase; SPTR: A8W258 Putative uncharacterized
FT                   protein; TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase family, NAD binding
FT                   domain; UDP-glucose/GDP-mannose dehydrogenase family,
FT                   central domain; UDP-glucose/GDP-mannose dehydrogenase
FT                   family, UDP binding domain; TIGRFAM: nucleotide sugar
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82185"
FT                   /db_xref="GOA:E3HB36"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB36"
FT                   /protein_id="ADO82185.1"
FT                   /translation="MKICVAGTGYVGLSNAVLLAQNNEVVALDVIQEKVDMINNRKSPI
FT                   ADNEIEDFLANKELNLIATTDAYKAYENAEYVIISTPTNYDPDKNYFNTRTVEAVIANV
FT                   LAINPEATMIVKSTVSVGYTEKVREMFDTDNIIFSPEFLREGKALYDNLYPSRIIVGEK
FT                   SERAEKFANLLAEGAIKENIDILFTNSTEAEAVKLFSNTYLALRVAYFNELDTYAEHRG
FT                   LDAKQIIEGVGFDPRIGNHYNNPSFGYGGYCLPKDTKQLRANYDQVPNNIIGAIVDANT
FT                   TRKDHIAEMILKREPKTVGIYRLTMKTDSDNFRDSAVQGIMKRIKAKGVEVVVYEPALK
FT                   EESFFKSRVINDLDEFKTMSDVIVTNRLSDDLVDVEEKIYTRDLYKRD"
FT   sig_peptide     448501..448581
FT                   /locus_tag="Ilyop_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            449742..450104
FT                   /locus_tag="Ilyop_0398"
FT   CDS_pept        449742..450104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR012657; KEGG: cbh:CLC_0794 hypothetical
FT                   protein; SPTR: A7FRZ6 Putative uncharacterized protein;
FT                   PFAM: S23 ribosomal protein; TIGRFAM: conserved
FT                   hypothetical protein TIGR02436"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82186"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB37"
FT                   /protein_id="ADO82186.1"
FT                   /translation="MKRSIAYDKAFKFSTRIVKLYKYLCSEKKEFVLSKQILRSGTSIG
FT                   ANLKEGLYGQSKKDFISKLSISLKEAAETEYWIDLLFETDYIEERMAISLKNDLVEIIK
FT                   ILTSSLKTSKNNLENS"
FT   gene            450672..451103
FT                   /locus_tag="Ilyop_0399"
FT   CDS_pept        450672..451103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0399"
FT                   /product="VanZ family protein"
FT                   /note="InterPro IPR006976; KEGG: cbk:CLL_A3403
FT                   acetobutylicum phosphotransbutyrylase; PFAM: VanZ family
FT                   protein; SPTR: C3RHB2 Putative uncharacterized protein;
FT                   PFAM: VanZ like family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82187"
FT                   /db_xref="GOA:E3HB38"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB38"
FT                   /protein_id="ADO82187.1"
FT                   /translation="MKKYFSVIISVLIMIIIFKFSSEDIGRSLKHSDAVSRIIDYIFDG
FT                   GMLLSVRKLAHFIIYFFLAFFLQFIFPDNSISSKNKKIVLLIVFIYACSDEFHQIFVSG
FT                   RGAHFRDVIIDTSGGMTAIFMTHLWRKTYKKINIRARIS"
FT   sig_peptide     450672..450737
FT                   /locus_tag="Ilyop_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(451246..451893)
FT                   /locus_tag="Ilyop_0400"
FT   CDS_pept        complement(451246..451893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN0407 hypothetical protein; SPTR: C6JNM8
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82188"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB39"
FT                   /protein_id="ADO82188.1"
FT                   /translation="MKKKIFILCLTASMIFAQGCTNLKNMTSTSKSATTQENIASAVDI
FT                   NQEIFASGDARIEESGKGVAKMRAKQDAREKLRKKIYRESETILKAYLLEINFYSRKIS
FT                   DQVLKDLGEYVAEGILFEAEEKTSWSENNKMYMVLSVDKDAVPVKTKETFITHIDSIQA
FT                   KLKQVREKIQSIPVEGETFTETTDSNDIETDIILEENSPILDDSDEFIDVQL"
FT   sig_peptide     complement(451843..451893)
FT                   /locus_tag="Ilyop_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            452548..453402
FT                   /locus_tag="Ilyop_0401"
FT   CDS_pept        452548..453402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0401"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /note="COGs: COG0777 Acetyl-CoA carboxylase beta subunit;
FT                   InterPro IPR000438:IPR000022:IPR011762; KEGG: fnu:FN0408
FT                   acetyl-coenzyme A carboxylase carboxyl transferase subunit
FT                   beta; PFAM: carboxyl transferase; SPTR: C6JNM9
FT                   Acetyl-coenzyme A carboxylase carboxyl transferase subunit
FT                   beta; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit; PFAM: Carboxyl transferase
FT                   domain; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82189"
FT                   /db_xref="GOA:E3HB40"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB40"
FT                   /protein_id="ADO82189.1"
FT                   /translation="MGIFSRSKKKYATISVDRSVKTKPKQEKISGLWVKCPSCNEILYK
FT                   SDIENNLKKCTNCDHYFVMSSKERIDLLIDQGTFVEYDKDMISVDPLGFPGYAERYVQT
FT                   QEKVGMKDGVLSGTGTMNGIAVSIAVMEFNFLGGSMGSVVGEKITRAIERGIDENLPVI
FT                   VVSTSGGARMHEGILSLMQMAKTSAALERLRGKGLPFISIPVNPTTGGVTASFAMLGDV
FT                   NISEPDALIGFAGPRVIEQTIKQKLPEGFQKSEFLLKYGMLDVVAKREELKDTVARILG
FT                   NLL"
FT   gene            453427..454368
FT                   /locus_tag="Ilyop_0402"
FT   CDS_pept        453427..454368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0402"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /note="COGs: COG0825 Acetyl-CoA carboxylase alpha subunit;
FT                   InterPro IPR001095:IPR020582:IPR011763; KEGG: fnu:FN0409
FT                   acetyl-coenzyme A carboxylase carboxyl transferase subunit
FT                   alpha; PFAM: Acetyl-CoA carboxylase, alpha subunit,
FT                   conserved region; SPTR: C3WAE0 Acetyl-coenzyme A
FT                   carboxylase carboxyl transferase subunit alpha; TIGRFAM:
FT                   acetyl-CoA carboxylase, carboxyl transferase, alpha
FT                   subunit; PFAM: Acetyl co-enzyme A carboxylase
FT                   carboxyltransferase alpha subunit; TIGRFAM: acetyl-CoA
FT                   carboxylase, carboxyl transferase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82190"
FT                   /db_xref="GOA:E3HB41"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB41"
FT                   /protein_id="ADO82190.1"
FT                   /translation="MEFEKDILELEKKIVELKEFSEAKNIDLSGEIDKLKNEYNEKMKE
FT                   IYSELGPWDRVQVARHPKRPYTLDYVEHITTDFVELHGDRLYKDDPAVVAGICKIDGKK
FT                   VMIIGHQKGREVEEKIHRNFGMANPEGYRKALRLMKMAERFNMPVITLIDTPGAYPGIE
FT                   AEKHGQGEAIARNLLEMAGLKVPITAIVIGEGGSGGALAFGVADKVYMCENSIYSVISP
FT                   EGCAAILFKDAAKAPEAAESLRVSADSVLELGIIDGIILEPVGGAHRNYNEMTENVKKQ
FT                   ILGAISELEEKSTEELLQDRYDKFRKMGAFSE"
FT   gene            454508..455539
FT                   /locus_tag="Ilyop_0403"
FT   CDS_pept        454508..455539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0403"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018253; KEGG: chy:CHY_0925 putative
FT                   lactaldehyde reductase; PFAM: iron-containing alcohol
FT                   dehydrogenase; SPTR: Q3ADL2 Putative lactaldehyde
FT                   reductase; PFAM: Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82191"
FT                   /db_xref="GOA:E3HAX0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAX0"
FT                   /protein_id="ADO82191.1"
FT                   /translation="MQHRFFIAPMSLMGAGCLKQAGKEIKKLNLKKAIVVTCKSILESE
FT                   IITQLKDMLDDNEIDYVIYDKTKARPDMSDVVTGVDMLKKENCDFIISFGGNSTRNCAK
FT                   GMSLMIRSKDGISKSDESLPLVAINVTSFMTGEVPIFTQKNKNKDEKILIDRSTTPIIT
FT                   VTDSDLLKGISNKIMGAIGIDALRHAVEAYLSDAATPMTDACAFQAIKILFSNLENVID
FT                   KDIIDDDVREQITYGNYMAGISYNNTVLGHIYSMEEKNYHEENIQQEKNSAFISEAQGF
FT                   SSDKIFKKMTEVAFAMGSDIKDINEDTAMGFVMDEIKRLSDKVGIPCGMSKDERVIFGK
FT                   GRL"
FT   gene            complement(455572..456078)
FT                   /locus_tag="Ilyop_0404"
FT   CDS_pept        complement(455572..456078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0404"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.12"
FT                   /note="COGs: COG0229 Conserved domain frequently associated
FT                   with peptide methionine sulfoxide reductase; InterPro
FT                   IPR011057:IPR002579; KEGG: pca:Pcar_2611 peptide methionine
FT                   sulfoxide reductase; PFAM: Methionine sulfoxide reductase
FT                   B; PRIAM: Peptide-methionine (R)-S-oxide reductase; SPTR:
FT                   Q3A1A8 Peptide methionine sulfoxide reductase; TIGRFAM:
FT                   methionine-R-sulfoxide reductase; PFAM: SelR domain;
FT                   TIGRFAM: methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82192"
FT                   /db_xref="GOA:E3HAX1"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:E3HAX1"
FT                   /protein_id="ADO82192.1"
FT                   /translation="MNHLFTLLFLIFSTLAFSMDFSSFEKPTDSELKKTLTDLQYKVTQ
FT                   KKGTERPFDNEYWDNKKEGIYVDLISGEPLFSSKDKYKSGTGWPSFTKPLVDENVVTKK
FT                   DFSLFMIRTEVRSKYGDSHLGHVFKDGPPPTNLRYCLNSASLRFIPKEKMEEEGYGEFL
FT                   KEFEE"
FT   sig_peptide     complement(456007..456078)
FT                   /locus_tag="Ilyop_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(456151..456732)
FT                   /locus_tag="Ilyop_0405"
FT   CDS_pept        complement(456151..456732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q1ZHB2 Signal
FT                   recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82193"
FT                   /db_xref="GOA:E3HB42"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB42"
FT                   /protein_id="ADO82193.1"
FT                   /translation="MKKIALLLTLSVLIIGCSKADPKEDMIAKTETAIVQEDISALEAE
FT                   KIEAARMEAARIEAARIEAAKIEAEKIKAAEMEAARIKAAEMEAEKIKAAEMEAAEMEA
FT                   AAAAKMDDAADEMTKMTAVEPTADSIDEMVDETVDEQIMEDEATSKAVEEVVMEEVPAV
FT                   PAEEKSSKGLLFGFGALVAAVAVYFVSKKK"
FT   sig_peptide     complement(456673..456732)
FT                   /locus_tag="Ilyop_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            456993..457586
FT                   /locus_tag="Ilyop_0406"
FT   CDS_pept        456993..457586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0406"
FT                   /product="recombination protein RecR"
FT                   /note="COGs: COG0353 Recombinational DNA repair protein
FT                   (RecF pathway); InterPro
FT                   IPR006154:IPR000093:IPR015967:IPR006171; KEGG: fnu:FN0412
FT                   recombination protein RecR; PFAM: TOPRIM domain protein;
FT                   Zinc finger C4-type, RecR; SMART: Toprim sub domain
FT                   protein; SPTR: C6JNN3 Recombination protein recR; TIGRFAM:
FT                   recombination protein RecR; PFAM: Toprim domain; RecR
FT                   protein; TIGRFAM: recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82194"
FT                   /db_xref="GOA:E3HB43"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB43"
FT                   /protein_id="ADO82194.1"
FT                   /translation="MATKSLERLIDEFNKLPGIGRKSATRLAFHVLEMDDMEVNIFAEA
FT                   IKNVKSSVKKCVICGNFGEEETCDVCRDEYRTNEIICVVEDTRDIVSFEKAKKYRGRYH
FT                   VLNGKIDPLNGMTPDKLNIKSLVERVAAEDVKEVILAMNPDLEGETTAMYLTNLLKPFG
FT                   IKVTKIASGIPMGGNIEFSDIATISKALEGRREL"
FT   gene            complement(458240..459355)
FT                   /locus_tag="Ilyop_0407"
FT   CDS_pept        complement(458240..459355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0407"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="COGs: COG0686 Alanine dehydrogenase; InterPro
FT                   IPR016040:IPR007886:IPR007698:IPR008141; KEGG:
FT                   spl:Spea_2235 alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein; SPTR: A4BEQ1 Alanine
FT                   dehydrogenase; TIGRFAM: alanine dehydrogenase; PFAM:
FT                   Alanine dehydrogenase/PNT, C-terminal domain; Alanine
FT                   dehydrogenase/PNT, N-terminal domain; TIGRFAM: alanine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82195"
FT                   /db_xref="GOA:E3HB44"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB44"
FT                   /protein_id="ADO82195.1"
FT                   /translation="MKIGVPKEIKNNENRVGLIPASVAQLVADGHQLFVETKAGIGVGI
FT                   SDEDYIKAGAKILDSLEDVFEAADMIIKVKEPQPREIACLKPHHLLYTYLHLAADKPQT
FT                   EGLMASGATCIAYETIVLEDKSIPLLAPMSEVAGRMATQMGAFYLQENQGGKGVLIGGV
FT                   PGTKRAKCVIIGAGVAGQNALQMAVGLGADCTIIDLDIHKLRYLDDIYGNKIKTIYSNS
FT                   HNIEEAVVNADLVIGTVLVPGAKAPKLVTREHIKKMQPGTVLVDVAIDQGGCFETSKAT
FT                   THTEPIFFVDDVLHYCVANMPGAFARTSTYALNNATLKYARALAGMDIHKACKKYPELI
FT                   NGINVIDGKLVYEQVAKDLDLHYTPLEDVCK"
FT   gene            459945..462773
FT                   /locus_tag="Ilyop_0408"
FT   CDS_pept        459945..462773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0408"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="COGs: COG0178 Excinuclease ATPase subunit; InterPro
FT                   IPR003439:IPR017871:IPR004602; KEGG: fnu:FN1103
FT                   excinuclease ABC subunit A; PFAM: ABC transporter related;
FT                   SPTR: C3WBK2 Excinuclease ABC subunit A; TIGRFAM:
FT                   excinuclease ABC, A subunit; PFAM: ABC transporter;
FT                   TIGRFAM: excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82196"
FT                   /db_xref="GOA:E3HB45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB45"
FT                   /protein_id="ADO82196.1"
FT                   /translation="MLDKIIVRGAREHNLKNINVEIPKNKFVVITGVSGSGKSSLAFDT
FT                   IYSEGQRRYVESLSAYARQFIGQMQKPDMDSIEGLSPAISIEQKTTNKNPRSIVGTMTE
FT                   VYDYMRLLFAHVGTAHCPICGEKVEKQSIEEMVDSILLRFEEKTKIILMSPLVKEKKGT
FT                   HKNLFINLQKKGFVRVRVDGEVLHLEDEIELDKNKKHTIEVVVDRVVLKKQDKDFISRF
FT                   TQSVEASTELSGGRVVLSIEGEDYSYSENFVCPNHEEVSIPDINPRLFSFNAPYGACPE
FT                   CNGLGKKLEVDENRLIEDENLSLNNGGIYIPGAASRKGYSWAVFQSMARAFDIDLDKPV
FT                   KELSKRELDIVFYGVVGKSFRVDYKGRDFQYHGMKEYEGAIKNLERRYYETASDSMKDE
FT                   IENKYMIEKICKVCNGKRLKPEVLGVTINEKNIMEICFVSVKEALEFFQNLKLSPKEEM
FT                   IAKEILKEIRERLSFMINVGLDYLSLARETKTLSGGESQRIRLATQIGSGLTGVLYVLD
FT                   EPSIGLHQRDNNKLLATLNRLKDLGNTLIVVEHDEDTMFQADYIFDLGPGAGRFGGEIV
FT                   AKGTPKQIMRSKKSLTGKYLNKNIKIETPEKRRKWKKSIKLQGASGNNLKNVDVEIPLG
FT                   VMTLVTGVSGSGKSTLINQTLFPLLFNMLNKGKLYPLENKGIKGVEKLDKVIDIDQSPI
FT                   GRTPRSNPATYTKIFDDIRNLFAETKESKIRGYKKGRFSFNVRGGRCEACQGAGIIKIE
FT                   MNFLPDVYVECEVCKGKRYNRETLEVTYKGKNISDVLGMSVGEAYEFFEKIPSLERKLR
FT                   VLMEVGLDYIKLGQPATTLSGGEAQRIKLATELSKVARGHTVYILDEPTTGLHFEDIRK
FT                   LLEVLNRLVDKGNTVIVIEHNLDVIKTADHIIDIGPEGGDEGGKIIAVGTPEQLIEVEK
FT                   SYTGHYLKKVME"
FT   gene            462830..464962
FT                   /locus_tag="Ilyop_0409"
FT   CDS_pept        462830..464962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0409"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG0531 Amino acid transporter; InterPro
FT                   IPR004841; KEGG: ter:Tery_1903 amino acid
FT                   permease-associated region; PFAM: amino acid
FT                   permease-associated region; SPTR: Q114B6 Amino acid
FT                   permease-associated region; PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82197"
FT                   /db_xref="GOA:E3HB46"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR018491"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB46"
FT                   /protein_id="ADO82197.1"
FT                   /translation="MEKRFGAFSGVFLPTFLTIIGVIFYLRFGWIVGNAGIMGTISIVV
FT                   LAHVITIATALSISSITTNMDVKGGGAYYLISRSLGLEIGGSIGIPLYLSQVISVALYI
FT                   LGFVESVKMIYPAINDKIVALAVTVVIGIISAVGADLAVKTQYVVFSVIILSLGTIAIS
FT                   GNYDMVPLSFGSFSSSGNYWKAFAVFFPAVTGILAGVSMSGDLKNPRKDIPKGTLAAIG
FT                   VTFVIYLIQIFWLGMNISEEDLLNNKLIIISKTRFPILIIGGIWAATLSSALGSMVAAP
FT                   RTMMALSKDSVFPKIFGKGSGKSNEPRIASLVSFVIAIIFIIKVNLDFVAPVITMFFLN
FT                   TYGAINTVAALETLVGNPSYRPTFKTPWVVSLIGALGSYRVMFLINSNATIICLAFTLC
FT                   IYLYLSKKNISRTWGDLRDGVLVSIIRICLLKLRFNQKKEKNWKPDVLVFSGEPESRSD
FT                   LVYLAQQFSKGRGIITLVHYIFGRIEDKKEEVKEAKKGLEKYIRENSLNAFSEVVVGSD
FT                   MTATMEKTVQTNGIGLLKPNTVLMGIPKSLERVPPLIRFIRKITYFDKNLILLVENDEN
FT                   SFGNKKTIDIWWRGLENNGNLMLNLAHLMSLNDDWKKCRIRLLSIVRTPNESDERERIL
FT                   KKMLDYLRIDAEVKVVSKEKEKSISEMIYENSFETDLVFMGLAVPDEHREEEYYERLMN
FT                   MTKGLKTVLLVKGRLV"
FT   sig_peptide     462830..462994
FT                   /locus_tag="Ilyop_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            465305..466117
FT                   /locus_tag="Ilyop_0410"
FT   CDS_pept        465305..466117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0410"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="COGs: COG0796 Glutamate racemase; InterPro
FT                   IPR001920:IPR015942:IPR018187:IPR004391; KEGG:
FT                   lba:Lebu_1881 glutamate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; PRIAM: Glutamate racemase; SPTR: C4BZQ7 Glutamate
FT                   racemase; TIGRFAM: glutamate racemase; PFAM:
FT                   Asp/Glu/Hydantoin racemase; TIGRFAM: glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82198"
FT                   /db_xref="GOA:E3HB47"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB47"
FT                   /protein_id="ADO82198.1"
FT                   /translation="MDNRGIGVFDSGFGGLTVVKEIKKVLPGEKIYYFGDTARLPYGSK
FT                   SKENIIHYSLEIAEFLKTKDIKALVVACNTASAFALDELKKHCSFPVIGVIEAGSRRAL
FT                   GITKNGKVGIIGTKGTVSSGVYDRSLSKGRKGIEVYSKPCPLFVPLVEEGMVQDEVTEI
FT                   MIDRYLREFKNKVDSLIMGCTHYPLLEDEIKRYFEKYELEVVNPAVETALELEKLLAEK
FT                   AILSKKSNGEIEFYVSDSPNHFKELGEMFLGEKIDRVEKINIEDYWRG"
FT   gene            466119..466718
FT                   /locus_tag="Ilyop_0411"
FT   CDS_pept        466119..466718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0411"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /note="COGs: COG0632 Holliday junction resolvasome
FT                   DNA-binding subunit;
FT                   InterProIPR003583:IPR016027:IPR010994:IPR013849:IPR
FT                   011114:IPR012340:IPR000085; KEGG: fnu:FN1104 Holliday
FT                   junction DNA helicase RuvA; PFAM: DNA recombination protein
FT                   RuvA domain I; RuvA domain protein; SPTR: C6JI67 Holliday
FT                   junction DNA helicase ruvA; TIGRFAM: Holliday junction DNA
FT                   helicase RuvA; PFAM: RuvA, C-terminal domain; RuvA N
FT                   terminal domain; TIGRFAM: Holliday junction DNA helicase,
FT                   RuvA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82199"
FT                   /db_xref="GOA:E3HB48"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB48"
FT                   /protein_id="ADO82199.1"
FT                   /translation="MFEYLKGELTLKKLEYAVVDINGIGYKVNISLKTYEKLVLGEKTK
FT                   LYIYNYIREDMFKLIGFAEEKERNLFEILINVNGIGVSLALAILSTFDVEDMRDIVSRE
FT                   DVKLLTKVPKLGIKKAQKLIVDVKDKLKGLQLEEGASGSTASKGIQIEEELYMALESLG
FT                   YSKKDIEKLVTREEIMAYEGIEAAIKDVLKKIQSKL"
FT   gene            467075..468439
FT                   /locus_tag="Ilyop_0412"
FT   CDS_pept        467075..468439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0412"
FT                   /product="mannose-1-phosphate guanylyltransferase (GDP);
FT                   mannose-6-phosphate isomerase, type 2"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="2.7.7.13"
FT                   /EC_number="5.3.1.8"
FT                   /note="COGs: COG0836 Mannose-1-phosphate
FT                   guanylyltransferase;
FT                   InterProIPR011051:IPR005835:IPR001538:IPR014710:IPR 006375;
FT                   KEGG: mvu:Metvu_0406 mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; PFAM:
FT                   mannose-6-phosphate isomerase type II; Nucleotidyl
FT                   transferase; PRIAM: Mannose-1-phosphate
FT                   guanylyltransferase; SPTR: C9RFB4 Mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: Nucleotidyl transferase;
FT                   Mannose-6-phosphate isomerase; TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82200"
FT                   /db_xref="GOA:E3HB49"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB49"
FT                   /protein_id="ADO82200.1"
FT                   /translation="MKVIILAGGCGTRLWPLSRDHYPKQFIKIKTEEPSLFQETFERSL
FT                   LISEVDDIYVVTNEKYKFLVMGAIEELGYDYNESNIFVEPEAKNTLPAIYAGVHGASKD
FT                   IDSTFVVFPSDHRILKSDEFTDIIKASENLAENHIITFGIKPDGPNTGYGYISPAEKRL
FT                   NGYIVEKFHEKPDCETALSYIEKGYFWNSGIFMFNSEFFTNEVKSHAKNIYEAFDTSTD
FT                   IKEAFSKIHTKVSMDYGIMEKSSRIAVVPVDIGWNDLGSFDAFYDVYKRDDNDNIVEPE
FT                   NIVIDSKNNYIYSETGKLVASIGVEDLIIVDNRDALLVCKKEQSQKVKQVVETLNFRND
FT                   LRSQYHVKEYRPWGHSKVLEEEKNSFKINRIVVGVGKELSYQVHYHRSEHWVVVKGMAK
FT                   VILENKEKLVSAGESIFIKPGEKHKLENPGKVPLEIIEVQMGEYLENDDIIRFED"
FT   gene            469105..470412
FT                   /locus_tag="Ilyop_0413"
FT   CDS_pept        469105..470412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0413"
FT                   /product="PhoH family protein"
FT                   /note="COGs: COG1875 ATPase related to phosphate
FT                   starvation-inducible protein PhoH; InterPro
FT                   IPR006596:IPR003714; KEGG: gsu:GSU1866 PhoH family protein;
FT                   PFAM: PhoH family protein; SMART: Nucleotide binding
FT                   protein PINc; SPTR: C6JKR5 PhoH family protein; PFAM:
FT                   PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82201"
FT                   /db_xref="GOA:E3HB50"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB50"
FT                   /protein_id="ADO82201.1"
FT                   /translation="MRKIYVLDTNVLIHDPKAIFNFVDNEVIVPISVIEEIDKLKRDPT
FT                   TGAQARITSRVIDKIREKGSLSKGVELENDIFFKVEIGYGTIKLPEFMHKELVDNKILA
FT                   VTLGIKEENPDKKVVIVTKDINMRIKGDSLGLEVEDYETDKVNYSELYEGSYEVDVSDE
FT                   TFKTFEKTGRVKIEDVASKENEPNCFFKMKNSGKVISGRYSKTKKRIERMAFADVSAWG
FT                   VRARNDEQEYAMDLLMDDNIRVITLVGRAGTGKTLLAVATGLEQVVERKKYKKLFIARP
FT                   IIPMGKDIGYLPGSEKEKLKPWMQPIYDNIDFLSENKEDKAGEKVVMGLESLGLLKIEA
FT                   LTYIRGRSIPAGFIIIDEAQNLTPLEIKTIVTRAGEDTKIVFTGDPDQIDSPYLDANTN
FT                   GLTYLAEKFRMVDISGHITLKKGERSKLAELAAKLL"
FT   gene            470717..471859
FT                   /locus_tag="Ilyop_0414"
FT   CDS_pept        470717..471859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0414"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="COGs: COG0683 ABC-type branched-chain amino acid
FT                   transport systems periplasmic component; InterPro
FT                   IPR000709:IPR001828; KEGG: ckr:CKR_2433 hypothetical
FT                   protein; PFAM: Extracellular ligand-binding receptor; SPTR:
FT                   B9E4Q9 Putative uncharacterized protein; PFAM: Receptor
FT                   family ligand binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82202"
FT                   /db_xref="GOA:E3HB51"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB51"
FT                   /protein_id="ADO82202.1"
FT                   /translation="MKKIVKILGVLGMIMALAACGGKKEEEASVIKIGSILPLTGDIAT
FT                   FGESSKNGLLILQDEVNEAGGINGKKIEFLFEDDENKPASSASVAQKLINNDKVVAIIG
FT                   SIASKCSIAVGPIATQSKIPMITPTSTNPKVTTQGGEYVFRACFIDPFQGKILAKFSAE
FT                   DLKAKKAAVLYDVANDYSKGLAEFFQKGFEEAGGEVVSVETYNTGDSDFNAQLTKINAL
FT                   KPEVLLLPDYYNTVGLIAKQARSTGIDAIFLGGDGWDSPDLFTVGGDAVDGGYFTNHYS
FT                   PEDTSPEVVAFKEAYEARFESVPSAFSALSYDAGKILVAAIEKAGSTDGEKIKEALKAT
FT                   DITAVSGKVKYDADRNPIKGAVILKTEAGKQKFFKKINID"
FT   sig_peptide     470717..470800
FT                   /locus_tag="Ilyop_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            472122..472997
FT                   /locus_tag="Ilyop_0415"
FT   CDS_pept        472122..472997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0415"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="COGs: COG0559 Branched-chain amino acid ABC-type
FT                   transport system permease components; InterPro IPR001851;
FT                   KEGG: ckr:CKR_2437 hypothetical protein; PFAM:
FT                   inner-membrane translocator; SPTR: B9E4R3 Putative
FT                   uncharacterized protein; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82203"
FT                   /db_xref="GOA:E3HB52"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB52"
FT                   /protein_id="ADO82203.1"
FT                   /translation="MEIIQQLLNGLALGSVYALIAIGYTMVYGIIKLINFAHGDIYMAG
FT                   AYFGYVAVARLNLGFIPALILAMTLSALLGIIIEKVAYKRLRNSPRITLLITAIGMSLL
FT                   LENGFRLIFGPNPKPFPELLKTKIFHLGSLRINNIQLIIFAVSIVLVIILEYIVFKTKT
FT                   GKAMRASSYDIEAAKLMGINVDKIISLTFAIGSALAGAGGILVGIAYPRIEPYMGIMPG
FT                   LKAFVAAVLGGIGVLPGAMLGGLVMGVAETFTKAFISTKLSDAIIFSILIVVLIVKPDG
FT                   LLGKQIKEKV"
FT   gene            473005..473997
FT                   /locus_tag="Ilyop_0416"
FT   CDS_pept        473005..473997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0416"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="COGs: COG4177 ABC-type branched-chain amino acid
FT                   transport system permease component; InterPro IPR001851;
FT                   KEGG: ckr:CKR_2436 hypothetical protein; PFAM:
FT                   inner-membrane translocator; SPTR: B9E4R2 Putative
FT                   uncharacterized protein; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82204"
FT                   /db_xref="GOA:E3HB53"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB53"
FT                   /protein_id="ADO82204.1"
FT                   /translation="MKKLKNLKLILGIVVMVIYSIFFLLIQTGALNPYYGQILIVLGIN
FT                   IILAVSLNLVIGFTGQLALGHAGFMSIGGYTAAIMSLNYNLPFFISLVIGGLVSAVIGF
FT                   LIGMPILRLKGDYLAITTLGFGEIIRVAVVNMDFLGGPRGLAGIPKKTNFTWVYFITLF
FT                   TVIIIYNIIRSPYGRAMLSIREDEIASESMGINTTKFKMMAFVIASFFAGIAGGLYAHQ
FT                   FMFLDPKSFDFLKSFEILTFVVFGGMGSLSGSLMATTVLTYLPEVLRTFAEYRMIIYAA
FT                   SLVMLMLFRPQGIMGNKEINLAHIKEFILCKLLRKCKKKGGAFNVTIEG"
FT   sig_peptide     473005..473094
FT                   /locus_tag="Ilyop_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            473978..474742
FT                   /locus_tag="Ilyop_0417"
FT   CDS_pept        473978..474742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0417"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="COGs: COG0411 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro
FT                   IPR003593:IPR003439; KEGG: cbe:Cbei_5045 ABC transporter
FT                   related; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: A6M3H1 ABC transporter related; PFAM: ABC
FT                   transporter; Branched-chain amino acid ATP-binding cassette
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82205"
FT                   /db_xref="GOA:E3HB54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB54"
FT                   /protein_id="ADO82205.1"
FT                   /translation="MSLLKANNLTMQFGGITAVSDFSIEVGENELMGLIGPNGAGKTTV
FT                   FNMLTGVYKPTKGDINFAGEDITGLKPYDITRKKAARTFQNVRLFKDLSVIDNVKISLT
FT                   YQIKLGLFESILRTPNYYKVEKEIHEKAMKILEIFKLENKSEEYAKNLPYGEQRRLEIA
FT                   RALAASPKLLLLDEPAAGMNPQETQELMELITWIKEEFKIAILLIEHDMKLVMGICEKI
FT                   LVLDYGKILTVGTPDEVKNNPEVIKAYLGEEG"
FT   sig_peptide     473978..474031
FT                   /locus_tag="Ilyop_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            474744..475445
FT                   /locus_tag="Ilyop_0418"
FT   CDS_pept        474744..475445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0418"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="COGs: COG0410 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: cbe:Cbei_5046 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: A6M3H2 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82206"
FT                   /db_xref="GOA:E3HB55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB55"
FT                   /protein_id="ADO82206.1"
FT                   /translation="MLEIKNLNLHYGMIHALRDINVKVNKGEIVTLIGANGAGKSSTLR
FT                   ALSGLEKASSGEILFEGKDIAKNPANEIVAMGMSHVPEGRRVFANLTVYENLELGAYLR
FT                   KDKDIKKDIQLILDKFPRLRERLYQRAGTLSGGEQQMLAMGRALMIKPKLLLLDEPSMG
FT                   LAPIIVKNIFDIILEINKNGTTVLLVEQNAHAALKIAHKAYVLETGSIVYEGDAKSLLE
FT                   DDTIRSAYLGE"
FT   gene            475694..475918
FT                   /locus_tag="Ilyop_0419"
FT   CDS_pept        475694..475918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0419"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="InterPro IPR004692; KEGG: fnu:FN0538 protein
FT                   translocase subunit SecG; PFAM: Preprotein translocase SecG
FT                   subunit; SPTR: C6JKR3 Translocase subunit secG; TIGRFAM:
FT                   preprotein translocase, SecG subunit; PFAM: Preprotein
FT                   translocase SecG subunit; TIGRFAM: protein translocase,
FT                   SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82207"
FT                   /db_xref="GOA:E3HB56"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB56"
FT                   /protein_id="ADO82207.1"
FT                   /translation="MVGFLTALLFIFALSLIILVLIQPDRSRGMSGNMGMGASNTVFGV
FT                   SQDGGPLAKMTEVVAALFIVTALLLYLLK"
FT   sig_peptide     475694..475780
FT                   /locus_tag="Ilyop_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            476034..477272
FT                   /locus_tag="Ilyop_0420"
FT   CDS_pept        476034..477272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0420"
FT                   /product="Recombination protein MgsA"
FT                   /note="COGs: COG2256 ATPase related to the helicase subunit
FT                   of the Holliday junction resolvase; InterPro
FT                   IPR003593:IPR003959; KEGG: fnu:FN0297 recombination factor
FT                   protein RarA; PFAM: AAA ATPase central domain protein;
FT                   SMART: AAA ATPase; SPTR: C6JKR2 Recombination factor
FT                   protein RarA; PFAM: MgsA AAA+ ATPase C terminal; Holliday
FT                   junction DNA helicase ruvB N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82208"
FT                   /db_xref="GOA:E3HB57"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB57"
FT                   /protein_id="ADO82208.1"
FT                   /translation="MKSLFHGNYDNIRPLAYQMRPKTLLDYVGQEEIIGEKSVLRKLIT
FT                   KGKMINSIFFGPPGTGKTSLAEIIAEELSYSFEKMNATTANLSDFREVVERAKKRVELE
FT                   NRRTLLFLDEIHRFNKLQQDSLLPYTEEGLIVLVGATTENPYYTLNNALLSRCMVFEFK
FT                   KLEERHIRELVKKGCKRLDILEKLSSEMEDIILELSRGDARVALNYVELFANTAEDLNE
FT                   NELKELFKKRNDAYHKKEDKYNIVSAFIKSIRGSDPDAAVYWMARMLSGGEDPRYIARR
FT                   LMILASEDIGMANPEAMLIAHAAMDASEKIGMPEVRIILSQAAIYLAISSKSNSSYEAV
FT                   NSALDDISKGKIEDVPKHLKNQYGELYKYPHSHPGNFVQQVYKKDRKKYYNPGDNKNER
FT                   LISQKLLKLWDEK"
FT   gene            477293..478534
FT                   /locus_tag="Ilyop_0421"
FT   CDS_pept        477293..478534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0421"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="COGs: COG0124 Histidyl-tRNA synthetase;
FT                   InterProIPR004154:IPR002314:IPR006195:IPR004516:IPR 015807;
FT                   KEGG: fnu:FN0298 histidyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; PRIAM: Histidine--tRNA ligase; SPTR: C3WCE1
FT                   Histidyl-tRNA synthetase; TIGRFAM: histidyl-tRNA
FT                   synthetase; PFAM: Anticodon binding domain; tRNA synthetase
FT                   class II core domain (G, H, P, S and T); TIGRFAM:
FT                   histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82209"
FT                   /db_xref="GOA:E3HB58"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB58"
FT                   /protein_id="ADO82209.1"
FT                   /translation="MKLLKAVRGTKDIFGEDALKYNHIVNTAKEVFEAYGYSMIKIPIF
FT                   EETNLFKRGIGEGTDVVEKEMYTFTDRGDRSITLRPEGTASVVRSYLEHKIYGKEEFTR
FT                   YYYTGSMFRYERPQAGRQREFNQLGIEALGEGSPILDAEVIAMSYTLLEKLGITDLEVN
FT                   INSVGGNESRSKYRDTLINFLTPSKDELCEDCRARYERNPLRVLDCKNPKCKEITEEAP
FT                   SIIDSLNQEEREHYESVKKYLDIFGIKYRENSRLVRGLDYYSSTVYEVITNKLGSQGTV
FT                   LGGGRYDNLLKQLGNKEIPAVGFAAGIERLMMLLEDYPKNNPEVFIAWLGKDEATYAFG
FT                   IAKALRDAGIKTCIEFSSRSLKASMKKADKLGVGHAIIIGDEEMANKKMVLKNFQERTQ
FT                   ETLSIEDVIKRLKK"
FT   gene            478569..480344
FT                   /locus_tag="Ilyop_0422"
FT   CDS_pept        478569..480344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0422"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="COGs: COG0173 Aspartyl-tRNA synthetase;
FT                   InterProIPR002312:IPR016027:IPR004365:IPR004364:IPR
FT                   004115:IPR006195:IPR012340:IPR004524; KEGG: fnu:FN0299
FT                   aspartyl-tRNA synthetase; PFAM: tRNA synthetase class II (D
FT                   K and N); nucleic acid binding OB-fold tRNA/helicase-type;
FT                   GAD domain protein; SPTR: C6JKR0 Aspartate-tRNA ligase;
FT                   TIGRFAM: aspartyl-tRNA synthetase; PFAM: GAD domain; tRNA
FT                   synthetases class II (D, K and N); OB-fold nucleic acid
FT                   binding domain; TIGRFAM: aspartyl-tRNA synthetase,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82210"
FT                   /db_xref="GOA:E3HB59"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB59"
FT                   /protein_id="ADO82210.1"
FT                   /translation="MIYRTHNLGELRKEDITKKVTLSGWVATKRDLGGLTFIDLRDREG
FT                   VTQIIFNPEENADLAEKSQKIRTEAVIKITGEVRERYSKNPNMPTGDIEVFVEELEILN
FT                   NCDVLPFQISGEENLSENMRLKYRYLDLRKPKMTRNLKMRHKMLMAIRNYMDEKGFLDV
FT                   DTPILTKSTPEGARDFLVPSRTNEGDFYALPQSPQLFKQLLMISGVERYYQIAKCFRDE
FT                   DLRADRQPEFTQLDIEMSFVEMEDVINEIEGLAKRVFQSVTEEAADYEFQRMEYAEAME
FT                   RFGSDKPDIRFGVELKELTDIMKNCGFKAFSGVANSGGLVKAVVAPGSAENFSRKVLGE
FT                   YEDYVKTYFGAKGLAWIKVTEEGVNSPIAKFFSEEEIATILARTGAVAGDVIMILADRA
FT                   KVVYDGLGALRLKLGKDLDLINNDEYKFLWIVDFPMFEWSEEEERYKAQHHPFTSIKAE
FT                   DMDAFMTGEMDKVRTNSYDLVLNGAEIGGGSIRIHNPEVQAKVFERLGLSEEEAREKFG
FT                   FFIDAFKYGAPPHGGLAFGIDRWLMVMLKESSIRDVIPFPKTNKGQCLMTEAPSKVEDG
FT                   QLEELYLKSTYIPVK"
FT   gene            480434..480633
FT                   /locus_tag="Ilyop_R0019"
FT   ncRNA           480434..480633
FT                   /locus_tag="Ilyop_R0019"
FT                   /product="6S RNA"
FT                   /note="6S / SsrS RNA as predicted by Rfam (RF00013), score
FT                   37.20"
FT                   /ncRNA_class="other"
FT   gene            480709..482421
FT                   /locus_tag="Ilyop_0423"
FT   CDS_pept        480709..482421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0423"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR015945:IPR009080:IPR005148:IPR008909:IPR
FT                   001412:IPR019825:IPR014729:IPR001278; KEGG: fnu:FN0506
FT                   arginyl-tRNA synthetase; PFAM: Arginyl-tRNA synthetase,
FT                   class Ic, core; arginyl tRNA synthetase domain protein;
FT                   DALR anticodon binding domain protein; PRIAM:
FT                   Arginine--tRNA ligase; SPTR: C3WCE3 Arginyl-tRNA
FT                   synthetase; TIGRFAM: arginyl-tRNA synthetase; PFAM: DALR
FT                   anticodon binding domain; Arginyl tRNA synthetase N
FT                   terminal domain; tRNA synthetases class I (R); TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82211"
FT                   /db_xref="GOA:E3HB60"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB60"
FT                   /protein_id="ADO82211.1"
FT                   /translation="MILIEKELGAIFEETIKNIYGEQEIKPIDIEAASNEKFGDFQTNF
FT                   AMVNAKVLRSNPRAIAENVVNNLVDNNVIEKIEVAGPGFINIFLKEEYLGDRVRKISTE
FT                   KYDLSFLDTHGDVIIDYSSPNIAKRMHIGHLRSTIIGDSIKRIYRYLGYKVVADNHIGD
FT                   WGTQFGKLIIGYRNWLDREAYKANPIEELERVYVEFSKNSEENTELEDQAREELRKLHE
FT                   GDEENYSLWQEFIKVSLDEYNKVYGRLGVDFDTYYGESFYHDMMPAVVEELLDKNIAKE
FT                   DDGANVVFFEEKDKLHPCIVQKKDGAFLYATSDIATVKFRKENYDVNQIIYVTDERQQD
FT                   HFRQFFKITDMLGWEVKKNHVWFGIMRFAEGIFSSRKGNVIRLEHLLDEGKKKALEVVE
FT                   EKNPTLSAEEKANISEVVGIGAIKYADLSQNRQSPVIFEWDKILSFEGNTAPYLQYSYA
FT                   RIQSILRKGAENSKVLKEDSKIILEESAERSLVLYMSLFPKMVMKAAESFRPNLVTDYL
FT                   FELSRRFNTFYNSCPILNQEDEILYSRLLIADRTAKVLKEGLDLLGIGTVDRM"
FT   gene            482564..483436
FT                   /locus_tag="Ilyop_0424"
FT   CDS_pept        482564..483436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1660 P-loop-containing kinase; InterPro
FT                   IPR005337; KEGG: fnu:FN1089 hypothetical protein; PFAM:
FT                   conserved hypothetical protein; SPTR: C6JKQ8 ATP-binding
FT                   protein; PFAM: P-loop ATPase protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82212"
FT                   /db_xref="GOA:E3HB61"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB61"
FT                   /protein_id="ADO82212.1"
FT                   /translation="MKNIQLIIISGLSGAGKTSAINSFEDMGYFTIDNIPCTMGNVLLK
FT                   AIKNGDMDKKKLCMGIDARSFEKVEEFSSLLDELEASGIDYRLIFLESKVEVILNRYNL
FT                   TRRKHPIEAKTILDSIIEERSIMGDIRKRASVILDTSSLKPKDIGLKLKKLLFDRQDEE
FT                   ITVHFQSFGFKYGTPIDLDLMFDVRFLKNPYYLEELRDKTGNDKEVSEYVMGFQESQEF
FT                   FKKLVDMLEFLIPKFITEGKSHLSVGVGCSGGRHRSVTYINLLKDYFSGRSDIRVVTSH
FT                   REEERGHWL"
FT   sig_peptide     482564..482623
FT                   /locus_tag="Ilyop_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            483440..485242
FT                   /locus_tag="Ilyop_0425"
FT   CDS_pept        483440..485242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0425"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="COGs: COG0322 Nuclease subunit of the excinuclease
FT                   complex;
FT                   InterProIPR000305:IPR010994:IPR009055:IPR001943:IPR
FT                   001162:IPR002345:IPR004791; KEGG: fnu:FN1090 excinuclease
FT                   ABC subunit C; PFAM: excinuclease ABC C subunit domain
FT                   protein; Excinuclease ABC C subunit domain protein;
FT                   UvrB/UvrC protein; SMART: Excinuclease ABC C subunit domain
FT                   protein; SPTR: C3WDC4 Excinuclease ABC subunit C; TIGRFAM:
FT                   excinuclease ABC, C subunit; PFAM: UvrB/uvrC motif; UvrC
FT                   Helix-hairpin-helix N-terminal; GIY-YIG catalytic domain;
FT                   TIGRFAM: excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82213"
FT                   /db_xref="GOA:E3HB62"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB62"
FT                   /protein_id="ADO82213.1"
FT                   /translation="MDIKKIDIPENPGVYLMKKGDKVIYVGKAKNLKKRVSSYFNREHI
FT                   DEKTRELVKNIESLDFIICNSELDALVLENNLIKRYSPKYNISLKDEKTYPYIKFTKED
FT                   YPKITIIRTTKSLDTESGYYFGPYPYGCRNLKKTLIKIFKIRDCKRDMSKKYDRPCLKY
FT                   FMNLCTGPCVYKDVMHEYRENVENAKKLLKGRGKEVIAHQKAKMEKASEELRFEEAILY
FT                   RNQLKELENAEKSQVAEYDKAVDEDLFVFSIEGERLFLCVLNMRDGKILEKKSSGTDLK
FT                   GKVFDNLFQEVVTDYYSKHSIPKNIVFQKENEENSEIVGKWLTLKSGKKIDLYFPKVKS
FT                   RRMDLLDMALLNLNRDIESYFTRKNVLEEGLMSLYSILELKKIPRRIECFDISNIQGKD
FT                   AVASMSVAIEGKLSKKEYRKFKIKSKDTPDDFQMMREVAERRYSKLKEHELPDLILIDG
FT                   GLGQLGSVGNILKKLKKSEFLDIISIAKREEEIFKLGETTPYIFPKSEESLKILQRLRD
FT                   EAHRFGVSYHRKLRSKRVLASELDSIEGIGPKRKEALLKKFGSVSGIKKAGEDELCTVL
FT                   SEALAKRVIRGLNDDGKKKDTGNR"
FT   gene            485211..485573
FT                   /locus_tag="Ilyop_0426"
FT   CDS_pept        485211..485573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0426"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789:IPR011006; KEGG: aoe:Clos_1079 two
FT                   component, sigma54 specific, Fis family transcriptional
FT                   regulator; PFAM: response regulator receiver; SMART:
FT                   response regulator receiver; SPTR: A8MGT2 Two component,
FT                   sigma54 specific, transcriptional regulator, Fis family;
FT                   PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82214"
FT                   /db_xref="GOA:E3HB63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB63"
FT                   /protein_id="ADO82214.1"
FT                   /translation="MGKKRILVIDDEESIRFLLREVIEDLGYHCLEAESAIIGIEVVVS
FT                   ENPDLIILDIQMPQMNGLEAIQKIRKINKKVPIFMLSAFSHMENVIENMGVDVQEFIPK
FT                   PFDIDYLSKRITEEMG"
FT   gene            485583..486593
FT                   /locus_tag="Ilyop_0427"
FT   CDS_pept        485583..486593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lba:Lebu_0605 hypothetical protein; SPTR:
FT                   C6JKQ6 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82215"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB64"
FT                   /protein_id="ADO82215.1"
FT                   /translation="MRKIIKVAILVTVFLLTAGCNHVVLRQDLYEKVAFKSEKIQPGKN
FT                   IIKVYSLEFPENYFEKLKYMEDFELISKQLLLEDKSLNLLVSRSMYDTIDSLKKGDVLP
FT                   EEKIYLKTASDLTDAELAEIDKKIDVYVTDRGGSVQRHLNKQVYFWMVLNGNKSEFVGE
FT                   NLYTELDKQKLVEKVRTSRKEFSRVLNNVKLNLIIKEKNLYATKNSVLDTSEGILTEEK
FT                   SMYLKGMKDSDFNKILGKEVKFNSPLLILDSEKFKGYTVVDGNYIFFYGGSDVKSSYHR
FT                   YDFEVEISEIVLKDLLKVESGILLDELFERTKPEINGIEEKAAQPDKKSVNWGIN"
FT   sig_peptide     485583..485651
FT                   /locus_tag="Ilyop_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            486593..488104
FT                   /locus_tag="Ilyop_0428"
FT   CDS_pept        486593..488104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0428"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG2208 Serine phosphatase RsbU regulator of
FT                   sigma subunit; InterPro IPR001932:IPR010822; KEGG:
FT                   fnu:FN1091 sigma factor SigB regulation protein RsbU; PFAM:
FT                   Stage II sporulation E family protein; SMART: protein
FT                   phosphatase 2C domain protein; SPTR: C6JKQ5 Sigma factor B
FT                   regulator; PFAM: Stage II sporulation protein E (SpoIIE)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82216"
FT                   /db_xref="GOA:E3HB65"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB65"
FT                   /protein_id="ADO82216.1"
FT                   /translation="MIYAGLIFVLFLTFLKILKSQEKAYRGEISTILRKLREKEEYNGI
FT                   IDSVHEEYDQTLQTILKQGKELENSLEELKEYRVELDITYNSLIKKSTQLEYSNEILER
FT                   RVANLSNLNAVARTVLSIIKLEKIIDIILDAYFVLTGAKKISLYLWEDGMLVNKKTKGN
FT                   IIFKGTLSYPIETLEGFSRNDFRRVYEELSRGFKVEENEAVIISDLNVKGKELGVIYIV
FT                   EDRERLIDSDQETISALAIQVANAINNAKMYEELLIKERISKELEVASRIQKKILPVEM
FT                   KKVCGLEIANYFEPAKEVGGDYYDYCQREEDRVSITIADVSGKGVPAAFLMALIRSVLK
FT                   TLNYKNIQPSEMLTTLNEIIYPDITEDMFVTLFHSKYIASERTLYYSNAGHNPLIIYKA
FT                   DLGEVVEYNVKGVAIGFIPEYQYKLGKVELSKGDILLYYTDGITEAENSNRDMFGIDRL
FT                   KEVIYDNRGKSAEDVKKAILDSINNFRGDHEQVDDLTFVVIRNNE"
FT   sig_peptide     486593..486664
FT                   /locus_tag="Ilyop_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            488305..488925
FT                   /locus_tag="Ilyop_0429"
FT   CDS_pept        488305..488925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR016181:IPR020137; KEGG: ppr:PBPRA0653
FT                   hypothetical protein; SPTR: Q6LUF1 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82217"
FT                   /db_xref="GOA:E3HB66"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB66"
FT                   /protein_id="ADO82217.1"
FT                   /translation="MEINWIEWFGYISSFVVLISLTMSSIIKLRWINLIGAIMFSIFGF
FT                   MINSYPTGTLNLGIAFIDLYYLYKIYMRKEEFSMVKANFDSDYFKYFINFNRKEIDEQY
FT                   NTLSETSDYKAYYYLRNNNISGVMIGRALDNDTFFIELDYVTKEFRDFKIGKYFLGENR
FT                   IKLLLKGYSILKARANSKHHAQYLEKIGFKKVGDDTNEYIKTI"
FT   sig_peptide     488305..488376
FT                   /locus_tag="Ilyop_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            488965..489777
FT                   /locus_tag="Ilyop_0430"
FT   CDS_pept        488965..489777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0430"
FT                   /product="purine nucleoside phosphorylase I, inosine and
FT                   guanosine-specific"
FT                   /EC_number="2.4.2.1"
FT                   /note="COGs: COG0005 Purine nucleoside phosphorylase;
FT                   InterPro IPR000845:IPR011268:IPR011270; KEGG: cbk:CLL_A1703
FT                   purine nucleoside phosphorylase I, inosine and
FT                   guanosine-specific; PFAM: purine or other phosphorylase
FT                   family 1; SPTR: B2TL17 Purine nucleoside phosphorylase I,
FT                   inosine and guanosine-specific; TIGRFAM: purine nucleoside
FT                   phosphorylase I, inosine and guanosine-specific; inosine
FT                   guanosine and xanthosine phosphorylase family; PFAM:
FT                   Phosphorylase superfamily; TIGRFAM: purine nucleoside
FT                   phosphorylase I, inosine and guanosine-specific; inosine
FT                   guanosine and xanthosine phosphorylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82218"
FT                   /db_xref="GOA:E3HB67"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB67"
FT                   /protein_id="ADO82218.1"
FT                   /translation="MYDKVMETVTYLNEKVAYRPKVAIILGSGLGDLVDYIEEKVEISY
FT                   EEIPNFPVSTVAGHAGQLVFGKIGGVEVLAMKGRFHYYEGYDMKQVTYPVYVMKQFGIE
FT                   NIIVSNAAGGANSTFKPGTLMLITDHINAFGTNPLIGKNDERFGPRFPDMSETYTKKLQ
FT                   ELAKTTAKEMGIDYREGVYLGTTGPTYETAAEVRAFISMGADAIGMSTVPEVIIANYTG
FT                   MNILGISCITNMATGIAKEAHSHEAVVEIAKRTGNEFCRWVAETVKKI"
FT   gene            489876..491402
FT                   /locus_tag="Ilyop_0431"
FT   CDS_pept        489876..491402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0431"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /note="COGs: COG3845 ABC-type uncharacterized transport
FT                   systems ATPase components; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: lba:Lebu_0606 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: C7N8N3 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82219"
FT                   /db_xref="GOA:E3HB68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB68"
FT                   /protein_id="ADO82219.1"
FT                   /translation="MSEYILEMKDIRKTFLDGKVVANDNITLKIKKGEKHAIVGENGAG
FT                   KSTLMKILNGLYQPTSGEIYYHGKKVEIDGPGEASKLGIGMVYQHFMLIPTLTVAENMI
FT                   LGVEPKKGMMLDLKTAREEVRRVSEKYGLEIDPDALVSDISVGIQQRVEILKILFKGAN
FT                   LLVFDEPTAVLTPQEVKELYKIMDNLIEEGKTIIFISHKLQEVLDISDNITVIRRGKDV
FT                   SNFPTSEATKEKIANAMVGRAVLFTTEKPEVELGKELVAVNNLIVKNNKGILAVDEASF
FT                   NIREGEILGIAGVEGSGQTELIEAITGLRKPQAGTILLDGKPITGKSARKIILDGVAHI
FT                   PEDRHKRAAISEFSVRDNFALGVHRDKYAKNRFLLNFKKMKDEAIGFMEKYDVRPREIG
FT                   TGFGRLSGGNQQKLVVARELEKDHKFIIASQPTRGVDIGAIESIHRMILEEKKKSNAVL
FT                   VVSAELSEILNLSDRIAVMCGGKITGILDRADATEEKIGILMAGGELHEN"
FT   gene            491392..492441
FT                   /locus_tag="Ilyop_0432"
FT   CDS_pept        491392..492441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0432"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4603 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR001851; KEGG:
FT                   lba:Lebu_0607 inner-membrane translocator; PFAM:
FT                   inner-membrane translocator; SPTR: C4BX86 Nucleoside ABC
FT                   transporter membrane protein; PFAM: Branched-chain amino
FT                   acid transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82220"
FT                   /db_xref="GOA:E3HB69"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB69"
FT                   /protein_id="ADO82220.1"
FT                   /translation="MKTKIQNAMVPVLAVAIALLIGAGIIAYLGENPLNAYYYLFKGAF
FT                   MGERAIARTLLEATPMIFTGLSVLFAFKAGMFNIGGQGQVIMGGLAAAAVGAFVQNIGI
FT                   NNLFVVLILSGLAGFAWAAIAGYLKAKLGVHEVISTIMLNYIAMSFEQYALNYPLKQGG
FT                   IMGPSPQTPPVMMASRLPQLIPSTKEALNVGFILAIIAAIVVWYIFEKTILGYEIKAVG
FT                   HNPTASENAGINVAKITALSLGIAGVLAALGGAERILGGVGQYTYRQGIMASYGFDGIA
FT                   VALLGKNSPVGAVLAAILFACLRVGGRAMQFNTTIPSQIVIILQSIIILLIAAENMFKF
FT                   FLERKKVSE"
FT   sig_peptide     491392..491472
FT                   /locus_tag="Ilyop_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            492441..493319
FT                   /locus_tag="Ilyop_0433"
FT   CDS_pept        492441..493319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0433"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="COGs: COG1079 ABC-type transport system permease
FT                   component; InterPro IPR001851; KEGG: sth:STH1233 sugar ABC
FT                   transporter permease; PFAM: inner-membrane translocator;
FT                   SPTR: C4BX85 Nucleoside ABC transporter membrane protein;
FT                   PFAM: Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82221"
FT                   /db_xref="GOA:E3HB70"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB70"
FT                   /protein_id="ADO82221.1"
FT                   /translation="MPIIISIIMATLRQAAPILITAIGGMFSEISGVVNIGLEGMMLMG
FT                   AFSAAVTSYYTGSPLIGILGGMMAGGLTAAIHAVLSIKYKGNQTVSGVAINLFASGFTV
FT                   FMLRVLFNQSGNTPTVPKAPALFGVSIIVVLIYVIAIWSQFFLYKTTTGLRMRAVGEHP
FT                   LAADTVGIDVAKIRYFGVIMSGVFAGLGGAYLSIGALSQFTKEMSAGRGFIALAALVFG
FT                   KWTPKGVLAASLLFGFADAGQTLIQQYVDFIPPQFIQMIPYILTLLALAGVVGKAVAPS
FT                   ASGKPYDKNSN"
FT   sig_peptide     492441..492485
FT                   /locus_tag="Ilyop_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(493385..494023)
FT                   /locus_tag="Ilyop_0434"
FT   CDS_pept        complement(493385..494023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0434"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   ckr:CKR_0629 hypothetical protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C3WEN5 Amino acid ABC transporter,
FT                   permease; TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component; TIGRFAM: amine acid ABC
FT                   transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82222"
FT                   /db_xref="GOA:E3HB71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB71"
FT                   /protein_id="ADO82222.1"
FT                   /translation="METQGMLIYILGGLKLTALLYIATGVLALPLGLFLSLGGVSKSVF
FT                   VRRGIALYTWIFRGSPLLLQLFFVYYGLPVMGITLTPFTAASLTFILNYSAYTCEILRG
FT                   CIQSIPKGQYEASRVLGMNYFKTMRHIILPQALRMSLPALSNEAVNLVKDTALISSIGM
FT                   AEILRNSKEIVARDFTIMPFILCGLIYLAVSSIIILIFKKAEDKYEIIY"
FT   sig_peptide     complement(493940..494023)
FT                   /locus_tag="Ilyop_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(494023..494811)
FT                   /locus_tag="Ilyop_0435"
FT   CDS_pept        complement(494023..494811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0435"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR001320:IPR001638:IPR018313; KEGG: ckr:CKR_0630
FT                   hypothetical protein; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3; ionotropic glutamate receptor; SPTR:
FT                   C3WEN6 Extracellular solute-binding protein; PFAM:
FT                   Bacterial extracellular solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82223"
FT                   /db_xref="GOA:E3HB72"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB72"
FT                   /protein_id="ADO82223.1"
FT                   /translation="MKKIVLIFLATIALLGCGKKSTDSYDKIKEQGKFIVGLDDTFAPM
FT                   GFRDESGEIVGFDIDLAKEVASRMGVEAEFSPREWSSIVFELKSGNIDMVWNGMTITPE
FT                   RQEQIAFSEPYFANDQIIMTLADSPIQTAEDLKGKIIGVQLGSSSYTLVMKNPISESAS
FT                   EIKKYATNAEALMDLEAKRIDAVVMDVIVGEYYAAKKEAREGKDIFKSLDKALGKEDFG
FT                   VGLRKEDKKLKKEIDKILDEMKKDGTFDTIHDKWFGGKEA"
FT   sig_peptide     complement(494740..494811)
FT                   /locus_tag="Ilyop_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            495214..496530
FT                   /locus_tag="Ilyop_0436"
FT   CDS_pept        495214..496530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0436"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="COGs: COG0733 Na+-dependent transporter of the SNF
FT                   family; InterPro IPR000175; KEGG: bfs:BF0389 putative
FT                   sodium-dependent transporter; PFAM: sodium:neurotransmitter
FT                   symporter; SPTR: B7AM89 Transporter; PFAM:
FT                   Sodium:neurotransmitter symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82224"
FT                   /db_xref="GOA:E3HB73"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB73"
FT                   /protein_id="ADO82224.1"
FT                   /translation="MKGKKGVYTASLGLIGSAIGLGNLWRFPYMVGKNGGGAFLIVYFC
FT                   FVALLGIPLMLGEFVLGRSSHAGIVGAFKNFTPGKPWYLAGGLGILTSSLILGFYGVVG
FT                   GWSLRFFYLSSTNALINKNPDELGNAFRSFITSPADPIFWQVLFMVITALVLISKIEGS
FT                   IEKITKIMMPMLFLIIMVLCMKALVLPELGKGMAFFLKPDFSKITAGGIQAAMGQSFFS
FT                   LSIGMGVLITYGSFMKRDENLLVSALHVIGTDTLVAFLIGVIVFPVAFTYGIDPESGPG
FT                   LIFTTLTSLFNEIQGGYGLGVMFFLLLFLAALTTAISLLESVVTCLNNQCKLPRNTSVL
FT                   IATVIITALGAVTSLSLGVWGESNIFYVLDYITVDVFLPVMAMLTSFYLGYVLELKVIK
FT                   EEMSNDGIQFKYTKHLQMMLKFVCPVIIAIVLLGGLALN"
FT   gene            496603..497541
FT                   /locus_tag="Ilyop_0437"
FT   CDS_pept        496603..497541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0437"
FT                   /product="protein of unknown function DUF1385"
FT                   /note="COGs: COG3872 metal-dependent protein; InterPro
FT                   IPR010787; KEGG: fnu:FN1092 hypothetical protein; PFAM:
FT                   protein of unknown function DUF1385; SPTR: C3WDC7 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1385)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82225"
FT                   /db_xref="GOA:E3HB74"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB74"
FT                   /protein_id="ADO82225.1"
FT                   /translation="MKNKEITVGGQAVIEGVMMKGSKNLATAVRKPDGEIVYRKTDISS
FT                   KSGKISKLPFVRGSIILFSTLILGTKELTFSANQADDTEEELSDKELFMTVTFALLLGV
FT                   GLFMVLPSAIGGLLFSANKLYANILEAFLRLLFFVVYIWAISFSKDIRRVFEYHGAEHK
FT                   SIYAFENGLELTPENAKQYTTLHPRCGTSFLLIVMLCSIFVFSIVDFVIPTPATMWGRI
FT                   GLKAVLRVLFMPAIAGLSYEFQRFTSRNLHKKWVRTLASPGLLLQKITTKEPDLDQLEV
FT                   AIVALRVAMGETVDNAVEIENKNLKVKEEHA"
FT   gene            complement(497580..499286)
FT                   /locus_tag="Ilyop_0438"
FT   CDS_pept        complement(497580..499286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0438"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: glo:Glov_3440 diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein;
FT                   SPTR: B3E241 Diguanylate cyclase; TIGRFAM: diguanylate
FT                   cyclase; PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase
FT                   (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82226"
FT                   /db_xref="GOA:E3HB75"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB75"
FT                   /protein_id="ADO82226.1"
FT                   /translation="MNKTESKYIKIKYFLYIFAPFFILTLIFFTVVRNSSIKNEIDQIK
FT                   ISEKISIESVHEIILNDLSSVTSDVLYLSQNISLYKDLKKSPLDFKETSHQYFNFIKYK
FT                   KIYDQIRYIDNSGLEKIRVNYKDGNPVIVENTQLQNKEERYYFKNSIKLNKGEIFMSDF
FT                   DLNIEDKNIELPYKPVLRFATPVIDKSGKKLGIVIVNYLGKNILSDIENNSDLKNSSSY
FT                   FMINSSSYYLIHQDKNKEWGFMFDEKKSINMKNDNPELLEEMKNNLMGQLFLDNSLFTY
FT                   TKVNPTKDKYILSENPQNNYSNEDFEKYRWIIISTIPEKHFIKIKSEINHKLIWKFYII
FT                   SIFIALLAFLYSKSKYSEYLSLEMIKEKNSELTEKNKEIETKKETLKKMNTYLEEKNEQ
FT                   LFLHSTIDPLTKTYSRRYFSELFSKELTKLKRHHLSLCCMIFDIDHFKSINDNYGHLAG
FT                   DYILEAISKIIHDKIRNEDIFGRYGGDEFLIALPETELKAGKIVAEKIIKTIAEETFIF
FT                   NDTSIKVTLSIGISALDDSFDTIEAAIKNSDSALYLAKKNGRNRVEVYHKS"
FT   gene            499543..501450
FT                   /locus_tag="Ilyop_0439"
FT   CDS_pept        499543..501450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0439"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG0531 Amino acid transporter; InterPro
FT                   IPR016152:IPR004841:IPR002178; KEGG: hoh:Hoch_4824 amino
FT                   acid permease-associated region; PFAM: amino acid
FT                   permease-associated region; SPTR: Q1K1W9 Amino acid
FT                   permease-associated region; PFAM: Amino acid permease;
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82227"
FT                   /db_xref="GOA:E3HB76"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB76"
FT                   /protein_id="ADO82227.1"
FT                   /translation="MNLKKELGFWEVFSIATGAMISSGIFILPGIAFEKAGPSIILSYF
FT                   LGGILALSGILNVIELATAMPKAGGDYFFVMRTLGPLFGTVSGVLSWFALSLKSAFAIL
FT                   GIASFIDGIFYGSVTANDMFFISIFVTIFFMVLNIIGVDVAAKFEVTLVIILICVMVLY
FT                   VIVGSSSVDVSRYTPFISSFEDGKIKEIFPIFKNSGMYKIVGTTSLIFVSFGGLLKATT
FT                   VAEEVKDAGNNITKGMIASIMTITILYVLMLTVTVGNIDGGYLAGSLSPISDTAKRVFG
FT                   PWGYYLINFAALLAFFTTANAGIMAASRYPMALSRDGLVPPIMSTVSIKFKTPVLSILF
FT                   TGTFIMLSLMLPLELLAKTASAVILLAYMLTSLCVIILRESNVKNYKPIFKAPLYPWLQ
FT                   ISCIIIFNYFMFSLGWKVLKINVLLIIISIMVYFLYGKKRTSQEYALLHLLLRITENLG
FT                   LKHGLEEELRDIIHERDEVELDEFDRLIKNAKILDLKGPVTLDELFDIEARHLTSVVDK
FT                   PEHELIKLFNDREREFSTAITDFTAIPHIVVDEKDLFYLMVVRCREGIRFNEKRNSVKA
FT                   VFLFISSPTLRKTHLRTLASIASLTREESYERKWMSAKNENYLRDMILLSKRERIHHKF
FT                   "
FT   sig_peptide     499543..499644
FT                   /locus_tag="Ilyop_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            501514..502758
FT                   /locus_tag="Ilyop_0440"
FT   CDS_pept        501514..502758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0440"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="COGs: COG0112 Glycine/serine
FT                   hydroxymethyltransferase; InterPro
FT                   IPR015424:IPR001085:IPR019798:IPR015421; KEGG:
FT                   fno:Fnod_0085 serine hydroxymethyltransferase; PFAM:
FT                   glycine hydroxymethyltransferase; PRIAM: Glycine
FT                   hydroxymethyltransferase; SPTR: C6JIN0 Serine
FT                   hydroxymethyltransferase; PFAM: Serine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82228"
FT                   /db_xref="GOA:E3HB77"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB77"
FT                   /protein_id="ADO82228.1"
FT                   /translation="MNLSNLNNIDPEIYDVVLKEEDRQEYGLELIASENFVSKAVMETT
FT                   GSVLTNKYAEGYPDKRYYGGCQFVDVAEKLAIERAKQLFGAEYVNVQAHSGSQANMAVY
FT                   KSLINIGDTILGMKLDHGGHLTHGMHVNFSGKDYKVVSYSVKKDDELIDYEEVRKLALE
FT                   SKPKIIIAGASAYPRIIDFKKFRDIADEVGAYLMVDMAHIAGLIVAGEHPNPVEYAHVV
FT                   TTTTHKTLRGPRGGMILTNDENIAKKVNKTIFPGIQGGPLMHIIAAKAVAFKEALQPEF
FT                   KDYQIQVVKNAKVLADALQKGGLRIVSGGTDNHMMLVDLTPKGLTGKAVEEGLGKAHIT
FT                   VNKNGIPYDTQKPMITSGIRIGTPALTTRGMKEEEMKKVASFILAVVDNIQDDAKIKEV
FT                   GEEIKEFCKDFPLYR"
FT   gene            503250..503972
FT                   /locus_tag="Ilyop_0441"
FT   CDS_pept        503250..503972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0441"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="COGs: COG1489 DNA-binding protein stimulates sugar
FT                   fermentation; InterPro IPR005224; KEGG: lba:Lebu_0441 sugar
FT                   fermentation stimulation protein; PFAM: sugar fermentation
FT                   stimulation protein; SPTR: C6JKQ2 Sugar fermentation
FT                   stimulation protein; TIGRFAM: sugar fermentation
FT                   stimulation protein; PFAM: Sugar fermentation stimulation
FT                   protein; TIGRFAM: sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82229"
FT                   /db_xref="GOA:E3HB78"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB78"
FT                   /protein_id="ADO82229.1"
FT                   /translation="MKKIYEINCDQKGSFIERPNRFIAKVKLDNGSLETVHVHDSGRIR
FT                   ELLFEGNRVNIKSASNPNRKTKWDMISALSDDGEEILINSAYHRYISENIIRDPEISPF
FT                   GKLDSLRAEVKYGKSRIDYMLTKNGENIWVEVKGVSLSVDKMAMFPDAPSTRAQKHLKE
FT                   LMELLEKGDKAAVLLLIFRKSECFRPKWETDPVFSALFYEAMERGVEIYPVQLELKDGN
FT                   INYKGLLPIEERNERKPV"
FT   gene            504070..504375
FT                   /locus_tag="Ilyop_0442"
FT   CDS_pept        504070..504375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0442"
FT                   /product="cysteine-rich small domain protein"
FT                   /note="COGs: COG2158 Uncharacterized protein containing a
FT                   Zn-finger-like domain; InterPro IPR007212:IPR013032; KEGG:
FT                   aoe:Clos_2205 hypothetical protein; PFAM: cysteine-rich
FT                   small domain; SPTR: C6JKQ1 Putative uncharacterized
FT                   protein; PFAM: Cysteine-rich small domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82230"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB79"
FT                   /protein_id="ADO82230.1"
FT                   /translation="MFESDGFNYKFVQNSKCEYFPCHDIKDKEKFNCLFCYCPLYMMGE
FT                   ECGGNFKYTEHGIKDCSKCVLPHIKDVGYDHVQEKMMTVIDMVKDEYLIKKVKNGG"
FT   gene            complement(504395..505651)
FT                   /locus_tag="Ilyop_0443"
FT   CDS_pept        complement(504395..505651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0443"
FT                   /product="glutamate 2,3-aminomutase"
FT                   /EC_number="5.4.3.-"
FT                   /EC_number="5.4.3.2"
FT                   /note="COGs: COG1509 Lysine 2 3-aminomutase; InterPro
FT                   IPR007197:IPR003739; KEGG: amt:Amet_2738 lysine
FT                   2,3-aminomutase YodO family protein; PFAM: Radical SAM
FT                   domain protein; PRIAM: Lysine 2,3-aminomutase; SPTR: A6TRS1
FT                   Lysine 2,3-aminomutase YodO family protein; TIGRFAM: lysine
FT                   2,3-aminomutase YodO family protein; PFAM:
FT                   Lysine-2,3-aminomutase; Radical SAM superfamily; TIGRFAM:
FT                   KamA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82231"
FT                   /db_xref="GOA:E3HB80"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="InterPro:IPR030801"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB80"
FT                   /protein_id="ADO82231.1"
FT                   /translation="MNKRREISLERAGELKSRIEDYLSVRDSIPTGFSEKVQEQYKKSK
FT                   EILMKHFGASEEQWNDYKWQLINRISDIETLSLIVNLTEKEKEEIKNVGATYRWAISPY
FT                   YAALIDPENKYDSIRLLSVPTGSEAAHPEGEVDPMGEEFTNPAGSITRRYPDRLIINTT
FT                   NECAMYCRHCQRRRNIGETDTHKSDAVIMESIDYIRNNPEIRDVLLTGGDVLCLSDKRL
FT                   EWILKELKSIPHVDYIRLGTRTLVTMPQRITDELVDMLKKYQPIYINTHFNHPKEITPE
FT                   VKEACDKLANGGISLGNQAVLLNGINNDKYVMRLLNHEMLKIRVRPYYIFHAKHVKGTL
FT                   HFNTSVDDGIEIMEYLRGYTSGMAIPTYIINAPKGQGKTPIMPQYLLSRSKNSVKIRTW
FT                   EGVVIDYENHPTIDIKEYL"
FT   gene            506050..506910
FT                   /locus_tag="Ilyop_0444"
FT   CDS_pept        506050..506910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0444"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="COGs: COG0130 Pseudouridine synthase; InterPro
FT                   IPR020103:IPR002501:IPR014780; KEGG: fnu:FN0635 tRNA
FT                   pseudouridine synthase B; PFAM: pseudouridylate synthase
FT                   TruB domain protein; SPTR: C3WAF1 tRNA pseudouridine
FT                   synthase B; TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   TruB family pseudouridylate synthase (N terminal domain);
FT                   TIGRFAM: tRNA pseudouridine 55 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82232"
FT                   /db_xref="GOA:E3HB81"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB81"
FT                   /protein_id="ADO82232.1"
FT                   /translation="MDGIINIDKSSGMTSFDVVRRLKRILKMKKIGHTGTLDPMATGIL
FT                   VICTGRATRLAQDIEGQRKTYIAGFELGYKTTTYDTEGEITHRTDKGAKREELEKALEN
FT                   FRGEIDQIPPMYSALKVNGKRLYELAREGKEVERKSRRVTIENLEILDFDGRKGTFTCT
FT                   VSKGTYIRSLIYDIGELLGTYGVMTSLRRTQVGEYTLDIAYTLEEIEDMMGKEDYSFSK
FT                   SIEESFLYPTIEISGEKNIKLFNNGNTLIYEKEDGRYRIYNDKKFLGLAEVKKCRLKGY
FT                   KYYNV"
FT   gene            506923..508728
FT                   /locus_tag="Ilyop_0445"
FT   CDS_pept        506923..508728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0445"
FT                   /product="GTP-binding protein TypA"
FT                   /note="COGs: COG1217 membrane GTPase involved in stress
FT                   response;
FT                   InterProIPR000795:IPR009000:IPR009022:IPR004161:IPR
FT                   000640:IPR005225:IPR006298; KEGG: lba:Lebu_0578 GTP-binding
FT                   protein TypA; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor G
FT                   domain protein; SPTR: C4C154 GTP-binding protein TypA/BipA;
FT                   TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: Elongation factor Tu domain 2; Elongation
FT                   factor G C-terminus; Elongation factor Tu GTP binding
FT                   domain; TIGRFAM: GTP-binding protein TypA/BipA; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82233"
FT                   /db_xref="GOA:E3HB82"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB82"
FT                   /protein_id="ADO82233.1"
FT                   /translation="MKVKNIAIIAHVDHGKTTLVDGMLRQSGVFGSHEVLSERVMDSND
FT                   LEKERGITIFSKNASLRFKDYKVNIVDTPGHADFGGEVQRILKMVDSVLLLVDAFEGVM
FT                   PQTKYVLKQALEHGLRPIVVVNKIDRPNSTPEEVVDSVFDLFVELGANDLQLEFPVVYA
FT                   SAKNGFAKYNLEDADENMQPLLETILEHVEDPEGDPEAPLQMLATNIAPDNYLGKLGTG
FT                   RIYNGVLSKNQEVTLIKRDGELINYKVTRIFGYEGLKRVEMEKAVAGDIVTIAGLEKID
FT                   IGETVADRENPMALPLIDIDEPTLAMTFMVSDSPFVGREGKFVTSRNIWDRLQKELEHN
FT                   VSMKVEETESADAFIVKGRGELQLSILIENMRREGFELQVAKPQVIFKEVDGVKCEPIE
FT                   LAIIDVADEFTGVVIEKLGIRKGEMINMVQGTDGYTRIEFKVPARGLIGFRNEFMTETR
FT                   GTGILNHSFYDYEAHRGEVPTRQRGVLISIDAGTTTAYSLGNLQDRGVLFAPPGQEVYA
FT                   GMIIGEHSRENDLTVNVTKGKQLTNMRASGSDATVKLAPPREFTLEQALEYIADDELVE
FT                   ITPESIRMRKKILDEGARKRSQRKG"
FT   gene            508733..509632
FT                   /locus_tag="Ilyop_0446"
FT   CDS_pept        508733..509632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0446"
FT                   /product="Ankyrin"
FT                   /note="InterPro IPR002110:IPR020683; KEGG: ankyrin repeat
FT                   protein; PFAM: Ankyrin; SPTR: C3WAF3 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82234"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB83"
FT                   /protein_id="ADO82234.1"
FT                   /translation="MKKIVFMLLTILILIGCSNRQTDGGIDIDNVKVTPEDVYTSIFLD
FT                   DSDSVKLFLDNGFPINYKDELGETLLIKAVKGNSKNVINLLALRGALLEERTFSKSRKN
FT                   TNITVPGRTAIYFAENLDILNLLVDNGANVNFVNGEGEPLLIYFIKHKPDEYTKLLIKK
FT                   GAKVNSVDENMWTPLIWAVVNSKEEIVKELIIEDVDLFYRDSQGNYAVYYAFNKNIISL
FT                   LLEDGYRIKAENKDDETIMGEVYLKCVSNGYYDEVEKLLEMGIDVNYMSYGDSALSLAK
FT                   ENKDAKMTVLLKSRGAVE"
FT   sig_peptide     508733..508798
FT                   /locus_tag="Ilyop_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            509879..510502
FT                   /locus_tag="Ilyop_0447"
FT   CDS_pept        509879..510502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0447"
FT                   /product="Dak phosphatase"
FT                   /note="COGs: COG2376 Dihydroxyacetone kinase; InterPro
FT                   IPR004007; KEGG: ele:Elen_1228 Dak phosphatase; PFAM: Dak
FT                   phosphatase; SPTR: C5ESN5 Putative uncharacterized protein;
FT                   PFAM: DAK2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82235"
FT                   /db_xref="GOA:E3HB84"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB84"
FT                   /protein_id="ADO82235.1"
FT                   /translation="MILNKENFVDMLNSSCQLIDKNIDKLGNIDAKFGDGDHGVTMSKI
FT                   SNIIKKCINNWENESVYEFFENMGEEIMDVNGGSAGPLYGTFFQGLGEGIENSEEIDNK
FT                   VFKKMILSSLENMQMITKAKVGDKTMMDTLIPAAECAKKSSLELPECITEIADAACRGA
FT                   EKSKEFPSKFGRARFFKDETIGYMDAGAMSLSLIFMGFNEGIKK"
FT   gene            510520..511518
FT                   /locus_tag="Ilyop_0448"
FT   CDS_pept        510520..511518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0448"
FT                   /product="Glycerone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="COGs: COG2376 Dihydroxyacetone kinase; InterPro
FT                   IPR004006; KEGG: ele:Elen_1229 glycerone kinase; PFAM: Dak
FT                   kinase; PRIAM: Glycerone kinase; SPTR: C6JQS7 Putative
FT                   uncharacterized protein; PFAM: Dak1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82236"
FT                   /db_xref="GOA:E3HB85"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB85"
FT                   /protein_id="ADO82236.1"
FT                   /translation="MKMKKFINNPENLTQELLEGLALANKEILTLVEGHLVVSKDLETA
FT                   DRVTVVTLGGTGHEPALQGFVGKGMVDIAVCGDIFAAPGPDSCVKAIQMADKGHGVLFV
FT                   VLNHSGDMLTANLTMKKIKKMGINVAKVVTQEDISSAPREDADNRRGFVGCVPLYKIAG
FT                   GAALQGKSLEEVANVSQRYADNMAAISVSLRGATHPATGGPLAELDEEEMGVGMGQHGE
FT                   GGGEKIPMETADVTTDILMEKVLDDLKIKSGEKLMVVVNGSGATTLMEMLIVYRRAVKH
FT                   LEEKGIEVVGNMVGEILTVQETSGFQLFIARMDNELQSYWNEPCKTPYYSK"
FT   gene            511546..512418
FT                   /locus_tag="Ilyop_0449"
FT   CDS_pept        511546..512418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0449"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="COGs: COG1830 DhnA-type fructose-1 6-bisphosphate
FT                   aldolase; InterPro IPR002915:IPR013785; KEGG: sfu:Sfum_2464
FT                   aldolase; PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; SPTR:
FT                   C5EKT5 Aldolase; PFAM: DeoC/LacD family aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82237"
FT                   /db_xref="GOA:E3HB86"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB86"
FT                   /protein_id="ADO82237.1"
FT                   /translation="MADLEGNKVSKNFHLDKKSTLEGFHVKGLNHSDWGMKTRLSKIFN
FT                   EESGNSVILAFDHGYIMGPTSGLERLDIVVPPLLPHIDVLMATRGGLRSCISPACGKGI
FT                   ALRCTAGRSVLDDDLSNEFKVVDTEEVIRMNASCMAIQVFIGSKNQHENLKELNRAVNE
FT                   GTRYGIPTMGVVAVGKEMSRTKEYFLLATRMIAEFGAHIIKTYYCEGFEEVVAACPVPI
FT                   VVAGGKKIPEKDALNLTYMAIKAGARGVDMGRNIFQAENPVAMAEAVSLIVHKNYTDEE
FT                   AYEIYLKNK"
FT   gene            512457..512975
FT                   /locus_tag="Ilyop_0450"
FT   CDS_pept        512457..512975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A1605 hypothetical protein; SPTR:
FT                   A2SG78 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1097)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82238"
FT                   /db_xref="GOA:E3HB87"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB87"
FT                   /protein_id="ADO82238.1"
FT                   /translation="MTKKEYIVGPIIVAAIAMVVQVIDQTSVLNISSVGTGFGWVSFQA
FT                   WACYFLAGCTPKGAIRTFNSYLLGCIASIIIMILGGTLASILGFFGFPMAILICVVPVI
FT                   CLEKSGEWFDFVPGLFIGAGAFFGFMSYVPGASFLNATVTIMIYCILGLLAGYFTILFR
FT                   TKYEMVLSK"
FT   gene            512991..513305
FT                   /locus_tag="Ilyop_0451"
FT   CDS_pept        512991..513305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pdi:BDI_0628 hypothetical protein; SPTR:
FT                   C6JQS9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82239"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB88"
FT                   /protein_id="ADO82239.1"
FT                   /translation="MEILHVGVITNVPVDGEAYNDGLKVHLTDPENHPFKYEFLRFEDG
FT                   SPLHKRIQTEPHIAIKVDSIEEEVSKATEILSEEMDCGGMFIRFADIDGFIFEFTEFRN
FT                   "
FT   gene            513468..514412
FT                   /locus_tag="Ilyop_0452"
FT   CDS_pept        513468..514412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0452"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG2390 Transcriptional regulator contains
FT                   sigma factor-related N-terminal domain; InterPro IPR007324;
FT                   KEGG: kol:Kole_0940 transcriptional regulator, DeoR family;
FT                   PFAM: putative sugar-binding domain protein; SPTR: C6JPG9
FT                   Putative uncharacterized protein; PFAM: Putative
FT                   sugar-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82240"
FT                   /db_xref="GOA:E3HB89"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB89"
FT                   /protein_id="ADO82240.1"
FT                   /translation="MIYEIDKIKKIVDVARMYYEQNLTQNEIAKALSISRPSISKMLAE
FT                   AKNLGIVKITITSPLEQNEELLKNIKETFNLKGGIIVHGAASEKVNNAFITNESAIYIM
FT                   NKLTKSNKIGLGWGKMMNSIVKRISETSSVKTSGSICPLLGNSVTPYEEYHPDSLVRKL
FT                   GEKMGLKPFYIYSPTFFASKEEFEGFLNLENQKIINNLWNSLDIAILNIDNHPSVPDFA
FT                   TASRFGESLNTKKIIGHMISYYYNINGEILKSSSDYTNHISLSDLKNTETVIGVCSSDT
FT                   NVKAVIGALKTGLITHLIIDDELATKVLETISK"
FT   gene            complement(514479..514892)
FT                   /locus_tag="Ilyop_0453"
FT   CDS_pept        complement(514479..514892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0453"
FT                   /product="rare lipoprotein A"
FT                   /note="COGs: COG0797 Lipoprotein; InterPro
FT                   IPR009009:IPR005132:IPR012997; KEGG: vsp:VS_2124
FT                   lipoprotein A family protein; PFAM: Rare lipoprotein A;
FT                   SPTR: A3XZG2 Rare lipoprotein A; TIGRFAM: rare lipoprotein
FT                   A; PFAM: Rare lipoprotein A (RlpA)-like double-psi
FT                   beta-barrel; TIGRFAM: rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82241"
FT                   /db_xref="GOA:E3HB90"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB90"
FT                   /protein_id="ADO82241.1"
FT                   /translation="MKNKFNIFIILILLLISGCSAVSKKTEVYSKTHTLKGMASWYGKD
FT                   FHGRLTASGEKYNIRYYTAAHKSLPFGTIVRVTNLNNGKSVRVKINDRGPFVKGRVIDL
FT                   SPKAFKSIASLNSGVIPVKIEILDDSETFRYKS"
FT   sig_peptide     complement(514803..514892)
FT                   /locus_tag="Ilyop_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(514896..516230)
FT                   /locus_tag="Ilyop_0454"
FT   CDS_pept        complement(514896..516230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0454"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /EC_number="4.3.1.1"
FT                   /note="COGs: COG1027 Aspartate ammonia-lyase; InterPro
FT                   IPR000362:IPR008948:IPR020557; KEGG: pth:PTH_0981 aspartate
FT                   ammonia-lyase; PFAM: fumarate lyase; SPTR: A5D3M4 Aspartate
FT                   ammonia-lyase; PFAM: Lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82242"
FT                   /db_xref="GOA:E3HB91"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB91"
FT                   /protein_id="ADO82242.1"
FT                   /translation="MRIEKDGIGELEIPKTKYYGIHTQRAIDNFYLKNGKKTNPELIKS
FT                   FALVKLAAAEANFKAGKLDEDKKNYIVRACERVYNGELESEFPLSSIQGGAGTSTNMNA
FT                   NEVVANAALEEMGEEKGRYDLINPIEDVNLSQSTNDTYPTAVKITVIRILRELVTEAMA
FT                   LQEELQKKEKEFSPIFKLGRTQLQDAVPLTLGQSFGAFAEAVSRDRWRLYKIEERIRRI
FT                   NIGGTAIGTGIGASLKYRYYVTEELKRLTGYGLARAENLIDATQNLDVFVEISGLLKTM
FT                   AVNLNKISNDLRLMSSGPNGGIGEIKLPSIQMGSSIMPGKINPVGAEFIKQIFHKVQGN
FT                   DLIVSAAAAEGEFELNALTPIISESVLESIEVLRDGIKMFREKVIKGITADKERCEKHL
FT                   RASLSTITSHIDQLGYELLSEILKECEKTGKSYDELLKEKGLVKE"
FT   gene            complement(516246..517475)
FT                   /locus_tag="Ilyop_0455"
FT   CDS_pept        complement(516246..517475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0455"
FT                   /product="iron-only hydrogenase maturation protein HydF"
FT                   /note="COGs: COG1160 GTPase; InterPro IPR002917:IPR005225;
FT                   KEGG: tpd:Teth39_0245 small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; SPTR: C4BVH2 Iron-only
FT                   hydrogenase maturation protein HydF; TIGRFAM: small
FT                   GTP-binding protein; PFAM: GTPase of unknown function;
FT                   TIGRFAM: small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82243"
FT                   /db_xref="GOA:E3HB92"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB92"
FT                   /protein_id="ADO82243.1"
FT                   /translation="MSELNKTPSSSRLHIAIFGKRNMGKSTLINALTGQNLAIVSEYAG
FT                   TTTDPVYKAMEILPIGPCVIIDTAGLDDLGDLGELRVKKSLEVLKKTDIALLTVTGEGF
FT                   SDFDREIIKLLEEKNIPFITVINKKDIIPANSEFTEELKIKNIPYVAVSAQLKEEIHTL
FT                   KELIIKYSPKEFEQPTIVGDLINPGESIVLVIPVDTGMPKGRLILPQVQTMRDILDNDG
FT                   VFHVCKERELRWTLDKLKEKPKLVITDSQEFSKVSADTPDDILLTSFSILFARYKGDLM
FT                   KMVKGAKALKNLKAGDKVLMAEACTHHAQPDDIGKVKIPRWIRQNIENDLTFDFCAGRD
FT                   YPDNLSDYKLVIHCGGCTLNRKEMLSRIEVSSVQGVPVLNYGLCIATLHGILDRALKPF
FT                   PEVYFQWLED"
FT   gene            518267..518893
FT                   /locus_tag="Ilyop_0456"
FT   CDS_pept        518267..518893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0456"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: fnu:FN1162 hydroxyacylglutathione
FT                   hydrolase; SPTR: C3WCQ6 Hydroxyacylglutathione hydrolase;
FT                   PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82244"
FT                   /db_xref="GOA:E3HB93"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB93"
FT                   /protein_id="ADO82244.1"
FT                   /translation="MKIKTFYLGEMMSCAYLTWNEDTKEAFLFDCGGENLENLFAFLRA
FT                   NELTLKKVIFTHGHHDHIVGLKKLLQHVSDVEIYIGEEEEKFLTDANLNLSAFLGKSFT
FT                   YEGKVKTVKEGDMIGGFKVIDTPGHTVGSKCYYNSKEKIMLSGDTLFKRSYGRYDLPTG
FT                   NGEVLFVSLGKICNEYPGETKVYSGHTEVTTLGEEKVFLQMNGLI"
FT   gene            518957..519229
FT                   /locus_tag="Ilyop_0457"
FT   CDS_pept        518957..519229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0457"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845:IPR011991; KEGG: mca:MCA2535 ArsR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   ArsR; SMART: regulatory protein ArsR; SPTR: Q604K4
FT                   Transcriptional regulator, ArsR family; PFAM: Bacterial
FT                   regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82245"
FT                   /db_xref="GOA:E3HB94"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB94"
FT                   /protein_id="ADO82245.1"
FT                   /translation="MEIDKAVLLFKMMSNPIRLGILKELSEKGVLCVSMLEEAIGSSQS
FT                   STSQHLAHLRNSGILTCQKNGKKVCYTIADKNVEELIKQLKLEEN"
FT   gene            519291..520217
FT                   /locus_tag="Ilyop_0458"
FT   CDS_pept        519291..520217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0458"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR000103:IPR013027; KEGG: fnu:FN1163 thioredoxin
FT                   reductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: C3WCQ7
FT                   Thioredoxin reductase; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase; TIGRFAM: thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82246"
FT                   /db_xref="GOA:E3HB95"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB95"
FT                   /protein_id="ADO82246.1"
FT                   /translation="MEKIYDMIIIGGGPAGLTAAIYAGRAQLNVLVIEKRELGSLISAH
FT                   KIDNYPGFPDGITGRELYQLKKEHALKYNVNIVEGTFLELDIFSEPKIVKTDVENYHGK
FT                   SVIIASGWPKNSVKKIKGEQEFIGKGVSYCATCDGAFTRNLKVGLFGQGDEVAEEALFL
FT                   TRYSKEIFIFSKENSLKCNEELKNALLSHENVKIIPNSSIVEIKGNDYVEEVVVSRDGL
FT                   EESYSLDYTFLYLGTRSTEELFSGFAKLDPNGYIITGEDMKTEVDGVYAAGDIRSKAIR
FT                   QVTTAVADGTIASLEAAKYILKQKKES"
FT   gene            complement(520230..521021)
FT                   /locus_tag="Ilyop_0459"
FT   CDS_pept        complement(520230..521021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0459"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="COGs: COG0568 DNA-directed RNA polymerase sigma
FT                   subunit (sigma70/sigma32);
FT                   InterProIPR000943:IPR013325:IPR013324:IPR009042:IPR
FT                   007627:IPR007630:IPR011991:IPR014284; KEGG: tle:Tlet_1973
FT                   RpoD family RNA polymerase sigma factor; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 1.2; sigma-70
FT                   region 4 domain protein; SPTR: C6JPD1 RNA polymerase sigma
FT                   factor; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   Sigma-70 factor, region 1.2; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82247"
FT                   /db_xref="GOA:E3HB96"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB96"
FT                   /protein_id="ADO82247.1"
FT                   /translation="MNISNYLKEISHYPLLTKEEEIEFALKAQNGDESAHEKLVTSNLR
FT                   LVVSIAKKYINIGIPVLDLIQEGNIGLIKAVSKFDTTMDKRFSTYATFWIKQSILRYIS
FT                   SNKGVIRYPTYIYDNISKINKFIRDYKNKYGSVPSIEVIATGLEFKKKDVEKYLNIFEQ
FT                   SLNSLEESYGENGDLHSIIPSDDLFEEQIITDSVNEELISNLKILNSKERDVIIHRFGL
FT                   FNKNVLTLEEIGNHLNLTRERIRQIQLKAIDKLRDKFRYTM"
FT   gene            521164..521736
FT                   /locus_tag="Ilyop_0460"
FT   CDS_pept        521164..521736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0460"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="COGs: COG0817 Holliday junction resolvasome
FT                   endonuclease subunit; InterPro IPR002176:IPR012337; KEGG:
FT                   fnu:FN0214 crossover junction endodeoxyribonuclease RuvC;
FT                   PFAM: Crossover junction endodeoxyribonuclease RuvC; PRIAM:
FT                   Crossover junction endodeoxyribonuclease; SPTR: C6JPD0
FT                   Crossover junction endodeoxyribonuclease ruvC; TIGRFAM:
FT                   crossover junction endodeoxyribonuclease RuvC; PFAM:
FT                   Crossover junction endodeoxyribonuclease RuvC; TIGRFAM:
FT                   crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82248"
FT                   /db_xref="GOA:E3HB97"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB97"
FT                   /protein_id="ADO82248.1"
FT                   /translation="MRVLGIDPGTATVGYGIVDFKNNNYDTVTYGCIYTDKDLPMSKRL
FT                   EKIYDELYALIEEYKPAHMAVEELFYFKNNKTVISVGQARGVIILCGEKQGLCLDSYTP
FT                   LQVKMGITGYGKSEKKQVQIMVQKILKLNELPEPDDAADALAIAVTHINSLNSGCYSIS
FT                   DNKKICGKKIGSGKLTAKEYRELYNIK"
FT   gene            521760..523040
FT                   /locus_tag="Ilyop_0461"
FT   CDS_pept        521760..523040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0461"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003661:IPR003594:IPR004358:IPR009082:IPR 005467;
FT                   KEGG: tma:TM1359 sensor histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: histidine kinase A domain protein;
FT                   ATP-binding region ATPase domain protein; SPTR: Q9X180
FT                   Sensor protein; PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82249"
FT                   /db_xref="GOA:E3HB98"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB98"
FT                   /protein_id="ADO82249.1"
FT                   /translation="MWGKINYNLSRKTIIGKKLTNNEKDISHMIQEFESIEKMMSVIYS
FT                   EKNEGRVIFCILLLLIGKLDLGYVESYYFHYDEESKTLQYKEGYFNLDKIEEEELDEIY
FT                   DSLSDIIEVDQAPFLKEILEIGEPVYDIKKFTELTPYTFLSRLNNFSVIPVGYADKNYG
FT                   VLIMAGNKKLLKMGKRKRELVDIFKYNLSMYLYNRDLEKKELKDDRLKTIGYFANSIVH
FT                   EFKTPVSVIKGFATLAKNKLDDPEKLKIYLENIINESDRIIEMSDEVGEYAQTRNSLSI
FT                   EEEFYFQDVVKEIYKKFKNKFERLEIKPIFMEEKKILVKANKKTFSRTVCHILKNVAEN
FT                   VDYKKDNRYILFRFEEQDGRDVVVFEDNGCGIPEDNLSKVFSPFYTTKINGTGLGMTIV
FT                   KEYYEKIGMEIKLESVCGKYTKLTVIL"
FT   gene            523051..523503
FT                   /locus_tag="Ilyop_0462"
FT   CDS_pept        523051..523503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0462"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0219 rRNA methylase (SpoU class); InterPro
FT                   IPR001537:IPR016914; KEGG: fnu:FN0809 23S rRNA
FT                   methyltransferase; PFAM: tRNA/rRNA methyltransferase
FT                   (SpoU); SPTR: C3WCQ5 23S rRNA methyltransferase; PFAM: SpoU
FT                   rRNA Methylase family; TIGRFAM: rRNA methylase, putative,
FT                   group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82250"
FT                   /db_xref="GOA:E3HB99"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E3HB99"
FT                   /protein_id="ADO82250.1"
FT                   /translation="MNIVLLNPEIPYNTGNIGRSCVLTNTSLHLIKPMGFSLDEKQVKR
FT                   AGLDYWNSVDLHTWDSLEELIKANPDSNFYFATTKTKKKYSDVKYEKNDFIVFGPESRG
FT                   VPEEILEANKENCITIPMIKMGRSLNLSNSAAIILYEALRQTGFDF"
FT   gene            523594..523989
FT                   /locus_tag="Ilyop_0463"
FT   CDS_pept        523594..523989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0463"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG1607 Acyl-CoA hydrolase; InterPro
FT                   IPR006683; KEGG: mpt:Mpe_A0438 acyl-CoA hydrolase-like
FT                   protein; PFAM: thioesterase superfamily protein; SPTR:
FT                   A2SCW1 Acyl-CoA hydrolase-like protein; PFAM: Thioesterase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82251"
FT                   /db_xref="GOA:E3HBA0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBA0"
FT                   /protein_id="ADO82251.1"
FT                   /translation="MSMEYTGFQNEMEPALRLVAMPADTNPAGDVFGGWIMAQVDLAGA
FT                   VIASQRAQSRIVTIKVTDFVFKEPVYVGDLVTCYGKIEKIGNTSITVKVVVCAQRNRYE
FT                   KTCIKVTEATVVYVAIDEDGNPKEISK"
FT   gene            525161..526594
FT                   /locus_tag="Ilyop_0464"
FT   CDS_pept        525161..526594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0464"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG0531 Amino acid transporter; InterPro
FT                   IPR004841:IPR002293; KEGG: cps:CPS_2040 amino acid permease
FT                   family protein; PFAM: amino acid permease-associated
FT                   region; SPTR: B0MFB3 Putative uncharacterized protein;
FT                   PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82252"
FT                   /db_xref="GOA:E3HBA1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBA1"
FT                   /protein_id="ADO82252.1"
FT                   /translation="MTNQKLGLSSAISAGIGLIVATSCLVTLSQGVGFAGKGFIIALAI
FT                   ACGLNILVSFSFAELNGLMPVTGGLGQYTLAAMGPFVSMIAVIGGYIICGILAASSEAA
FT                   MIGFVVNSSILPNVSPLLITLISILFLFIINVFGIRSYARTQMITTVIMIGSMIIIGVM
FT                   GALKLGSGEVVTQANQAFNPMGFGVVSMTALAFWLFIGVEFVLPLTKDMKKPEKDIPRG
FT                   MILALLILMVVQSIMIFGISNYVPYEILQTSNQPHMDFARLLLGKVGTGWMTIISIGAV
FT                   VSTLNTILAGIPRMLLGMAEGGMLPKAFTKTNRYGVPYNGLFLITGGIVTALLTGITSA
FT                   DDLIIFILTGCLFWMASYIVAHLNVLVLRKRYPDAKRSFCVKLFGLPQIVGILGMIYMM
FT                   THIIDVPDLRNAIYSNAAILMMALVAYCFVWVKFVMKKGLFETISMEEVIAQDENSSDL
FT                   DLNNDPDYDDEKKLETVFS"
FT   sig_peptide     525161..525265
FT                   /locus_tag="Ilyop_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            526639..527775
FT                   /locus_tag="Ilyop_0465"
FT   CDS_pept        526639..527775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0465"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="COGs: COG2423 ornithine cyclodeaminase mu-crystallin
FT                   homolog; InterPro IPR016040:IPR003462; KEGG:
FT                   mmw:Mmwyl1_3168 ornithine cyclodeaminase; PFAM: ornithine
FT                   cyclodeaminase/mu-crystallin; SPTR: B0MFB2 Putative
FT                   uncharacterized protein; PFAM: Ornithine
FT                   cyclodeaminase/mu-crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82253"
FT                   /db_xref="GOA:E3HBA2"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBA2"
FT                   /protein_id="ADO82253.1"
FT                   /translation="MKDSKVDFIYLSEKDMIEAGVKDMGGCVDAMEEMFKLLKVGDFRM
FT                   GGSNGFSHGCMVTFPEESPFPNMPLDGPDRRFMAMPAYLGGQFDMAGAKWYGSNSDNRE
FT                   KGLPRSILMLTLNDKDTGAPVAHMSANVLSAYRTGAIPGVGVKYLAHENAKVCGIVGPG
FT                   VMGKTALASFIAVRPGIETVKIKGRSQGSIDSFVKYVKEEFPTVKNIEIVDDIESAVKD
FT                   ADVVCLATSATLGNLDEYPYVKEEWIKPGAVICCPASARFDEDFIVNKARTVVDCLHLY
FT                   EAWAEEYPYPTFHTIPIPACYNMDLLHEGKITKDDIHDLGDILMGTIPARRNDEEIIIY
FT                   SVGGMPVEDIAWGTIVYRNALKKGIGTKLNLWEKPELA"
FT   gene            527836..528144
FT                   /locus_tag="Ilyop_0466"
FT   CDS_pept        527836..528144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR001041; KEGG: ckl:CKL_2061 hypothetical
FT                   protein; SPTR: B0MFB1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82254"
FT                   /db_xref="GOA:E3HBA3"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBA3"
FT                   /protein_id="ADO82254.1"
FT                   /translation="MRIEEHPVLGKIEKGELVDFTMDGKPLKGHEGEPISAALKAAGVM
FT                   VHRHTHKHSPRGVFCAIGRCTDCVMVVNGKANVRTCVTPLEQGMVVETQYGVSAKAK"
FT   gene            528360..529949
FT                   /locus_tag="Ilyop_0467"
FT   CDS_pept        528360..529949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0467"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR013027:IPR000103:IPR017896; KEGG: ckr:CKR_1805
FT                   hypothetical protein; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: B0MFB0 Putative
FT                   uncharacterized protein; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82255"
FT                   /db_xref="GOA:E3HBA4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBA4"
FT                   /protein_id="ADO82255.1"
FT                   /translation="MKRYDLIVVGAGPAGLSAAIEAAKRGLEVAVFDENSKPGGQLFKQ
FT                   IHKFFGSKEHKAKIRGFKIGDELLETANELGVKVVLNAIVIGIYSEKEITVNIDDEIIH
FT                   YKADSIIVATGASENMVTFDGWTLPGVIGAGAAQTMMNLHGVKPGKKILMLGSGNVGLV
FT                   VSYQLLQAGCEVVAVVDAAPKIGGYGVHAAKIARCGVPFYLSHTIIKAEGDDCINGVVV
FT                   GEVDSKWQIVEGTEKHFDVDTICLAVGLSPISQLLKMAGCEMIEDPKKGGLVPVCDNYG
FT                   ATSLPGIFVAGDVSGIEEASSAMIEGRIAGIAAAHALGYIEKEELIKEAEELESSLISL
FT                   RQGMFAPENRGKDILKTDEGFDVSNNLLRKGYLTDDEVTKYPGVKSVSGVHPIIECSQN
FT                   IPCNPCQDACPKGCIKIGSDITTLPAFDESTKCTGCGLCVVSCSGQSIFLIDEDKEKGY
FT                   THITMPYEFLPLPEKGDKGKALDRSGKPICEAEVVGVRTSKNFDQTSLLTIKVTDDMGM
FT                   KARFFKQLQEVK"
FT   sig_peptide     528360..528425
FT                   /locus_tag="Ilyop_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            529951..530274
FT                   /locus_tag="Ilyop_0468"
FT   CDS_pept        529951..530274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0468"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="InterPro IPR007419; KEGG: ckr:CKR_1803 hypothetical
FT                   protein; PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; SPTR: B0MFA9 Putative uncharacterized protein;
FT                   PFAM: BFD-like [2Fe-2S] binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82256"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBA5"
FT                   /protein_id="ADO82256.1"
FT                   /translation="MSKINDRSKDIGKFIPQADDDTIICRCEEVTKGEIRQAIHAGMFT
FT                   LQEVRKYLRTGMGLCQGQTCGKLVKKIISQELGISPLELESAVSRAPMRPIEMKVLGNE
FT                   RKG"
FT   gene            530279..531406
FT                   /locus_tag="Ilyop_0469"
FT   CDS_pept        530279..531406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0469"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0665 Glycine/D-amino acid oxidase
FT                   (deaminating); InterPro IPR006076; KEGG: drm:Dred_1730 FAD
FT                   dependent oxidoreductase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: B0MFA8 Putative uncharacterized
FT                   protein; PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82257"
FT                   /db_xref="GOA:E3HBA6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBA6"
FT                   /protein_id="ADO82257.1"
FT                   /translation="MINKADVIIIGSGVIGNATAYNLAKAGKSVIVLEKDESIGDGGST
FT                   RNGGGVRQSGRHSAELPLAMYGVKNLWPNLSEELGVDVEYYQEGNLRLGKTEEHLKVLQ
FT                   GIVDRSKALGLDLKMVEGDEAREICPYLSDEVIGASWCPTDGHANPMLVTLGYYKKARE
FT                   LGACFITGEEVVEIKKIKGKARQVVTKENIYEGDKIILAAGYGSRKIAETVGVDVPMNP
FT                   ILMEVLVTEAQSPMFYQMLGTAEADFYGHQSTHGSFVFGGTSGHEAFNKDGGIHATNSK
FT                   TASAVCRGIMKYFPDLGDLKIIRTWAGHLDYCVDGIPVMSHVEEVPGLILACAFSGHGF
FT                   GIAPTVGMLLSEMAMDKETTLDVTPFRYDRFKAKI"
FT   gene            531441..531833
FT                   /locus_tag="Ilyop_0470"
FT   CDS_pept        531441..531833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0470"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="COGs: COG0251 Putative translation initiation
FT                   inhibitor yjgF family; InterPro IPR013813:IPR006175; KEGG:
FT                   syf:Synpcc7942_2408 hypothetical protein; PFAM:
FT                   Endoribonuclease L-PSP; SPTR: Q31KI1 Putative
FT                   uncharacterized protein; PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82258"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBA7"
FT                   /protein_id="ADO82258.1"
FT                   /translation="MEMVRTNYSSGAPLEEKAGYSRMVTVGPFVYLGGTTSVKPDGTVH
FT                   GEDDPYEQTKFIFDKLLKIMEKADSGAENVVKVKAYVTDMKYAPEVARAYSEYFLNIKP
FT                   LFTMVGTTMLNRPTQLVEIEMDAIKY"
FT   gene            531967..533115
FT                   /locus_tag="Ilyop_0471"
FT   CDS_pept        531967..533115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0471"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018211; KEGG: drt:Dret_1261
FT                   iron-containing alcohol dehydrogenase; PFAM:
FT                   iron-containing alcohol dehydrogenase; SPTR: C6QU71
FT                   Iron-containing alcohol dehydrogenase; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82259"
FT                   /db_xref="GOA:E3HBA8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBA8"
FT                   /protein_id="ADO82259.1"
FT                   /translation="MNFIFDIPATVFFGDNKIVETGNLLKGFGTTKTMIVCDKAMLDLG
FT                   FVDKVISSLEEENIEYVIFDSVMPNPTDVLMHEGAKIAEEKNINSFVAIGGGSVMDSAK
FT                   AINILLTNKGKIADYEGINKVAISTLPLIMIPTTSGTASEVTSVSVVTDTKRHKKMVIA
FT                   GQFVGGNIALCDPSLTMKLPKGITASTGMDALTHAIEAYVSKWASPVTDAMALKSIKLI
FT                   MESLEEAVLKSSKISREKMMLGSVTAGMAFNSALLGLVHSLAHPLSAHYDIAHGVANAI
FT                   FLPYVVEYNIETFGDKLKPLAESMGIEIGGLDEKTLADSVVNKLIDLSETIKIPKLKSL
FT                   NIPKEDFKMLAEEAMLEMSTMTNPKETNVDDLIMIIEKAYLR"
FT   gene            533424..534602
FT                   /locus_tag="Ilyop_0472"
FT   CDS_pept        533424..534602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0472"
FT                   /product="transcriptional regulator, PucR family"
FT                   /note="COGs: COG2508 Regulator of polyketide synthase
FT                   expression; InterPro IPR012914; KEGG: cbe:Cbei_1935 PucR
FT                   family transcriptional regulator; PFAM: purine catabolism
FT                   PurC domain protein; SPTR: C4IJY1 Transcriptional
FT                   regulator, PucR family; PFAM: Purine catabolism regulatory
FT                   protein-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82260"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBA9"
FT                   /protein_id="ADO82260.1"
FT                   /translation="MAIKLSELYKSTSRKNMKLIAGKNGINNIVTWAHMIESIETSIFL
FT                   DGKELAFITGIALEKVDIEEKLYELVEHTYKHKASGIVINTGPYIEKIPEDVIQFCNEN
FT                   NFPLFEVPWHTHLANLMKDFCYQITLSDKTTLELSSALNNAIFFPSQHELYIPYLESKG
FT                   FRTIWPYCVVLIEIFERDGITAVNSKKRIKLLRFIENILYSYERTIIYDVDAKITLAFA
FT                   NYTQEEIKNILDEIKKRCMEILKKDEKIYLCVGENTKNIQCIAKSARQAMDVLKLQRKK
FT                   EIYDKVSMYSDLGAYKLLLAIEDKEIIKKYFRETIEELVKNDELKGTDYLTVLESYLRN
FT                   SGSIKAVSEELFYHKNTVCYKLSKIEGILGCNLSYLDNRMTYRLALMIMDII"
FT   gene            534732..535463
FT                   /locus_tag="Ilyop_0473"
FT   CDS_pept        534732..535463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0473"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663:IPR011991; KEGG: gka:GK2275 GntR family
FT                   transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR: C3WCJ6
FT                   Transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82261"
FT                   /db_xref="GOA:E3HBB0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBB0"
FT                   /protein_id="ADO82261.1"
FT                   /translation="MIDRNSRTPIYVQIEKYFLELIQENKIKVGEQFPSETVLSKELGV
FT                   SRMTIRQAINSLVINGYLVRSRGKGTFVKERDTKKIELPLDKLRNFSKEVQKSGKEPVN
FT                   IVVVFKLTEAPLNISKILKIADGEKVFYMERLRCLGDVPAVLEQTYMRNDLFDDLTEDV
FT                   ILSSKYKYIQEKGYKIKESKREIMAEIPLENVASLLKLNRNEPVLKAKSITFLADGTPF
FT                   EYSEISYNQKKYKFTLIAEYD"
FT   gene            535602..536927
FT                   /locus_tag="Ilyop_0474"
FT   CDS_pept        535602..536927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0474"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="COGs: COG1486
FT                   Alpha-galactosidase/6-phospho-beta-glucosidase family 4 of
FT                   glycosyl hydrolase; InterPro
FT                   IPR001088:IPR015955:IPR016040:IPR019802; KEGG:
FT                   cbe:Cbei_4984 glycoside hydrolase family protein; PFAM:
FT                   glycoside hydrolase family 4; PRIAM:
FT                   6-phospho-beta-glucosidase; SPTR: C3WCK0 Glycoside
FT                   hydrolase; PFAM: Family 4 glycosyl hydrolase; Family 4
FT                   glycosyl hydrolase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82262"
FT                   /db_xref="GOA:E3HBB1"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBB1"
FT                   /protein_id="ADO82262.1"
FT                   /translation="MDKRFNIVLVGGGSTWTPGILKAICKKQKDFPLASIVLYDVDEER
FT                   QEVIGKFGEILFREEYPEAKFIYTTDKKVAFTDMDFVFCQMRTGGYPMRELDEKIPLSE
FT                   GVIGQETCGPGGFAYGMRSIRDMIELVNDVREMSPDAWILNYTNPAAIVADALNRVFPD
FT                   DKKILNICDQPVNLLRSYGRLLDMDPSEFEPVYFGLNHFGWFTHLYNKNGVDMAPKLKE
FT                   IITTGGFIPVDAEQRDQSWLDTYAMVRDMLVDFPEYLPNTYLQYYLYPDYKANKLDPNY
FT                   TRANEVMNGREKRVFQECRDAVNAGTTKLSDVVHNDAHGDMIVEVAEAIAFNKNKTYIV
FT                   IIQNNGLVENVPNDAMVEVAASLGINGPKPYGVGKVDTFYKAMIENQFAYERLTVEAYF
FT                   EGSYNKALKALTLNRTVVDAKKGRKILDKLIDANKDYWPKLV"
FT   gene            536952..538469
FT                   /locus_tag="Ilyop_0475"
FT   CDS_pept        536952..538469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0475"
FT                   /product="PTS system IIB component, Glc family; PTS system
FT                   IIC component, Glc family"
FT                   /note="COGs: COG1263 Phosphotransferase system IIC
FT                   components glucose/maltose/N-acetylglucosamine-specific;
FT                   InterProIPR001996:IPR003352:IPR018113:IPR013013:IPR 019775;
FT                   KEGG: cbl:CLK_3455 PTS system, maltose/glucose-specfic,
FT                   IIBC component; PFAM: phosphotransferase system EIIC;
FT                   Phosphotransferase system EIIB/cysteine, phosphorylation
FT                   site; SPTR: B1KTP1 PTS system, maltose/glucose-specfic,
FT                   IIBC component; PFAM: Phosphotransferase system, EIIC;
FT                   phosphotransferase system, EIIB; TIGRFAM: PTS system,
FT                   glucose-like IIB component; (TC 4.A.1)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82263"
FT                   /db_xref="GOA:E3HBB2"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBB2"
FT                   /protein_id="ADO82263.1"
FT                   /translation="MKDKVMKYLQDFGRSLMLPIALLAAVGILFGFTAALSRPQIKDML
FT                   PFLNGGGVAYVLFLIRTMSIKIFGLIPVLFAISISLGLAKKEKEIAALAGFVCYYTLMW
FT                   SSSYMVASNYISFPNSALGSALGLGGVPEMGAVGGMIAGTLTAYIHNKYYNINLPVAIA
FT                   FFGGKRFVAIGVIIVGSILGQILPFIWLPISNTIQFVGIGISNLGLFGTFLYGFLERLL
FT                   IPTGLHHILNGIFRTTAVGGELNGTVGVWNIFFEYFGKVDINELKEYTRFLSQGKIPYM
FT                   VFGLPAAALAMYKTAPEGKKKTTEALLIAGVLASMTTGITEPLEFTFLFIAPLLFVFHS
FT                   VMAGLSFLLMDLFSVGIGNTQGGLIDLLVYGTLVPGSNWIYPVIVGLGYSGIYYFTFKY
FT                   YFTKKGIIIDSGVESTEKSSTNISESKDEKTALIIDGLGGDSNIVSVDNCFTRLRLEVK
FT                   NSKDIDEVKLKSTGAAGIKIISETQVQVIYGPKVNIIASGVKDHLGY"
FT   sig_peptide     536952..537062
FT                   /locus_tag="Ilyop_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            538575..539729
FT                   /locus_tag="Ilyop_0476"
FT   CDS_pept        538575..539729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0476"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="COGs: COG1929 Glycerate kinase; InterPro
FT                   IPR004381:IPR018193; KEGG: bth:BT_1437 hypothetical
FT                   protein; PFAM: glycerate kinase; PRIAM: Glycerate kinase;
FT                   SPTR: C4BZY6 Glycerate kinase; TIGRFAM: glycerate kinase;
FT                   PFAM: Glycerate kinase family; TIGRFAM: glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82264"
FT                   /db_xref="GOA:E3HBB3"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBB3"
FT                   /protein_id="ADO82264.1"
FT                   /translation="MKVVIAVDSFKGSLSSLELGQLIENGIKKIYENAEVKKVPVADGG
FT                   EGTVDALVEGTKGQFVDVKVHDPFMRLIDAKYGIMGNNVAVIEMAEASGLPLLKPEERD
FT                   LRKATTYGTGELIKDAIEKGCREFIIGIGGSATNDAGLGMMQALGYKFLDKDGELLGYG
FT                   GEIMGKVAEIDSSGTMDGLNKCRFSVACDVDNPFYGPKGAAHVYSRQKGADDETVEYLD
FT                   LSLQKLALTLKEKTGKDISDIPGAGAAGGLGGGFVAFLDGELKPGIDIILQEVGLAESI
FT                   EGADFVITGEGRIDFQSVMGKAPMGVSKMSRDKGIPVIAIAGCVADDAGAMHDHGLDAF
FT                   FSTINYPVSLEEAMNKERAGTFVEKNVEEIFRLIKVCEIKYKSR"
FT   gene            539760..540263
FT                   /locus_tag="Ilyop_0477"
FT   CDS_pept        539760..540263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0477"
FT                   /product="PTS system IIA component, Glc family"
FT                   /EC_number="2.7.1.69"
FT                   /note="COGs: COG2190 Phosphotransferase system IIA
FT                   components; InterPro IPR011055:IPR001127; KEGG: fnu:FN0915
FT                   PTS system, N-acetylglucosamine-specific IIA component;
FT                   PFAM: sugar-specific permease EIIA 1 domain; SPTR: C6JKA0
FT                   PTS system; TIGRFAM: PTS system, glucose subfamily, IIA
FT                   subunit; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 1; TIGRFAM: PTS system,
FT                   glucose subfamily, IIA component; (TC 4.A.1)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82265"
FT                   /db_xref="GOA:E3HBB4"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBB4"
FT                   /protein_id="ADO82265.1"
FT                   /translation="MGLFNFFKKEKTIEDNWFDIYSPLNGKVINISEVPDEAFASKMIG
FT                   DGCAIEPYEGSIFSPVAAEINIFETNHAVSFEVENEIEMIVHFGIDTVNLKGNGFERIA
FT                   ESGLKVKIGEELVKYDIDFIKENAKSVRTPVIINNMDLVEELKIVANGDVKVGDLLMRV
FT                   KMKK"
FT   gene            540690..542117
FT                   /locus_tag="Ilyop_0478"
FT   CDS_pept        540690..542117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0478"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484:IPR018485; KEGG: spe:Spro_2464
FT                   carbohydrate kinase FGGY; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: C0C493 Putative uncharacterized protein;
FT                   PFAM: FGGY family of carbohydrate kinases, N-terminal
FT                   domain; FGGY family of carbohydrate kinases, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82266"
FT                   /db_xref="GOA:E3HBB5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBB5"
FT                   /protein_id="ADO82266.1"
FT                   /translation="MSKYIIGIDNGSQSTKVTIFDLEGNEVCYGSKTLKSLYTAEGGVA
FT                   LHPNDDLWDSVLGGLKDCLSKFTGNKNSILAIGLCTIRCCRVLLKKDGSLAYPVLSWMD
FT                   KRLSAPYVHDNDEVKYVTTTSGYLASRMTGEFKDTCSNLEVYWPIDRKTLDWSTDDQVI
FT                   KDNGLKRDQLFSIIKPGESYGSLKTELCREFGLKEGIQVVSSGNDKAVEVLGSGINDDK
FT                   SIMISLGTFISSMLLREDYFEDAKSFFPTLACVPFKYVYESKGIRRGMWTVSWYKDLLG
FT                   EEVIKKSKELGVSEEDYLNQIGETIPPGSDGLITLLDWLNNSDYEFRKGVMLGFDHRHT
FT                   SAHIYRSILEAISYNIKNNIYEMLDEIGAEIDNITVIGGGSKSNLMMKIIADMFGLPVK
FT                   RNKATSSACLGAAICAAKYLGIYKSFDEAMEKMVRVSEVFEPDKNLYKFYDEINTKVIK
FT                   NIRKHTDEILKITHSVF"
FT   gene            complement(542135..542998)
FT                   /locus_tag="Ilyop_0479"
FT   CDS_pept        complement(542135..542998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0479"
FT                   /product="UV-endonuclease UvdE"
FT                   /note="COGs: COG4294 UV damage repair endonuclease;
FT                   InterPro IPR001719:IPR013022:IPR004601; KEGG: pca:Pcar_1346
FT                   putative UV damage endonuclease; PFAM: UV-endonuclease
FT                   UvdE; SMART: AP endonuclease family 2; SPTR: Q3A4W2
FT                   UV-damage endonuclease; PFAM: UV-endonuclease UvdE;
FT                   TIGRFAM: UV damage endonuclease UvdE"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82267"
FT                   /db_xref="GOA:E3HBB6"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBB6"
FT                   /protein_id="ADO82267.1"
FT                   /translation="MKIGLVCMLKGRGMKKGFTGIKALEKLSQVEIDKKACEAALYNID
FT                   YTLECLKWVKNHGQGMFRVSSSLIPYNEFWNWKNFDSILEKLKILKKFAKDNNIRLIMH
FT                   PDQFTVLNSENNEVVHNSIKILNHHYEISELLGVEDIIIHVGSSKGDYKERFIKNTKLL
FT                   NKKLKAKILLENCHSVGIEDVIEICEKTGIRPCLDFHHDRIKPSSQSFENYIEKILNLS
FT                   KNKVPLAHISSPAGDEKNSYKSHSEYISTEDLIKFRKYFDLFDVEIEAKGKEKAVKKVV
FT                   DFFKKI"
FT   sig_peptide     complement(542930..542998)
FT                   /locus_tag="Ilyop_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            543198..543440
FT                   /locus_tag="Ilyop_0480"
FT   CDS_pept        543198..543440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpf:CPF_0107 hypothetical protein; SPTR:
FT                   Q93SG3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82268"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR023860"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:E3HBB7"
FT                   /protein_id="ADO82268.1"
FT                   /translation="MNERIATLSVFIEKKESVKKVNDILSEFSELIISRMGIPYREKRV
FT                   SVIVLILDGTNEDMSALSGRIGNLEGVSVKTAVKK"
FT   gene            543691..545106
FT                   /locus_tag="Ilyop_0481"
FT   CDS_pept        543691..545106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0481"
FT                   /product="iron-only hydrogenase maturation protein HydG"
FT                   /note="COGs: COG1060 Thiamine biosynthesis protein ThiH;
FT                   InterPro IPR006638:IPR007197:IPR010722:IPR013785; KEGG:
FT                   kol:Kole_0394 biotin and thiamin synthesis associated;
FT                   PFAM: biotin and thiamin synthesis associated; Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB; SPTR:
FT                   C4BVD1 Iron-only hydrogenase maturation protein HydG; PFAM:
FT                   Radical SAM superfamily; Biotin and Thiamin Synthesis
FT                   associated domain; TIGRFAM: thiazole biosynthesis protein
FT                   ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82269"
FT                   /db_xref="GOA:E3H5X9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5X9"
FT                   /protein_id="ADO82269.1"
FT                   /translation="MKKTWKDEVEEKSFINGELIETLLEKNNNPSDSEFDLVMEKAKRQ
FT                   ERLSIDDVSILLNSDQEDRVNKIFSLAKDIKERVYGNRVVLFAPLYIGNKCTNSCTYCG
FT                   FKVTNDIMRKSLSLDEVQHEVEALVDEGHKRVIMVYGTHPDYPAEYIKDTVKKAYTVKK
FT                   GKGEIRRVNINASPMDEEDYKIVKEAGIGTYQIFQETYHEETYKKVHPRGEKSNFKWRL
FT                   FGLSRAMKAGIDDVGIGALFGLYKWKFEVMGLMQHVEHLESNFGVGPHTISFPRLNEAT
FT                   GSKKDPEFIVGDMELKRIIAILRLAVPYTGLILTARENAELRRECMTLGVSQIDAGTQI
FT                   ELQGYSKKKEEQDLSKEQFKIGDTRSLDEVMGELMSSGFTPSFCTACYRLGRTGEHFME
FT                   FSKPGFIHHFCTPNAILTLAEYLEDYAGEETKAVGYSLIFEQIEKSELLPEVKETLKLK
FT                   LEKVKKGERDLYY"
FT   gene            545109..545585
FT                   /locus_tag="Ilyop_0482"
FT   CDS_pept        545109..545585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0482"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="COGs: COG0262 Dihydrofolate reductase; InterPro
FT                   IPR012259:IPR001796:IPR017925; KEGG: bcb:BCB4264_A2220
FT                   dihydrofolate reductase; PFAM: dihydrofolate reductase
FT                   region; PRIAM: Dihydrofolate reductase; SPTR: C1SJK6
FT                   Dihydrofolate reductase; PFAM: Dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82270"
FT                   /db_xref="GOA:E3H5Y0"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Y0"
FT                   /protein_id="ADO82270.1"
FT                   /translation="MISLIVAFDENRVIGKNNKLPWNIPEDMEKFKKATMGNIIIMGRN
FT                   TFEGIGRPLPGRINIVITKDESFHYKGVEVFHSVEEALEEALKLGKEVFFIGGESIYRQ
FT                   VADLVDKFYISYIHGKYDGDSYFPEISLSNFQIIKEEIYDDFIYKEYEKNTLAL"
FT   gene            545840..547162
FT                   /locus_tag="Ilyop_0483"
FT   CDS_pept        545840..547162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0483"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="COGs: COG2067 Long-chain fatty acid transport
FT                   protein; InterPro IPR005017; KEGG: lba:Lebu_1782 membrane
FT                   protein involved in aromatic hydrocarbon degradation; PFAM:
FT                   membrane protein involved in aromatic hydrocarbon
FT                   degradation; SPTR: C6JK47 Outer membrane protein P1; PFAM:
FT                   Outer membrane protein transport protein (OMPP1/FadL/TodX)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82271"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Y1"
FT                   /protein_id="ADO82271.1"
FT                   /translation="MKIIKLTTGILGILFSTVSFGASIDHVQNLSMEYNANPAQQGAIS
FT                   PGSSPYFNPAGLMQLENGNYFGVGLQLAIGEEKMEYDGKEYKADLLEPMPNVSFVSKND
FT                   ERAWYWTLGGIGGGGDLEYEDGVAGIGFLTDLEVSGMSPVTSVNDNYAEGSNKYIQSTL
FT                   GRAWFVTDKISVSAAGRVVYGMRSLVAEADLTLLNGDDESISIDSERTAWGYGGQFGMN
FT                   YKATEKLNIGMRYDTRIVMEFEADADETYVNSYLGSVFDSIPNLGNGDGYFGISDFYPE
FT                   YADGVKMRRDLPAVAAIGASYAVNDRWNLYAGGNYYFNKDADMDREVEEANSNYENGWE
FT                   LAAGSEYWLNNKWAWLIGVNYAYTGAPEETYDDVEYALNSIMLGTGFKYRQSETTEWVV
FT                   SVANYWYEGNEGIYSEDYGTEENQKYDKSIVSVGVGLTKKF"
FT   sig_peptide     545840..545902
FT                   /locus_tag="Ilyop_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            547969..548562
FT                   /locus_tag="Ilyop_0484"
FT   CDS_pept        547969..548562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0484"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR009057:IPR001647:IPR012287; KEGG:
FT                   fnu:FN1004 TetR family transcriptional regulator; PFAM:
FT                   regulatory protein TetR; SPTR: C6JK46 TetR family
FT                   transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82272"
FT                   /db_xref="GOA:E3H5Y2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Y2"
FT                   /protein_id="ADO82272.1"
FT                   /translation="MPKKAIFTKDHILNKAFEMLEKKGLEEITARNLAKALKSSPAPIY
FT                   GFFKSMDDLKKELIERSKSVFMEYVKNQNTELPLLNIGMGIVTFAREEKQLFRSIFLRE
FT                   KSYQGLIQEFKELVEEEITADNRFMGLPKEVKETLFLDCWTYAHGMATLTCTGYFENPS
FT                   DEFIKDRLMQSAAGIIYRRLEEAPELENFFKDQG"
FT   gene            complement(548633..551212)
FT                   /locus_tag="Ilyop_0485"
FT   CDS_pept        complement(548633..551212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0485"
FT                   /product="exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /note="COGs: COG0608 Single-stranded DNA-specific
FT                   exonuclease; InterPro IPR001667:IPR003156:IPR004610; KEGG:
FT                   fnu:FN0374 single-stranded-DNA-specific exonuclease RecJ;
FT                   PFAM: phosphoesterase RecJ domain protein; phosphoesterase
FT                   DHHA1; SPTR: C6JNX8 Single-stranded-DNA-specific
FT                   exonuclease recJ; TIGRFAM: single-stranded-DNA-specific
FT                   exonuclease RecJ; PFAM: DHH family; DHHA1 domain; TIGRFAM:
FT                   single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82273"
FT                   /db_xref="GOA:E3H5Y3"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Y3"
FT                   /protein_id="ADO82273.1"
FT                   /translation="MNNTKWIYKGDYLHENSSLPIDRDILNILYNRGIKDEKEINRFLY
FT                   SSIEDIRDPMTLADMDLAVNRILKAKEKQEEIWIYGDYDVDGITSTSMCFMALRDIGLN
FT                   VRYYIPLRDEGYGLNKEALSYIKNEGGDVIITVDCGISSIEEIEHANKIGLNVIITDHH
FT                   EINNALPSAYAVINPKREDNVYPFKFLAGVGTAFMFLYAIYRKMGIGEKMHQYLDIVAI
FT                   GTIADIVPLVEENRIFSKFGLKLLENTKHLGLRTLLGFLYPEYETKVFNTYDVGFVIAP
FT                   VFNAAGRLEDAKIGVELFVSDSKKESREISQNLMGKNNERKEIQSEILDLVEKNISEES
FT                   LDMKNVIVVASKDFHHGVIGIVASKIVDKYYKPTIIMEIKEKENIAVASCRSIDNFSMI
FT                   DALNTMPDIFLKYGGHDGAAGFSIPADKIQEFSDRINSYAGSILDESDFQKPVKIEKEI
FT                   LFHKISYEFLDKLRLLEPFGFGNPTPIFSIKNCLFKDLRMIGKDKNHMMFTILKDGNEI
FT                   KNCVWFSSGHNFQEIAHMREIDVAFKLKQEIFKDRYMNKIYIEDLNPSQNERNYLKESI
FT                   AIYDTVFPMEAVIYSRREPSDKDVYLSFSDGVELIQERRVAGFIDYQTAAVLKRLKYSY
FT                   NFNFITEIKKVVKKPENYNIHLNIKRDYSFSTLAYKKNEIFKEIKKFILGELNYNSIQK
FT                   KILSSVFKEGKRTLAITDPGRGIGAVIETIGIYNFISGKKLLLVTQGNIPEKLKNYTQV
FT                   SEKYLEGYDYYIFMNTTPGNEMKTLRENILVISHTDISIEGFHKIKDSYSLPQNIKILP
FT                   ESQLVKLYDIQKIFYTKKLPYKEKIEILKNIKNYTEIFSTKDILAFF"
FT   gene            551521..552033
FT                   /locus_tag="Ilyop_0486"
FT   CDS_pept        551521..552033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0486"
FT                   /product="AMMECR1 domain protein"
FT                   /note="COGs: COG2078 conserved hypothetical protein;
FT                   InterPro IPR002733; KEGG: dtu:Dtur_1016 AMMECR1 domain
FT                   protein; PFAM: AMMECR1 domain protein; SPTR: B8E1G8 AMMECR1
FT                   domain protein; PFAM: AMMECR1"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82274"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Y4"
FT                   /protein_id="ADO82274.1"
FT                   /translation="MYKTKSIYTQVALSSIMENFAKEEKILSIPDELKVKAACFVTLHK
FT                   INGELRGCIGTLEPFRENLYEEIWGNAKSAAYDDPRFPPLREYELEEIEISVDVLEKAE
FT                   KIDKIEKLDPKIYGVIVSSRGRRGVLLPDIEGVDSPEKQVSIAREKGGILPGENADIYR
FT                   FQVKRYH"
FT   gene            552045..553058
FT                   /locus_tag="Ilyop_0487"
FT   CDS_pept        552045..553058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0487"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR006638:IPR007197:IPR016431; KEGG:
FT                   tte:TTE1955 pyruvate-formate lyase-activating enzyme; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Q8R8P0 Pyruvate-formate lyase-activating
FT                   enzyme; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82275"
FT                   /db_xref="GOA:E3H5Y5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Y5"
FT                   /protein_id="ADO82275.1"
FT                   /translation="MKKALFYNSEGENIRCFLCPHNCLIGEGNYGICNMRKNIEGELYT
FT                   MNYGISSAVSLDPVEKKPMYHFYPGSKVLSVGSIGCNLKCKYCQNYTIAQGKFEEFEGY
FT                   TEGLSPEGIAGEAVRLKENGNIGVAYTYNEPIIWYEFMYDISKVIKSRGMKNIMVSNGF
FT                   INPEPLEKLLETIDAFSIDLKGFTDEFYKKITGSRLEPVKRTLETIAASDRHLEVEYLV
FT                   IPGHNDDKKKFSEMLDWYEKSLGKDVPLHINRYFPMYKMTEPATPMKTLKELYEMAKNK
FT                   LDYVYLGNTESDLGSDTYCPNCGSLIVKRSGYFSEDLGSKNGKCKKCGLKIRGEGL"
FT   gene            553055..553888
FT                   /locus_tag="Ilyop_0488"
FT   CDS_pept        553055..553888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0488"
FT                   /product="protein of unknown function DUF52"
FT                   /note="COGs: COG1355 dioxygenase; InterPro IPR002737; KEGG:
FT                   mma:MM_1761 hypothetical protein; PFAM: protein of unknown
FT                   function DUF52; SPTR: Q8PW40 UPF0103 protein MM_1761; PFAM:
FT                   Memo-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82276"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Y6"
FT                   /protein_id="ADO82276.1"
FT                   /translation="MTVRKCGVAGSFYPNSPEEIKEIFEEALQKESDNIKTELKNKNII
FT                   GGVSPHAGYVYCVREAVHLFEILREKGEKYDTVVLVNPNHTGYGEAVSIDSNKAWETPF
FT                   GSIELDSEFGDELSFPVEPMAQRFEHSGEVMLPYLYYFIKKGFKILPICMMRQDLKTAK
FT                   NIAEKIKNASEKLNRKILILISSDFTHFHSSEEGAKLDSYAIESLLKMDSGEFQDRILE
FT                   KDISICGMGPIMVLLEYSKMILKNPKLEILKRGHSGEVYPSDEVVDYVSILVYEE"
FT   gene            complement(553932..554549)
FT                   /locus_tag="Ilyop_0489"
FT   CDS_pept        complement(553932..554549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0489"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: cbe:Cbei_4210 hypothetical
FT                   protein; SPTR: A6M140 Putative uncharacterized protein;
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82277"
FT                   /db_xref="GOA:E3H5Y7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Y7"
FT                   /protein_id="ADO82277.1"
FT                   /translation="MKKNGFSLIELVVVIAITLVVLGIAGLSIKKAIERNDYQKIATFI
FT                   PKIIFTETNKAFEDGDEKEIEINLSSKYIKEGSNEIELPQNYSYSFFAVTKTDDDEMGD
FT                   SSKGETTELVTSDNVVFKIADDGTLTETYDNDGTLLKNGFYSKYHPSILVQKSDSSPFC
FT                   RIDIVSSSYIIPRVIVYKPLSDSMSFPDDMKDESMWEEDNFN"
FT   sig_peptide     complement(554454..554549)
FT                   /locus_tag="Ilyop_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            554733..555377
FT                   /locus_tag="Ilyop_0490"
FT   CDS_pept        554733..555377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: C6JJ35 Predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82278"
FT                   /db_xref="GOA:E3H5Y8"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Y8"
FT                   /protein_id="ADO82278.1"
FT                   /translation="MSKKKGTIMLEVVIAIVIFLIGILPIIGFTVKVLGQNRRTTEIEE
FT                   DTRVVTSVIDYIKSMGYDYVSDYVLSGVSTLDKEYVLEYEEAEDSYVVDTVKSTSDFET
FT                   DFWGEIYNEKSDEADALFLLESRGLDLEGAKLSIVINKTDLSMNENSYKNPVNNQTTTN
FT                   IIGYEGVIDDKILYGRVILEYTSTKDNSGETKEYGQNFLLTPVENWGHLYE"
FT   sig_peptide     554733..554837
FT                   /locus_tag="Ilyop_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            555370..556044
FT                   /locus_tag="Ilyop_0491"
FT   CDS_pept        555370..556044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0491"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: dth:DICTH_1047 prokaryotic
FT                   N-terminal methylation motif domain protein; SPTR: A9E590
FT                   Putative uncharacterized protein; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82279"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Y9"
FT                   /protein_id="ADO82279.1"
FT                   /translation="MNKRGFTVIEALVAVAVLAVVFLLSSPLIKGFGMVSRRVQMQKKV
FT                   DHKFSVVTKFMKSKVRSAKNSRDLSGYNDKLGYVGVFKKFKSKDVDDVDYYSEDYYEAK
FT                   DFFKELETDEKKSGPILFLEIPADSTSDSVNSKFVFFMFEKDKIKYRESKEFTESDETD
FT                   DTFTFDGNGWETIMDDVEDCSFKYREGIVTFFIDMDVDEFEGKIKDTVRDTVISRIDIN
FT                   SL"
FT   sig_peptide     555370..555462
FT                   /locus_tag="Ilyop_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            556058..557035
FT                   /locus_tag="Ilyop_0492"
FT   CDS_pept        556058..557035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msi:Msm_0232 signal peptidase I; SPTR: A6EMM9
FT                   TolB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82280"
FT                   /db_xref="GOA:E3H5Z0"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Z0"
FT                   /protein_id="ADO82280.1"
FT                   /translation="MKNFIFLKSVFPCRRNKSTKGEKNGSAIILSVMCLAFFLSMSLNI
FT                   YYTGAKKAESAIDKVTGEKITNNIDTASSIGYQELYLAENFVRKGFIYDDDHPSSFGDT
FT                   DSYAVPNEDGQSSYFNYGTGEYTSEYYGIQLNSFSEYFDSHWDYTLTDSSKQKTMISEN
FT                   IEEIKYTYNKAKDDKVYRVMERSWQSGGVPEKTQKLWKSTGSSYDEEKKVSIGGYRLTH
FT                   IILKDSSGTEKYNEDVTTTTTLKSDIEDILATGTVGDEYSIEATFEKTVVLAAYESDGD
FT                   VKIPEMSFDIIVNETIDLNTDDGLLLTDVEYENSAISMEINQVN"
FT   sig_peptide     556058..556222
FT                   /locus_tag="Ilyop_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(557107..558537)
FT                   /locus_tag="Ilyop_0493"
FT   CDS_pept        complement(557107..558537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sse:Ssed_2342 putative outer membrane adhesin
FT                   like proteiin; SPTR: A8FVS8 Putative outer membrane adhesin
FT                   like proteiin"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82281"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Z1"
FT                   /protein_id="ADO82281.1"
FT                   /translation="MKKAVFLIFIFIISLNSFGKRKVYLIVHKNTEVGSGNFFVSAMDT
FT                   SGNKITGITTTKTDGDEYDTVKISIDTDEEKIKVAAGYDWKGGEGYDDYYVLLANEAAD
FT                   GFEDVRDTIVENDSDGDYDYLDILNTSYYSAYSSFPGVEVTSDMRFFAVPVRDDSSNIS
FT                   SNIIEEIPFPAPFTIENGKIITTDKYTGTAKVIASEYTQSNISGAVTVTDKDGNSKIKE
FT                   WKESDDFKTEFDSYYSSNGEYTNWTPGESVSSTTSSDGKVVTNSVTGKNASTGDYSLLG
FT                   ILSVSLSGDAGDVITVYSRQGSGTQKWSGNEDQIIDSDSSTHSGEYIFVKKDGDTILPI
FT                   PGLNDQTSYIDFVQDEDDEDIALEVPEDQDADNPDYYNITMGSNDALILFEHGGNYSST
FT                   ASYSDMQDFVVLIKLYSNSSESATMTFITDEGVEVDSATSMITNSPESDRQRNSDIGIK
FT                   IMDVSDGDNSFKIKRISK"
FT   sig_peptide     complement(558412..558537)
FT                   /locus_tag="Ilyop_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(558681..560573)
FT                   /locus_tag="Ilyop_0494"
FT   CDS_pept        complement(558681..560573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0494"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="COGs: COG0741 Soluble lytic murein transglycosylase
FT                   and related regulatory protein (some contain LysM/invasin
FT                   domains);
FT                   InterProIPR019734:IPR011716:IPR008258:IPR013026:IPR
FT                   000189:IPR011990; KEGG: gur:Gura_2700 lytic
FT                   transglycosylase, catalytic; PFAM: Lytic transglycosylase
FT                   catalytic; Tetratricopeptide TPR_3; SPTR: C3WCZ8 Predicted
FT                   protein; PFAM: Transglycosylase SLT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82282"
FT                   /db_xref="GOA:E3H5Z2"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Z2"
FT                   /protein_id="ADO82282.1"
FT                   /translation="MKKILFFIILAINSLISFAADDVNIKDYKIFASGKNFLSQNNYKD
FT                   ALTQFELLSEKYPESLLFKSNYANYYIGITYYNLGDYDNARNFLERAIYTPKDFKAEDP
FT                   YFQKSKKHLFEYKRNYYLAKIYLEQGLKDEALKHFKFLVKNYYSKELETYEKMALKELE
FT                   KHDPYFEILYMVKYENALPILLSLKNEDILALGDFFLSKGSYQSAEKVYSEYLNLEKKD
FT                   VHQVKLSLLETLKRSKKYDVLLEKSSDFITLSDNSDFYYYLALAQMQLGKKSDAEQTFS
FT                   KVKTGKYKKAASISIARILSSRREYKKAISILKSIKSSYANNLLMETYIKAGMTEEFKK
FT                   ASVNYIKKYPYSDQAAYYRFLLYKESQNPNYLNWIIKYNINTYYYELAYSIMENMRNLE
FT                   AYPLNYKSRIYREKVQRLESLAELKDGEILKIEIENMDFPEKDRVFREYLMSSIYEKGG
FT                   FYLSAVLKSRKYQNDFSKYSNLITFLYPRYYDFMVKKAAKKYNIEEALIYSVILQESVF
FT                   EPSLISKAGATGLMQIMLSTAKDMDPDITQEKLLAPDINIELGSRYLKSLLTKFDGNIP
FT                   KTVAAYNAGAGNVVKWKSDKKGDLDIEKIPFSETKKYVKRVINNYYKYKRIYHY"
FT   sig_peptide     complement(560517..560573)
FT                   /locus_tag="Ilyop_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            560925..562826
FT                   /locus_tag="Ilyop_0495"
FT   CDS_pept        560925..562826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0495"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="COGs: COG0323 DNA mismatch repair enzyme (predicted
FT                   ATPase);
FT                   InterProIPR003594:IPR020568:IPR013507:IPR014790:IPR
FT                   014762:IPR014763; KEGG: lba:Lebu_0138 DNA mismatch repair
FT                   protein MutL; PFAM: MutL dimerisation; DNA mismatch repair
FT                   protein domain protein; ATP-binding region ATPase domain
FT                   protein; SPTR: C3WCZ9 DNA mismatch repair protein mutL;
FT                   TIGRFAM: DNA mismatch repair protein MutL; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; MutL C
FT                   terminal dimerisation domain; DNA mismatch repair protein,
FT                   C-terminal domain; TIGRFAM: DNA mismatch repair protein
FT                   MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82283"
FT                   /db_xref="GOA:E3H5Z3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Z3"
FT                   /protein_id="ADO82283.1"
FT                   /translation="MGVIKILDESVSNIIAAGEVVENPASMIKEILENSLDAKSTNIRI
FT                   QVKNSGRDVTISDNGVGMSKDDLLLCIERHATSKIFNKEDIFNLYTYGFRGEALASIAS
FT                   VSKMRITSKRESDELGTEIKALAGKVTKVSPVSVNEGTEIEIKELFYNTPARLKFLRKK
FT                   STEYGKIKETVLKESLANPNVGFSLEIDGRELLKTSGKGIQNTILELFGRNVLKNLKEF
FT                   PLGFLGNLEITRSSKDYMHTYVNGRYVKSQILEKAIIDGYYTKLTKGRYPFAIIFLEID
FT                   PKEIDVNVHPSKKIVKFSESSFVYNQVFSEIEKAIGEDEDIVSLEMSFQNREKNVENFL
FT                   DLDEFKGIIDKEISTPKKTPDKEHSEKEKTEEKNNEKTVPSFKEEVIKTQEVSLLDGEG
FT                   VFQKKYSAEDKNIKNRPEVLQEEKKIYQSIDVSEKKPEIPEKTIEEKNYFRVIGQFMNS
FT                   YIIVERNKTLEIYDQHIVQERVLYETLKKRHFSREVATQNLLVPLKLRLSYEEKNIVFE
FT                   NLEIFNEFGFEIEDFGDDEVLLRGVPVFDFRTSIENTFRFMLEELKNETGVKDFREKII
FT                   ISMSCRNSIKAGEKLSFDEMELLIKRLHDVGKYTCPHGRPIILKVTLEELEKNFKRR"
FT   gene            562871..563341
FT                   /locus_tag="Ilyop_0496"
FT   CDS_pept        562871..563341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0496"
FT                   /product="protein of unknown function DUF163"
FT                   /note="COGs: COG1576 conserved hypothetical protein;
FT                   InterPro IPR003742; KEGG: fnu:FN0463 putative cytoplasmic
FT                   protein; PFAM: protein of unknown function DUF163; SPTR:
FT                   C3WD00 Putative uncharacterized protein; PFAM: Predicted
FT                   SPOUT methyltransferase; TIGRFAM: rRNA large subunit m3Psi
FT                   methyltransferase RlmH"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82284"
FT                   /db_xref="GOA:E3H5Z4"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Z4"
FT                   /protein_id="ADO82284.1"
FT                   /translation="MISVNLICVGKIKEKYIKNGIDEFLKRMSLYAKVKIIELKEDGND
FT                   SNRKQSLEKESMEIIKTAEKNKGYNVLLDIGGKNLSSEEMSKEIERLTVTGTSTINFII
FT                   GGSYGVSEEVRKISQMRLSFSKMTFPHQLMRLILMEQIYRWFSIFNNSKYHK"
FT   gene            563362..563769
FT                   /locus_tag="Ilyop_0497"
FT   CDS_pept        563362..563769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lba:Lebu_0136 hypothetical protein; SPTR:
FT                   C6JNY3 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82285"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Z5"
FT                   /protein_id="ADO82285.1"
FT                   /translation="MYAVGETFYYEIFDEEYELHVVGDIILSGKEYIIAEDFEGEKRAF
FT                   LFDENEEDIVLLEDDDAIEVIEHWEEEYFGTSSDIGDWDEDGYYDREDSVAISDDGDEE
FT                   SYISENYIEEEPVYDEYEEDVDSFITGLMGK"
FT   gene            563779..564147
FT                   /locus_tag="Ilyop_0498"
FT   CDS_pept        563779..564147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011038; KEGG: lba:Lebu_0135 hypothetical
FT                   protein; SPTR: C4C7Q4 Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF1934)"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82286"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Z6"
FT                   /protein_id="ADO82286.1"
FT                   /translation="MYLIIESRDSFGEKSSEKVSCQKEVTSKGIKYSYKNEHGDCKIFI
FT                   FKDMVQITRKGVINSAQIFKDGKTTFFHYQTPYTSTKFTLKTTEMKQKKEGLFLSYEIY
FT                   DGEEKVNDIEVAIKEVWN"
FT   gene            564231..565742
FT                   /locus_tag="Ilyop_0499"
FT   CDS_pept        564231..565742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0499"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR019734:IPR013026:IPR011990; KEGG:
FT                   fnu:FN0465 hypothetical protein; SPTR: C3WD03 Predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82287"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Z7"
FT                   /protein_id="ADO82287.1"
FT                   /translation="MKKYTIAAFIMAVFYLGALPYNKLYAMGSKKEKVLKEEVQDINPY
FT                   GGKSKKVDYKIVSEKINLNENNVSEVYKEIVKSINTAGVRRYPDSYRGEDYEILTGETL
FT                   NVSFPEPGEYKVEIIESPYLSRSSVVVKNQNIFFETGYQGEYILNVTKDGMFYKRFRVN
FT                   SKLKYSFTQEKNYDIILNSYENEKLDILLTSVKLSRVAFPDALYHKDTAFMILEKTLVS
FT                   KKMAEAEEAAKFIRNNFQLDFMEKKQLFYFDMEIAKDDPFKYRDFLEKNIHEPGFSDKL
FT                   VNIILSGKTLREKDELFLKKTYSETLNPEIAVYLGKWYMDKGNIIDAERYLIYGKEYYT
FT                   LCMLYLQNEDLDRFDATLSKVSEDKVHQLKKEREIYHRAKLIKKEVDLGDEKYQGENYE
FT                   EAVLFYKRAEEKDIEAARKLDTDMKIGMSYYYITRYEDAANYFEKAMESEKTPMKKAEI
FT                   AYLTGVCYYRMQDKEKSMKTFEKLAKDYPGTTWSKKAMVYIIRLR"
FT   sig_peptide     564231..564308
FT                   /locus_tag="Ilyop_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            565772..567256
FT                   /locus_tag="Ilyop_0500"
FT   CDS_pept        565772..567256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0500"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="COGs: COG1190 Lysyl-tRNA synthetase (class II);
FT                   InterProIPR018149:IPR016027:IPR004365:IPR004364:IPR
FT                   006195:IPR012340:IPR002313; KEGG: fnu:FN0466 lysyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (D K and N);
FT                   nucleic acid binding OB-fold tRNA/helicase-type; SPTR:
FT                   C6JNY6 Lysyl-tRNA synthetase; TIGRFAM: lysyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class II (D, K and N);
FT                   OB-fold nucleic acid binding domain; TIGRFAM: lysyl-tRNA
FT                   synthetase, eukaryotic and non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82288"
FT                   /db_xref="GOA:E3H5Z8"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Z8"
FT                   /protein_id="ADO82288.1"
FT                   /translation="MERYFDRVADDHVIMDKWEKVKEIKEAGLEPFGRKYDKKHMVGEL
FT                   LSHTLKEEDSTVFKTAGRIMACRGQGKAVFAHIEDETGRIQVYLRKDTLGDKVFEIVKK
FT                   MGTGDFVGVEGSLFVTKKGELTLRVAGFEFLSKNIRPLPEKYHGLTDVETRYRKRYLDL
FT                   VMNKEVKETFVKRIQIVNSVKTLLNSKGFMEVETPIMHPIVGGASAKPFVTHHNTLDMT
FT                   LYLRIAPELYLKRLIVGGFDKVYEINRSFRNEGISTRHNPEFTMMELYQAYADFNDMMD
FT                   LTEEIIMNAAKTINGTTTVEYNGKELVLENFKRVHMVDFVKEITGADFWGDVSVEDARL
FT                   LAKQNNVVLAPHMNTVGHIINEFFEQKCEEHIIQPTFVYGHPVEISPLAKRNADDHRFT
FT                   DRFELFIDAREYANAFSELNDPADQRGRLEAQLEEAMLGNEEANAEIDDDYIEALEYGM
FT                   PPTGGLGVGIDRLVMLLTGAPSIRDVILFPQMRKKD"
FT   gene            567289..568686
FT                   /locus_tag="Ilyop_0501"
FT   CDS_pept        567289..568686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0501"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: cyc:PCC7424_3092 diguanylate cyclase; PFAM: GGDEF
FT                   domain containing protein; SMART: GGDEF domain containing
FT                   protein; SPTR: B7KBD8 Diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain; TIGRFAM:
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82289"
FT                   /db_xref="GOA:E3H5Z9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E3H5Z9"
FT                   /protein_id="ADO82289.1"
FT                   /translation="MVEPYGFTIFFNSISNIFKKKNKFCNNCGNILTIQKNGYDSDSSK
FT                   GEIIINIDMRTILLSHSISDTVITLVLYFVWKQNKGRFEGISDWVMCFALQSVGITMIL
FT                   MRNLIPDFLSIVVANVLLIAGSVKFYFGTALFIDRKINKNFYFGLLGIFTLIYLYFGLV
FT                   EPKLTVRAVVFSLFVAFINIDAARILYKSDNKKMANNYRFTWALLLLISLLYLLMAGYY
FT                   IIGAAGVKFLKVGFVISLMTIISQMLLICITFSILVMINSRLVLGLEEESQKRDKILED
FT                   YKYLATVDGLTKLWNRKTIEGRLREEFDRSQRYRSKMSVILLDVDHFKKVNDNFGHPTG
FT                   DLVLEKISEILKNTLRKTDFIGRWGGEEFIVVCVETDQRAVWKVAEKLRQEIEHYNFGL
FT                   ESQVTISLGTATLDRGESLEDILKRADDNMYRAKKAGRNKTIPSLNSKEKFYEKLENDF
FT                   EICDLKV"
FT   gene            568750..569160
FT                   /locus_tag="Ilyop_0502"
FT   CDS_pept        568750..569160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ckr:CKR_P13 hypothetical protein; SPTR: B9E6F5
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82290"
FT                   /db_xref="InterPro:IPR035255"
FT                   /db_xref="UniProtKB/TrEMBL:E3H600"
FT                   /protein_id="ADO82290.1"
FT                   /translation="MLDKKYIGFLKELKSLKSSASNLLKSDSGEEFENIKCHEIIGYLK
FT                   VEIENALHEMELLSKTTLEGKLVLNSQGRFNLDTAQELYFTCGSPIELLIDGEWYRGRV
FT                   ESDGDDYYFYNYESENQTLEEGMKARIRVDRG"
FT   gene            569337..571130
FT                   /locus_tag="Ilyop_0503"
FT   CDS_pept        569337..571130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0503"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro
FT                   IPR006589:IPR017853:IPR006047:IPR013781; KEGG: gsu:GSU2636
FT                   alpha-amylase family protein; PFAM: alpha amylase catalytic
FT                   region; SMART: alpha amylase catalytic sub domain; SPTR:
FT                   Q749V6 Alpha-amylase family protein; PFAM: Alpha amylase,
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82291"
FT                   /db_xref="GOA:E3H601"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E3H601"
FT                   /protein_id="ADO82291.1"
FT                   /translation="MRSINEVNLKELAKDREYYKSPQNWEDEILYFLLVDRFSNGAEKD
FT                   LYRHTDYENVLCNEETKKIWEEFGDKWNGGNLKGIKSKISYLKNMGVTAIWISPVLRQV
FT                   AFEESYHGYGIQNFLDIDPHFGVKEDLKELVDEAHKNGIYVIMDIILNHTGNVFAYEET
FT                   ETVYNGSQFHVKAFRDKNGQPVIPLDNPPIDEIWPDGGVWPLELMNRETFTRKGHIINW
FT                   DVYPEYAEGDFYSLKNIYTGSGDYTEFNPSEALKILTECYKYWIAYADIDGFRLDTVKH
FT                   LEQGATRYFTTEIHEYSKTIGKNNFYIIGEITGGIEFAIETLEKTGLNAALGINKIPEK
FT                   LENITKGYADSVEFFDIFRNSNLLGENENTWYRDNVITMFDDHDMVIHRDQKHRFCADK
FT                   STNSLIVNALFLNLFSLGIPCIYYGTEQGFDGSGDREKYVRENMFGGEFGTFRTRGKHF
FT                   FDDKNPLYLNISKMCKVRKENLILKQGRQYQREISYDGLDFSFPHKLGDGRHEGVVAWS
FT                   RILSQDEVVMAMNSHIEKDLKVDVVLDPGIHKEGEKFTCIYSSEESFEETTVSSFFIGE
FT                   RLVIPVNVPKHGCVIYSKKQL"
FT   gene            complement(571177..572322)
FT                   /locus_tag="Ilyop_0504"
FT   CDS_pept        complement(571177..572322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0504"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018211; KEGG: dae:Dtox_2962
FT                   iron-containing alcohol dehydrogenase; PFAM:
FT                   iron-containing alcohol dehydrogenase; SPTR: C8W2N3
FT                   Iron-containing alcohol dehydrogenase; PFAM:
FT                   Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82292"
FT                   /db_xref="GOA:E3H602"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E3H602"
FT                   /protein_id="ADO82292.1"
FT                   /translation="MYSYFIPTVNLMGRGAVSNVGKQAKILNGSKALLITDEILVKIGV
FT                   AEKIISLLNESGVETSVYDKVNPNPTVKNVSDALSVYQNEKCDIIIALGGGSSIDCAKG
FT                   VGILATNGGNISDYEGVDKSENPMPPFITINTTAGTGSEMTRFTIITNTDTSVKMAIVD
FT                   WHVTPTVSINDPELMISMPASLTAATGMDALTHAIEAYVSTIATPVTDSAAIKAVELIS
FT                   KYLRPAVANGENIEAREMMAYAAFLAGMAFNNASLGNVHAMAHQLGGFYNLPHGVCNAI
FT                   LLPQVQEFNLIAYPERFADIARALGENIEGISPMEAGAKAISAIKRLSKDVGIPSGLRE
FT                   LGVKEEDFPILADNTLKDVCIATNPRKSSKNQIIQLFRDSM"
FT   gene            572739..573566
FT                   /locus_tag="Ilyop_0505"
FT   CDS_pept        572739..573566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0505"
FT                   /product="NAD(+) diphosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /note="COGs: COG2816 NTP pyrophosphohydrolase containing a
FT                   Zn-finger probably nucleic-acid-binding;
FT                   InterProIPR020476:IPR015797:IPR015376:IPR000086:IPR 020084;
FT                   KEGG: sat:SYN_00716 NTP pyrophosphohydrolase containing a
FT                   Zn-finger N; PFAM: NUDIX hydrolase; Zinc ribbon NADH
FT                   pyrophosphatase; PRIAM: NAD(+) diphosphatase; SPTR: Q2LVA3
FT                   NTP pyrophosphohydrolase containing a Zn-finger N; PFAM:
FT                   NADH pyrophosphatase zinc ribbon domain; NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82293"
FT                   /db_xref="GOA:E3H603"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E3H603"
FT                   /protein_id="ADO82293.1"
FT                   /translation="MINEIAPNIFNISLLSREAIKSEEQVLCYKNGKVLMKTLEDKFLI
FT                   PKKNELGEWVTEGILLGEVDGEKCFIAEGKDKMPQGFEYVGMRDIRGQSDKLFKWVTAV
FT                   GFHLFSWISDNKFCGRCGSSMEFKENERALKCTSCKNIIFPKLSPAIIVAITKGDKLLL
FT                   AKNKLHPGSFYSLIAGYVEAGETIEETVKREVMEEVGINVKNIRYYKSQPWPFSSSLML
FT                   GFFAEYDGDKPIKVDGIELSHADWFDADNLPEIPNKDSVAGEMIRIFREKNKI"
FT   gene            574203..574652
FT                   /locus_tag="Ilyop_0506"
FT   CDS_pept        574203..574652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0506"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG2153 acyltransferase; InterPro
FT                   IPR016181:IPR000182; KEGG: cbh:CLC_2162 acetyltransferase;
FT                   PFAM: GCN5-related N-acetyltransferase; SPTR: A7FVQ5
FT                   Acetyltransferase, GNAT family; PFAM: Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82294"
FT                   /db_xref="GOA:E3H604"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3H604"
FT                   /protein_id="ADO82294.1"
FT                   /translation="MEWKIKKFDELSNRELYDIIQQRVDVFVVEQNCPYAEVDGKDIDA
FT                   YHLFATEDGKIAAYTRILHPGVSFDEVSIGRVLVNMGYRGEGLGQELMKKTMEFVTKDL
FT                   KEKSIRISAQEYLLEFYLSLGFEEASDVYLEDGIPHIDMLFTKGQ"
FT   gene            574686..575228
FT                   /locus_tag="Ilyop_0507"
FT   CDS_pept        574686..575228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0507"
FT                   /product="Lipocalin family protein"
FT                   /note="COGs: COG3040 Bacterial lipocalin;
FT                   InterProIPR002446:IPR011038:IPR013208:IPR002345:IPR 012674;
FT                   KEGG: cps:CPS_2173 lipoprotein Blc; PFAM: Lipocalin family
FT                   protein; SPTR: Q482W9 Lipoprotein Blc; PFAM: Lipocalin-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ilyop_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADO82295"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:E3H605"
FT                   /protein_id="ADO82295.1"
FT                   /translation="MKSFLKIFIIFLTFFIYSQSYSWRRQEKKYGISEFQSEKYLGKWY
FT                   EIVRKDHGFEKGLSNVTAQYEQLGKNKVKVVNRGYDIKNEKIKTVVGKAKIKYKNVDNI
FT                   LKVSFFWPFYADYIIMDYDREEYKYALVRGRSDKYLWILSRTPVLDSEILEKLLEKAEK
FT                   DGIKLDDLIYVKHDKSQ"
FT   sig_peptide     574686..574745
FT                   /locus_tag="Ilyop_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            575366..576583
FT                   /locus_tag="Ilyop_0508"
FT   CDS_pept        575366..576583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ilyop_0508"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG4591 ABC-type transport system involved in
FT                   lipoprotein release permease component; InterPro IPR003838;
FT                   KEGG: fnu:FN0581 lipoprotein releasing system transmembrane
FT                   protein LolE; PFAM: protein of unknown function DUF214;
FT                   SPTR: C6JQA7 Lipoprotein releasing system transmembrane
FT                   protein lolE; PFAM: Predicted perm