(data stored in ACNUC7421 zone)

EMBL: CP002287

ID   CP002287; SV 1; circular; genomic DNA; STD; PRO; 7013095 BP.
XX
AC   CP002287;
XX
PR   Project:PRJNA48393;
XX
DT   31-OCT-2010 (Rel. 106, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Achromobacter xylosoxidans A8, complete genome.
XX
KW   .
XX
OS   Achromobacter xylosoxidans A8
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Achromobacter.
XX
RN   [1]
RP   1-7013095
RX   DOI; 10.1128/JB.01299-10.
RX   PUBMED; 21097610.
RA   Strnad H., Ridl J., Paces J., Kolar M., Vlcek C., Paces V.;
RT   "Complete genome sequence of the haloaromatic acid-degrading bacterium
RT   Achromobacter xylosoxidans A8";
RL   J. Bacteriol. 193(3):791-792(2011).
XX
RN   [2]
RP   1-7013095
RA   Strnad H., Ridl J., Paces J., Paces V., Vlcek C.;
RT   ;
RL   Submitted (18-OCT-2010) to the INSDC.
RL   Department of Genomics and Bioinformatics, Institute of Molecular Genetics
RL   AS CR, v.v.i., Videnska 1083, Prague 142 20, Czech Republic
XX
DR   MD5; f73e0c8097335299737a2fa43f6bf9ea.
DR   BioSample; SAMN02603404.
DR   EnsemblGenomes-Gn; AXYL_00162.
DR   EnsemblGenomes-Gn; AXYL_00165.
DR   EnsemblGenomes-Gn; AXYL_00325.
DR   EnsemblGenomes-Gn; AXYL_00416.
DR   EnsemblGenomes-Gn; AXYL_00681.
DR   EnsemblGenomes-Gn; AXYL_00705.
DR   EnsemblGenomes-Gn; AXYL_00770.
DR   EnsemblGenomes-Gn; AXYL_00771.
DR   EnsemblGenomes-Gn; AXYL_00772.
DR   EnsemblGenomes-Gn; AXYL_00773.
DR   EnsemblGenomes-Gn; AXYL_00774.
DR   EnsemblGenomes-Gn; AXYL_00775.
DR   EnsemblGenomes-Gn; AXYL_00820.
DR   EnsemblGenomes-Gn; AXYL_00848.
DR   EnsemblGenomes-Gn; AXYL_01032.
DR   EnsemblGenomes-Gn; AXYL_01033.
DR   EnsemblGenomes-Gn; AXYL_01142.
DR   EnsemblGenomes-Gn; AXYL_01159.
DR   EnsemblGenomes-Gn; AXYL_01160.
DR   EnsemblGenomes-Gn; AXYL_01233.
DR   EnsemblGenomes-Gn; AXYL_01259.
DR   EnsemblGenomes-Gn; AXYL_01275.
DR   EnsemblGenomes-Gn; AXYL_01705.
DR   EnsemblGenomes-Gn; AXYL_01783.
DR   EnsemblGenomes-Gn; AXYL_01784.
DR   EnsemblGenomes-Gn; AXYL_01787.
DR   EnsemblGenomes-Gn; AXYL_01853.
DR   EnsemblGenomes-Gn; AXYL_01941.
DR   EnsemblGenomes-Gn; AXYL_01952.
DR   EnsemblGenomes-Gn; AXYL_01954.
DR   EnsemblGenomes-Gn; AXYL_01960.
DR   EnsemblGenomes-Gn; AXYL_02096.
DR   EnsemblGenomes-Gn; AXYL_02097.
DR   EnsemblGenomes-Gn; AXYL_02098.
DR   EnsemblGenomes-Gn; AXYL_02099.
DR   EnsemblGenomes-Gn; AXYL_02100.
DR   EnsemblGenomes-Gn; AXYL_02189.
DR   EnsemblGenomes-Gn; AXYL_02242.
DR   EnsemblGenomes-Gn; AXYL_02279.
DR   EnsemblGenomes-Gn; AXYL_02588.
DR   EnsemblGenomes-Gn; AXYL_04065.
DR   EnsemblGenomes-Gn; AXYL_04528.
DR   EnsemblGenomes-Gn; AXYL_04532.
DR   EnsemblGenomes-Gn; AXYL_04533.
DR   EnsemblGenomes-Gn; AXYL_04535.
DR   EnsemblGenomes-Gn; AXYL_04653.
DR   EnsemblGenomes-Gn; AXYL_04721.
DR   EnsemblGenomes-Gn; AXYL_04831.
DR   EnsemblGenomes-Gn; AXYL_04832.
DR   EnsemblGenomes-Gn; AXYL_04833.
DR   EnsemblGenomes-Gn; AXYL_04834.
DR   EnsemblGenomes-Gn; AXYL_04835.
DR   EnsemblGenomes-Gn; AXYL_04969.
DR   EnsemblGenomes-Gn; AXYL_05016.
DR   EnsemblGenomes-Gn; AXYL_05167.
DR   EnsemblGenomes-Gn; AXYL_05168.
DR   EnsemblGenomes-Gn; AXYL_05169.
DR   EnsemblGenomes-Gn; AXYL_05170.
DR   EnsemblGenomes-Gn; AXYL_05171.
DR   EnsemblGenomes-Gn; AXYL_05172.
DR   EnsemblGenomes-Gn; AXYL_05588.
DR   EnsemblGenomes-Gn; AXYL_05778.
DR   EnsemblGenomes-Gn; AXYL_05814.
DR   EnsemblGenomes-Gn; AXYL_05844.
DR   EnsemblGenomes-Gn; AXYL_05962.
DR   EnsemblGenomes-Gn; AXYL_05967.
DR   EnsemblGenomes-Gn; AXYL_06048.
DR   EnsemblGenomes-Gn; AXYL_06477.
DR   EnsemblGenomes-Gn; AXYL_06479.
DR   EnsemblGenomes-Gn; AXYL_06480.
DR   EnsemblGenomes-Gn; AXYL_06481.
DR   EnsemblGenomes-Gn; EBG00001268782.
DR   EnsemblGenomes-Gn; EBG00001268783.
DR   EnsemblGenomes-Gn; EBG00001268784.
DR   EnsemblGenomes-Gn; EBG00001268785.
DR   EnsemblGenomes-Gn; EBG00001268786.
DR   EnsemblGenomes-Gn; EBG00001268787.
DR   EnsemblGenomes-Gn; EBG00001268788.
DR   EnsemblGenomes-Gn; EBG00001268789.
DR   EnsemblGenomes-Gn; EBG00001268790.
DR   EnsemblGenomes-Gn; EBG00001268791.
DR   EnsemblGenomes-Gn; EBG00001268792.
DR   EnsemblGenomes-Gn; EBG00001268793.
DR   EnsemblGenomes-Gn; EBG00001268794.
DR   EnsemblGenomes-Gn; EBG00001268795.
DR   EnsemblGenomes-Gn; EBG00001268796.
DR   EnsemblGenomes-Gn; EBG00001268797.
DR   EnsemblGenomes-Gn; EBG00001268798.
DR   EnsemblGenomes-Gn; EBG00001268799.
DR   EnsemblGenomes-Gn; EBG00001268800.
DR   EnsemblGenomes-Gn; EBG00001268801.
DR   EnsemblGenomes-Gn; EBG00001268802.
DR   EnsemblGenomes-Gn; EBG00001268803.
DR   EnsemblGenomes-Gn; EBG00001268804.
DR   EnsemblGenomes-Gn; EBG00001268805.
DR   EnsemblGenomes-Gn; EBG00001268806.
DR   EnsemblGenomes-Gn; EBG00001268807.
DR   EnsemblGenomes-Gn; EBG00001268808.
DR   EnsemblGenomes-Gn; EBG00001268809.
DR   EnsemblGenomes-Gn; EBG00001268810.
DR   EnsemblGenomes-Gn; EBG00001268811.
DR   EnsemblGenomes-Gn; EBG00001268812.
DR   EnsemblGenomes-Gn; EBG00001268813.
DR   EnsemblGenomes-Gn; EBG00001268814.
DR   EnsemblGenomes-Gn; EBG00001268815.
DR   EnsemblGenomes-Gn; EBG00001268816.
DR   EnsemblGenomes-Gn; EBG00001268817.
DR   EnsemblGenomes-Gn; EBG00001268818.
DR   EnsemblGenomes-Gn; EBG00001268819.
DR   EnsemblGenomes-Gn; EBG00001268820.
DR   EnsemblGenomes-Gn; EBG00001268821.
DR   EnsemblGenomes-Gn; EBG00001268822.
DR   EnsemblGenomes-Gn; EBG00001268823.
DR   EnsemblGenomes-Gn; EBG00001268824.
DR   EnsemblGenomes-Gn; EBG00001268825.
DR   EnsemblGenomes-Gn; EBG00001268826.
DR   EnsemblGenomes-Gn; EBG00001268827.
DR   EnsemblGenomes-Gn; EBG00001268828.
DR   EnsemblGenomes-Gn; EBG00001268829.
DR   EnsemblGenomes-Gn; EBG00001268830.
DR   EnsemblGenomes-Gn; EBG00001268831.
DR   EnsemblGenomes-Gn; EBG00001268832.
DR   EnsemblGenomes-Gn; EBG00001268833.
DR   EnsemblGenomes-Gn; EBG00001268834.
DR   EnsemblGenomes-Gn; EBG00001268835.
DR   EnsemblGenomes-Gn; EBG00001268836.
DR   EnsemblGenomes-Gn; EBG00001268837.
DR   EnsemblGenomes-Gn; EBG00001268838.
DR   EnsemblGenomes-Gn; EBG00001268839.
DR   EnsemblGenomes-Gn; EBG00001268840.
DR   EnsemblGenomes-Gn; EBG00001268841.
DR   EnsemblGenomes-Gn; EBG00001268842.
DR   EnsemblGenomes-Gn; EBG00001268843.
DR   EnsemblGenomes-Gn; EBG00001268844.
DR   EnsemblGenomes-Gn; EBG00001268845.
DR   EnsemblGenomes-Gn; EBG00001268846.
DR   EnsemblGenomes-Gn; EBG00001268847.
DR   EnsemblGenomes-Gn; EBG00001268848.
DR   EnsemblGenomes-Gn; EBG00001268849.
DR   EnsemblGenomes-Gn; EBG00001268850.
DR   EnsemblGenomes-Gn; EBG00001268851.
DR   EnsemblGenomes-Gn; EBG00001268852.
DR   EnsemblGenomes-Gn; EBG00001268853.
DR   EnsemblGenomes-Gn; EBG00001268854.
DR   EnsemblGenomes-Gn; EBG00001268855.
DR   EnsemblGenomes-Gn; EBG00001268856.
DR   EnsemblGenomes-Gn; EBG00001268857.
DR   EnsemblGenomes-Gn; EBG00001268858.
DR   EnsemblGenomes-Gn; EBG00001268859.
DR   EnsemblGenomes-Gn; EBG00001268860.
DR   EnsemblGenomes-Gn; EBG00001268861.
DR   EnsemblGenomes-Gn; EBG00001268862.
DR   EnsemblGenomes-Gn; EBG00001268863.
DR   EnsemblGenomes-Gn; EBG00001268864.
DR   EnsemblGenomes-Gn; EBG00001268865.
DR   EnsemblGenomes-Gn; EBG00001268866.
DR   EnsemblGenomes-Gn; EBG00001268867.
DR   EnsemblGenomes-Tr; AXYL_00162-1.
DR   EnsemblGenomes-Tr; AXYL_00165-1.
DR   EnsemblGenomes-Tr; AXYL_00325-1.
DR   EnsemblGenomes-Tr; AXYL_00416-1.
DR   EnsemblGenomes-Tr; AXYL_00681-1.
DR   EnsemblGenomes-Tr; AXYL_00705-1.
DR   EnsemblGenomes-Tr; AXYL_00770-1.
DR   EnsemblGenomes-Tr; AXYL_00771-1.
DR   EnsemblGenomes-Tr; AXYL_00772-1.
DR   EnsemblGenomes-Tr; AXYL_00773-1.
DR   EnsemblGenomes-Tr; AXYL_00774-1.
DR   EnsemblGenomes-Tr; AXYL_00775-1.
DR   EnsemblGenomes-Tr; AXYL_00820-1.
DR   EnsemblGenomes-Tr; AXYL_00848-1.
DR   EnsemblGenomes-Tr; AXYL_01032-1.
DR   EnsemblGenomes-Tr; AXYL_01033-1.
DR   EnsemblGenomes-Tr; AXYL_01142-1.
DR   EnsemblGenomes-Tr; AXYL_01159-1.
DR   EnsemblGenomes-Tr; AXYL_01160-1.
DR   EnsemblGenomes-Tr; AXYL_01233-1.
DR   EnsemblGenomes-Tr; AXYL_01259-1.
DR   EnsemblGenomes-Tr; AXYL_01275-1.
DR   EnsemblGenomes-Tr; AXYL_01705-1.
DR   EnsemblGenomes-Tr; AXYL_01783-1.
DR   EnsemblGenomes-Tr; AXYL_01784-1.
DR   EnsemblGenomes-Tr; AXYL_01787-1.
DR   EnsemblGenomes-Tr; AXYL_01853-1.
DR   EnsemblGenomes-Tr; AXYL_01941-1.
DR   EnsemblGenomes-Tr; AXYL_01952-1.
DR   EnsemblGenomes-Tr; AXYL_01954-1.
DR   EnsemblGenomes-Tr; AXYL_01960-1.
DR   EnsemblGenomes-Tr; AXYL_02096-1.
DR   EnsemblGenomes-Tr; AXYL_02097-1.
DR   EnsemblGenomes-Tr; AXYL_02098-1.
DR   EnsemblGenomes-Tr; AXYL_02099-1.
DR   EnsemblGenomes-Tr; AXYL_02100-1.
DR   EnsemblGenomes-Tr; AXYL_02189-1.
DR   EnsemblGenomes-Tr; AXYL_02242-1.
DR   EnsemblGenomes-Tr; AXYL_02279-1.
DR   EnsemblGenomes-Tr; AXYL_02588-1.
DR   EnsemblGenomes-Tr; AXYL_04065-1.
DR   EnsemblGenomes-Tr; AXYL_04528-1.
DR   EnsemblGenomes-Tr; AXYL_04532-1.
DR   EnsemblGenomes-Tr; AXYL_04533-1.
DR   EnsemblGenomes-Tr; AXYL_04535-1.
DR   EnsemblGenomes-Tr; AXYL_04653-1.
DR   EnsemblGenomes-Tr; AXYL_04721-1.
DR   EnsemblGenomes-Tr; AXYL_04831-1.
DR   EnsemblGenomes-Tr; AXYL_04832-1.
DR   EnsemblGenomes-Tr; AXYL_04833-1.
DR   EnsemblGenomes-Tr; AXYL_04834-1.
DR   EnsemblGenomes-Tr; AXYL_04835-1.
DR   EnsemblGenomes-Tr; AXYL_04969-1.
DR   EnsemblGenomes-Tr; AXYL_05016-1.
DR   EnsemblGenomes-Tr; AXYL_05167-1.
DR   EnsemblGenomes-Tr; AXYL_05168-1.
DR   EnsemblGenomes-Tr; AXYL_05169-1.
DR   EnsemblGenomes-Tr; AXYL_05170-1.
DR   EnsemblGenomes-Tr; AXYL_05171-1.
DR   EnsemblGenomes-Tr; AXYL_05172-1.
DR   EnsemblGenomes-Tr; AXYL_05588-1.
DR   EnsemblGenomes-Tr; AXYL_05778-1.
DR   EnsemblGenomes-Tr; AXYL_05814-1.
DR   EnsemblGenomes-Tr; AXYL_05844-1.
DR   EnsemblGenomes-Tr; AXYL_05962-1.
DR   EnsemblGenomes-Tr; AXYL_05967-1.
DR   EnsemblGenomes-Tr; AXYL_06048-1.
DR   EnsemblGenomes-Tr; AXYL_06477-1.
DR   EnsemblGenomes-Tr; AXYL_06479-1.
DR   EnsemblGenomes-Tr; AXYL_06480-1.
DR   EnsemblGenomes-Tr; AXYL_06481-1.
DR   EnsemblGenomes-Tr; EBT00001800826.
DR   EnsemblGenomes-Tr; EBT00001800827.
DR   EnsemblGenomes-Tr; EBT00001800828.
DR   EnsemblGenomes-Tr; EBT00001800829.
DR   EnsemblGenomes-Tr; EBT00001800830.
DR   EnsemblGenomes-Tr; EBT00001800831.
DR   EnsemblGenomes-Tr; EBT00001800832.
DR   EnsemblGenomes-Tr; EBT00001800833.
DR   EnsemblGenomes-Tr; EBT00001800834.
DR   EnsemblGenomes-Tr; EBT00001800835.
DR   EnsemblGenomes-Tr; EBT00001800836.
DR   EnsemblGenomes-Tr; EBT00001800837.
DR   EnsemblGenomes-Tr; EBT00001800838.
DR   EnsemblGenomes-Tr; EBT00001800839.
DR   EnsemblGenomes-Tr; EBT00001800840.
DR   EnsemblGenomes-Tr; EBT00001800841.
DR   EnsemblGenomes-Tr; EBT00001800842.
DR   EnsemblGenomes-Tr; EBT00001800843.
DR   EnsemblGenomes-Tr; EBT00001800844.
DR   EnsemblGenomes-Tr; EBT00001800845.
DR   EnsemblGenomes-Tr; EBT00001800846.
DR   EnsemblGenomes-Tr; EBT00001800847.
DR   EnsemblGenomes-Tr; EBT00001800848.
DR   EnsemblGenomes-Tr; EBT00001800849.
DR   EnsemblGenomes-Tr; EBT00001800850.
DR   EnsemblGenomes-Tr; EBT00001800851.
DR   EnsemblGenomes-Tr; EBT00001800852.
DR   EnsemblGenomes-Tr; EBT00001800853.
DR   EnsemblGenomes-Tr; EBT00001800854.
DR   EnsemblGenomes-Tr; EBT00001800855.
DR   EnsemblGenomes-Tr; EBT00001800856.
DR   EnsemblGenomes-Tr; EBT00001800857.
DR   EnsemblGenomes-Tr; EBT00001800858.
DR   EnsemblGenomes-Tr; EBT00001800859.
DR   EnsemblGenomes-Tr; EBT00001800860.
DR   EnsemblGenomes-Tr; EBT00001800861.
DR   EnsemblGenomes-Tr; EBT00001800862.
DR   EnsemblGenomes-Tr; EBT00001800863.
DR   EnsemblGenomes-Tr; EBT00001800864.
DR   EnsemblGenomes-Tr; EBT00001800865.
DR   EnsemblGenomes-Tr; EBT00001800866.
DR   EnsemblGenomes-Tr; EBT00001800867.
DR   EnsemblGenomes-Tr; EBT00001800868.
DR   EnsemblGenomes-Tr; EBT00001800869.
DR   EnsemblGenomes-Tr; EBT00001800870.
DR   EnsemblGenomes-Tr; EBT00001800871.
DR   EnsemblGenomes-Tr; EBT00001800872.
DR   EnsemblGenomes-Tr; EBT00001800873.
DR   EnsemblGenomes-Tr; EBT00001800874.
DR   EnsemblGenomes-Tr; EBT00001800875.
DR   EnsemblGenomes-Tr; EBT00001800876.
DR   EnsemblGenomes-Tr; EBT00001800877.
DR   EnsemblGenomes-Tr; EBT00001800878.
DR   EnsemblGenomes-Tr; EBT00001800879.
DR   EnsemblGenomes-Tr; EBT00001800880.
DR   EnsemblGenomes-Tr; EBT00001800881.
DR   EnsemblGenomes-Tr; EBT00001800882.
DR   EnsemblGenomes-Tr; EBT00001800883.
DR   EnsemblGenomes-Tr; EBT00001800884.
DR   EnsemblGenomes-Tr; EBT00001800885.
DR   EnsemblGenomes-Tr; EBT00001800886.
DR   EnsemblGenomes-Tr; EBT00001800887.
DR   EnsemblGenomes-Tr; EBT00001800888.
DR   EnsemblGenomes-Tr; EBT00001800889.
DR   EnsemblGenomes-Tr; EBT00001800890.
DR   EnsemblGenomes-Tr; EBT00001800891.
DR   EnsemblGenomes-Tr; EBT00001800892.
DR   EnsemblGenomes-Tr; EBT00001800893.
DR   EnsemblGenomes-Tr; EBT00001800894.
DR   EnsemblGenomes-Tr; EBT00001800895.
DR   EnsemblGenomes-Tr; EBT00001800896.
DR   EnsemblGenomes-Tr; EBT00001800897.
DR   EnsemblGenomes-Tr; EBT00001800898.
DR   EnsemblGenomes-Tr; EBT00001800899.
DR   EnsemblGenomes-Tr; EBT00001800900.
DR   EnsemblGenomes-Tr; EBT00001800901.
DR   EnsemblGenomes-Tr; EBT00001800902.
DR   EnsemblGenomes-Tr; EBT00001800903.
DR   EnsemblGenomes-Tr; EBT00001800904.
DR   EnsemblGenomes-Tr; EBT00001800905.
DR   EnsemblGenomes-Tr; EBT00001800906.
DR   EnsemblGenomes-Tr; EBT00001800907.
DR   EnsemblGenomes-Tr; EBT00001800908.
DR   EnsemblGenomes-Tr; EBT00001800909.
DR   EnsemblGenomes-Tr; EBT00001800910.
DR   EnsemblGenomes-Tr; EBT00001800911.
DR   EuropePMC; PMC3021230; 21097610.
DR   EuropePMC; PMC3156400.
DR   EuropePMC; PMC3294760; 22328747.
DR   EuropePMC; PMC3421494; 22675125.
DR   EuropePMC; PMC3669393; 23741407.
DR   EuropePMC; PMC3938422; 24586319.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02227; sX8.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP002287.
DR   SILVA-SSU; CP002287.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7013095
FT                   /organism="Achromobacter xylosoxidans A8"
FT                   /strain="A8"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:762376"
FT   gene            1..1464
FT                   /gene="dnaA"
FT                   /locus_tag="AXYL_00001"
FT   CDS_pept        1..1464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="AXYL_00001"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13363"
FT                   /db_xref="GOA:E3HLR5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLR5"
FT                   /protein_id="ADP13363.1"
FT                   /translation="MKEFWQTCVSRLEQELPPQQISAWIRPLVPLAYDETQAVLRVAAP
FT                   NRFKLDWVRKNFSHQIEALAAEWFERPVQVLFELPSQGTAPRMPVAPVRAPQPAQTYPS
FT                   GGSPAGGAPPPGPALAPAQPAPAPATTAAAQAVNADAANIVYERSRLNTDLTFENFVTG
FT                   KANQLARAAALQVAENPGTSYNPLFLYGGVGLGKTHLIHAIGNAMVAAGTGVRVRYVHA
FT                   DQYVSDVVKAYQRKAFDDFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEAMVAQRK
FT                   QIIITSDTYPKELSGIDSRLISRFDSGLTVAIEPPELEMRVAILLRKAESEGVPMPEEV
FT                   AFFIAKHLRSNVRELEGALRKVLAYARFHGRDVLTVDVCKEALKDLLSVSNGQITVENI
FT                   QKTVADFYKIKVADMYSKRRPANIALPRQVAMYLAKELTQKSLPEIGDLFGGRDHTTVL
FT                   HAVRKISDARAKQAELNHTLHVLEQTLKG"
FT   gene            1467..2576
FT                   /gene="dnaN"
FT                   /locus_tag="AXYL_00002"
FT   CDS_pept        1467..2576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="AXYL_00002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13364"
FT                   /db_xref="GOA:E3HLR6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLR6"
FT                   /protein_id="ADP13364.1"
FT                   /translation="MQLVQTTRDALLKPLSTVAGIVERRHTLPILANILMRKEGNKVAF
FT                   IATDLEVQITTHADFGVGQDNESTTVAARKLLDILKALPDTGDVRLALASNKLSVQSAK
FT                   SRFALQTLAASEFPTVAQPEQWDVSLTMPQRTLRHLFNMVHFAMAQQDIRYYLNGMLLV
FT                   FEPGRVRAVATDGHRLAHCSTEADGISERHEVIVPRKTVLEMQRLLEDSDEPVSIDVAP
FT                   GQIRFRFGDVELVSKLVEGKFPDFTRVIPTNYTRHFLVNREALQGSLQRAAILTTDKFK
FT                   GVRLQLAQNQMKISSSNAEQEEAQEEIDIDYGHEALDVGFNVGYLLDVLANVKVDNIQW
FT                   SVMPDANASALITLPEDDQFKYVVMPMRI"
FT   gene            2672..5119
FT                   /gene="gyrB"
FT                   /locus_tag="AXYL_00003"
FT   CDS_pept        2672..5119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="AXYL_00003"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13365"
FT                   /db_xref="GOA:E3HLR7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLR7"
FT                   /protein_id="ADP13365.1"
FT                   /translation="MSDQQNTTPENSGYGADSIKMLKGLEAVRKRPGMYIGDTSDGTGL
FT                   HHMVFEVVDNAIDEALAGYCDDIVVTIHTDNSISVTDNGRGIPTDIHKDDEFHRSAAEI
FT                   VMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSEWLRLTIRRNGEVHQMEFRQGERVA
FT                   PLAVTGTTDKRGTEVRFLADPIIFNNIEYHYEILSKRLRELSFLNNGVKIRLIDQRQGK
FT                   EENFAFSGGVKGFVEYINRSKTVLHPNVFSVTTESSAGGVPVGVEVAMQWNDSYSESVL
FT                   CFTNNIPQRDGGSHLTGLRAAMTRIINKYIADNELAKKAKVETSGDDMREGLACVLSVK
FT                   VPEPKFSSQTKDKLVSSEVRPAVEEAVARTLESWLLENPIDAKALCAKIVEAARAREAA
FT                   RKAREMTRRKSVLEGAGLPGKLADCQEKDPALCELYIVEGDSAGGSAKQGRDRKFQAIL
FT                   PLRGKVLNVEKARFDRLIASEQIATLITALGTSIGPDFNVDKLRYHRLIIMTDADVDGA
FT                   HIRTLLLTLLYRQMPELVQRGYVYIAQPPLYKVKVGREERYLKDDQEEAQFMLQLALKD
FT                   AEIISGGNIIRGDELSDLARQYVAADGVIARLSRVFDVGALSAMAEGVEINLESAESTA
FT                   DSARRLADAMRDPVSGNGVEVVPQFDEATERHRLSVQRMHHGNVRVSIIDADFVNGSDY
FT                   AVLSKAAKSFSGKVSARSLAARGEGEKRKEQTVSDFREAMQWLRSEADRSISKQRYKGL
FT                   GEMNPEQLWETTMDPKVRRLLRVQIEDAIAADEVFTTLMGDDVEPRRNFIETHALSAGN
FT                   IDA"
FT   gene            complement(5316..6011)
FT                   /locus_tag="AXYL_00004"
FT   CDS_pept        complement(5316..6011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00004"
FT                   /product="bacterial regulatory protein, GntR family protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13366"
FT                   /db_xref="GOA:E3HLR8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLR8"
FT                   /protein_id="ADP13366.1"
FT                   /translation="MDYSEASPVAQALADRSIAGAVVDALRGEIIHGQLKPGERLRQDA
FT                   VASRFRVSQTVVREAFKDLIRECFLVSEPRRGVSVATMSADEAEEMTTLRSVVEPQALA
FT                   WAIPKLTEVQFEAAERVLKELDNETSVDQIILLNARFHRGLYAAANRPRTLTMVETLRL
FT                   GFERYLRYTWEFTTHRDRSQQEHWELLAMCKQGEVNNACSLLTQHIRATGDLLVECLAK
FT                   RPIEQTSKL"
FT   gene            6113..6850
FT                   /locus_tag="AXYL_00005"
FT   CDS_pept        6113..6850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00005"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   2 family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13367"
FT                   /db_xref="GOA:E3HLR9"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLR9"
FT                   /protein_id="ADP13367.1"
FT                   /translation="MTLRLSDFDAVTFDVYGTLIDWEPSIAKFLTRWARENRIEADAET
FT                   LIMAFDGARAAIQKERPAHLYPDVLTKCFERICVQFKVAVDPDLRRQFAAAPHTWPAFD
FT                   DSHAGLVRLQQSAKVGAFSNIDQASLNTSCDNLDFRFDLVVTAQRVGAYKPDWPHFDTG
FT                   IGDLMRMGIPRERILHVGQSLRADITPANRLGVRCAWVNRPGRLLGLSGEGAAEAKPDL
FT                   TVSSLAELVAALTGADQPAPTLV"
FT   gene            6867..7754
FT                   /locus_tag="AXYL_00006"
FT   CDS_pept        6867..7754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00006"
FT                   /product="glutamate/aspartate periplasmic-binding protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13368"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLS0"
FT                   /protein_id="ADP13368.1"
FT                   /translation="MTTTIHFVPRVLRGALGAVLLAGSVAAMAQSTDPILERIKAKGTI
FT                   TLGYRESSIPFSYLDDARKPVGYAMDLCMKVVDAVRQRLQMPALKVDYIAVNPQNRIAL
FT                   VANGTVDLECGSTVNSLGRQAQVDFSAPHFISTTRLLVRKGADIKEVEDLNGKAVALPI
FT                   NTTPERLIKALIEAKNLQVRIVPVRDNSEGFLALSTGRADAFSTDDILLYGLRKSAPTP
FT                   VDFEVVGRPLSFDPYGLMLQKNSTVFLSLVNATIARSVRSGELNASYDKWFAPMGVPLS
FT                   KDLAAAFKLAALPE"
FT   gene            7774..8493
FT                   /locus_tag="AXYL_00007"
FT   CDS_pept        7774..8493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00007"
FT                   /product="amino ABC transporter, permease protein, 3-TM
FT                   region, His/Glu/Gln/Arg/opine family domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13369"
FT                   /db_xref="GOA:E3HLS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLS1"
FT                   /protein_id="ADP13369.1"
FT                   /translation="MMNYAWNWNVLFEEPYAGWLISGLQATVLISLAAWAIAVVIGLAL
FT                   GVLGSLPGRIRWLLTVYVSVFRNVPLLVQLFIWFFVVPELLPGEVGRWLKRDLPMPEIW
FT                   TAIAALGLFTAARVAVQVRSGIAALSRGQRLAAYASGMTLAQAYRYILLPQALRLVLPP
FT                   MTSEFLTVFKNSALALTIGVFEMTAQSRQIESYTFSGFEAFTAATLVYLSIALCVTAGM
FT                   RSLEKKLLIPGTQGGRI"
FT   gene            8490..9152
FT                   /locus_tag="AXYL_00008"
FT   CDS_pept        8490..9152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00008"
FT                   /product="amino ABC transporter, permease protein, 3-TM
FT                   region, His/Glu/Gln/Arg/opine family domain protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13370"
FT                   /db_xref="GOA:E3HLS2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLS2"
FT                   /protein_id="ADP13370.1"
FT                   /translation="MNGVFDVSVIVKAWPFLLEGLGLSLLLTLVAMAGGLVLGLLLALA
FT                   RLSRHALLAGAAAVYVNGFRAVPLILVIFWFYFLVPLIVGKPVGALPSALIAFTLFEAA
FT                   YYSEIIRAGLQSVRSGQWQAAAASGLSRAQALRFVVLPQALRNMMPVLITQAIVLFQDT
FT                   SLVYVISLRDFMTSTSIVANRDNRLIEMYLFAALVYFVLCASLSLAAHLAAKRRSAV"
FT   gene            9149..9907
FT                   /locus_tag="AXYL_00009"
FT   CDS_pept        9149..9907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00009"
FT                   /product="glutamate/aspartate transport ATP-binding protein
FT                   GltL 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13371"
FT                   /db_xref="GOA:E3HLS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLS3"
FT                   /protein_id="ADP13371.1"
FT                   /translation="MTSEQREEAPMIEVSGLHKSYGATPVLNGCDMAIRRGEVAVICGP
FT                   SGSGKSTLIKCFNGLESFQRGSVRVDGVDVGAAASNLSDLRSRVGMVFQHFELYPHLTV
FT                   LDNLCLAPMKVLGRTREAAHHKARELLGRVGLPGKIDAYPAQLSGGQQQRIAIARALAM
FT                   DPIVMLFDEPTSALDPEMIGEVLSVMLELAQDGMTMAVVTHEMGFARRAADNVIFMDAG
FT                   KVVENTPTDMFFASPRSARAQDFLSGLVSH"
FT   gene            9994..11055
FT                   /locus_tag="AXYL_00010"
FT   CDS_pept        9994..11055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00010"
FT                   /product="pyridoxal-phosphate dependent enzyme family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13372"
FT                   /db_xref="GOA:E3HLS4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLS4"
FT                   /protein_id="ADP13372.1"
FT                   /translation="MRVPVFDDVSAALERIRPHVVTTPLMRSAALDCIVGAPVWIKAEN
FT                   LQVTGSFKARGAFNALLGLSESERQRGVVAYSTGNHGQAVAWAARCLGIPATIVMPADA
FT                   PRNKVARALAHGARVVHYDRRRESREVIGMRLLLESGGTLIPPGDHPDVLAAQGTVALE
FT                   ALDALAPAARANLGTFAAPCGGGGLVAGCGLVLDALLPNLRVVAVEPCGFDDTVRSLAS
FT                   GTREVNAPTATTLADALQAVTPAQLPFEINRHFLDEALAVTDAEIAYAIRFSLTELGMV
FT                   VEPGGAVALAAVLAGRLQSGGKDMLIVLSGGNIDMPLLARLLQENDDTVEIDRNRAAEP
FT                   SQVTHFVNTTRTP"
FT   gene            11052..12278
FT                   /locus_tag="AXYL_00011"
FT   CDS_pept        11052..12278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00011"
FT                   /product="aminotransferase class I and II family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13373"
FT                   /db_xref="GOA:E3HLS5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLS5"
FT                   /protein_id="ADP13373.1"
FT                   /translation="MNAIEEKFLKLGIDNAPGQEVRESHGGERLLHEGASLPGVAVDFS
FT                   HGDVNAGAFEPTPGALDAFVQGVHRGGSQAYTEYRGQSAIREKLALDLAAFSGHPVSGA
FT                   EELIITPGTQSALFLAVASTVTAGEKVAIVQPDYFANRKLVEFMGAEMIPVQLDYLNNT
FT                   AHAGLDLQQLESAFKAGAKVFLFSNPNNPTGAVYSRNEIGQIAALAERFGATVIVDQLY
FT                   SRLLYAGQPYVHLRGVPQADDNVVTIMGPSKTESLSGYRLGVAFGNARIIQRMEKLQAI
FT                   VSLRAPGYCQAVLQTWFSEPAGWLADRIGRHQQIRDDLLSLFRGIEGVAVRTPQAGSYL
FT                   FPQLPKLHMTLQTFIRTLRSRANVTVTPGTEFSPHAGDSIRLNFSQNHEAAVDAVKRIA
FT                   TVLEEHRLA"
FT   gene            12298..12681
FT                   /locus_tag="AXYL_00012"
FT   CDS_pept        12298..12681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00012"
FT                   /product="endoribonuclease L-PSP family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13374"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLS6"
FT                   /protein_id="ADP13374.1"
FT                   /translation="MIRKAYSSESTPPPAGTYSVAMQAGQLLFLSGQTPRDRDNVRHGD
FT                   KPFAAQARMALDNLEAAANAAGASLRDAVKVGVFLRDLAHAQEFDAIYATYVGEPPPAR
FT                   TLIQSGFSAFDIEVDAILVRSFA"
FT   gene            complement(12754..13677)
FT                   /locus_tag="AXYL_00013"
FT   CDS_pept        complement(12754..13677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00013"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13375"
FT                   /db_xref="GOA:E3HLS7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLS7"
FT                   /protein_id="ADP13375.1"
FT                   /translation="MSKLPDLEGWAIFAKVAETGSFAKAAAEFSLSQATVSKSISRLEA
FT                   RMKTTLFHRTSRSMTLTESGYAALERAARILEEGEAVESEVTEKSSSLRGKIRLSAPMS
FT                   FGVTHLAPMLPPFMQANPDVALEIEFSDKQADLVSERFDLALRISNLVDSTLLARRLCS
FT                   VRILLVGAPSYFKRAGRPKHPKDLAHHTALQYMYARNGSSWRFRHEKHGDFSQSLPVHL
FT                   NVNNAEALTPALQAGMGLALQPEFLAWKDLQSGALETVMDDWQVDPIALHIVTPPGRRR
FT                   PARVQAFIEYLAERLTAEPWANDVHV"
FT   gene            13997..14683
FT                   /locus_tag="AXYL_00014"
FT   CDS_pept        13997..14683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00014"
FT                   /product="isochorismatase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00014"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13376"
FT                   /db_xref="GOA:E3HLS8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLS8"
FT                   /protein_id="ADP13376.1"
FT                   /translation="MSANKYLEVLTPQNSQIIFIDQQPQMAFGVQSIDRQTLKNNVVGL
FT                   AKAARTFNIPTTITTVETDSFSGNTYPELLAVFPEHKILERTSMNSWDDQNVRDALAAN
FT                   GRKKVIVAGLWTEVCNTTFALCAMLEGEYEIYMVADASGGTSVDAHKYAMDRMVQAGVV
FT                   PVTWQQVLLEWQRDWARKETYDAVTAIVKEHSGAYGMGIDYAVTHVHKLAERVQHGERI
FT                   GPNPAK"
FT   gene            14800..16392
FT                   /locus_tag="AXYL_00015"
FT   CDS_pept        14800..16392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00015"
FT                   /product="major facilitator superfamily protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13377"
FT                   /db_xref="GOA:E3HLS9"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLS9"
FT                   /protein_id="ADP13377.1"
FT                   /translation="MPDQKSNATRGTFAPLRQSVFAVLWAATVLGNIGSFMRDVASSWL
FT                   VTDLSASPTAVALIQTAATLPIFLLAIPAGVLSDILDRRRFLIFVQLLLASVSGTLLLL
FT                   SHFGALTVDYLIALTFVGGIGAALMGPTWQSIVPELVPREELKGAVALNSLGINIARAI
FT                   GPAAGGLILASFGAAVTYGLDVLSYVFVIAALLWWKRPVAVDSGLSENFFGAFRAGLRY
FT                   TRASKELHRVLLRAAVFFLFASAVWALLPLVARQMLGGTAGFYGVLLGAVGAGAIIGAL
FT                   VMPKLSARLNTDGLVLLASVASAAVMAGLVSAPPQWVAVLLLVVLGMGWITALTTFNGV
FT                   AQAILPNWVRGRGLAVYLMVFNGAMAAGSLGWGLVAREIGVPYALAVSAAGLVVVALLF
FT                   HRVRLPIGEADLQASNHWPEPLLAEPVANDRGPVLVQVEYRIRQEDRPAFLDAMKRLSQ
FT                   ERLRDGAYAWGVVEHTGDPQRVVEWFFVESWAEHLRQHHRVSHADADLQAEALRFHMGP
FT                   DKPEVHHFLALKH"
FT   gene            16474..17178
FT                   /locus_tag="AXYL_00016"
FT   CDS_pept        16474..17178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00016"
FT                   /product="pirin family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13378"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLT0"
FT                   /protein_id="ADP13378.1"
FT                   /translation="MVERRPLASLGHARRGWLDVKHHFSFAAYQDPERMNWGALRAWND
FT                   ETIAPGSGFPPLLHADVEIITCVRQGALTHEDDLGNRGRTGVGEVQVMSAGSGMTHAEF
FT                   NMEGGPAQVFEIWIEPDRRGAPPSWGRKSFTREACKGRFITLASGMDGDEDALPIRSDA
FT                   RVLALALKAGEDATYRFARGARRGYLVASKGRLKVNGVEIGLGDGAAIRDETELRLTAL
FT                   DDAEILLADTHA"
FT   gene            17220..17483
FT                   /locus_tag="AXYL_00017"
FT   CDS_pept        17220..17483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13379"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLT1"
FT                   /protein_id="ADP13379.1"
FT                   /translation="MKIYLLSLGAGLLVGVVYSLLQVRSPAPPLVALIGLLGILVGEQI
FT                   VPVGRQLLSGTAFVAACDKEKAVSHVLGQLPGRHQAQDKEHG"
FT   gene            17513..19498
FT                   /locus_tag="AXYL_00018"
FT   CDS_pept        17513..19498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00018"
FT                   /product="amidohydrolase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13380"
FT                   /db_xref="GOA:E3HLT2"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:E3HLT2"
FT                   /protein_id="ADP13380.1"
FT                   /translation="MPTRRDLIGVASALALNGMLGRHAIASSKGEPNMSNATPDVIFHN
FT                   GRITTLDRSKPQASAVAIKNGRFVAVGTDAEIMPLAGAGTRVVDLKRRAALPGLYDNHT
FT                   HVVRGGLNYNMELRWDGVRTLADAMAMLKRQVAITPAPQWVRVVGGFTEHQFAEKRLPT
FT                   IDEINAIAPDTPVFILHLYDRALLNGAALRAVGYTKTTPNPPGGEIMRDAQGNPTGLLL
FT                   AKPNATILYATLAKGPKLPFDYQVNSTRHFMRELNRLGVTGVIDAGGGFQNYPDDYAVI
FT                   QKLADENQMTVRLAYNLFTQKPKQEKEDFLNWTSSVKYKQGTDYFRHNGAGEMLVFSAA
FT                   DFEDFRVERPDMPPEMEGELEEVVRVLVQNQWPWRLHATYDETISRALDVFEKVHRDTP
FT                   LTGLNWFFDHAETISDKSIDRIAALGGGIAVQHRMAYQGEYFIERYGAKAAEATPPVAK
FT                   ILQRGVKVSAGTDATRVASYNPWVSLSWMVTGKTVGGTRLYPARNCLDRETALRMWTEN
FT                   VAWFSNEEGKRGRIEPGQLADFIVPDKDYFSCTEDEISFLTSDLTVVGGRVVYGAGEFG
FT                   PLDDNPLPPAMPDWSPTRLFGGYGAWGDPQGAGRNSLGYRNMAACACASSCGLHGHDHA
FT                   RAWASNAPSSDLQGFFGALGCSCWAV"
FT   gene            19510..19980
FT                   /locus_tag="AXYL_00019"
FT   CDS_pept        19510..19980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00019"
FT                   /product="DoxX family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13381"
FT                   /db_xref="GOA:E3HMW8"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMW8"
FT                   /protein_id="ADP13381.1"
FT                   /translation="MSTLFQWERRLADMARPLFGASMVRFLAYLGLCAAYLQGGLVKLF
FT                   DFPGAVREMAHFGLSPEPLFAALVIALELVASLMILTGRLRWLGALALAAFTLVATGIA
FT                   LRFWEMPLGQERFMAANSFFEHLGLAGGLLLVAWLDLRETKFGGATSWGQAT"
FT   gene            complement(20047..21258)
FT                   /locus_tag="AXYL_00020"
FT   CDS_pept        complement(20047..21258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13382"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMW9"
FT                   /protein_id="ADP13382.1"
FT                   /translation="MHHPEPAYVCRKADPRVWRRPRWLLILIGMLAAASAFGQDVIWIG
FT                   QPSARDYLALNVQRAVEGYAELRQQMAQFEARVGEARRAYFAAAPADRAAAGDKFGELL
FT                   FQKDLMIAWPRISAGGDQAQRLASLMALGNNGRPLDGGIPPSARQAFNSWTSAVGFSVG
FT                   AGLGMTPDPIKAAAALASSGSLKEYETYRRLRDQAEYDDWEAQRSGAARKLIEPGSVIP
FT                   ARLFFGETPMMRGFDHRVGKPENHILRCMYAGRKEETSLFYFWQGRPPQDIAILLAMNP
FT                   GGLARLKDHAVDQCPPDDKQARAIEASPIKAVITPEMARDARAQRNSIPLDPIEAQAIQ
FT                   DRNAAARQKLDARKAREDERNAKLQACREALQTEVLAARQDRDRVATDAARAKYRDCSR
FT                   NAGK"
FT   gene            21608..22459
FT                   /locus_tag="AXYL_00021"
FT   CDS_pept        21608..22459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00021"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 3 family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13383"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMX0"
FT                   /protein_id="ADP13383.1"
FT                   /translation="MFTQILVASRLGVAHALGAFMLCTAAPMAFGAATIKADSLTVGSD
FT                   LTYPPYAYMDGGKPAGFDADFSRLLASKLSLAPVFVDTRFPDLILGMRARRFDTVASAL
FT                   YVTPERTKLIDFIPYLKTGASLLVLASSQYAPTGPEALCGKRVASIKGASWTPKLQKVS
FT                   RETCQPKGQGEIKVLEFPTSPEAMMALRSQAADAMIEDAAVVHGMLAQSKDSLKVTSTS
FT                   LLYPIVIGLGINKESKELQSALNGALQRARDSGEYQALLARYGLEEPSAAEVQAALAGP
FT                   AR"
FT   gene            22482..23990
FT                   /locus_tag="AXYL_00022"
FT   CDS_pept        22482..23990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00022"
FT                   /product="glutamine transport ATP-binding protein GlnQ 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13384"
FT                   /db_xref="GOA:E3HMX1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMX1"
FT                   /protein_id="ADP13384.1"
FT                   /translation="MHFDWDYAVSLLWDTDFWKACWVVVKLSTATWVIGVAAGFLLALG
FT                   KQAKNPFVSRLAGLYIWFFRSLPLLVLLVFIYNLPQVFPAAGALLSDPFYAGLTALVVS
FT                   ETAFIAEIHRGGILGVPRGQIEAGRALGIRYAGIQRMIVIPQALRIALPALSNEFITIA
FT                   KLTSLVSVISLAEILLVGQRLYTQNFLVFETMLAVALYYVLIVTLFDKLLGWLESHMNI
FT                   LRRAPKPLALDESARREIQEGQSGPALTAAGDAPALEVRQARKRFGDHEVLKGIDLTVK
FT                   AGEVISIIGPSGSGKTSLIRTLNGLETLDGGEVLLHGKPFLGSPGTGAQAGPGDRILDI
FT                   GMVFQSFNLFPHKTVLQNVMLAPEYHGRGSAGVLRREALVLLNKVGMLDHAHKYPHQLS
FT                   GGQQQRVAIARALAMRPSIMLFDEPTSALDPELVAEVLKVVETLAREGMTMLIVTHEMG
FT                   FAFKVSDRVVFMETGRVLLDAPPADVLASEDPRVKDFLSHVHVS"
FT   gene            23974..25323
FT                   /locus_tag="AXYL_00023"
FT   CDS_pept        23974..25323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00023"
FT                   /product="amidase family protein 1"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13385"
FT                   /db_xref="GOA:E3HMX2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMX2"
FT                   /protein_id="ADP13385.1"
FT                   /translation="MSMSPERCDISLRAVSTCLERASADPVSAALALVARRDEDALAEA
FT                   RARDALRAIAPDDEPLAGMVLGVKACFDVRGWTTHAGSQVLADAPAARRDAALVQALRR
FT                   AGAVLLAQNNMTEFAYGALGLNARFGTPLSPLMADVPRVAGGSSSGGAVAVAQGMVSLA
FT                   LASDTSGSARIPAAFCGVAGFKPSRGRYEDAGMMYLSPTFDVPGIIAADAAQCLLVDKV
FT                   LAPWDAAMPAPGVQGATPLASKVFVVPDHVEDLLEPEVRRAFAAWLECLMDAGAALRRE
FT                   SMPCLALAGKVARDGGIIAADAYALHASCLAADAARYDPRVGPRMLLGAQVPAHAYIAA
FT                   QRRLADLRREYDRAIAGADAVLTPTVPMLPPPVAQLDDDDSYLRENGRAFSLTEFANRL
FT                   DLPSISIPGHRAAKQAVGLMATGLRGGDRALLLAAAQIEDALGSASRRQH"
FT   gene            25353..25754
FT                   /locus_tag="AXYL_00024"
FT   CDS_pept        25353..25754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00024"
FT                   /product="ectoine synthase family protein"
FT                   /EC_number="4.2.1.108"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13386"
FT                   /db_xref="GOA:E3HMX3"
FT                   /db_xref="InterPro:IPR010462"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMX3"
FT                   /protein_id="ADP13386.1"
FT                   /translation="MIVIHSDDLTDTERHARGPGWESKRIIIKRDGIGYSVHETRVFEG
FT                   AELHLHYKHHYEANYCMEGEGEVLDVATGATHAIRPGTLYALDKNDQHVLRAVKGDLRL
FT                   VCVFNPPLSGQETHRADGSYAEPEAQARA"
FT   gene            complement(25773..26447)
FT                   /locus_tag="AXYL_00025"
FT   CDS_pept        complement(25773..26447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00025"
FT                   /product="bacterial regulatory protein, GntR family protein
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13387"
FT                   /db_xref="GOA:E3HMX4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMX4"
FT                   /protein_id="ADP13387.1"
FT                   /translation="MPAERDSGISIAERISHQLRDDIMEGKLPPGTQLVEVDLAADYGA
FT                   SRNTIREVLHQLGREGLATFIRHKGVVVRRMERKDLREIYAARRALELQAIAGSLPLQP
FT                   ALLDKMLAAIDAAERALSKKKWRNVGTLSLQVHQHIVAQLGSRLLDEFFLTLCAQLRLV
FT                   FASEVDESLIQTPDWIERERRIHGLLVQGRRDLAAQALTDYLDDSERTLMAVLTRLKQQ
FT                   AK"
FT   gene            complement(26501..27346)
FT                   /locus_tag="AXYL_00026"
FT   CDS_pept        complement(26501..27346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13388"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMX5"
FT                   /protein_id="ADP13388.1"
FT                   /translation="MSNYPAAYQVSKGSVLNVDRDFYRTLIADPAQRKLLETHVVPIRS
FT                   GFAWKVPAGHVFRIVTLEGPQVADFNMWNLHNPRERMWASRTRQLQQAHVSTHDRIWST
FT                   LPYLRPMVTITDDTLAGYGTDSDGGRVHDLLGTRCDPYVNKLLSGEDFHFHCHSNLTRA
FT                   VAPHGLTEFDVHDVLNVFQVTGLNDDDKYFMKACPAKPGDYLEFFAEMDLLCALSTCPG
FT                   GDLSVPMWGPDARDPIDVCRPLGVEVYALDPALLQGWTPPEVSPYKGVHGLHPEKVEWK
FT                   "
FT   gene            complement(27443..28366)
FT                   /locus_tag="AXYL_00027"
FT   CDS_pept        complement(27443..28366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00027"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13389"
FT                   /db_xref="GOA:E3HMX6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMX6"
FT                   /protein_id="ADP13389.1"
FT                   /translation="MKPLDLNLLLTLDVLIQEGSVVGAARRLNLSTPAMSRSLARIREA
FT                   VGDPVLVRSGRGLAPTPRALALHEQVRHVIDQAQAVFTAFGEDVNLATLTRVFTLRAND
FT                   VFVGGYGGRLREHLRRYAPRAVLRFVSEGNHDADALSGDADLYIGSSQKFGADIKVQTL
FT                   FTTAFCGLARNEHPIFKAPITPQRFCAYDHVSVSRRGRAQGPIDDTLEELGLARHVTLI
FT                   TPTFHAAIFALADSDLVLPSMPQNLMPGVERLGLKLRAFEVPVSMRPVTVVQAWPPRLD
FT                   SDPAHRWLRQTIKQVCGTPAEASPTL"
FT   gene            28531..29013
FT                   /locus_tag="AXYL_00028"
FT   CDS_pept        28531..29013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00028"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13390"
FT                   /db_xref="GOA:E3HMX7"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMX7"
FT                   /protein_id="ADP13390.1"
FT                   /translation="MALEVLELHHHAVRMPLDKVAAMGAFYGHVLGLDTDRGRWEIPGI
FT                   AGYFLDMGNDCQIHLLGSDGPSPYSQGPGCDPVENHVALAVRDIAAAEAELQRLAVDYW
FT                   KLDNVAAPELMQLFLRDPVGNLIELHQIGRCRCKRSDRAFADAKAAQGAAPSQGRD"
FT   gene            29031..29705
FT                   /locus_tag="AXYL_00029"
FT   CDS_pept        29031..29705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00029"
FT                   /product="flavoprotein oxygenase DIM6/NTAB family-like
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13391"
FT                   /db_xref="GOA:E3HMX8"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMX8"
FT                   /protein_id="ADP13391.1"
FT                   /translation="MFIDLNDLAGPARYKLLTAAIVPRPIAWIVSRDAAGTTNVAPFSF
FT                   FNLMSGDPPLICVGIGVRGDAPKDTARNIAERGEFTVSLVSAPQAGRMNVTAVDFPAGV
FT                   DESREAGLELSPSRRIEVPWVAQSPVAFECRVHELMRIDRRSLIVAQVAAMHVRDDVVA
FT                   DREHLYLDGPAMDLLARLHNPGWYCRPQAAFQMPQLTLAQWEALKQSGEAERYLEQGAG
FT                   ER"
FT   gene            complement(29724..30656)
FT                   /locus_tag="AXYL_00030"
FT   CDS_pept        complement(29724..30656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00030"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13392"
FT                   /db_xref="GOA:E3HMX9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMX9"
FT                   /protein_id="ADP13392.1"
FT                   /translation="MAIPRMGLRHIEAFRAVMMTGSMTAAARRVHTSQPHVSRLIAQLE
FT                   AITQFALFDRNGSRLSPTQDGSRFFQEVEKTFIGLAGLESAAASIRSFSASRLSVAAMP
FT                   RLAGGLLARIVAAFKTEYPDVMVSIHSGNASTVHNWISSGFCDTGLAMLSGDSPGIQVE
FT                   PVLTMSCVAVVPKGHRLAKLKKLKPADFAGEPFVAFTSGTPLREKIDAVFRTAKVERQT
FT                   VAEAGLGSSICALVGAGLGVALINPLAAREEYAAHNVEIRPFSPAVPVTVALLYPPYHT
FT                   RTRLVSVFSRYAHQLMLEEMGDLKARTGR"
FT   gene            30828..31739
FT                   /locus_tag="AXYL_00031"
FT   CDS_pept        30828..31739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00031"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 3 family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13393"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMY0"
FT                   /protein_id="ADP13393.1"
FT                   /translation="MKALAAISAAVALLGGAASAHAEGPSRLDKIKETGVITLGHPETS
FT                   VPFAYLDGNQKPIGYTVEICQEVAQYVKAALKLPKLEVRYNPTTSATRIPLLANGTIDL
FT                   ECGNTTNNLERHKLVSFAPTTFVAQVVLVARKDGGVDPNNLESFRGKSIAAQAGGQTFR
FT                   LISQLNAKGNLGITMAPTKDTAETILMVESGRAAGSANDDGIAYGAVASSKNPDAFVIG
FT                   TKGLEMAPYGIMEPKDDPAFKKVVDDAVRDLIKTGKVAAIYDKYFNSPIPPKQINLKYP
FT                   MSDALKRALANPTDSGDPKAYE"
FT   gene            31806..32579
FT                   /locus_tag="AXYL_00032"
FT   CDS_pept        31806..32579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00032"
FT                   /product="amino ABC transporter, permease protein, 3-TM
FT                   region, His/Glu/Gln/Arg/opine family domain protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13394"
FT                   /db_xref="GOA:E3HMY1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMY1"
FT                   /protein_id="ADP13394.1"
FT                   /translation="MGIAIKGRGMNYNWSWSVFLDMSPDGVHTFLQTIFIGVGWTLALA
FT                   LTAWVFSLLLGSVLGVMRTASSRLMNALGATYVEVFRNIPLLVQMFLWYFVLPELLPHA
FT                   WGLAMKQMPQPWGQFVPAVLCLGFYGSARVAEQLRAGIQSLPRGQFQAGTALGLTEAQV
FT                   YRYVILPEAFRIVLPPLTSEFMGTIKYSSVALTIGLLELTGQARSMAEFSFHIFEAFSA
FT                   ATVIYLIINGIVVLGMRMLERHVAVPGLIGSAKRP"
FT   gene            32589..33278
FT                   /locus_tag="AXYL_00033"
FT   CDS_pept        32589..33278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00033"
FT                   /product="amino ABC transporter, permease protein, 3-TM
FT                   region, His/Glu/Gln/Arg/opine family domain protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13395"
FT                   /db_xref="GOA:E3HMY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMY2"
FT                   /protein_id="ADP13395.1"
FT                   /translation="MGKFDFDVIWAALPYLFKTGMTFTLTLTALAGVMGLALGTLLAMM
FT                   RLSRFKILSVPAGIYVNVMRSIPLLLVIFWFYFLVPYIAAWVVGSPTPLRVGAFNSAVI
FT                   TFTLFEAAYFCEIMRAGIQSIARGQVSASMALGLNHWQGMRYVVLPQAFRNMLPALLTR
FT                   IIILFQDTSLVYVLSLTDFLGAAAKIGQRDGRLVELYLFVAVVYFVICFTASRLVKLLE
FT                   KRTRVLR"
FT   gene            33312..34070
FT                   /locus_tag="AXYL_00034"
FT   CDS_pept        33312..34070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00034"
FT                   /product="glutamate/aspartate transport ATP-binding protein
FT                   GltL 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13396"
FT                   /db_xref="GOA:E3HMY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMY3"
FT                   /protein_id="ADP13396.1"
FT                   /translation="MQLSSQPPMIAIKQVSKWYGDFQVLDDCSTTVGRGEVVVVCGPSG
FT                   SGKSTLIKTVNALEPFQKGEIQVNGISVGDPRTNLPKLRAVAGMVFQHFELFPHLSVTE
FT                   NLCLGQLKVLKRGKDEARQRALALLERVGLSAHKDKHPGELSGGQQQRVAIARALSMDP
FT                   VVMLFDEPTSALDPEMVNEVLDVMTDLAAEGMTMMVVTHEMGFARRVADRVIFMDGGKI
FT                   VEDCDKEQFFGDVEERAPRTRQFLSKILQH"
FT   gene            34076..35131
FT                   /locus_tag="AXYL_00035"
FT   CDS_pept        34076..35131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00035"
FT                   /product="L-allo-threonine aldolase"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13397"
FT                   /db_xref="GOA:E3HMY4"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMY4"
FT                   /protein_id="ADP13397.1"
FT                   /translation="MTQTHPAATRAPVDLRSDTVTHPTAAMYERMRTAPIGDDGLDGDP
FT                   TVRELEAYVATQLGKEAGLFVPSCTMANLLAVLAQTQRNEQVVLESAAHMYTSERGAAT
FT                   FTGSFYLGVRGSDGAMDLNRLEEALLSGGHRLKTALVTMETSHNNAAGAVLPLDHMQAV
FT                   LGLARAAGAPVHLDGARLYNAAVALGVAAGEIARHADTVSLCLSKGLSAPVGAVLVGSQ
FT                   PVMARARVLRRMLGGTQRQSGIMAAAGLEGVQAMSGRLAEDHVRARRLSAGINRLGRTI
FT                   SATEPQTNIVQVETAGTGMSNTEWVAALQAAGLLVRPWGRTRLRCVTHRHIGDADIDAA
FT                   VRAFETVLNAG"
FT   gene            35174..36079
FT                   /locus_tag="AXYL_00036"
FT   CDS_pept        35174..36079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00036"
FT                   /product="EamA-like transporter family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13398"
FT                   /db_xref="GOA:E3HMY5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMY5"
FT                   /protein_id="ADP13398.1"
FT                   /translation="MTTTHLSRKDYLCALAVVVIWGTNFVAMKVGMRGLSPMLLGALRF
FT                   ALAAFPLILFVRAPRLPWRWVAAYGLVQGLGQFGLLFTALKFGMPAGMASLVIQTQAFF
FT                   TLLLAAPLLHERAQRHHWIGLGVAALGLAVIAGGRGEGPGQMTMVGFALTLGGAFMWAV
FT                   SNIIVRLASRKAPGYDPFAFIAWSSAAPVLPFLLLAVLIDGWEPVTGMILGMGWGEILS
FT                   VLYLAVLATLVAYTLWTQLLTRHAAAKIAPFSLLVPVVGLWAASMAFGERLEPLQWLGV
FT                   ACVLAGLLFNQLGGRWLRTR"
FT   gene            complement(36158..36454)
FT                   /locus_tag="AXYL_00037"
FT   CDS_pept        complement(36158..36454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00037"
FT                   /product="acylphosphatase family protein"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13399"
FT                   /db_xref="GOA:E3HMY6"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMY6"
FT                   /protein_id="ADP13399.1"
FT                   /translation="MQDPKADTHIETVHVTITGTVQGVGYRHATVRRAHMLGAKGWVQN
FT                   LPNGTVEALVQGTADQVDHMLEWLRRGPPGASVEEITTRREYTDKRYIRFEQL"
FT   gene            36614..37510
FT                   /locus_tag="AXYL_00038"
FT   CDS_pept        36614..37510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00038"
FT                   /product="phytanoyl-CoA dioxygenase PhyH family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13400"
FT                   /db_xref="GOA:E3HMY7"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMY7"
FT                   /protein_id="ADP13400.1"
FT                   /translation="MEETSLLSEAETARYREQGYLALNDMCPQDEVGYIRRTLLDLFAN
FT                   KTGYNEGAQYDFVSRDDPSKPAKFPSLHDPRHYAPGLLKTEYHERTLELARQLLGPEAA
FT                   LYGEHALLKPGPHGPETPWHQDEAFRSPDFIYNELSIWLALQPATLENGCMQFIPGSNQ
FT                   WEVLEHRSPGGDKTLHPLECCGDFARDQAVPEPLDPGGITVHDARTLHFTGPNTSQSPR
FT                   LAYILIYNTPPVYKPGRREFPWLEGRWTDSQTRKKQWHKRGGLAVDVMRRLPGARLTSP
FT                   RWVAWATIRAVSKVWPR"
FT   gene            37716..38879
FT                   /gene="lldD1"
FT                   /locus_tag="AXYL_00039"
FT   CDS_pept        37716..38879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldD1"
FT                   /locus_tag="AXYL_00039"
FT                   /product="L-lactate dehydrogenase [cytochrome] 1"
FT                   /EC_number="1.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13401"
FT                   /db_xref="GOA:E3HMY8"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMY8"
FT                   /protein_id="ADP13401.1"
FT                   /translation="MTANLSKITCVEDLRAIAQKRVPRMFYDYADSGAWTEGTYHANES
FT                   DFQKIKLRQRVAVNMEGRSLRTTMVGHDVVMPLAIAPTGLTGMQHADGEILAAKAAADF
FT                   GVPFTLSTMSICSLEDVAEATKKPFWFQLYVMRDREFVANLIDRAKAAGCSALVLTLDL
FT                   QIMGQRHKDIKNGLSTPPKPTLRNLINLATKPRWCMGMLGTKRRTFGNIVGHVKGVDDL
FT                   SLLSSWTADQFDPRLSWDDVEWIKQRWGGKLIIKGILDVEDAQMAANSGADALIVSNHG
FT                   GRQLDGAMSSIAALPSIADAVGSKIEVWMDGGVRSGQDILKAVALGARGAMIGRAFLYG
FT                   LGAYGQAGVKRVLEILYKEMDTTMALCGRRSIEPGDRSILLPGTYPN"
FT   gene            38984..40057
FT                   /locus_tag="AXYL_00040"
FT   CDS_pept        38984..40057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00040"
FT                   /product="bacterial extracellular solute-binding family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13402"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMY9"
FT                   /protein_id="ADP13402.1"
FT                   /translation="MTRNKQDKARHPGAGKRLLGAAVAALLSAGAAAQQTTLHVGMNGG
FT                   DMARVFTQHVFPAFERAHNVRIVVEPGISTEVLARAQAEKDKPRLHLMFLDDGVMARAI
FT                   SMGLCAQLNDDPVLKELYPTAVKKDRMAAGIDIGMTGLGYNTKVFAERGWAPPTSWMDL
FT                   ADPKYRGQVVVQSASSSTFGLHTFLMINRILGGDDRNYGPGFAHWPTVVGPNVREYLPD
FT                   SARLADMVQADEAALFPWTPTAITRLKKRGVHVEYAQPREGSMILMVGECVVAGNSQPE
FT                   LSQKLALYLLSERAQTKALEMGGHFPSNRNVLAPADHADALQRFQGYMSNAKIPNWDQI
FT                   NETRPAFNARWNREIGR"
FT   gene            40137..40970
FT                   /locus_tag="AXYL_00041"
FT   CDS_pept        40137..40970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00041"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   AraC family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13403"
FT                   /db_xref="GOA:E3HMZ0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMZ0"
FT                   /protein_id="ADP13403.1"
FT                   /translation="MKPATLNHYGQRLEPVLRWLASHPDADPDLYRLAELACLSPYHFH
FT                   RVYRAMMGETVNATVQRIRMHRAAVALGNSEASLREVAQRAGYESDAAFNRAFGATFGI
FT                   SPGRYRAVRSRPFDPQELGMYPIKIETFPGATLAVLPHRGSYQEIGPLFSRAFMLAVSR
FT                   GIAQPDSIGYGVYFDDPEQVPASQLRSMAGMSVAPDADLGAELERFEIPQGRCAILTYT
FT                   GPYNEMDKPYNWMFSEWLPGSGEVPADFPMFEQYLNDPRTTPPAQLQTRICLPLK"
FT   gene            complement(41001..42281)
FT                   /gene="codA"
FT                   /locus_tag="AXYL_00042"
FT   CDS_pept        complement(41001..42281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="AXYL_00042"
FT                   /product="cytosine deaminase"
FT                   /EC_number="3.5.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13404"
FT                   /db_xref="GOA:E3HMZ1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMZ1"
FT                   /protein_id="ADP13404.1"
FT                   /translation="MLDLILRHCTLPDGRQNIDIGIANGRIVALEPALKAEAAQTVDAA
FT                   GQLVAPPFVDAHFHMDSTLSFGLPRVNQSGTLLEGIALWGELKPLLTQEALVERALAYC
FT                   DWAVARGLLAIRSHVDVCDPRLLATEALLHVREKVRPYLDLQLVAFPQDGVLRAPGALD
FT                   NLKRALDMGVDVVGGIPHFERTMQDGAESVRILCELAAERGLRVDMHCDESDDPLSRHI
FT                   ETLAYHAQRLGLQGRVTGSHLTSMHSMDNYYVSKLIPLMREAGVAAIANPLINITLQGR
FT                   HDTYPKRRGMTRVPELLAAGVPVAFGHDCVMDPWYSLGSGDMLEVAHMGLHVAQMTGQD
FT                   AMRACFEAVTTTPAKILGLDETGLAVGKRADLVLLQARDAVEALRLRATRLMVLRAGQV
FT                   VATTPPATATLNLPGRPASVSFQTPAR"
FT   gene            complement(42493..43443)
FT                   /locus_tag="AXYL_00043"
FT   CDS_pept        complement(42493..43443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00043"
FT                   /product="inner-membrane translocator 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13405"
FT                   /db_xref="GOA:E3HMZ2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMZ2"
FT                   /protein_id="ADP13405.1"
FT                   /translation="MEWMDLMSSSAFWVAVLRLATPLILGTLGVLLCERAGVLNLGIEG
FT                   IMAAGAFTGWLVVYLGAPLYVGVLAAAFAGAVFGLLHAVLTVPLGLSQHVSGLGVTLLA
FT                   TSLSYFAYRVTFPSVTTPPTITPFAEMKFLDGIPFIGPVLAGQTPMTLLALAAVPILAW
FT                   VLNRTPVGLAIRMVGENPAAAEGQGLSVTRLRMGAIVAGSALMGVAGSFLTLAAFNAFF
FT                   FNMVNGRGWVCVALVVFASWRPGKALLGALIFAFFDALQLRMQQGGAALPGLPELPYQV
FT                   YLMLPYVLSILALVVMARRAAYPQALMKPYRKGER"
FT   gene            complement(43454..44527)
FT                   /locus_tag="AXYL_00044"
FT   CDS_pept        complement(43454..44527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00044"
FT                   /product="inner-membrane translocator 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13406"
FT                   /db_xref="GOA:E3HMZ3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMZ3"
FT                   /protein_id="ADP13406.1"
FT                   /translation="MKLILERRPEPSRLALALAPFAAIAFTLAVCTLLVAWAGAPVGRT
FT                   YALLFEGAFGSRFALSETLTRATPLMLTGLACAVAFRARFYNIGAEGQLYLGALAAVAV
FT                   GGLHDGTGFDLPVPALFAGMMLAAALAGALLLLIPAILKTRLGVDEVVTTLLGNFIVLL
FT                   FVSMMLDGPMKDPMAMGWPQSVALNGDLELGKLIERTRAHTGLLWAAGLALGLWLLNRY
FT                   TVFGFQMRAVGANAHASRFLGLPVSRVMLGTAMLSGALAGLAGAIEVAGRTGYVTLDMS
FT                   PGYGYTGVVVAMLAGLHPLGVILASLFVAGMLVGADSMSRAIAVPNYIADVIVATSLLA
FT                   MLVATLFAQYRLRRNRA"
FT   gene            complement(44577..46106)
FT                   /locus_tag="AXYL_00045"
FT   CDS_pept        complement(44577..46106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00045"
FT                   /product="ABC transporter family protein 1"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13407"
FT                   /db_xref="GOA:E3HMZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMZ4"
FT                   /protein_id="ADP13407.1"
FT                   /translation="MNHAPLALQLSGITKRFGSLTANDDISLTLRQGEVLALLGENGAG
FT                   KSTLVSILFGHYVADAGNIEVFGQPLPAGRPDAALAAGVGMVHQHFTLADNLTVLDNIM
FT                   VGTESLWKLASGRGKARQRLVELGQRFGLGVDPDARVGTLSVGEKQRVEILKALYRGAR
FT                   VLILDEPTAVLTPQEVQDLFATLRGFVDEGLAVIFISHKLDEVMAVSGRVAVLRQGKLV
FT                   AERETASTNPAELAELMVGRKVVMPHAEAVAAAEQAAPVVTLSQVTVRDGRDGATRLDS
FT                   LDLVVHKHEIVAIAGVAGNGQQALVSVLTGLRQPTDGTIRLGPEHAAAPTTPAGWTAAH
FT                   VGRIPEDRHGEGVIGDSPLWENAIVEDLKDPRFARWGLIRARAGKAYAQALAKQFDVRA
FT                   ASLDVRTRSLSGGNMQKLILGRTLARQPRFIVADQPTWGLDIGAVAYVREQLLAARTRG
FT                   AGVLLVSEDLEEIFALADRIAVLCSGKLIAVKPVSEWTPATVGLAMTGTQG"
FT   gene            complement(46103..47134)
FT                   /locus_tag="AXYL_00046"
FT   CDS_pept        complement(46103..47134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00046"
FT                   /product="basic membrane protein family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13408"
FT                   /db_xref="GOA:E3HMZ5"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMZ5"
FT                   /protein_id="ADP13408.1"
FT                   /translation="MKAFSTPSVAGIARRGLLKLAAAAAGALLFSGVAQAQAPAKTKVA
FT                   AIYTVPVEQQWVSRIHKALVAARDRGEIEYTFSENVTNADYERVMRQYAEQGNKLVVGE
FT                   AFAVEAAARKVAKDYPQTAFLMGSSGKPQQPNFSVFDNYIQEPAYLTGMIAGGMSKTGK
FT                   IGLVGGYPIPEVNRLMHAFIEGAKEVNPQAEFTVTFIGSWFDPPKAKEAAFAMIDKGAD
FT                   VLYAERFGVSDAARERGKLAIGNVIDTQQQYPETVVASALWSMEPTIDEALKQVRAGTF
FT                   KADDYGQYSLMKHKGSSLAPLGTFESKIPADLMAKVQAKQKAILDGGFSVKVNDKEPKS
FT                   SAR"
FT   gene            47866..48507
FT                   /locus_tag="AXYL_00047"
FT   CDS_pept        47866..48507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13409"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMZ6"
FT                   /protein_id="ADP13409.1"
FT                   /translation="MEWELRETVFSAPRMGRYLNRYGGDVLRAAVAYDHNVLLAQALMP
FT                   ALQTMEIVLRNAIHRSLSRSMGSVDWWNGLPSPEFEWLQRAVGDAGVKIQRRRERVTTD
FT                   KIVAELTFGSWTRLFNAQHGRTLWGRLLLAFPTCPKAKRQRGPISSSLNRIRDLRNRVM
FT                   HHEPSLWVAPSVKDIHDDIQEVLDWIDPGINRWLVHHDSLPARWAECAAI"
FT   gene            48642..49571
FT                   /locus_tag="AXYL_00048"
FT   CDS_pept        48642..49571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00048"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13410"
FT                   /db_xref="GOA:E3HMZ7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMZ7"
FT                   /protein_id="ADP13410.1"
FT                   /translation="MQDIQLLLEQYGGWLVFANVLVEQAGLPVPAYPMLIAAGALGGAG
FT                   GWLVPWMAATVACLLADSLWYAAGQRYGSRLLGVICKMSLSQDSCIRQTQRLYLRIGVR
FT                   ALLVCKFLPGAGALSTVMAGLTGTPYRRFLGYDLVGSLIWSGSALLLGGLFHNVVNDFL
FT                   EILGTYGAMGLGVLASVLALYILARFLRRRILLRSLRVIPRLSVDELMQWRQAGRNALV
FT                   FDVRPEAMREEQRIPGAIAVDLKAPLPRLDAEALESDIVVYCACPNEVSAALLASRLRA
FT                   AGYPKTWALRGGYQAWQEHEHPLPPQGA"
FT   gene            49622..50548
FT                   /gene="panE1"
FT                   /locus_tag="AXYL_00049"
FT   CDS_pept        49622..50548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE1"
FT                   /locus_tag="AXYL_00049"
FT                   /product="2-dehydropantoate 2-reductase 1"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13411"
FT                   /db_xref="GOA:E3HMZ8"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMZ8"
FT                   /protein_id="ADP13411.1"
FT                   /translation="MRILFLGAGGTGGYFGGRAAQAGADVTFLVREPRAARIREQGLRI
FT                   KSPLGDATLQPQLVTQQTLQGSYDVVVLSCKAYDLASAIEAIRPAVGPDTAVLPIMNGV
FT                   LQYDVLDREFEPHRVLGGLCQINATLGPEGEVVHLGKYANIVFGERAGPARSDRCVALE
FT                   QALAGGEYVSRLSTDIYQDIWEKYVFLTTLAAATCLMRGSVGQIASTDDGIDIMSGLLQ
FT                   ESQAVAAASGHAVRPEADASARKLITDRTQPVTASMFRDLSQGLPVEADHIVGDMVRRA
FT                   RTLGVDATYLRTAYAHLQVYQAQRAAA"
FT   gene            50813..51424
FT                   /locus_tag="AXYL_00050"
FT   CDS_pept        50813..51424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00050"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13412"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HMZ9"
FT                   /protein_id="ADP13412.1"
FT                   /translation="MKVALIGITGRVGSRVADELLKRGHQVTGIARNLSDVNPQLGLTI
FT                   KQGDATDPEALTSLLTGHDAVISASRFVSSDAKPLLSAVKDAGVPRLLVVGGAGSLLVA
FT                   PGKMLIDTPEFPDAYKPEARAGVVFLDTLRHEKVLNWTFLSPSALFEPGERTGKFRLGD
FT                   DTLLADDEGKSWISMEDYAIALVDELEAPKHSRRRYTVGY"
FT   gene            51559..52017
FT                   /locus_tag="AXYL_00051"
FT   CDS_pept        51559..52017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00051"
FT                   /product="snoaL-like polyketide cyclase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13413"
FT                   /db_xref="GOA:E3HN00"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN00"
FT                   /protein_id="ADP13413.1"
FT                   /translation="MRMKLKSLALCMLVAASCLAAVPAAAAAPQSNKDLVVAFFRMMFQ
FT                   DRDIDEAVRLYVSPNYIQHNPYMQDGVGPLVDFFPAYFEQHPQSIVEIKRVIAEGDLVL
FT                   IHNLWRDSPEDRGQAVMDIFRVENGKIVEHWDVSQEIPENPANKNGMF"
FT   gene            52028..52597
FT                   /locus_tag="AXYL_00052"
FT   CDS_pept        52028..52597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00052"
FT                   /product="flavin reductase-like domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13414"
FT                   /db_xref="GOA:E3HN01"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN01"
FT                   /protein_id="ADP13414.1"
FT                   /translation="MASIEPVDLSRAYLLLNHGPTVLVTSAHGDARNVMAAAWAMPLDF
FT                   SPPKMLVVVDKNTYTRGLIEASGEFALCIPSRAQARATLRVGTDSGRDEDKFQASGLTT
FT                   FPASKIGAPLISGCLGWLECRVVPEPHNQQAYDLFIGEVVAAWAEPEAFSGNRWHFPDD
FT                   ERRSVHYVAGGSFFATGEAFNVSDPE"
FT   gene            52603..53112
FT                   /locus_tag="AXYL_00053"
FT   CDS_pept        52603..53112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00053"
FT                   /product="nucleoside 2-deoxyribosyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13415"
FT                   /db_xref="GOA:E3HN02"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN02"
FT                   /protein_id="ADP13415.1"
FT                   /translation="MRSVYLAGFDVFLPDAAAHGKRLQALCATYGFDGLFPLDNEAPRD
FT                   LSGQALAQWIYRENVALIRRADMVMANLNPFRGAEPDSGTAFEVGYAIACGKPVWGYTG
FT                   QAGSLIDQVAVGAAADDGASRMVDAHGYTVEDFGLNLNLMLACSARIVTGSAADCLAQM
FT                   AREPGR"
FT   gene            complement(53176..53826)
FT                   /locus_tag="AXYL_00054"
FT   CDS_pept        complement(53176..53826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00054"
FT                   /product="bacterial regulatory protein, TetR family protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13416"
FT                   /db_xref="GOA:E3HN03"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN03"
FT                   /protein_id="ADP13416.1"
FT                   /translation="MTAIPQPRKSPRQLRSQHTVETILQATARVLATHGYAGTNTNLIA
FT                   ETAGVSVGSLYQYFPNKNALIAALHNRHDNQMLDVIDGVLDSNPAATLRERVAAIVEAM
FT                   LHAHMLEPALHRVLEREFPLFDQPHEHSRADQDIHRRMRHLLELHRAEIAQQDRDLATY
FT                   VVLRIMESLVHAAALEPPAGFSTQQLEQAVVDAVMGYLGEPAARAAPRKTARR"
FT   gene            53976..55175
FT                   /locus_tag="AXYL_00055"
FT   CDS_pept        53976..55175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00055"
FT                   /product="major facilitator superfamily protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13417"
FT                   /db_xref="GOA:E3HN04"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037541"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN04"
FT                   /protein_id="ADP13417.1"
FT                   /translation="MSHSSTAGAMPAAQGPVRSVFAQVLPLALAVFVGFFMIGLPMPVL
FT                   PLYVDGTLALGALVVGVVAGLQFAAALLSRAYAGSLADRRGAKRAVVGGFVLGSVAGLF
FT                   YLLADDLSARPQAALAALLAGRALMGCAESLIVTGALSWGVGRVGPQNAGRVMAWVGVA
FT                   IYAAYALGAPTGMRLYGVTGFAGIAWATALIPLAALALVLPLRGARAAGGVRTPFYKVL
FT                   GLVLLPGAGLALASVGFGVITAFVSLLFSQRGWDGAAWMFTAFGVGFILARVFFAGLPD
FT                   KLGGARVALVCVLIEAAGQWLIWTGTTPAWAFAGALLTGAGYSLAFPAFGVEAVRRVPA
FT                   ASRGAAMGAYVAFLDVALGLSSPAAGWLAGEQGYGAVYAMGGACALAAMVVAMALRTRR
FT                   "
FT   gene            complement(55214..55933)
FT                   /gene="ribB"
FT                   /locus_tag="AXYL_00056"
FT   CDS_pept        complement(55214..55933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="AXYL_00056"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13418"
FT                   /db_xref="GOA:E3HN05"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN05"
FT                   /protein_id="ADP13418.1"
FT                   /translation="MSNVTLTPQSPIPSLASQPFAARLQRALHHLRLGRPVILMDDFDR
FT                   ENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPGETLDRLELPPMVQRNQSRFATAFT
FT                   VSIEAREGVSTGVSAVDRVTTIRAAISPSAQSDDIVSPGHVFPLRAQPGGVLTRRGHTE
FT                   GSVDLAVLAGLRPAGVLCELMNADGTMMRGAALERYAAQHGLVALTIAELADHLQQLKD
FT                   GQAEAIDDEVLEMAATV"
FT   gene            complement(56312..56839)
FT                   /locus_tag="AXYL_00057"
FT   CDS_pept        complement(56312..56839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00057"
FT                   /product="SET domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13419"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN06"
FT                   /protein_id="ADP13419.1"
FT                   /translation="MTNEDTPIKPWYAVRRSKLHGNGVFAARKIPAGTRIIEYGGERIS
FT                   AKEADRRHPTNPDDPFHTFFFALSSGRVIDGGDQGNDARWINHSCQPNCEAQEGKHGKR
FT                   VYIVALQDIPRGTELSYDYGLVLDGRITKKLKEGYRCLCGTPPCRGTMLALPAKKKKKE
FT                   TAEQPEPVEAAS"
FT   gene            56947..57867
FT                   /locus_tag="AXYL_00058"
FT   CDS_pept        56947..57867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00058"
FT                   /product="bestrophin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13420"
FT                   /db_xref="GOA:E3HN07"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN07"
FT                   /protein_id="ADP13420.1"
FT                   /translation="MIVRPRPSALALFFVLRGSIIPRILSRILVITALSCLVVWMYHQE
FT                   WFSPAHLSAVPFSLFGLALSVFMGFRNNVCYDRWWEARKQWGELIVQARSLARESAVLL
FT                   AASTANPVQERIVRRCIGFGYALAARLRQEDMAAAARPWVQQDEAETLTGCRNVPDALL
FT                   MAINRDLAACLRRGELTDILYQALTQRVAACAAIQAACERIKFTPSPFAYSLLLHRTAW
FT                   LFCLLLPFGLVGTLEYMMPAAVTIVAYTFFGLDAVGDELEDPFGSDENDLPLSALARVI
FT                   EIDLLEGLGVRPLPEPAEPVDFVLR"
FT   gene            complement(57875..58345)
FT                   /locus_tag="AXYL_00059"
FT   CDS_pept        complement(57875..58345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00059"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   AsnC family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13421"
FT                   /db_xref="GOA:E3HN08"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN08"
FT                   /protein_id="ADP13421.1"
FT                   /translation="MNLDKFDLAILKVLQDNARASLNDIGAAVGLSSTPCWNRIKRMES
FT                   AGVIRGYTVDIDPASLGFMDTVIVHVTLESHSEETLYEFGRALAQIPEVLEAFLVSGDY
FT                   DYYIRIAVRDTRDYERLLREQLYRIPGIRHSKSCFVLRRLKETKLPLTGLAE"
FT   gene            58448..60259
FT                   /gene="ilvB1"
FT                   /locus_tag="AXYL_00060"
FT   CDS_pept        58448..60259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB1"
FT                   /locus_tag="AXYL_00060"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type 1"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13422"
FT                   /db_xref="GOA:E3HN09"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN09"
FT                   /protein_id="ADP13422.1"
FT                   /translation="MNDRLHPTAAAALAATDRPAHNGAKILLDTLIAHGVDTVFGYPGG
FT                   AVLPLYDALYAEPRLRHVLVRHEQAAVHAAEGYARSTGRTGVVFVTSGPGMANTTSGLL
FT                   DAMCDSIPVLCISGQVATAAIGTDAFQECDAIGISRSVTKWNTQVRSVDDVAAVTARAF
FT                   ELTRQGRPGPVLLDFPKDVQLAVPRDADDDAVPSQQKLAALRARRQAGKLAPKLPQSAV
FT                   RRAAALIAQAKRPIFYGGGGLVNAGPEACEAYTDLVRHTGAPCTLTLMGLGAFPASDPQ
FT                   FVGMLGMHGTVEANLAMHNADLVVCIGARFDDRITGKLSEFCPHARKIHIDIDPASINK
FT                   VVRVDVALVGDCLPLVRALRAELGDEPMDAARLAPWYKRIAAWRAQDCLGYTPAADAIL
FT                   PQHLMSRLNAALTDRDAIVSTDVGQHQMWAAQYLRFDKPNRWLTSGGAGTMGYGVPAAI
FT                   GAQVAHPDKTVVCVSGDASVLMNIQELSTAMQHQTPVKVVLCNNGYMGMVRQWQELIHG
FT                   GRYSHSYNASLPDFVALARAFGWGAARVDDPAQLDAALAECLAHDGPYFLDVAVTAQEN
FT                   CFPMMPAGHGHQKMMLAEGVWYQDETT"
FT   gene            complement(60355..61134)
FT                   /gene="idnO1"
FT                   /locus_tag="AXYL_00061"
FT   CDS_pept        complement(60355..61134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idnO1"
FT                   /locus_tag="AXYL_00061"
FT                   /product="gluconate 5-dehydrogenase 1"
FT                   /EC_number="1.1.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13423"
FT                   /db_xref="GOA:E3HN10"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN10"
FT                   /protein_id="ADP13423.1"
FT                   /translation="MNTLPYLRNFDLTGQVALVTGSARGLGFCIARALAGCGARVLING
FT                   RNAEAVAAAAGELTAAGLDAHALPFDISDDAAMERAFLDIDRDHRRLDILVNNVGARNR
FT                   KTLRDTSPAEIRELIDTDMVAGMLLAKFAAERMVRQGSGRLIAITSVVGELARSGDAVY
FT                   PAAKQGLTGMVRALAAEFGGYGITSNAIAPGTFATETNAEMVADPAVGPRIAERNPMGR
FT                   WGEPEEIAGAAVFLASPAASYVNGHVLVVDGGLSIQF"
FT   gene            complement(61245..62099)
FT                   /locus_tag="AXYL_00062"
FT   CDS_pept        complement(61245..62099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00062"
FT                   /product="binding-protein-dependent transport system inner
FT                   membrane component family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13424"
FT                   /db_xref="GOA:E3HN11"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN11"
FT                   /protein_id="ADP13424.1"
FT                   /translation="MTTTDSADSLQGQLRLDRRASIARRLRITLWQVLILAIILGSWET
FT                   LTRIPWFTQNTLFDPFFISQPSRVAVRLWEWLQPGPRSVWPHLWLTLQATMVGLLVGVG
FT                   SGFVVGMTLSRSRFLADVFNPFIVAFNSMPRIAFVPLITMFFGLGLASKVVTSWFVVFF
FT                   LVFFNTYKGGRSVERELVDFCRTLGGSPRQILWRVRIPTAAAWTFAALPNAISFALIGV
FT                   VLAEFVGSTTGMGYLMITALATLNATDMFAAVTLLSIVGIALVYCVTWLERRLLHWAPE
FT                   FRE"
FT   gene            complement(62113..62883)
FT                   /locus_tag="AXYL_00063"
FT   CDS_pept        complement(62113..62883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00063"
FT                   /product="nitrate transport ATP-binding protein NrtC domain
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13425"
FT                   /db_xref="GOA:E3HN12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN12"
FT                   /protein_id="ADP13425.1"
FT                   /translation="MITLDKVGKAYQTRQATTHAVGEVSLTIPEGEFVSIVGPSGCGKS
FT                   TLLNMIAGFLRPTTGTIRVDGRVVDGQVPPALGYIFQKDTLLPWFSVRKNVALGLKFQG
FT                   VSADKIERRVAELLEMGHLSQFADAFPHQLSGGMRRRVALLMSLAVEPRILLLDEPFGA
FT                   LDTHTKTHLHRELIEIWRKLGQTIVMVTHDLDEAILLSDRVVVLSGPPSRVLLDERIEI
FT                   PHPRDVFTLRETPQFVTHVQSLWSVLGQQFRAAA"
FT   gene            complement(62883..63941)
FT                   /locus_tag="AXYL_00064"
FT   CDS_pept        complement(62883..63941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00064"
FT                   /product="NMT1/THI5 like family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13426"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN13"
FT                   /protein_id="ADP13426.1"
FT                   /translation="MSNSPDSTTRRRVLAAAGALAGISLINGRVAFAQPKLGRVVYGQG
FT                   SIDPFFAAGYVALKKGYFGEGGLEVEYLNSQSGPRTNQLLAAGQIVFGATAATAAPALT
FT                   LAGKPATLVFGFDRKLTYANVIVRREDFESGKIKSLKDLAGKRVGATQPQSSTWLMALY
FT                   LMQKAGVADKVDIRPLGDLATMLGALKTGSVSASMATMSMMEQAQQEGWGVPIFDATTE
FT                   SSWNEFMGGDVPGIAALTLQDTIQKRPEVVQAFVTGLVRAQDFISANSAAAVTDAIYDD
FT                   YLNAFPRAAIEKTLGVYKETVFLKDNIITQDAYDRMTAIMGDGRQFSNDEIKTVPYDRC
FT                   VNMSFVRRARGL"
FT   gene            complement(64073..66697)
FT                   /locus_tag="AXYL_00065"
FT   CDS_pept        complement(64073..66697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00065"
FT                   /product="DNA topoisomerase family protein"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13427"
FT                   /db_xref="GOA:E3HN14"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN14"
FT                   /protein_id="ADP13427.1"
FT                   /translation="MNKTLIIAEKPSVALDISRALGGFAREGDYFESERYVLASSIGHL
FT                   LSLVAPNDPVKGKWSFTHLPVIPPEFELGPTDKKSAERLKLLVRLAKRKDVDAIINACD
FT                   AGREGELIFRYIIQYAGVKKPIQRLWLQSMTQAAIREAFANLRDDSQLKPLEAAARSRA
FT                   EADWLVGINGTRAMTAFNSKDGGFFKTPVGRVQTPTLAIVAEREERIRRFVPRDYWEVR
FT                   ATFVAAAGLYEGRWIDPQFKKDDRDPEKRESRLWSEAAAQSVVAACREQPGNVTEESKP
FT                   STQMSPALYDLTSLQREANGRFGFSAKTTLALAQTLYERHKALTYPRTDSRYLPEDYIA
FT                   TVQETMRALAKGGSNAVGGLSRHAETVVGNQWVKPNRRIFDNKKVSDHFAIIPTLQIPH
FT                   DLSEAEAKLYDLVLKRFLAVFFPAAEYRVTTRMTEVQGHRFRTDGKVLVSPGWLAVYGK
FT                   EAQGEDANLVPVADGETVRTEDVEAVGLSTKPPARFNEGTLLSAMEGAGKLVDDEELRE
FT                   AMSERGLGTPATRAAIIEGLLNEVYLRREGRDLVPTAKARQLMTLLSGLDVTELTSPEL
FT                   TGEWEHKLKQIEQGGLGREAFMREIAQMTQVIVKRAKEYERDTVPGDYATLQTPCPKCG
FT                   AVVKENYRRFACTACDFSIGKHPGGRTFELPEVEELLAKREIGPLQGFISKMGRPFAAI
FT                   LRISDEFKLEFDFGQSDEDDNEAVDFSGHTPVGSCPKCQSRVFEHGMSYVCEKSVGPEK
FT                   SCDFRSGKVILQQEISREQMEKLLTNGRTDLLDGFVSSRTNRKFKAFLVRQPDGKIGFE
FT                   FEPRPEKPGRAPAKTAAKTATKTAAKKAPAKKAAVKKTATKTATKTAVKKAVKKAAPKK
FT                   TAA"
FT   gene            66760..69390
FT                   /locus_tag="AXYL_00066"
FT   CDS_pept        66760..69390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13428"
FT                   /db_xref="GOA:E3HN15"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="InterPro:IPR025513"
FT                   /db_xref="InterPro:IPR025833"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN15"
FT                   /protein_id="ADP13428.1"
FT                   /translation="MQVGTERQAGSELHAWRQFLARSTLWLGVLLLGSAAVCWVAANWQ
FT                   DMTKVQRFAGIQGLLAVCALAAAWAGLRLRASPGVRRTIPGALLALAGILLGALLALLG
FT                   QTYQTGADTWELFAWWALLLLPWALAAGSQAVWLLWVLVLNVAMALWLGERVFSWVLIF
FT                   GGPGVPGLMMAGLNLVLLLGWELAARRWRASTLVGPRVLAALAISVLVLTQMLGDFLGR
FT                   GLGLYNGIAWVAVTLGLGFYYQKGRRDLIILAMLAAGVICVSLRVAGEWLLRLEPGVWA
FT                   ALPLAALLMAEAVLAARWLRRLAGDPQTAVVAAADSEPAAASAGNSVDPADASAPVAQL
FT                   APVPAPQADPPWYVQCLLGLSAWLSTVLLLVFIAFSGFITSEGGALVAGLVLCAAGVAV
FT                   LRSDAGPFWRQCGTAMAFAGQILIIFGLSSSTSFASACVFVLLMAATVYAVGPDVILRF
FT                   LSGLLIAAAGAGLIWRGLSPDLGGEDLLDAWLGFDVMRATFVWLPIAVTGAWATAVIFS
FT                   VSHRLGGKRAHALQPLAWAFLLSVQGMVWLAGGLSAQQLPAMWQLNPHTAVLVVAGALL
FT                   PLAAAFAVLWPRRHVLTAGVTWGVPIALLILALFWLPSPGVGFALAWLLLGFGLNQSRL
FT                   VVFGVISLLAYLGVYYYQLDVPLLQKALWLGGAALLLFVLRALVWLVPRLMRTIAPSRR
FT                   APLPPVSAPLRWRTLAILGGLALVLVVANGGIWQREKLLASGKVVILELAPVDPRSLMQ
FT                   GDYMALNFAASREVTRLRLGGERPEAEESVMGYEPDGYVMLQTDARGVGQPLRIQPDTH
FT                   PHTDAEVPLRYRIRDNSVRIVTNAYFFPEGQAERYQVAKYGELRVAENGEALLVRMLDQ
FT                   DLKPL"
FT   gene            complement(69377..70273)
FT                   /gene="gluQ"
FT                   /locus_tag="AXYL_00067"
FT   CDS_pept        complement(69377..70273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluQ"
FT                   /locus_tag="AXYL_00067"
FT                   /product="glutamyl-Q tRNA(Asp) synthetase"
FT                   /EC_number="6.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13429"
FT                   /db_xref="GOA:E3HN16"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN16"
FT                   /protein_id="ADP13429.1"
FT                   /translation="MNYIGRFAPSPSGPLHAGSLVAALASWLDARAQNGRWLLRIEDVD
FT                   TPRTVPGAAEVIMGQLDALGLAWDGDIMWQSRRNDAYQAAFDSLAARGLIYGCGCTRRE
FT                   IADSALRGQTAPGADGERPYPGTCRHGLPAGREARAWRVIMPEGVEHFVDRWLGPQEQN
FT                   VAQAVGDIALRRADGLWAYQLAVVVDDAAQGVTDVVRGADLLSSTARQRVLGRLLGLSP
FT                   VRYLHVPLILDASSGLKLSKQNGAPPIDTGAPLAALTAAWRALGFGVIDTANRDQFLRE
FT                   ATAQWARRFPLCAATAA"
FT   gene            complement(70340..70798)
FT                   /locus_tag="AXYL_00068"
FT   CDS_pept        complement(70340..70798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13430"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN17"
FT                   /protein_id="ADP13430.1"
FT                   /translation="MFDILVYLYENYYTPQACPAADVLAKRLAAAGFEHEDIDDALGWL
FT                   YGLAETTERCVDLAQAPATGTRIYTDNEYQQLGTESIGFIAFLESAGVLPAPLREIVID
FT                   RGLASPETPVPLSKIKIIALMVLWSQEAEIDNLVLEELLDEDGVRLLH"
FT   gene            complement(71040..73064)
FT                   /locus_tag="AXYL_00069"
FT   CDS_pept        complement(71040..73064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00069"
FT                   /product="TRAP transporter, 4TM/12TM fusion family protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13431"
FT                   /db_xref="GOA:E3HN18"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN18"
FT                   /protein_id="ADP13431.1"
FT                   /translation="MEIDHEKTQQLAEKYDSEIRFRPLDKTATWIVSGLLVTLSLFHYY
FT                   TAGFGLLREATHRGVHLAFVLSLIFLVFGFSKSHYQRQPKSTWYSPGGIPLYDWIIAIA
FT                   LALSVLYIPYIFEDLAFRVGNPMPMDVLMGSILLIGLLEATRRAMGWPLPIIAIVFMAY
FT                   AMFGPYFPGLLKHAGNTWSQVVNHMYLTSQGVYGVAVGVVATYVFHFVLFGVLATRIGL
FT                   GQLFLDVASTVAGRYAGGPAKVSVFGSAMFGMLSGSSVANAVTVGSLTIPAMIRIGYPR
FT                   HFAAGVEAASSTGGQITPPIMGAAAFLMIEFLGIPYQQIAIAGIFPAFLYFFGMFMQVH
FT                   FEAKREGLRGLTEEEMPKLKQSFKMRWPTLIPLVLLIGVLASGRTPYLAAFAGITGCII
FT                   VGLLNPFQRLRWRDLYEAFETGAKYALAVGAAAGTVGIVIGVVTLTGVGFKISYIVIAA
FT                   SQVLASGAAMVIPDTIANMQSLTLVAALIMTGIVCILMGCGVPTTANYLIMVAVAAPTL
FT                   VQLGVQPIAAHFFVFYFGILADITPPVALAAYAAAGMAGSDPFKTGNTAFRLGITKLIV
FT                   PFVFVFSPSLLISVQGFTWYDFFVTLFGCMVGLVLLSAAFSRYMLVGMKSWERWLCTIG
FT                   ALLTILPGLTSGLVGLAICIPVFMRQLAQLKLESAPKAA"
FT   gene            complement(73175..74134)
FT                   /locus_tag="AXYL_00070"
FT   CDS_pept        complement(73175..74134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00070"
FT                   /product="TRAP transporter solute receptor, TAXI family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13432"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN19"
FT                   /protein_id="ADP13432.1"
FT                   /translation="MKLKNWITALTIAAAAVGAAGSAQAQQFFRIGTGGTAGTYYPVGG
FT                   IIGNAVSQPGKLIATAVASNGSVANINGIMGGSFEAGFTQSDVAFWAYSGTGTFEGKPK
FT                   AQDLRLISTLYPESIHLVTRKGSGIKGVADLKGKRVSMDEPGSGTLVDVRLILGAYGLT
FT                   DKDIKAEYLKPNQAGDKLKDGGLDAFFFVGGAPAGAIAELASTGSIELVSLVGPEIDAL
FT                   RGKQEFFTPDVITANTYQNLPEVKTISVNAQMVTSAKIPDQVVYDVTKALYSDATRKTL
FT                   DAGHAKGKLITKENAVKGAGIPFHPGAEKFYKEVGLLK"
FT   gene            74387..75526
FT                   /locus_tag="AXYL_00071"
FT   CDS_pept        74387..75526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00071"
FT                   /product="metal-activated pyridoxal enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13433"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN20"
FT                   /protein_id="ADP13433.1"
FT                   /translation="MSQEVIRGIALPPAAQPGDPLAGVDTPSLALDLTAFEANLRAMQA
FT                   WADRHEVALRPHAKAHKCPQIALRQLALGARGICCQKVSEALPFVAAGIRDIHISNEVV
FT                   GPAKMALLGQLARAAKIGVCVDNAQNLAQLSAAMVQAGAEIDVLVEVDVGQGRCGVSDD
FT                   ATVLALAQQARALPGLNFAGLQAYHGSVQHYRTREERATVSRQAARIAASYAQLLRESG
FT                   IACDTITGGGTGSVEFDAASGVYTELQAGSYAFMDGDYGANEWGGPLTFQNSLFLLSTV
FT                   MSTPTAERVVLDAGLKSASAECGPPAVYGESGLTCIAINDEHSVVRVEAGATAPALGSV
FT                   LRLVPAHVDPTFNLHDGLVVFKDGVVQDIWEISARGFSR"
FT   gene            75530..76912
FT                   /locus_tag="AXYL_00072"
FT   CDS_pept        75530..76912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13434"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN21"
FT                   /protein_id="ADP13434.1"
FT                   /translation="MPQQPVSFDWKIPLSDVLDTLRQIYSTRHPALASARLDLLRSVMS
FT                   DDRADDFLPALGQELEALGLALIEQREEDDAIRLLIVPQVEADSLKTQIQARGWEAVAH
FT                   RQEGAAAGAQAALPKPAAGPLCGPEDYLDIPYAVALAPGWACAAMEDWEAPALTDLCAW
FT                   PALHAIDGKFPARRGLLASCVSLSGVHAWIEQGPDGLSSTPYAHLLHSGQVELPPSNRP
FT                   GMPLPPRAAQVQRRTPEFSLGFAGDDLLLVDRGMVFLYPAYGRQAGDSAAEPTLLHTAP
FT                   AQRRPVSDRSAVILMPDGRTCVLCRGQLLEFREGRLHPLPLSYGAPLSGDISHPVALGD
FT                   SAIAWLEDGMLCHASLDVGAVHQHEVAHLPAGGMTLQALQGGWLLLGHWHAPHRSLDLG
FT                   QLWHPASGQLLRIRHGALDLDSGIQQWIGLPGGEVVAGGQTRYARLGRFDALLGRLDAK
FT                   AQ"
FT   gene            complement(76992..77120)
FT                   /locus_tag="AXYL_00073"
FT   CDS_pept        complement(76992..77120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00073"
FT                   /product="entericidin EcnA/B family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13435"
FT                   /db_xref="GOA:E3HN22"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN22"
FT                   /protein_id="ADP13435.1"
FT                   /translation="MTHRIWLALLLAITAITAGCNTMEGAGKDIERGGEKIQQKAQ"
FT   gene            complement(77177..77362)
FT                   /locus_tag="AXYL_00074"
FT   CDS_pept        complement(77177..77362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00074"
FT                   /product="CsbD-like family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13436"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN23"
FT                   /protein_id="ADP13436.1"
FT                   /translation="MDNDRIKGAAKEVKGSIKETAGKLTGNRETEAEGKAEKTVGKVQR
FT                   NVGEAKDQARDLLNKK"
FT   gene            complement(77584..79083)
FT                   /locus_tag="AXYL_00075"
FT   CDS_pept        complement(77584..79083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00075"
FT                   /product="sensory box protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13437"
FT                   /db_xref="GOA:E3HN24"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN24"
FT                   /protein_id="ADP13437.1"
FT                   /translation="MKKTATAFTTERRHLLEIIDGLIEGIILLDQDRRIVWANDTALAM
FT                   HGVTDLAALGGTAAGYRKAFTLRYRNHRALRAAQYPLDRALAGEAYKDVVVEVTSRRDS
FT                   DFSRMHQVRNLELRDAQGAAEGMVLVLLDVTERYNAEERFERTFNANPAPAVICSLADL
FT                   RHVKVNEGFLAMTGYKREDVLGKTLRQLDVLGDTPQREDALHRLAEGTTIPQTETTITV
FT                   RDGGTKLVVVAGQPIEVAEQPCMLFTFNDLEPRRKAESALRHSEQRFATAFRLAPVPMT
FT                   LSSTTGELLEVNDAFVATTGYDARTLARDEDALAQLWTDPQAYDRAMASLEQGASVRSQ
FT                   EMALRTREGALLDCLVSAAPVSIQDQPCVLAAIQDITERKRSEVELMEAIETVMQDTSW
FT                   FSRTVIEKLAQIRAPQGAPQEQGELADLTPREREILGLMCQGHTDAEIAASLHLSRNTV
FT                   RNHVAALYSKLDVHRRSAAIIWARQRGIVGYEKPARKQAQK"
FT   gene            79265..79516
FT                   /locus_tag="AXYL_00076"
FT   CDS_pept        79265..79516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00076"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13438"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN25"
FT                   /protein_id="ADP13438.1"
FT                   /translation="MNTNQKPGDPSSQPGIDPSQRPGQEPGGAPEKQAPGQVPGQPGPD
FT                   DVDPGRVPPEVPGNPGQPAEKPRQPGEPGRPGQPDDPA"
FT   gene            complement(79602..80567)
FT                   /locus_tag="AXYL_00077"
FT   CDS_pept        complement(79602..80567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00077"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13439"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN26"
FT                   /protein_id="ADP13439.1"
FT                   /translation="MKRILSSLAAGLALATAAATAHADYPERPIRLIVPFPPGQATDIF
FT                   ARALAEKLGAAVKQPIVVENRAGAGSNIGMEQAARATPDGYTLVIAGSAAAVNQTLYKT
FT                   INYSLTKDFAPVSGVFSVPLMFLATPASGITSLKQLVTQARANPGELAYASAGIGGTQH
FT                   LSAEMFKAAAKIDIRHIPYKGSGPAQADFLGHQVPLMVDSVTAGLPHVQSKKAVALAVT
FT                   TAKRLPQLPDVPTVAESGYPGFEAIGWAAVLAPRDTPAEVTGYLSKQIGQVLNSPDMQK
FT                   FFRDRGAEPMPLTPDATGAFIAGEVKKWGEAVKQSGAQVD"
FT   gene            80780..81973
FT                   /locus_tag="AXYL_00078"
FT   CDS_pept        80780..81973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00078"
FT                   /product="succinylornithine transaminase"
FT                   /EC_number="2.6.1.81"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13440"
FT                   /db_xref="GOA:E3HN27"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN27"
FT                   /protein_id="ADP13440.1"
FT                   /translation="MEFSQFKTNALMEITSRPDLVFVRGQGSWLEDHAGKRYLDFVQGW
FT                   AVNTLGHSAPEMQKALLDQSKLLMNPSPAFYNLPSIELAERLTGASVFDRVFFANSGGE
FT                   ANEGAIKLARKWGQVHKKGAYKIITMNHGFHGRTLATMSASGKPGWDKMFAPQVEGFPK
FT                   AEINDLESVRKLIDDQTVAIMLEPVQGEAGVVPASKEFMQGLRKLADEHKLLFIVDEVQ
FT                   TGMGRTGTMFAYQQSDVVPDIMTLAKGIGGGVPLAALLARQEVCVFSHGDQGGTYNGNP
FT                   LMAAVGVAVFDALAAPGFMESVNARAKQLSEGLLALSAKWGMKGERGMGLLRALVMDRD
FT                   DGPAIVEAARNLAPNGLLLNAPRGNLLRFMPALNVTAEEIDTMLAQLDGLIAQVRKA"
FT   gene            82175..82465
FT                   /locus_tag="AXYL_00079"
FT   CDS_pept        82175..82465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00079"
FT                   /product="barstar family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13441"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN28"
FT                   /protein_id="ADP13441.1"
FT                   /translation="MTARVQEVSIVLREVNTPRELHECLMNALNFPGWYGHNWDAFWDA
FT                   ITGLVDMPHRLRFIGWSILEDRLPTEAQKLRECLEEMQMRLPELAACVSYE"
FT   gene            complement(82502..82654)
FT                   /locus_tag="AXYL_00080"
FT   CDS_pept        complement(82502..82654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13442"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN29"
FT                   /protein_id="ADP13442.1"
FT                   /translation="MAALALSEDDVHVFRPMFVEELLVLDLYNCACYRLPMELVQEWID
FT                   AGRPQ"
FT   gene            complement(82704..83870)
FT                   /locus_tag="AXYL_00081"
FT   CDS_pept        complement(82704..83870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00081"
FT                   /product="filamentation induced by cAMP protein Fic 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13443"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN30"
FT                   /protein_id="ADP13443.1"
FT                   /translation="MRVREDILQILHTRQRETRPWLSSSELAGSIDTSWSTVKRQLDVL
FT                   LKAGLVLCEGRGRATRYRVADQASAWAYAATNIATRLAEPAPDTNGMIWSEHGRALLAH
FT                   LRQPLASRAPVGYQRSFVEDYVPNQSSLLPPALAQALADEGRMQGQQPAGTYARRVLEP
FT                   LLLDLSWSSSRLEGNRYSLLAAQELFKRGAAATDLDAIMLLNHKAAIEFMIDAVPMHGL
FT                   TSAIIGNLHAILMQHLLPNTKGLGHIRQTVVNISGTTYLPIQAPALLQEIFDHILEKAR
FT                   LIKNPVEAAFFLWVNLAYLQPFEDGNKRTSRLSANIPLMLYNSAPLSFLDVEAQDYAYA
FT                   MMGVYERGDVALAVDLFTWSYRRSIRKYAIPLDAAACRIPFACDSEKS"
FT   gene            84188..85066
FT                   /locus_tag="AXYL_00082"
FT   CDS_pept        84188..85066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00082"
FT                   /product="restriction endonuclease family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13444"
FT                   /db_xref="GOA:E3HN31"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN31"
FT                   /protein_id="ADP13444.1"
FT                   /translation="MWHHLATTQAAEILFPRPECIFCNADMLSCPVDNLWDLNEDAIRK
FT                   EHDLQVRQNAIYVDGSFLLHRPIMSVPEVVGTAFHCCPVCGWWCVIRELQYETPAKGYS
FT                   AYQWAAGALTSVLPSPIHSPVEELRNYLCARYSDRFSIEPYQFEKIVTSILKSYRLDVQ
FT                   ITSRSNDGGLDVIGIDGSGEAFGVQVKRYRGVIEIEQLRSFVGALVLHGLPQGMFVTTS
FT                   GFTAGAKSVCQKAELQGIKLSLIDSERLLEMLKIAQIKDFDKEQLPDLADSYSKKIKAL
FT                   NYGYSHHLGSL"
FT   gene            85193..90508
FT                   /locus_tag="AXYL_00083"
FT   CDS_pept        85193..90508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13445"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN32"
FT                   /protein_id="ADP13445.1"
FT                   /translation="MTTDQGDDGQKTPGTTQAAPSGTSPELTGGQGFSFEDAVSAVYAV
FT                   ALLCETTAPGLPGRVVRHVSVQQGSFGQPLDDLIVRAEGADQVSITFSAQVKRKLVVSA
FT                   ASTNTDFRETIERSYETLSDPDFQISLDRVGAIVGEISDAAKRSFETLCEWARAESSLE
FT                   QFVRKLRTDGAAGEKLPQFEAVRDILSSKVAPDTIDATTHNLLSHFVLIRMDLLTEGSP
FT                   TEAQVVATLANAVAPVDRLRADDLWRRLLALVRVSQGRAAGYDRKTLVARLSGTFRLVE
FT                   APSAQGALQAIQQESRLAAAEITNSISGLSVPRDTSVQAVVEAAKSPGFVQIGGMPGAG
FT                   KSVVLRSAVEQLATSGTVLFLKSDRLRGSTWAQYATAAGMTHGSLEELLVELSASSCSV
FT                   LFVDGIDRVEIEHRGILLDLLNSIYSSPLLSGWCVVATVRDTGMEPLRTWLPARLFSSG
FT                   VRTLTIDSFDDEEAEALAQVKPALRPLLFGNDSVRAVVRRPFFAAVLAKEVDSSNAQAT
FT                   SEVDLAALWWERGGYGADPTRVGYRRNALVQLAKTGAHQLGRRIPIADVDAQTLAELEA
FT                   DGIVRPVRRGHTVQFSHDIFFEWAFLQYLVRADETWPEVIREIGEPPALGRVVELLSQA
FT                   ELAHGENWADHLAALEGNQRLRSQWLRAWMAGPFSLETFALYSSTFDRAMLDTAHSRVR
FT                   KVVVWYQAEKTKPNAAILERSDDPDLDLAKRMLYADMWGHPSDIAAWARFCDWLLDHAS
FT                   DIPIRVIPDVVSAFEVWQNMFLHYRNRVSERIAQTCLAWLYHIQHLQHRTDFSTDRGVW
FT                   GEIEDGRDGLDELESALRTLVLNSSLTQRSLVTQYLRDLCRVEQMPHQVVQSVFSHSPF
FT                   LARTCPAELADFALSVVRKRLPVVVQKELREEDFLVPHSFSHIEWDHLSIEDQFSFFPA
FT                   APTREPFHSLLQQAPDQGRRLVREVANHALRSWRQLHRLSREKDGTPIPLVMQFPWGRQ
FT                   VFWGDSRLYLGARGCFGSSTVNSGWMALEAWAFNELEKGTPADEVLEAVLAGHQSVGAL
FT                   AVAAAIALQEQHTSAVTLPIATNQRLWHWDIRRQVEDMGQMANLIGFLQPQDRPHGLAV
FT                   KEGNERPVRRADIRSLGTLMVLRGGELGTQAAAAIQGFSGDLPFDYAEQRKNAEVRSDF
FT                   ARTAEIWAELGKRENYRAELSADESKVVISHENPKATGEDIQMMQAQHSEMGRYLTLLT
FT                   WVYPYFDEGKLKESLTLEAAATAAIELDSEDLFATGHEFTELAHQRQSAVAGVAAILLL
FT                   EKAEAHLEWATEVCARAAQTPEVPQPFFTRSVKLMHHPVLYAAKGLGALFAVAEDNEDV
FT                   RPLQSFLTHLCAHPYEEIAVAAFGALLGAWSRYPDIAWAAMRLATALAIFEVQYGPGDA
FT                   EARRYARIQDVIAEELQRLQDGAPVAEFLPTWPEPWVPIIDGEAVQARRRRGRSVNAEW
FT                   RVNPVHVDTSLLEKVLTVIPLEATLADQAHAALFLDWSEGLTKWTIKRIAPDWARSRRD
FT                   LYEAHGPDYFGWRRYLFRFLSRVTLKLAVEEGTRRFLQPALATNDETFASLGECFSSHL
FT                   IAQVADSSEIPQTALELLSVVTQRVLAYRDWRHAAQGGHAEQDFVDIVKHLFFADLGYA
FT                   GGAVRFANQNWAEVGAVIPIFEPILRVHGSVTFVARAWMSLCESSFEHYPVQHFVDSLE
FT                   HLFAGDGTPSGWRNTQLPGRLSGLIQRFSERQQPMPLAMAQKLLRALDRLVDMGDRRAA
FT                   AVQLSEVFRSVRVTN"
FT   gene            90864..91196
FT                   /locus_tag="AXYL_00084"
FT   CDS_pept        90864..91196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13446"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN33"
FT                   /protein_id="ADP13446.1"
FT                   /translation="MQSHPLTQNPWSVDTDPEFGSIPLSHLHHIDRARHAIEAIARMVG
FT                   NSASEPDATGGQPLDAWAVAALMGGVEGLCDHLGTLTDAMLAQARFCEVDADLGDVTHG
FT                   APSSIQ"
FT   gene            complement(91238..91795)
FT                   /locus_tag="AXYL_00085"
FT   CDS_pept        complement(91238..91795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00085"
FT                   /product="bacterial transferase hexapeptide family protein
FT                   1"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13447"
FT                   /db_xref="GOA:E3HN34"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN34"
FT                   /protein_id="ADP13447.1"
FT                   /translation="MANDDRSLIIPRRTPESAAMTANIKRAMTITAALNRLTFNDAAEV
FT                   RALFSELIGKTVDDSFLLIPPFYTTGGPDISVGRNVFVNQNCTFYDLGGLSIADDVMIG
FT                   PNVSLITSGHPIEPSRRRDFVTAKPIVIERNVWIAAGVTVIGGVTVGENSVVAAGSVVT
FT                   KDVPANSLVGGNPARVIRSIAE"
FT   gene            92067..92939
FT                   /locus_tag="AXYL_00086"
FT   CDS_pept        92067..92939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00086"
FT                   /product="alpha/beta hydrolase fold family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13448"
FT                   /db_xref="GOA:E3HN35"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN35"
FT                   /protein_id="ADP13448.1"
FT                   /translation="MTAPVEHRRIPVDNIDTFYRIAGPSDAPALLLPHGYPCSSYEFRN
FT                   LMPRLADRWRLIAPDYPGAGYSATPEDFDYSFDGYAAFLDRFVLALGLDRYALYLHDFG
FT                   SPIGARLAIRAPHRVTALIIQNGDVPYEDALGPKYADIEATWALPPAEMRGAIGDSITE
FT                   ASFQEEFLNHVGPEVVDRISPDLWKLHWSLMTPRRKEVAIDLIAGLKQNRAWFAEHRRY
FT                   LRDHQPPTLIVWGPQDHYMPEASARAYLRDLPDAELHLLEGGGHWLLETHLDEVAVLMR
FT                   GFLQRVLAA"
FT   gene            complement(92951..93373)
FT                   /locus_tag="AXYL_00087"
FT   CDS_pept        complement(92951..93373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00087"
FT                   /product="putative lipoprotein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13449"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN36"
FT                   /protein_id="ADP13449.1"
FT                   /translation="MMRLARLFLITLAAASALAGCDAALEPAPPGSKLNAEAIATRDTP
FT                   PEHQFKGVLAGKPVHLLMHKCKVYMVEPADGENLKWTLVLEGDLYPLPTSCIRQSLTES
FT                   KGVVTAFIGRQAFGAGGCCTGTPEYRSRDGVNWKPR"
FT   gene            complement(93389..93763)
FT                   /locus_tag="AXYL_00088"
FT   CDS_pept        complement(93389..93763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00088"
FT                   /product="glutaredoxin family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13450"
FT                   /db_xref="GOA:E3HN37"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN37"
FT                   /protein_id="ADP13450.1"
FT                   /translation="MLVKALRVGLGQIIVLGDALTRPRPQQRSAQGQATVNTEAAKLSL
FT                   YQFHACPFCVKTRRAIHKLNAPIALRDAKGDPEARAQLQAGGGKVKVPCLRIDDAAGTR
FT                   WMYESSDIIAYLEQRFANVA"
FT   gene            94046..95116
FT                   /locus_tag="AXYL_00089"
FT   CDS_pept        94046..95116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13451"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN38"
FT                   /protein_id="ADP13451.1"
FT                   /translation="MMSIPVPARLCLMTALLAPALTLAQPSVDADLAARAAAQMERHRA
FT                   NVDDLLSTVRREGMALLVIPTINLDAAPQRDFDNEATRDRYVRQRSTFMRWNHKSEKDY
FT                   AISAGQGEHKLDMVDVGPQFQTVRGKLLYQVIPVWPGEYWLNRITYHQPRTELPETVPS
FT                   QSATERLKKIGIATLDYAVDREFKKTSTRPQSEPEADDGLGQGCEVVLRVGGGCDEAAR
FT                   ELRWRISAERAFNEGWADAVPAPGIDVELSFSPIAAIKLEAGEVVLTDGFVLPLDQPVM
FT                   TPDSCEGVAFDPVCTMDSITLTRLPASLEDFRQAPDAGSFKLPKLDEALRDLVYRAPTL
FT                   YYKPESAAAPNLIRAE"
FT   gene            95304..95963
FT                   /locus_tag="AXYL_00090"
FT   CDS_pept        95304..95963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13452"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN39"
FT                   /protein_id="ADP13452.1"
FT                   /translation="MPHARFTLHALAALGALSMTLGATAQAQGTGQNAPATPLAPAKYC
FT                   ECRFSSGQYEAYSVNGTCTVQRYAGGRKCEYGFSGIGANPTVLTSILGQGADHAQLQSA
FT                   AKIVTLYLAYAESGDTSALSESRFIEGALPVLARGSLFRQAVVNAELPVKQIDSEIVIF
FT                   SRKYSNVIAEVFQGKRPPLSVTWTEGFQFEIGRGYVLMDYKQASQLLVLFFSAAKR"
FT   gene            95970..96467
FT                   /locus_tag="AXYL_00091"
FT   CDS_pept        95970..96467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13453"
FT                   /db_xref="GOA:E3HN40"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN40"
FT                   /protein_id="ADP13453.1"
FT                   /translation="MDLTCMRELPGLDWAVLLVAVVVALILFVLGIYLLLRPRPSPTPN
FT                   TKHEVETTIDKYGLKAPAGVFLIVLSIALFGGLYWQLNNRFPANAEEFSGAPRTLGSIA
FT                   EGLRRNSSADILLKGGAETVVISQPVSGACWSALVDKLCAAHRDTLTCSRDGDRIVIDR
FT                   KP"
FT   gene            96548..96943
FT                   /locus_tag="AXYL_00092"
FT   CDS_pept        96548..96943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13454"
FT                   /db_xref="GOA:E3HN41"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN41"
FT                   /protein_id="ADP13454.1"
FT                   /translation="MNLSDRLKAWAKRIKRDGLTLWFAGKHARTPWYAKALGLFVVAYA
FT                   LSPIDLIPDFIPVLGYVDDVLLLPGLIWLAIKLLPPDVLQECRVQADAWMQSQGKKPRS
FT                   VAGAVMIVALWLGISIVAWFWLAPYFR"
FT   gene            complement(96973..97683)
FT                   /locus_tag="AXYL_00093"
FT   CDS_pept        complement(96973..97683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13455"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN42"
FT                   /protein_id="ADP13455.1"
FT                   /translation="MQKTEGATFLMAYDKGNSHFSDLHFHDCTFDNCALSMVKIPQRMS
FT                   RVQNVLLSKCRAVNSMIHPCMFEDVLIEDLSTNPILLVWASFFRRVKLVGKIGKINLNL
FT                   TPTAFCTDERLLDQFATARVAFYAETDWALDISEAKLLGLRCEGVPLHLIRRYPQTQVI
FT                   VDKQGNYPGHKALGADFVQAFPGIASTLHSFDSSPAQSMLLTASLAAPKGRREEEKGAI
FT                   AELRNLGFVEEGSA"
FT   gene            complement(97740..98180)
FT                   /locus_tag="AXYL_00094"
FT   CDS_pept        complement(97740..98180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13456"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN43"
FT                   /protein_id="ADP13456.1"
FT                   /translation="MAFIEQWREDGLAIKAYAIQRNPDPAVALLSAEVAAAARKTAMAA
FT                   LQDAASDPRATGLGFCIVHVGEEAVWLLADWWISGGILCQQMYSAPLDQPEQFQPVRGP
FT                   FIACVWELEVTAHERGAWTRHVLRNEPDAAAYLADVLPAGSY"
FT   gene            complement(98289..98864)
FT                   /locus_tag="AXYL_00095"
FT   CDS_pept        complement(98289..98864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00095"
FT                   /product="isochorismatase family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13457"
FT                   /db_xref="GOA:E3HN44"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN44"
FT                   /protein_id="ADP13457.1"
FT                   /translation="MNTQPSAITPARTALLVMHYQTDIMELFPSVAPALLNNTRQLCDA
FT                   ARRAGVSVYFAKIHFSPGYPEVSPLNKNGQGIKQLGRFVHDRVSPELGRREDEPIITAH
FT                   RASVFFGTDLQVRLSAQGIDTLIMAGIASTGVMLSSIAHASDADYRLLTVKDCCYDPDP
FT                   VVHEHLFATAFESRTTVLSLDDALSLLA"
FT   gene            complement(99056..100180)
FT                   /locus_tag="AXYL_00096"
FT   CDS_pept        complement(99056..100180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00096"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13458"
FT                   /db_xref="GOA:E3HN45"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN45"
FT                   /protein_id="ADP13458.1"
FT                   /translation="MPTRRQLIQHTATLMGIHAAASLSLGLLASGARAASAPQWHMPDE
FT                   GAPQARAFIAFGAQDAIWEDFTADVQAALGRIARAIAAHQPVTVFCRSRERSLAERHCG
FT                   TDNVSFVETRLDDIWMRDIGANFVLDGRGSATGVDFNFNGWGNKQRHAADAKIAAETTE
FT                   VTDTEYLQSELIGEGGGIEVDGHGTGIMTESSWINSNRNPGWSKAEVEEELKRCLGLRK
FT                   IIWLPGIKGKDITDAHVDFYARFARPGVVVANLDMDPESYDYALTRKHLEILRRATDAD
FT                   GKPLEIHTMSPPLNPRRSKFLRDNPDFAAGYINYFVINGAVIAPEFGDAEADAKARELL
FT                   TRLYPGRKVVQLDIDAIASGGGGIHCVTNQLPAA"
FT   gene            100329..101207
FT                   /locus_tag="AXYL_00097"
FT   CDS_pept        100329..101207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00097"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13459"
FT                   /db_xref="GOA:E3HN46"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN46"
FT                   /protein_id="ADP13459.1"
FT                   /translation="MLKQWPPLNVLRGFEAAARLGSFHKAADELHLTQSAISQQVRSLE
FT                   DYLGQPLFFRQGRAVSLTDAGWDLLGTTQAMLQQLAAGIRRLDQYRKPNQLIVNTSPAF
FT                   SRHWLLPRLEAFRALHPEADLWLYTSDAAPDMAKQTIDIALRDDLGPQADCAFRVLVED
FT                   RMYPACHPRLLAADARATLHGEREMDWSHWETQGGADVGQHGQGMNFSDPGLLLDAARE
FT                   GLGMALVSSLLAGRSRRDGSLAALTEQTVRGPKWAWLVHRDSQDDPLTRAFCEWVSEEL
FT                   EASREGGGAAA"
FT   gene            101298..102050
FT                   /locus_tag="AXYL_00098"
FT   CDS_pept        101298..102050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00098"
FT                   /product="short chain dehydrogenase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13460"
FT                   /db_xref="GOA:E3HN47"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HN47"
FT                   /protein_id="ADP13460.1"
FT                   /translation="MSNLQSMRPVALITGSTSGIGEAIARRLSRDGYAVVVHSRRSAEA
FT                   GHALARELGEAVYVQADLANDADRVRLVREAVAAWGRLDVLVNNAGISCVIPHADLAAA
FT                   RPDIWHELHEVNVVAPFRLVAEAQAALQAAAAHGRPACVINVSSHAGIRPKGASIPYAA
FT                   TKAALNHVTRLLALSLAPDIRVNAVAPGLVDTPLTADWTQAQQLWRDKAPMRRAASPED
FT                   IAQAVSMLVASDYLTGEILLSDGGLNLT"
FT   gene            complement(102155..103048)
FT                   /locus_tag="AXYL_00099"
FT   CDS_pept        complement(102155..103048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13461"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP82"
FT                   /protein_id="ADP13461.1"
FT                   /translation="MKTIQKTRPRSSSLRTTLAGLLASTLAAMFSPAATAAEAAGAAAL
FT                   PPTARAAAITPPDAPTVMYSIYQIDGKGADSYEVANGSIATFWFGHAFELGGTGYYTGF
FT                   VWDTRERYGKPGEDEVGPGTQVNLAEATFTLTGSTPERPWKFRGMEHTIGEFGAYEKPE
FT                   DVDTRRKPVEYRTPAGKLLLAVPTEGFDNGISFSGYALLIFNPAGPDEGAGWTYVGSIN
FT                   TGEDNSAACAEGDVMPCVASSGELVFSAHGGSDMPRVTVKRSGTEISGPDKTRQLGAGD
FT                   AVIYAYDAAGKKYVQK"
FT   gene            complement(103344..105770)
FT                   /locus_tag="AXYL_00100"
FT   CDS_pept        complement(103344..105770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00100"
FT                   /product="TonB-dependent siderophore receptor family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13462"
FT                   /db_xref="GOA:E3HP83"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP83"
FT                   /protein_id="ADP13462.1"
FT                   /translation="MAQCHFHRRLSAGRYALLCALSMTAALTVQALAPSAAHAQSAAAQ
FT                   TFDLPAGSLADALVALGRQAQLQVLFSPDTVAGLSAPAVSGAMTPQIALNRLLARSGLV
FT                   AVPSGSGFVVRRPADASSTDAITLAPVTVTGRDLTVTEGTGSYTAPAVTIGKNAQSLRE
FT                   IPQSVSVVTRQLLDDQNLTNLDDAMRTVTGITVEASSIGGNHGNFYSRGYALDTIQVDG
FT                   VNTPASTGSDLSAGFGLAIYDHIEVLRGPSGLYQGAGDPGGTVNLVRKRAQKEFAFSGQ
FT                   VMTGSWDRYYTEADITGPLDSDGRLRGRLVASYDDRKSFVDGVYTEKPLFYGTLSFDLT
FT                   PDTVLTAGATYQQYKGRPFFGLPGYTDGRLLDVRRSTNLDPSWNHITEEVTEYFADVDH
FT                   RLANGGRIKVSGIYREQDEPSREFGWSDCAVDPITGDTCLVSWKYRSHWKTYGLDAFVA
FT                   TPFEAFGRQHELTVGADYRNVHKNFRYGGGDNADTNLYHPNNNIPKPDYQFTNGNDSKT
FT                   DQYGLYARTNLRVTDAATIIAGGRFTWWENRTQNRNAYFNQFTNTSDKINGKFTPYLGL
FT                   VVDLNEQLSAYASYTSIFTPQTVTDVNGQLLDPRTGKQFEIGLKGEFLDKRLNGHAALF
FT                   RMEDENRSMTDPNNPLFSMAAGKMRSQGFEAEISGSPAPGWDITAGYAYTTTKTLKGTE
FT                   EQKSQQYAFITPRHTFNLWTKYTFATGTLEGLSLGAGVRSVSSMYRLNGPVKFEQRPYT
FT                   TVSAQAGYRFNKHLEGTLTVNNLFDKVYYQRVWAAYGSNYYGEPRSVMLNLRATY"
FT   gene            complement(105871..106893)
FT                   /locus_tag="AXYL_00101"
FT   CDS_pept        complement(105871..106893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00101"
FT                   /product="FecR family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13463"
FT                   /db_xref="GOA:E3HP84"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP84"
FT                   /protein_id="ADP13463.1"
FT                   /translation="MTRSLPLSAVEEAASAWFMRRRERASDAGAEQAFQAWLRASAEHQ
FT                   REYERLEQVWEDMAALPRPDSAPTRTHAQSTGQAQIPPRTRPQSQPRPWSSPARRPAFL
FT                   RWGGALAAMLLIAAAAYQYVPISYETVANASTQTRSLDLSDGTHLHANVGTRVSVRYTL
FT                   AERHIRVEGGEVYIDAAPDRRPLIVAAGDAELRDIGTEFNVLLLPDVLQVGVRSGEVRL
FT                   NAKGANAPAAQTLQAGDTVLLSRADARLLRRQQVPASEIGAWQGGVAVMHDTTLQQLAG
FT                   YLALYRDTPLRFADERARGLRLSGTLDLRQPDAVLDMLPGLLPVTVSRRPDGAAVISSR
FT                   "
FT   gene            complement(106890..107435)
FT                   /locus_tag="AXYL_00102"
FT   CDS_pept        complement(106890..107435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00102"
FT                   /product="RNA polymerase sigma factor, sigma-70 family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13464"
FT                   /db_xref="GOA:E3HP85"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP85"
FT                   /protein_id="ADP13464.1"
FT                   /translation="MGERFFGVIAEAYKSWNAELVGFLNRQLKRSPEAAQDLAQETFAK
FT                   WLAAHQGAEPPEKPRAYLYEIARNLLRDHWRRENVRDEHVVASLDDQDFEPMTCGLAAP
FT                   AGQQPEARADASQRLRLLQAAIDEMPPRQREAFLLYRYDELRCEDIAEHMGISVRAVEK
FT                   HLQLALAHCKRRVHGETP"
FT   gene            complement(107619..108839)
FT                   /locus_tag="AXYL_00103"
FT   CDS_pept        complement(107619..108839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00103"
FT                   /product="major facilitator superfamily protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13465"
FT                   /db_xref="GOA:E3HP86"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP86"
FT                   /protein_id="ADP13465.1"
FT                   /translation="MPAPDSPSPLHRPAFLHYLFARIGASLAFQIVSVAVGWQIYALSG
FT                   SALDLGLIGLAQFLPMAALTLVVGHVADRYDRRKIVAVCMALEALATLVLAIAALHGVG
FT                   GKTLIYATIIIMSSARAFEAPTMATLIPAVVPREWLPRATALASSSGQIAQIAGPALGG
FT                   VGYGLGAGWIYCVAAALYLSAFASIATLVIERAPPRKEPTTWRTLFAGITFIFQRRLLL
FT                   GTLSLDLFAVLLGGATALLPIFAKDILNAGPWALGALRAAPACGAALMSLTLARLSLGE
FT                   HVGRLLFGALIVFGLATTVFGLSTSIPLSIGALVLLGAADAVSVVVRSSLVQLNTPDHM
FT                   LGRVSAVNTLFIGASNQLGEFESGVMAAAFGAVPAVVIGGVGTIAVAGLWMRWFPELRK
FT                   LRSLHAP"
FT   gene            109049..109990
FT                   /locus_tag="AXYL_00104"
FT   CDS_pept        109049..109990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00104"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13466"
FT                   /db_xref="GOA:E3HP87"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP87"
FT                   /protein_id="ADP13466.1"
FT                   /translation="MATLPDLSSRELQAISTVAECGSFVAAALTLNISQPALTRTVQRV
FT                   EKALGVELFHRSTRRVETTPAGQEFVSLANRMLSDLRISYENMREISDEQRGRSIVSAV
FT                   MSVAYTQLPGIVARYRESRPRIELQIREGVHGTVLDDVRSGVADMGITYIDEVPGDFSV
FT                   VSLGREAFHVVMPRKHPLSTQTGVTLEQLAPYALVSLPREAQTRRLIDSHASIAGVQLR
FT                   HAVTVSQFATVMQCVWAGVGIAIVPGGAVPAALSADLVARPLTKPALSQAIGVVFLKER
FT                   GLTPSASGFLAQLRSDWVQVVAPARRGRRSGA"
FT   gene            complement(110002..110967)
FT                   /gene="trxB1"
FT                   /locus_tag="AXYL_00105"
FT   CDS_pept        complement(110002..110967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="AXYL_00105"
FT                   /product="thioredoxin-disulfide reductase 1"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13467"
FT                   /db_xref="GOA:E3HP88"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP88"
FT                   /protein_id="ADP13467.1"
FT                   /translation="MSAADSHRHARLLILGSGPAGYAAAVYAARANLKPVLIAGMAQGG
FT                   QLMTTTEVDNWPADVHGVQGPDLMQRFQDHALRFGTEVIADHVQSVDLSRRPFTLRGER
FT                   ATYTCDALIVATGAVARYLGLDSEQAYMGRGVSGCATCDGFFHRGRDVCVVGGGNTAIE
FT                   EALYLSNIARSVTLIHRRGAFRAEAIMLDKLKAKVEQGLIRLKLDSVLDEVLGDAGGVT
FT                   GVRVRRLADGSCVDLEVSGCFIAIGHRPSTELFEGQLALEDGYIVTQAGRKGLATMTSI
FT                   GGVFAAGDVQDTVYRQAITSAGSGCMAALDAQRFLERSAV"
FT   gene            complement(110964..111980)
FT                   /locus_tag="AXYL_00106"
FT   CDS_pept        complement(110964..111980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00106"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13468"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP89"
FT                   /protein_id="ADP13468.1"
FT                   /translation="MEPCILAQDPSNPLRRRLLIGAAGATLGTLCGGAKALASSDYPSK
FT                   PLRVVIPYPPGGPTDIVGRIVAATLADKLGQSVVIDNRPGASGMIGADVVAKAAPDGYV
FT                   LLINVSGQLVNPALYANMSHDPLKDFRGITNLASTPIQLVISANSPVRSVADLIALVRS
FT                   QPGRHNFASSSNGTPGHLAGEVFKAAAKLDVTHIPYKGSAPALTDVIGGQVTYMLDSMP
FT                   SSISLVKGGKLRALAVTSDQRVAALPDVPTFAELGYPSVNLTTWYGMWAPAQTPPELVA
FT                   RIYQQVNAVLQRPDVRARLADAQAMPVGDTPEHFDAYCRSEAQRYAEIVRLAGIRLQ"
FT   gene            complement(112023..113255)
FT                   /locus_tag="AXYL_00107"
FT   CDS_pept        complement(112023..113255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00107"
FT                   /product="CoA-transferase family III family protein 1"
FT                   /EC_number="2.8.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13469"
FT                   /db_xref="GOA:E3HP90"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP90"
FT                   /protein_id="ADP13469.1"
FT                   /translation="MGALSHLRVLDLSRVLAGPWASQLLADLGAEVIKIERPGQGDDTR
FT                   GWGPPWISDPQWGDVAQSAYFAGANRNKKSVAVDIATPDGQRLVAALAAQCDVLIENFK
FT                   VGGLQAYGLDYDTLKRSHPGLVYCSITGFGQDGPYANRPGYDFLIQGMGGLMSITGRGD
FT                   GQPGAGPLKVGVALTDILTGLYATAGIQAALAHRDRTGEGQHVDVALLDVQVAALANQA
FT                   MNFLASGCEPARLGNAHPNIVPYQDFATRDGHVIVTVGNDAQFRRFCGAIGRPDLADDP
FT                   RYATNTARLASRDTLIPQIQTQMAEQPSAHWLSTLETLGVPCGPINGLAEVFADPQVLQ
FT                   RGMRVPMPDAQSGCAELVGNPLHLSGTPVEYRSAPPVLGAHTEPVLRDMLGLAPEALAE
FT                   LRRNGAIAAAS"
FT   gene            complement(113323..113901)
FT                   /locus_tag="AXYL_00108"
FT   CDS_pept        complement(113323..113901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13470"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP91"
FT                   /protein_id="ADP13470.1"
FT                   /translation="MLMNNGEKIAVYDPRGALRFEDVPVSARKKDLAGLRLGILDNSKW
FT                   NANKLLRGAAAALGEDIEFAEVNYYVKHSFSKDAAPELIERIAAENDVVLTAIGDCGSC
FT                   CSACVRDSIALERLGVPSAVIITTEFARETELTRQAIGMKALEPVVIAHPVSSITAEEV
FT                   AQRVVQIKEQAQQVWLGTKAPMQVRVELQ"
FT   gene            complement(113937..115049)
FT                   /locus_tag="AXYL_00109"
FT   CDS_pept        complement(113937..115049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13471"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP92"
FT                   /protein_id="ADP13471.1"
FT                   /translation="MSAVLQAKASPANMVPAGVDLVEYYYERGFTDGLPVVPPTQEKID
FT                   EIVARLGGDAHFVEARVAPRWGELTREVLAINMVMAGCKPEYAPVVLAAVKAVTDQAFN
FT                   LNGVQATTHVAAPLLVVNGPIAREIGMNGGVNAFGSGNRANATIGRALRLIMLNVGGGW
FT                   PGDLDKSTLGHPGKYTYCVCENELQSPLAPYHVEHGYKAEDSTVFAMAAEAPHSVTNHI
FT                   SNDPEGILDTMCSAMSTIASNSAVLGGHIAVVLGLEHAQTIGKHGWSRADVRNYLYVNH
FT                   GNRFIDLAYGHRYGKVYNRNLPKYYKRNDDTRIPIVHSPDHIHLFVMGGEAGRFSVLIP
FT                   GWGHMSTPVLRSIEGASADSGDCTSGACAI"
FT   gene            complement(115183..115602)
FT                   /locus_tag="AXYL_00110"
FT   CDS_pept        complement(115183..115602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00110"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13472"
FT                   /db_xref="GOA:E3HP93"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP93"
FT                   /protein_id="ADP13472.1"
FT                   /translation="MMSSMPSEQAAPRLFPTLRCRDAEAMIRWLTGVVGFTEHAVYRDD
FT                   GTVQHAELAYGSSLLMLGPDRDDAHGKLVGDLQGRRTDALYLAVDDPDALHAQVQASGA
FT                   TIETPPYDTAYGSREFACRDPEGNLWSFGTYWPKV"
FT   gene            complement(115687..117711)
FT                   /locus_tag="AXYL_00111"
FT   CDS_pept        complement(115687..117711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00111"
FT                   /product="methylcrotonoyl-CoA carboxylase alpha subunit 1"
FT                   /EC_number="6.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13473"
FT                   /db_xref="GOA:E3HP94"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP94"
FT                   /protein_id="ADP13473.1"
FT                   /translation="MFDTLLIANRGEIACRVAATARRMGIRTVAVYSDADANARHVAAC
FT                   DQAVYIGGSEPRASYLRADAILQAARDTGAGAIHPGYGFLSENEAFAEAAEKAGIAFVG
FT                   PPASAIAAMGSKSAAKSLMEKAGVPLVPGYHGDNQDPQFLKTQADAIGYPVLIKASAGG
FT                   GGKGMRVVESSGAFLDALASCQREAASSFGDDRVLIERYLQKPRHIEIQVFADTHGNCV
FT                   YLFERDCSVQRRHQKVIEEAPAPGMTEERRRAMGEAAVAAARAVGYVGAGTVEFIAEPD
FT                   GRFYFMEMNTRLQVEHPVTEMITGHDLVEWQLRVAAGQPLPARQEDLRIQGHAIEARIY
FT                   AENPEKGFLPSIGTLAYLGLPAHTAFANGDIRVDGGVRMGDTITPFYDPMIAKLIVHGA
FT                   DRDQARARMLQALAQTQAVGVQTNVAFLSRLMQDSAFAAADLDTGLIERQRATLLPEPQ
FT                   AASPATLALACAAVLVRQGLAQPGVTSGKHPADPWDARDGWRLGNRYQRHLQWVDNGET
FT                   RRVTVARQGGAWTLDSGAGPQAFLWRAHASANPNLAYGLRITLDGHESAGTVVLHADRA
FT                   HVFGEAGVHVLDLYDPLAHSQDTQGEHGGGLTAPMPGKIISISVKAGDTVEKGQPLLVM
FT                   EAMKMEHTISAPADGKVSEVFYGVGDQVTEGAELVAIGE"
FT   gene            complement(117768..119375)
FT                   /locus_tag="AXYL_00112"
FT   CDS_pept        complement(117768..119375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00112"
FT                   /product="carboxyl transferase domain protein 1"
FT                   /EC_number="6.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13474"
FT                   /db_xref="GOA:E3HP95"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP95"
FT                   /protein_id="ADP13474.1"
FT                   /translation="MPIIESRINPRSQDYTDNAQAMQAQLDDLDQQLAHTALGGSEAAR
FT                   AKHVARGKLLPRDRVEHLIDPGTPFLELSPMAAHGMYGGEAPGAGVITGIGRVAGTECV
FT                   IVCNDATVKGGTYYPMTVKKHLRAQEIAAQNHLPCVYLVDSGGANLPQQDEVFPDREHF
FT                   GRIFYNQAQMSAQGISQIAVVMGSCTAGGAYVPAMSDESIIVKNQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGGDVHTRLSGVVDHLAANDMHALQLARNAVARLNRKKPQPLATIPVRE
FT                   PRYDPSELNGIIPADTRKPYDVREVIARIVDGSEFDEFKARFGPTLVTGFAHIQGMPVG
FT                   IVANNGILFSESAQKGAHFIELCAQRKIPLVFLQNITGFMVGRKYENEGIARHGAKMVT
FT                   AVATANVPKFTVLIGGSFGAGNYGMCGRAYSPRMLFMWPNARISVMGGEQAASVLATVK
FT                   RDGIEARGGQWSADEETAFKTPIREQYEREGHPYYATARLWDDGIIAPADTRRVLGLAL
FT                   SAALNAPIEDTKFGVFRM"
FT   gene            complement(119601..120782)
FT                   /locus_tag="AXYL_00113"
FT   CDS_pept        complement(119601..120782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00113"
FT                   /product="acetyl-CoA acetyltransferase family protein 1"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13475"
FT                   /db_xref="GOA:E3HP96"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP96"
FT                   /protein_id="ADP13475.1"
FT                   /translation="MSDPIVIVSVARTPMGGMLGALSGLAAHELGSIAIKAAVERAGIK
FT                   PEQVEEVIMGNVLQAGQGQAPARQAALGAGLPLGVACTTIHKVCGSGLKAAMFGHDLLA
FT                   AGSANIVVAGGQESMSNAPYLLLKGRQGYRYGHNTVYDHMALDGLEDAYDKGKAMGVFA
FT                   EDCASKYSFTREQQDAFSLESLRRARAASEDGSFKWEIAPVTVAGRKGDTVIDTDEAPT
FT                   KAMPEKIPTLKPAFKKDGTVTAANSSSISDGAAAMVLMRASTAEKLGVKPLARIVAHSQ
FT                   HSQEPNWFTTAPVGALKNLFAKTGWKAEDVDLYEINEAFAVVTMAAMTDFKLPHDKVNI
FT                   HGGATALGHPIGASGARLMATLVGALRKTGGKRGVATLCIGGGEAVAMAIEMI"
FT   gene            complement(120818..122674)
FT                   /gene="aceK"
FT                   /locus_tag="AXYL_00114"
FT   CDS_pept        complement(120818..122674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="AXYL_00114"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13476"
FT                   /db_xref="GOA:E3HP97"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP97"
FT                   /protein_id="ADP13476.1"
FT                   /translation="MIRMSDVQHIEQAPAPGPAPLDVARLILAGFDRHYALFRYSAQRA
FT                   KALFESGDWHGIQRLSRERIEYYDMRVRECATQLEGVLRGRPEGAVGANGSAAPTLSDE
FT                   QTAFWQQIKQEFVGLLGEHRQPECAETFFNSVSCRILHRDYFHNAFLFVRPAIATDYLD
FT                   SSIPSYRVYYPATDGLEKSLIRMVADFGLALPFEDLPRDTRLLARAAVKQLRATLPRHV
FT                   GRRIASDCQIHALGSLFFRNKGAYIVGRLINQGTVYPFAVALMRNPAGQVVLDALLLGA
FT                   DDLSTLFSFTRAYFLVDMETPAAVVNFLSSLLPRKPKAELYTMIGLQKQGKTLFYRDFL
FT                   HHLAHSRDAFDIAPGIKGMVMCVFTLPSYPYVFKLIKDRIDKDGMDHATVRRKYQMVKL
FT                   HDRVGRMADTWEYSQVALPRARFAPALLEELRRLVPSLIEETGDTVVIRHVYIERRMTP
FT                   LNIYLRQASDALLDPAVREYGDAIRQLAAANIFPGDMLYKNFGVTRLGRVVFYDYDEIQ
FT                   RMTEMNFRRIPPAPNEEAELASEPWYAIGPNDVFPEEFGRFLLGDPRVRGAFMRHHAEL
FT                   LEPDWWQACRTHVAQGRIEEFFPYDTDRRLRPECPPGDHAAS"
FT   gene            complement(122685..123863)
FT                   /gene="ivd"
FT                   /locus_tag="AXYL_00115"
FT   CDS_pept        complement(122685..123863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ivd"
FT                   /locus_tag="AXYL_00115"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13477"
FT                   /db_xref="GOA:E3HP98"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP98"
FT                   /protein_id="ADP13477.1"
FT                   /translation="MNLPGLNFDLGEDLDMLRDAVRNFAQTEIAPRAAEVDRSDQFPMD
FT                   LWRKFGELGVLGMTADEEYGGAKMGYLAHMIVMEEISRASASVGLSYGAHSNLCVNQIN
FT                   RNGTAAQKAKYLPKLISGEHVGALAMSEPGAGSDVVSMKLRADKKGDRYVLNGTKMWIT
FT                   NGPDADTLVVYAKTDPEAHQRGITAFLVEKGFKGFSVAQKLDKLGMRGSHTGELVFQDC
FT                   EIPEENVLGQVNAGVKVLMSGLDYERAVLSGGPVGIMQAVMDVVVPYIHDRKQFGQAIG
FT                   EFQLIQGKVADLYTTLQASRAFCYQVGKNLDRLGAEHVRQVRKDCAALILYTAEKATWM
FT                   AGEGVQILGGNGYINEYPVGRLWRDAKLYEIGAGTSEIRRMLIGRELFNETA"
FT   gene            124098..125285
FT                   /locus_tag="AXYL_00116"
FT   CDS_pept        124098..125285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00116"
FT                   /product="amidohydrolase family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13478"
FT                   /db_xref="GOA:E3HP99"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E3HP99"
FT                   /protein_id="ADP13478.1"
FT                   /translation="MEFAVLELTNLDEIVALRRDIHMHPELCYEEHRTAKVVADTLRGW
FT                   GIETHTGIAKTGVVGVIKRGASDRAIMLRADMDALPMQEENQFDHRSRHDGKMHGCGHD
FT                   GHTAMLLAAARHLQAEGGFDGTVYLCFQPAEEGGAGGRAMIQDGLFERFPCEAVFGMHN
FT                   WPGLAAGTFGVCAGPMMAAANGFKITVRGKGGHAAAPQDCSDPVPALFAIGQSLQTILT
FT                   RSKRPLDAAVLSITQVQAGGSVINVIPNSAWLGGSVRAYSTDVVDLIERRMNEIAGNIA
FT                   AAHGCEADVFFERRYPALVNTVAETEFCMEVMREVVGQDKALVIEPAMASEDFAFLLQE
FT                   KPGCYVFLGNGDGEHRMAGHGLGPCMLHNASYDFNDSLIPAGASYWVRLAQRYLA"
FT   gene            125344..126315
FT                   /locus_tag="AXYL_00117"
FT   CDS_pept        125344..126315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00117"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13479"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPA0"
FT                   /protein_id="ADP13479.1"
FT                   /translation="MKKKTLLIKAAGAALAIMASGAMAQSWPAKPVTLVVPYTAGGSAD
FT                   AIGRRLGDVLRKESNVTVIVENKPGAGASVGTDFVARAQPDGTTLLLASTSPLTIFPHL
FT                   AKTNYDPMKDLTPVASVAVAPVAIVATKALPVKDFAGLIDYAKSHPDGVRYGTPGQGTV
FT                   AHIGMSAVTAQTGTKMLHVPYRGNSQALTDGLGGVVELLVVNSDVVLPHVANGALKPLA
FT                   VMAPERLAAWPDVPTMAELKMPQAQYYSNFGVFAPANLPATVAQPLQAALAKAVASAEF
FT                   QDLLAKSYLQPGTAVGDAFAKQVQAEFANNARVIKEGNIKAE"
FT   gene            complement(126420..126752)
FT                   /locus_tag="AXYL_00118"
FT   CDS_pept        complement(126420..126752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13480"
FT                   /db_xref="GOA:E3HPA1"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPA1"
FT                   /protein_id="ADP13480.1"
FT                   /translation="MGALQTLALFILTALAEIIGCYLPYLWLRKGHSIWLLAPAAASLA
FT                   LFAWLLTLHPTASGRVYAAYGGVYIGMALLWLWAVDGVRPSTSDWLGVGLCLAGMLVIM
FT                   FGPRSA"
FT   gene            complement(126763..127143)
FT                   /locus_tag="AXYL_00119"
FT   CDS_pept        complement(126763..127143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00119"
FT                   /product="MerR family regulatory family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13481"
FT                   /db_xref="GOA:E3HPA2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPA2"
FT                   /protein_id="ADP13481.1"
FT                   /translation="MSPSTWTISELSREFDVTPRTIRFYEDQGIVSPAREGRNRIFGPR
FT                   DRTRLKLALRGKRLGLQLSEILTLIDMYDGPGDTEVQLRQYLSVLEQHRSTLEQQRRDI
FT                   EDTLHEISQQEQQCRDLLAQKP"
FT   gene            127216..128283
FT                   /locus_tag="AXYL_00120"
FT   CDS_pept        127216..128283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00120"
FT                   /product="metallo-beta-lactamase superfamily protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13482"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPA3"
FT                   /protein_id="ADP13482.1"
FT                   /translation="MNPNEQKLQYPWTDFQPEPGRSHVVAEGVKWIRMPLPFALDHINL
FT                   WLLRDNIDGRDGWTIVDCGITRDEVKTLWERVFETELEGLPVLRVIVTHMHPDHIGLAH
FT                   WLCERWSAPLWMTMTDFVVASLWSSRRGDAGGGPGGQSAVDHFARHGLTDLDAQEQIRQ
FT                   RANYYPNLVPAVPARYTRIMHGDDVRIGGRDWRVIVGYGHAPEHASLFSPDLGVLISGD
FT                   MVLPRISTNVSVFDYEPDANPLPLYLRSLDGYADLPRDTLVLPSHGRPFKGLHERIAQQ
FT                   HEHHRDRLAEVLEACAIQPQSTTDIVPVLFKRKLDLHQLTFAMGEALAHLHALYFEGKL
FT                   KRALGADGIVRFSAV"
FT   gene            complement(128327..128953)
FT                   /locus_tag="AXYL_00121"
FT   CDS_pept        complement(128327..128953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00121"
FT                   /product="LysE type translocator family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13483"
FT                   /db_xref="GOA:E3HPA4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPA4"
FT                   /protein_id="ADP13483.1"
FT                   /translation="MLPIDTLIAFFGIAVLLALTPGPDNLFVLMQSAIWGRKAGMFVVL
FT                   GLCTGLLGHTAAVAVGLAAVFAASPMAFTVLKLAGAAYLAYLAWQILRAPVESEAGKRP
FT                   EPMRPGALYRRGIVMNLTNPKVLLFFFAFLPQFTSPALGPVGLQTMQLGAVFMVVTLLV
FT                   FGAIAFFSGAFGELLQRSVTAKRWLNRIAALVFIGLAVRLATATR"
FT   gene            129088..129813
FT                   /locus_tag="AXYL_00122"
FT   CDS_pept        129088..129813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00122"
FT                   /product="nitroreductase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13484"
FT                   /db_xref="GOA:E3HPA5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPA5"
FT                   /protein_id="ADP13484.1"
FT                   /translation="MPPTAMPQSPEPLQGADARPDASLEAWLQARHSCRAFLPEPVARG
FT                   TIERVLALAQRTASWCNCQPWQVTITEGAGTERLRGALQRRAEQSGFTPDFPFPREYQG
FT                   EYLARRRESGFQLYGAVGVARGDREAYRRQEMRNFQLFDAPHVAIVTTDEALGEYGAMD
FT                   CGGYVANFLLAAQANGVATVAQASLAMYPEVLREELGIAADRRVVCGISFGYADTAHPA
FT                   NSYRTSRASQSETVTWIGG"
FT   gene            129896..131089
FT                   /gene="metC1"
FT                   /locus_tag="AXYL_00123"
FT   CDS_pept        129896..131089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC1"
FT                   /locus_tag="AXYL_00123"
FT                   /product="cystathionine beta-lyase 1"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13485"
FT                   /db_xref="GOA:E3HPA6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPA6"
FT                   /protein_id="ADP13485.1"
FT                   /translation="MPTKHIDTLLQHAGTAPFNPETGTAPVPLPPMRASTVRFENLAAL
FT                   EKAQRSKAAGGRASTYGRMGMDTHAALEEVFTQLEGGTHCYLASSGLSAMTMVMMALCS
FT                   AGDHALISDCVYGPMRELDDAVLKRMNIEITYFAAGEDLEELVRPTTKLLYVESPGSLL
FT                   FEMLDMGAMAAFAQRRGLVLATDNTWGSGYIYRPLTLGAQVSVIAGTKYVGGHSDLMLG
FT                   AVVTNDEEIARKLNRTQYAMGYSISADDAWLALRGVRTMPIRMAQHARHALQVCEFFKS
FT                   RSETVRLFHPAWPQDPGHALWQRDCTGSNGMLSVELRLSPAAARVFVDSLTLFGIGFSW
FT                   GGYESLVQLVSGKDLSKHRYWGEGDNALVRLHIGLESPDDIIADLTQALEKAAAVQG"
FT   gene            complement(131111..132073)
FT                   /locus_tag="AXYL_00124"
FT   CDS_pept        complement(131111..132073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13486"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPA7"
FT                   /protein_id="ADP13486.1"
FT                   /translation="MTQAVSPAAVTLSDFGSFYAGGRQVRIDGQPQRDIAFTQSASLAY
FT                   DPNGLYHFEQAYVQYFIPARLAHPLPIVLLHGGGMTGAMWEQTPDGRPGWMQHFLRQGH
FT                   AVYVVDNVERGRAGWAPFKEVWPEPPIIRNAEESWTLFRFGRAEDYAARRAFEGQRFPV
FT                   AVFDDFIRHAVPRWLGNNDAALRGFCAVLDRIGPCLVMAHSHGGEVAYRALHARPDLVR
FT                   GVIGIEPSGFSPEVAAQAVADKPFLFVYGDYLDATPLWEKLCITGQAYADELARQGARV
FT                   QTWRLADMGIAGNSHMPMMDDNSDDIAARIGVWIRGTAA"
FT   gene            complement(132070..133281)
FT                   /locus_tag="AXYL_00125"
FT   CDS_pept        complement(132070..133281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00125"
FT                   /product="extracellular ligand-binding receptor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13487"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPA8"
FT                   /protein_id="ADP13487.1"
FT                   /translation="MKQRFPRSRAMLGLCLALAASLAQANEADGVKIGVLTDMAGVTAD
FT                   ATGKGSVEAARLAIEEMGGTLLGKPISLVSGDHQHRPDIGSSMARKWYDTDGVDVIVDV
FT                   PNSSVALAVQGIARDKKKLVLFSSPGTTALTQAQCSPYGVQWTYTTYALSRGTATAVVN
FT                   EGNKRWFILASDYAFGKQLAADTETVVKANGGEVVGTVYHPLNASDFASFLLQAQASKA
FT                   QIIAIANAGGDTISAIKQAAEFGIGGAQQLAAMLLLITDVHSLGLQAAQKTYLTVPSYW
FT                   DMNDGTRAFAKKFEARVGRPPTFLQAGVYGSVRHYLQAVKAAGTVDADAVMAKMKSLPI
FT                   DDPFSLNARIREDGLVVRDMMLAQVKTPAQSKAPWDYYNIVRNIPGATLAWPLSESQCP
FT                   LVKP"
FT   gene            complement(133418..134047)
FT                   /locus_tag="AXYL_00126"
FT   CDS_pept        complement(133418..134047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00126"
FT                   /product="DSBA-like thioredoxin domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13488"
FT                   /db_xref="GOA:E3HPA9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPA9"
FT                   /protein_id="ADP13488.1"
FT                   /translation="MLSPKIIRILAAAALTATAFFSPASHAQGAQQSIAINPPLPSDTP
FT                   GKIEVLEFFAYTCPHCAAMEPMVEDWAKTAPPDVVLKQVPIAFNAGMKPLQQLYYTLLA
FT                   LDRPDLHPKVFAAIHGEHKRLFDKKAMGEWAATQGVDREKFDSVFDSFSVQTQVQRANQ
FT                   LAEAYRIDGTPSFAVGGKFMTSPVMAGNSYEGALKEVTRLIPLTRN"
FT   gene            complement(134129..134878)
FT                   /locus_tag="AXYL_00127"
FT   CDS_pept        complement(134129..134878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00127"
FT                   /product="sporulation related domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13489"
FT                   /db_xref="GOA:E3HPB0"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPB0"
FT                   /protein_id="ADP13489.1"
FT                   /translation="MATKRKTTTRRSSGESGSTLYGALAGLLLGLIVAAVVAFYVTKAP
FT                   VPFVDRASRQGDNGKLPDPRQAPDPNAGLYGRDGAAGVPSTGPTATAPAPLPGAGVATG
FT                   PATGPAPTKGDDTPAKLDDLGALIATLPTSKGPAVASAAPSAAPSQAPTPISKAAPAPA
FT                   PKPAASASAANGTYYLQAGAFRGENDAESLKARIILLGLPVAVQKAEVNGKAINRVRVG
FT                   PFARLDDMNRARGRLGENKIETAVVRQ"
FT   gene            complement(134888..136570)
FT                   /gene="argS"
FT                   /locus_tag="AXYL_00128"
FT   CDS_pept        complement(134888..136570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="AXYL_00128"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13490"
FT                   /db_xref="GOA:E3HPB1"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPB1"
FT                   /protein_id="ADP13490.1"
FT                   /translation="MLLEQQKQLISLIQAAVAQSLPDAVANVLLERPKVAAHGDVATNV
FT                   AMQLAKPARRNPRELAQAIVDALMAQPGAAGLIESAEIAGPGFINLRITAAARQAVIAA
FT                   VAEQGAAFGRSPRSGEKILVEFVSANPTGPLHVGHARQAALGDALCRLYDAIGWDVTRE
FT                   FYYNDAGNQIHNLAISVQARARGLTTESPDWPVDGYKGDYIADIARDFQAGATVHSDGV
FT                   DVIATGDVDNLDDIRVFAVAYLRREQDLDLQAFGLAFDNYYLESSLYTSGRVEATVKAL
FT                   VAGGHTYEEGGALWLRTTELGTGDDKDRVMRKSEGGYTYFVPDVAYHKAKWERGFHRAV
FT                   NIQGSDHHGTVARVRAGLQALEEGIPKDYPAYVLHKMVKVMRGGEEVKISKRAGSYVTM
FT                   RDLIDWVGRDAVRYFLIQRRADTEFVFDVDLALSKSDENPVYYIQYAHARICSVINNAA
FT                   MPAADVAQADAALLTAPTEFALMQRLAEFPNVVALAAQELSPHHIAFWLRDCASDFHAW
FT                   YGAERVLIDDTALKLARLRLASTTRQVLANGLELMGVSAPERM"
FT   gene            136893..137240
FT                   /locus_tag="AXYL_00129"
FT   CDS_pept        136893..137240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13491"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPB2"
FT                   /protein_id="ADP13491.1"
FT                   /translation="MLITFHSKVVAEVLMLTDHAGALLQAAGKSFGDKIPERGVFTVEQ
FT                   LGPAISGIERAIDDYQSSHDKSDEEDDDKAPASPMARMVGLKERAFPLLDMMRQSLAAN
FT                   AEVTWEVSRGW"
FT   gene            137330..137647
FT                   /locus_tag="AXYL_00130"
FT   CDS_pept        137330..137647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13492"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPB3"
FT                   /protein_id="ADP13492.1"
FT                   /translation="MRSDITVVFDSRRSVDLSANVEPSPQRQSDARDWFDSAWETLGCE
FT                   PLRPSGKVLLLDKVLGVADALGYDTLSSDEKEAREFAEHLALALERPRITVDLPGLTVG
FT                   Y"
FT   gene            complement(137663..138463)
FT                   /locus_tag="AXYL_00131"
FT   CDS_pept        complement(137663..138463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00131"
FT                   /product="binding-protein-dependent transport system inner
FT                   membrane component family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13493"
FT                   /db_xref="GOA:E3HPB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPB4"
FT                   /protein_id="ADP13493.1"
FT                   /translation="MKDKLDTLGAWALGLLWILPLAYAMWAAFHPPAYATRFDLFAPLT
FT                   LDNFVRAWNAAPFPRYFLNTFLLVTMVLAAQLVLSTLAGYAFARFEFRGRDFVFMLVLL
FT                   QLMIMPDVLLVENYRSMSQLGIRDTVFAIGLPYFASAFGIFLLRQTFKTVPRELEEAAR
FT                   MEGANALQVLWKVYVPLAKPIYVAYGLVSVSHHWNNFLWPLIITNSVESRPLTVGLQVF
FT                   SSTDQGIDWSVITAATLMSAAPLLIAFLLFQRQFVQSFMRAGIR"
FT   gene            complement(138460..139335)
FT                   /locus_tag="AXYL_00132"
FT   CDS_pept        complement(138460..139335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00132"
FT                   /product="binding-protein-dependent transport system inner
FT                   membrane component family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13494"
FT                   /db_xref="GOA:E3HPB5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPB5"
FT                   /protein_id="ADP13494.1"
FT                   /translation="MSRSLNALYGWLLLLPAIVLLAAFTHYPAVATLWHSFFSTPKGAR
FT                   PARFVGLDNYAVMRDDPVFWQSLWNNLWFALGTIPTSIGIALIMALWVNRNLSGRGFLR
FT                   MAYFTPTVLPMVAVANIWLFFYTPQYGLIAQVMQLFGSPGPNWLGNRETALPALMLVTV
FT                   WKEAGFFMIFYLAALQTVSPSLREAAMLEGASRWQYFRRILWPLLMPTTLFVLINALIN
FT                   AFRLVDHVVVMTRGGPDNASTLLLYYIYQVGFSFWDTAYAATLTVVLLVVLALTALIKF
FT                   RWLDRRTHYQ"
FT   gene            complement(139349..140644)
FT                   /locus_tag="AXYL_00133"
FT   CDS_pept        complement(139349..140644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00133"
FT                   /product="bacterial extracellular solute-binding family
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13495"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPB6"
FT                   /protein_id="ADP13495.1"
FT                   /translation="MRRIVLKTLAASLAAACLSLPAQAQNKPVEVEFYYPVAVGGPITK
FT                   IVDDMVADFQKENPDIKIKPIYAGSYQDSIAKALTALKGGTPPQLAVLLSTDMFTLIDE
FT                   DAIVPIDSLAKSDADKKWLGGFYDAFMQNSRSGGHTWGVPFQRSTIVMYYNKNLFKAAG
FT                   LDPERAPATWAELVEYGKKLTKQDASGNTTQWGIEIPSGGAFAYWLFQALTTPNGAILM
FT                   NEAGNEVYLDKPAVVEAAQYWRDLSAKHKIMPTGTIDWGTTPKDFLEKKAAIVWTTTGN
FT                   LTNIRKNADFPFGVAMMPQQKRGGSPTGGGNFYIFKSGTPAQQQAALKFAQWVTTPERA
FT                   ADWSIATGYVAVTPAAWQTEKMKKYAQEVPAAAVARDQLEVSVAEFSTHENQRVTKTLN
FT                   DALQAALTGSKTPQQALTDAQREADRILRPYK"
FT   gene            complement(140672..141727)
FT                   /gene="ugpC1"
FT                   /locus_tag="AXYL_00134"
FT   CDS_pept        complement(140672..141727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC1"
FT                   /locus_tag="AXYL_00134"
FT                   /product="sn-glycerol-3-phosphate import ATP-binding
FT                   protein UgpC 1"
FT                   /EC_number="3.6.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13496"
FT                   /db_xref="GOA:E3HPB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPB7"
FT                   /protein_id="ADP13496.1"
FT                   /translation="MSSIVLDNLTKQYGNAAAIHGVSFTVPAGSFTVLLGPSGCGKSTT
FT                   LRMIAGLDTPTSGTIHIGDRDVTQLPPAKRRISMVFQSYALFPHLSVRENILFGLKVRK
FT                   EPARDYDRRLQRVADLLGLSHLLDRKPSQLSGGQQQRVALGRAVISEAPVCLMDEPLSN
FT                   LDAQLRHEMRREIRALQQDLGITMVYVTHDQTEAMSMADQVVLLRGGKIEQHDTPDALY
FT                   ARPATEFAARFIGTPPMNLIGLASLQGATVIAGTHGPAIAGAPAGAMKLGVRPEHIRID
FT                   PNGIAAKVESVEYFGADSIVVCRVGDTSGVAVRVGGHLRASAGETLGLSWQDGQQHFFA
FT                   ADSAVINSAGR"
FT   gene            complement(141848..142645)
FT                   /locus_tag="AXYL_00135"
FT   CDS_pept        complement(141848..142645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00135"
FT                   /product="calcineurin-like phosphoesterase family protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13497"
FT                   /db_xref="GOA:E3HPB8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPB8"
FT                   /protein_id="ADP13497.1"
FT                   /translation="MLIAQITDLHMRTPGDKAYGIIDPAAFLAPAVRALNALTPRPDCV
FT                   LITGDLTDLGRPHEYQVLREHLQALEIPYFLLPGNHDDRAQLRAAFPDHGYLQGGGPFI
FT                   QYAIETYPLRMLALDTVVPMKSHGELCQDRLDWLAARLAEQPERPTLVLMHHPPFLTGI
FT                   EHMDAIGLLAGAPELERIVARFPNVERVLCGHLHRTIFQRFGGTIASTCPGTAHQLALE
FT                   LGPRPTLQYIMEPPGYQLHWWQGKNLVTHHAVIGDYPGPYPFA"
FT   gene            complement(142685..143698)
FT                   /locus_tag="AXYL_00136"
FT   CDS_pept        complement(142685..143698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00136"
FT                   /product="periplasmic binding protein and sugar binding
FT                   domain of the LacI family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13498"
FT                   /db_xref="GOA:E3HPB9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPB9"
FT                   /protein_id="ADP13498.1"
FT                   /translation="MASRSSPRFSIIEVARKAGVSPATVSRAFNQPEIVHPDTLAHIRN
FT                   VAKRAGFRPNRVGRSLRSGSTRTIGLILPTLSNPVFAECFEGAERRARESGYSVMLTAT
FT                   GYDPAVESAAVQGLMDHQVDGLILTVADAAKSATLDDLDHAGIPYVLVYNESGAHPFAS
FT                   VDNRAAASDMVAHLAALGHRRIALVTGPLTASDRARRRLTGARACAKRLGLDAIQHISM
FT                   SSHTGSDLDALKAALRGKQAPTALFCSNDLLATAVIADLVGLGLSVPADISVCGFDGMR
FT                   FGALLTPPLTTVAQPSDGIGETACSNLLAQIQGQPPHSDRLPHCIVVGGTAAPVRR"
FT   gene            144014..145342
FT                   /locus_tag="AXYL_00137"
FT   CDS_pept        144014..145342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00137"
FT                   /product="amidase family protein 2"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13499"
FT                   /db_xref="GOA:E3HPC0"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPC0"
FT                   /protein_id="ADP13499.1"
FT                   /translation="MSTALNRLGALEAARKLQRRELTAEQLVRACFARIEQRESTIHAW
FT                   TALQKQAALDRAQALDRGALQGVLHGLPMGVKDLFDTVDLPTRYGSPIYERHHPGLDAA
FT                   SVALCRGAGAIVVGKTVTTEFATYQAGPTRNPRNEAYSPGGSSSGSAAAVADDMVPFAL
FT                   GTQTAASIIRPASYCGIVGFKPTFGSISRAGVKSVAESLDTIGGFARSVPDVALFASVL
FT                   MRDPRMLDLAYDGKPRIGMYRSLQWRHALPETKEAYAQAAAILSRAGAVVEEVPLPPEH
FT                   CVLVQLHADIMAFEVSQALAYERLEHAAQLSPKIQAILEAGSRITAEEHQKNLMRAAES
FT                   RARVDAWFDKYDVLLAPSASGEAPFADLGTGDPQFSRAWTVFGHPSLSLPFATGPQGLP
FT                   VGLQLVGARYSDHRTLAMAAWVHQRLLAATAPDIGASDMWPRG"
FT   gene            complement(145482..147194)
FT                   /gene="leuA"
FT                   /locus_tag="AXYL_00138"
FT   CDS_pept        complement(145482..147194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="AXYL_00138"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13500"
FT                   /db_xref="GOA:E3HPC1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPC1"
FT                   /protein_id="ADP13500.1"
FT                   /translation="MMLANPATKYVPFAPFTRDFSERTWPSRRITKAPIWMSTDLRDGN
FT                   QALIEPMSVERKVRFFEQLVKIGFKEIEVGFPSASQTDFDFVRKLIDEKRIPDDVTIIV
FT                   LTQSREDLISRTVESAAGAKQAIVHLYNACAPAFRKVVFNMSKDEIKNIATTGTRLVKQ
FT                   YMAQHPETQWRYQYSPEVFSTTEPEFALEVSNAVADVWQPTPDCKMVLNLPATIEATSP
FT                   NLYADQIEWMHKNLARRDSIVLSVHPHNDRGTAVAAAEFAVMAGADRIEGCLFGSGERT
FT                   GNVDLVTLALNLYTQGVHPGLDFSDIDEVRRCAEYCNQLPVHPRHPYAGDLVFTAFSGS
FT                   HQDAIKKGFAQQQADAVWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGVSYLLEQEHGL
FT                   VLPRRLQIEFSRAIQRVTDETGREVTADDVHTIFNREYLEQKSPWKLVRHRIDGNPSAG
FT                   EGQHFSIEAELEYNGERRIVTGKGDGAISAFVAALDVPVRIMDYHEHAIGTGTDTRAAS
FT                   YVELRVGESSTGFGVGIDRDIVTASFQAVLSAVNRHINAGAVAATEQETAETA"
FT   gene            complement(147716..148345)
FT                   /locus_tag="AXYL_00139"
FT   CDS_pept        complement(147716..148345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13501"
FT                   /db_xref="GOA:E3HPC2"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPC2"
FT                   /protein_id="ADP13501.1"
FT                   /translation="MMNLTSPASVRQDCRLIGQTLLKLALPRLIVRAIVIAVAVVIWYL
FT                   AANWILNFGRTMNYEFLHSLGQPTMDMVQKVNPYIWWAVAGIWTLIVFFTLRAWLSASL
FT                   ASGSATPVETSVLADLAPNLSEESLGVLRWTWGDRQEPFTVGDLRRSLSEIRHNRASKI
FT                   AMVAEQARVLESSDRKPRDPRDEVRHEARSEGRSDRYVEPRIGPAR"
FT   gene            148344..149789
FT                   /gene="rpoN1"
FT                   /locus_tag="AXYL_00140"
FT   CDS_pept        148344..149789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN1"
FT                   /locus_tag="AXYL_00140"
FT                   /product="RNA polymerase sigma-54 factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13502"
FT                   /db_xref="GOA:E3HPC3"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPC3"
FT                   /protein_id="ADP13502.1"
FT                   /translation="MQNIVPMTRPILELRPGQHLTLTPQLQQSIRLLQLSTLDLEAEIS
FT                   QVLAENPLLERQDEAPSAETPAESDRESSVQDDEPAAERETPVDEMPGSGGVYPDEDSS
FT                   RPEAARPDTLREHLLGQLMLTRAAPRDVALAGLLIDELDENGYLGSPLEEILGWLPAEL
FT                   EPDIDELKAALSLLQSFDPPGIGARDMAECLLLQLRNPDLGQLPEAADAAVLACARQIC
FT                   AQHLALLATGNAARLCAAVGCDDATFRSAHSLILRLEPRPGRAWTVPAADYAVPDVIVR
FT                   KARGGWQVTLNSAAVPKLQINGLYAQMLGNQKESAHAGLHSQLQQARWMIRNVEQRFDT
FT                   ILRVAQAIVQHQTAFFSQGPAAMRPLILKDIAGELGLHESTISRATTQKYMLTPFGTLE
FT                   LKRFFGTGVSTDGGDATSATAVQTFIRQMVADENRAKPLSDSQIMQKLADQGIVIARRT
FT                   VAKYREALRIAPAALRKAQAAAR"
FT   gene            149923..150204
FT                   /locus_tag="AXYL_00141"
FT   CDS_pept        149923..150204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00141"
FT                   /product="BFD-like [2Fe-2S] binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13503"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPC4"
FT                   /protein_id="ADP13503.1"
FT                   /translation="MYICVCNAITERQVRASVDGGATTLSDLQFELGVATCCGCCAATA
FT                   AEYLPGGRCSSVCDVRSIAVPVNPPAALVESGAPAANSSFPIPLVAIA"
FT   gene            complement(150235..151092)
FT                   /locus_tag="AXYL_00142"
FT   CDS_pept        complement(150235..151092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00142"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13504"
FT                   /db_xref="GOA:E3HPC5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPC5"
FT                   /protein_id="ADP13504.1"
FT                   /translation="MPDLDLLHSFVSVVDAGGFTAAGERVHRSQSTVSQQIRKLEETLE
FT                   CALFIREGRQVSLTEDGERLLGYARRMLALSTEVREAVSGRKRVDVIRLGIPDDFAADT
FT                   LTILVSEFARTRPGVRLSVRCDLTSALTRALERGDLDVALLKREPGAGPALAAWPEQLH
FT                   WIGAPGVEVPLAEPVPLVAFPQGCIYRNRAIHALEAAGRHWRIAYESPNLMGLQAALTG
FT                   GLGVALLERRCLLPDHQIIDAELPPVPPTELALCLADTVREPARQLAMAIREFCGKEAT
FT                   RPAA"
FT   gene            151223..152137
FT                   /locus_tag="AXYL_00143"
FT   CDS_pept        151223..152137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13505"
FT                   /db_xref="GOA:E3HPC6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPC6"
FT                   /protein_id="ADP13505.1"
FT                   /translation="MKVSSTLSAAALPVQASPGISWAPIAAFCFLWSSAFAAAKIAVRD
FT                   CPPLTLLTIRFLIAGALMLGLAAASGGWKMPARRDLIALILLGALNNALYLGLSWSGMT
FT                   TVSSAFTAVLISTNPLLIGVLAGPVLGERLGWRKLLGLCLGLAGVALVLRSRLTGMQED
FT                   LHGTLLVTGGLLALVAGTLLYKRLKPSSGLWTSTGIQSLAGAMVMLPFALTYESIGDAH
FT                   MTASLFWSMAYMIVAVSMGGYYLWFMILGRASATAASALHFLMPPLGLLFGWLVLGEHV
FT                   SWLDLLGIVPIAFGIWLATRRAD"
FT   gene            152504..152980
FT                   /gene="bfr"
FT                   /locus_tag="AXYL_00144"
FT   CDS_pept        152504..152980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="AXYL_00144"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13506"
FT                   /db_xref="GOA:E3HPC7"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPC7"
FT                   /protein_id="ADP13506.1"
FT                   /translation="MKGDKTVIQFLNKQLTNELTAINQYFLHARMLNHWGFDKLGKHEY
FT                   EESIGEMKHADRLIARIFMLDGLPNLQDLHKLLIGEDVPELLACDLKLEQGAQATVKEA
FT                   IAHCESVRDYVSRDLFQDILDDTEEHIDYLETQIDLIDKVGIQNYLQSQMSVPE"
FT   gene            complement(153061..153735)
FT                   /locus_tag="AXYL_00145"
FT   CDS_pept        complement(153061..153735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13507"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPC8"
FT                   /protein_id="ADP13507.1"
FT                   /translation="MSWRFLFATLLIALGASAWGGIQLGDWLVAHAPVAAPAPGQDASA
FT                   SQQPVLDANGRPYVAQPPQPRIDGTLGVPDKPSDREWQVNTVSLFDSVSDPAVKISRDR
FT                   ISPDQAREIAAASHVPLPSGASDVSTLDLQAPGTSTAINGGQVQAGGYGTPQMVQAPPP
FT                   PPNTAQAPGALGWQDALKRELAQCATQGFFERPSCSWAARNKYCGPNRAWGTMAECPAR
FT                   PQ"
FT   gene            complement(153772..155379)
FT                   /gene="prfC"
FT                   /locus_tag="AXYL_00146"
FT   CDS_pept        complement(153772..155379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="AXYL_00146"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13508"
FT                   /db_xref="GOA:E3HPC9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPC9"
FT                   /protein_id="ADP13508.1"
FT                   /translation="MNIPHEVARRRTFAIISHPDAGKTTLTEKLLLFAGAIQIAGSVKA
FT                   RKASRHASSDWMEIEKQRGISVASSVMQMEYRDCVINLLDTPGHADFSEDTYRVLTAVD
FT                   AALMVIDAANGVEPQTIRLLQVCRARNTPIITFINKMDREVREPLELLSEIEGHLGMDA
FT                   VPFSWPVGMGKAFGGVFDIRQDRMRVFRPGQERRSDKDDFIEGLSNPEIARRFGSAFEQ
FT                   ASGEIELINEAAPAFDREQFLAGKQTPVFFGSAINNFGVQEVLDALVEQAPPPGPRVSM
FT                   QRLVQPVEPKFTGVVFKVQANMDPAHRDRVAFVRVSSGRFERGMRLKVARTNKEMRPNN
FT                   VVSFLSQRRELLDEAYAGDVIGIPNHGVLQLGDVLTEGETLQFTGLPFFAPELFQAVEV
FT                   KDPLRTKQLRTGLTQLGEEGAIQVFRPEAAGGSLLLGAVGQLQFEVVAHRLKTEYGVDA
FT                   RMLPSRYTMARWITSENPKALRKFMDANAAHIAYDVVDAAAFLIGSPAQLRVAEELYPD
FT                   VKFHAMREHGGKVFGDKA"
FT   gene            complement(155490..156119)
FT                   /locus_tag="AXYL_00147"
FT   CDS_pept        complement(155490..156119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00147"
FT                   /product="LysE type translocator family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13509"
FT                   /db_xref="GOA:E3HPD0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPD0"
FT                   /protein_id="ADP13509.1"
FT                   /translation="MPLSTWLTFFLASSAISFSPGAGAISAMSSGLKYGFARGYWNTAG
FT                   LIMGILFQFVVVAVGLGAVLATSEMAFNVVKYLGVAYLIYLGVRQIRTDAAPVTVDSGD
FT                   PKAATIRELVLRGFLINTMNPKGTVFLLAVVPQFVDTALPLTQQYAAIAATLAFTDLVA
FT                   MGVYTLLAARVLRLLRSAKHIRWMNRTFGSLFILAGVFLASFRRHS"
FT   gene            complement(156153..157673)
FT                   /gene="rhlE1"
FT                   /locus_tag="AXYL_00148"
FT   CDS_pept        complement(156153..157673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlE1"
FT                   /locus_tag="AXYL_00148"
FT                   /product="ATP-dependent RNA helicase RhlE 1"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13510"
FT                   /db_xref="GOA:E3HPD1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPD1"
FT                   /protein_id="ADP13510.1"
FT                   /translation="MTTSTPFADLGLADSLLRAIAETGYTAPTPIQAQAIPQVLKGGDL
FT                   LAAAQTGTGKTAGFTLPILHLLMQKKPELRKPGRPRCLILTPTRELTAQVEESVQTYGK
FT                   YTPLNSMVMFGGVNINPQISALRKPLDILVATPGRLLDHCGQKTVDLSGVEILVLDEAD
FT                   RMLDMGFIRDIRKILALLPKQRQNLLFSATFSDEIRTLARGVLNNPGEVSVTPRNTATE
FT                   LVTQTVHMVEQHHKRDLISHIIRESGWHQVLVFTRTKHGANRLAEKLVKDGLTAAAIHG
FT                   NKSQSARTRALAGFKDSTVTVLVATDIAARGLDIDQLPQVVNFELPNVPEDYVHRIGRT
FT                   GRAGATGAAVSLVDNSEIKLLKDIERLIKKTIERKPVEGWTPPATSAAAFDRQERDEDN
FT                   RSPRGGGGRNGGRGGNGNGGRSRPAQGQGQPRAAAGGRAPAPARAGGEGRASHGSRDGK
FT                   PADHPAHAGRNEGRPQQNHRRPEGSGRPAGNGGSGRPSGAPRAALLSK"
FT   gene            157977..159449
FT                   /locus_tag="AXYL_00149"
FT   CDS_pept        157977..159449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13511"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPD2"
FT                   /protein_id="ADP13511.1"
FT                   /translation="MKKSAIVGVVVALGAVWTGTAWYTGQKAEAFVKQSIEQANLELKK
FT                   VGEKWGVTPVVELVSFERGVFTSTERYRVKVTEPAADGKPAIEHEIVFVEHLDHGPFPL
FT                   SNLKSGSFAPAMVASRFQLEETPLVKEWFAAAKGAVPLSGAYSVSYAKNITGNFDMAPV
FT                   EFAKDANSLKFSGMKGDVTYATGSKHGTVALKADSLTLAGESEESDIVSMAMTGLTLTS
FT                   DMTPASNDMYVGSQKVALKNWTITSKEKPPVQLKDTAITVDMTEANSLMGVKMAMDFGM
FT                   INVQEKDMAGVKLVLDAQKLDSKAFKALNDVYEAASRRMMQSKGEEQSPQFTDEEMQVV
FT                   KTNVDLLLAGNPTLAVSPLEVRTANGTSTFNLDLDMAKPASLDGEFADTLKQAIRKLNA
FT                   KLVLSKGNLSDLMAIEPQVRGVPAEQAQQTAKGQAEMVGTMATAMGMAKVENNNIVTYL
FT                   NYADGQVDFNGKKMPVEQFLMMVMSGAMGGAR"
FT   gene            complement(159556..160764)
FT                   /locus_tag="AXYL_00150"
FT   CDS_pept        complement(159556..160764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00150"
FT                   /product="amidohydrolase family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13512"
FT                   /db_xref="GOA:E3HPD3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPD3"
FT                   /protein_id="ADP13512.1"
FT                   /translation="MTATRQTLFIGGQVFDGKGKLLPNHGVLVEGRHVARVAPAGEFSG
FT                   YAGATVRTDGMTLMPSLADCHVHLVYTGGADPNAQLSKQGPAQITLTALENAQASLRGG
FT                   VTALRDCGGKDYLEFGVRDAIARGVFPGPTIKASGRIICMTGGHGNRIGRVADGCEDVV
FT                   KAVREQVHAGCDLVKIMATGGVMTPGVSPMDAHYSFDEMKAGVHEAKRFRKSTASHAQG
FT                   TLGILNAVRAGIDSIEHGIFMDDECLREMLDAQTYLVPTIAAVRNIVANADNGIPAYAV
FT                   EKARAVEQRHRESFQMYYKAGGRIALGTDAGTPFNLHGENAMELAYMVEFGMTPMDALI
FT                   AGTSRGHDLMGMDQHGAIADGNVADLLLVQGDPTEDIMKAADKRFHVAVLRNGEVAAGA
FT                   LPL"
FT   gene            complement(160790..162517)
FT                   /locus_tag="AXYL_00151"
FT   CDS_pept        complement(160790..162517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00151"
FT                   /product="ABC transporter family protein 2"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13513"
FT                   /db_xref="GOA:E3HPD4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPD4"
FT                   /protein_id="ADP13513.1"
FT                   /translation="MALLNIEDIRIEFPSRRGTLVAVDGVSLSLEKGEILGVVGESGAG
FT                   KSTIGNAVIGLLEAPGRLAGGAVLLNGERIDTLNPAQKRKVRGRRIGMIFQDPLTSLDP
FT                   LQTVESQLVETMQVHLDLSHAEAQKRAVQLLAQVGIDQPELRVKQYPHQFSGGMRQRVV
FT                   IALALCCEPEVIIADEPTTALDVSIQAQILELLKKLCREEQVGMIIITHDMGVIADVTD
FT                   RVAVLYHGKLVEQGPTSKILGDPDHPYTRSLISAVPRPDIKLRRFPLVTYIEDVKKPTQ
FT                   PLDLATHWLGQRRDFGARSGGPLVQVNDLSMRFVLKSALLKRNQRTLDAVKRVNFSIGE
FT                   GEVFGLVGESGSGKSTVARLISGLYTPSEGSVNFGGTDLTALKGEKQLNPFRRQIQMIF
FT                   QDPFSSLNPRMRVLDIVAEPIRFHKLAASEAEARRIVADLLDVVGLGDRAAERFPHEFS
FT                   GGQRQRICIARALATRPRFLICDEPTSALDVSIQAQILNLLKDLQEELGLTMLFISHDL
FT                   PVIRQMCDRVGVMRYGELLEVANTEDLFERPQHPYSQHLLGLMPRLQSMSREGLDVAG"
FT   gene            complement(162525..163451)
FT                   /gene="dppC1"
FT                   /locus_tag="AXYL_00152"
FT   CDS_pept        complement(162525..163451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC1"
FT                   /locus_tag="AXYL_00152"
FT                   /product="dipeptide transport system permease protein DppC
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13514"
FT                   /db_xref="GOA:E3HPD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPD5"
FT                   /protein_id="ADP13514.1"
FT                   /translation="MIARIAPFFARAADSDLWHSFKRSPGAIIAAIVTLAILLGALFAP
FT                   VVAPHNPFDLASLSIMDANTPPSWEEGGSPDFLLGTDDQGRDILSAVLYGSRVSLLVGF
FT                   ASVLFSMVLGVTLGLISGYAGGRVDSFIMRIADVQLSFPAILVALLIDGVARGLLPRDM
FT                   HDQLALYVLIFAIGISGWVQYARTVRGSTLVERNKEYVQAARLIGIGPFTILRRHILPN
FT                   VMGPVLVIATIHLAIAIITEATLSFLGVGVPPTAPSLGTLIRIGNSYLFSGMWWISIFP
FT                   GIALVALVLSVNLLGDWLRDALNPKLR"
FT   gene            complement(163462..164433)
FT                   /locus_tag="AXYL_00153"
FT   CDS_pept        complement(163462..164433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00153"
FT                   /product="binding-protein-dependent transport system inner
FT                   membrane component family protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13515"
FT                   /db_xref="GOA:E3HPD6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPD6"
FT                   /protein_id="ADP13515.1"
FT                   /translation="MLSFIAQRLIQSVLVMLTVALIAFAMFRYVGDPIASMVGQDTTPE
FT                   QRVQLREQLGLDDPFVVQYAHFVANAVRGDFGMSYRHRRPVSELLEERMPATLELSFVS
FT                   AVMALALGIPMGIYTALKRHGVLSKAFMAISLAGISLPTFLIGILLILFFGVQLRWLPS
FT                   FGRGDVVSLGWWTTGFLTKSGWLALIMPAITLALFQMTLIMRLVRAEMLEVLRADFIKF
FT                   ARARGLPERLINFRHALKNTMVPVITITGLQLGSIIAFAIITETVFQWPGMGLLFIQAI
FT                   SMVDIPVMAAYLVLIAFMFVVINLVVDLLYFAVDPRLRVQSK"
FT   gene            complement(164556..166163)
FT                   /locus_tag="AXYL_00154"
FT   CDS_pept        complement(164556..166163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00154"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5 middle family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13516"
FT                   /db_xref="GOA:E3HPD7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPD7"
FT                   /protein_id="ADP13516.1"
FT                   /translation="MRTFPHLKQAALAAAVAASLAFSAGAAAKTLHWSYQGDATSMDPM
FT                   ALNETFTLGFQGNIYETLAGYDGNLKLTPLLAESWENPEPNKWVFKLRKGVKFHDGSPF
FT                   TADDVIFSWKRSLTPGSDMKGYGAKASDIKKVDDYTIEVITPTPNPILPREWVFLYIMS
FT                   KSWSEKNKTTEATNVKGDNQGNYANLNANGTGPFMLTSRQPDVKTVLKRYDGYWNKNIK
FT                   TNVDEVIFQPITQEATRVAALISGEMDLVQPVPVQDWKRLEDAKGVKPLTAPEARAIFI
FT                   GMDQDRDELLFSDVKGKNPFKDPKVREAVVLAVDTKAINEKIMRGAAKPLGSLIATAIN
FT                   GYDESFGAPYKPDPERAKKLLAEAGYPKGFTVTMDCPNDRYVNDEKVCQAVAGMLARVG
FT                   IKINLLAQTKSKYFGKILLQAGNQTSMYMLGWTPSSTDAHNTLLNLTSCRNAKTAAGQF
FT                   NLGGYCNKKVDELTDKIGVETDQAKRNAMIKEAFEIVRNDYGYLPLHQQPMSWGVKDNI
FT                   KVIQRADDVLDLRDVVLP"
FT   gene            complement(166524..167912)
FT                   /locus_tag="AXYL_00155"
FT   CDS_pept        complement(166524..167912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00155"
FT                   /product="GTPase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13517"
FT                   /db_xref="GOA:E3HPD8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPD8"
FT                   /protein_id="ADP13517.1"
FT                   /translation="MAEDIIRIALVGHTNTGKTSLLRTLTRDTRFGEVADSPGTTRHVE
FT                   GARLRLEGRAVLEWFDTPGMEDSISLLEYLEKLDSPQERLDGPARIRRFLDTPAAHGRY
FT                   EQEARVLAKMLDCDAALYVIDARDPVLGKHRDELAILAACGRPLLPVLNFVNAPAHRAD
FT                   EWRAAMARLGLHAVVEFDTVAPPLDGEQQLYAKLGVLLDRHAAALARLSASLAEQRRTR
FT                   RGSAYELLADLLVDVAALHVASASDEAALTAASSKLRDQVRQREQTCVNALLALYNFRA
FT                   ADFTDDALPLQGERWGMDLFHPQALKDMGVQVGMGAAAGAMAGAAVDLFSAGLSLGTGM
FT                   LIGAAAGGLWQGVEKLGKRVAGKLRGWREISVDDAVLRLLALRQRQLIEALERRGHAAR
FT                   EPLRLDHPEDDAWRKGPLPEALKEARSRPEWSALGAPYEDSDRRKRVVRELAKTLADAP
FT                   PPGA"
FT   gene            complement(167905..169392)
FT                   /locus_tag="AXYL_00156"
FT   CDS_pept        complement(167905..169392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00156"
FT                   /product="putative membrane protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13518"
FT                   /db_xref="GOA:E3HPD9"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPD9"
FT                   /protein_id="ADP13518.1"
FT                   /translation="MAHRPQGLTVPPPDAMPSTTSRDSSPTAAPLGAGPVRAHWLAELI
FT                   RLREAHWGPLEDADTVRRVRQQDGDLPSRILARAELLAQRENLVSLVETWRRSALAILA
FT                   LLFLLAALSGAGAALGALGDGSRAVNVLWALGALLGLHALTFLLWLASFLLRASSVTGL
FT                   GRVWLWATRKLARGPDSALVPQAFLNLLARAGALRWLFGSISHLLWLTALCAALAVLLA
FT                   VLSTASYRFIWATTLLAPDTFVRLTQALGWLPAQLGFPMPDAAMIRASDGAQALPAEAQ
FT                   VQWSLWLIGVLVVYGILPRLLAGALCVAGSLRALRGLRIDPALPGFSALRDRLEPPALS
FT                   TGIDRPVDPLHEPRVGAPPLAGLGGQPVLLGLELPADLAWPPADMPAGIQQAGNLDNRE
FT                   ERNRVLDALAGKAAKRLLIACDARQTPDRGTLSLIAELAAHAEQTRIWLITPHADTVAP
FT                   ATRAPLWRERLLALGLPADAVLQAPIAPLSWLESGHG"
FT   gene            complement(169433..170323)
FT                   /locus_tag="AXYL_00157"
FT   CDS_pept        complement(169433..170323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00157"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   AraC family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13519"
FT                   /db_xref="GOA:E3HPE0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPE0"
FT                   /protein_id="ADP13519.1"
FT                   /translation="MPTVASAPADFSVFRTLASSTATLGRAAALGEGIAISQWSRSAHE
FT                   TMGYDNPGHHTLSLYLHGGDKSFRLGQDRLHGGAGKFCVLPSEHYSRWSMNDSVHFLHL
FT                   YIAPERLAREAVMRLDCEPRTLELRDRTYIHDDSLIDVCRQLLETDWNQPADRLAASSA
FT                   AETVLHHLLNQGVARKPAATLRGGLAPVVRRRIMDYVDAHLAEPLTLDELAGVAALSTY
FT                   HFARMFHTSFGEPPHAWVRTRRLAHARKLLAAGKGDLAGIAQASGFGNASHLARVFRDA
FT                   VGVTPGQYRSARTRH"
FT   gene            170473..171366
FT                   /locus_tag="AXYL_00158"
FT   CDS_pept        170473..171366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13520"
FT                   /db_xref="GOA:E3HPE1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPE1"
FT                   /protein_id="ADP13520.1"
FT                   /translation="MNLFLYFLTVVIWGTTWIAIKLQLGVVAIPVSIFYRFALAGLILF
FT                   AALALTRKLQKMDRRGHWLCVGQGLCLFCLNFLCFYTATQWIPSGLVSVVFSAATLWNA
FT                   LNARLWFGTRVAPRVMAAGALGFSGLVLLFWPELAGQQASHETLLGLGFALLGTFCFST
FT                   GNMLSSLQQRAGIRPLTGNAYSMLYGAAILLAGCVAAGLPFEFDSSASYVGALLYLAIL
FT                   GSVVGFTAYLTLVGRMGPARAAYCTVLFPVVALSVSTFAEGYQWTAPALLGLALVMLGN
FT                   LLVFTKWTPFARRAAA"
FT   gene            complement(171412..172608)
FT                   /locus_tag="AXYL_00159"
FT   CDS_pept        complement(171412..172608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00159"
FT                   /product="aminotransferase class-V family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13521"
FT                   /db_xref="GOA:E3HPE2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPE2"
FT                   /protein_id="ADP13521.1"
FT                   /translation="MSAPLTPSVVEALRAQTPGAHTTVHFNHAGASLPSAATLQAIHAH
FT                   LQREATQGPMEAGVRSRELIENARTLAARLLNADPSEIALTGGNSPGWGAAFAALEPWR
FT                   PGDRILVGRHEWGGNLAAMRLRAQRAGATLEVIPSDDSGCTDAQALEAMLDERVRLIAL
FT                   TWLPANGGLINPAAAIGNVARRHRIPYFVDAAQAVGQLPVDVAQIGCDVLSGAGRKALR
FT                   GPRGTGLLYVRRGFLDRLTPAFVDTHSAPLGADGEPVLRQDAARLESAEASLALRCGLA
FT                   NALQEALDIGLPAIRARIDATARALRTELAAIPGITVLDQGHERSGLVSFNLAGQDAVS
FT                   VQRAMAAQGITIGSNGVPYTPLDMEARGLTQIARASVSYLTNDEEIDRLLEGLRALAR"
FT   gene            complement(172626..173099)
FT                   /locus_tag="AXYL_00160"
FT   CDS_pept        complement(172626..173099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00160"
FT                   /product="endoribonuclease L-PSP family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13522"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPE3"
FT                   /protein_id="ADP13522.1"
FT                   /translation="MTRSISGRVAELGLTLEAASAPAANYVPFVQEGNLLYISGQISRK
FT                   DGKAAYLGRLGDQISDADGVEAARLSALGLLSQIAAATGDKLDRVARVVRLGVFVASTP
FT                   DFNRQSAIANGASDLMVEVFGDAGRHARSAVGVASLPQGVAVEVEAVIALTQA"
FT   gene            complement(173196..174110)
FT                   /locus_tag="AXYL_00161"
FT   CDS_pept        complement(173196..174110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00161"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13523"
FT                   /db_xref="GOA:E3HPE4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPE4"
FT                   /protein_id="ADP13523.1"
FT                   /translation="MRSARSLPALVSLRAFEAAARRMSFSLAAQELFVTQSAVSHHIQR
FT                   LEAELGVALFERRTRAVALTAAGQAYYERVHAAFELLRQGTDELRAPATPRQTLRVGLL
FT                   ASFATRWLAPRLAVFGAAHPDVDLQLQPDIGLADVAGGEVDVAIRYGRGVWPGVRSRLI
FT                   MAERLSVVCAPALIAGRKRPRTPQDLLRFPLLASHARHPFEWDAWARHHGVDLGGVQPV
FT                   RLHDYNIVVEAALAGQGMAMGRHRLISAQLASGALVHALPGTTLEAPRIGWWFVTPRGA
FT                   LGEAAQRFLDWLLQEAQAQGDTH"
FT   gene            complement(174245..174320)
FT                   /locus_tag="AXYL_00162"
FT   tRNA            complement(174245..174320)
FT                   /locus_tag="AXYL_00162"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            complement(174487..174693)
FT                   /locus_tag="AXYL_00163"
FT   CDS_pept        complement(174487..174693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13524"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPE5"
FT                   /protein_id="ADP13524.1"
FT                   /translation="MTTAASKKPEAFFKGSRLISRPGAVIQVRELILTDYGLRAITSGS
FT                   TGIRQGAIEDAGPPSALKGMVPA"
FT   gene            complement(174695..175453)
FT                   /locus_tag="AXYL_00164"
FT   CDS_pept        complement(174695..175453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13525"
FT                   /db_xref="GOA:E3HPE6"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPE6"
FT                   /protein_id="ADP13525.1"
FT                   /translation="MHINHLPGVRQKRLWQKRWPREVLFNGPPILVAGTAAVKSWREPL
FT                   LESWMFGLTAATGVWLILAALVRVAVARAEDDMDGPDVVHEGLGAAVSTMHTMLAEWCN
FT                   KRKCGADLRTTFHRVVPPVHEPREIEQIINYAGAGGEGAGRTFPVHTGIAGRAVRSKTP
FT                   LVMSSQHRTEDQLRAELVLEWGYTATQARRLGPGRYSAMAVPVLDRSGQHPVGVIYMDS
FT                   SDRALFERNDVAEIVGAGAKAISDFVTKRY"
FT   gene            complement(175671..175746)
FT                   /locus_tag="AXYL_00165"
FT   tRNA            complement(175671..175746)
FT                   /locus_tag="AXYL_00165"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            complement(175814..176263)
FT                   /gene="sspB"
FT                   /locus_tag="AXYL_00166"
FT   CDS_pept        complement(175814..176263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="AXYL_00166"
FT                   /product="stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13526"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPE7"
FT                   /protein_id="ADP13526.1"
FT                   /translation="MGETSTKPYLIRALHEWCTDNGYTPYITVQVDEHTMVPVAHVRDG
FT                   QITLNVGTLATNRLTLGNEFIEFQARFSGVTENVYVPVGAVSAIYARETGAGMGFEVQP
FT                   YEPPEAGAQGATVPAAPEGSDADAAPGDDGGDDDEPKRPRLTIVK"
FT   gene            complement(176276..176887)
FT                   /locus_tag="AXYL_00167"
FT   CDS_pept        complement(176276..176887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00167"
FT                   /product="stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13527"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPE8"
FT                   /protein_id="ADP13527.1"
FT                   /translation="MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDIDLYNKPEDISVMN
FT                   PYGQVPILVERDLVLYESNIINEYIDERFPHPQLMPADPVMRARTRLFLYNFEKELFVH
FT                   VSTLEDRSAKPDEKKLANARQNIRDRLAQLAPMLLKNKYMLGEEFSMLDVAVAPLLWRL
FT                   DHYGIELPKNAAPLQKYAERIFSRPAYIEALTPSEKVMRR"
FT   gene            complement(177041..177892)
FT                   /locus_tag="AXYL_00168"
FT   CDS_pept        complement(177041..177892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00168"
FT                   /product="cytochrome c1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13528"
FT                   /db_xref="GOA:E3HPE9"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPE9"
FT                   /protein_id="ADP13528.1"
FT                   /translation="MIKKLIGAVALMLTCTVTLAAGGGYPLDKAPYRVNDMSSLQNGAK
FT                   LFVNYCLNCHSASSMRYNKLKDIGLTDQQIKESLLFTGEKVGDMMNVAMTPKDAKQWFG
FT                   TTPPDLSVIARAKSVNAGPSGADYIYTYLRTFYRDTSRATGWNNLVFPAVGMPHALWEV
FT                   QGPRELTTVAMHEVESKGDAPKTWERVTTVYDAQGFSTVKAEPVANYHGHATFDAKFKA
FT                   ANPAQVATYDNDVADLTAFMSWMAEPVQTFRVRLGVGVMLFLLLFFLVTWRLNASYWKH
FT                   VR"
FT   gene            complement(177916..179304)
FT                   /locus_tag="AXYL_00169"
FT   CDS_pept        complement(177916..179304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00169"
FT                   /product="cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13529"
FT                   /db_xref="GOA:E3HPF0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPF0"
FT                   /protein_id="ADP13529.1"
FT                   /translation="MAGEKTVETTGLLGWLDRRFPVTSTWKAHLSEYYAPKNFNFWYFF
FT                   GSLALLVLVLQIVTGIFLVMHYKPDAERAFQSVEYIMREVPWGWLVRYMHSTGASMFFV
FT                   VVYLHMLRGLLYGSYRKPRELVWIFGVAIFLCLMAEAFFGYLLPWGQMSYWGAQVIVNL
FT                   FAAIPFIGPELSIWIRGDYVVSDATLNRFFAFHVIAIPLVLVGLVAAHLVALHEVGSNN
FT                   PDGIEIKQGPKDKYGRPKDGIPFHPFYSVHDLMGVAGFLLVFAFIVFFAPEMGGYFLEF
FT                   NNFIPADSLKTPPHIAPVWYFTPFYSMLRATTDEFTWVLAGASVLGAIALLVKSNLKGF
FT                   MRIAVPGILIVVAVLLRVIDAKFWGVVAMGGTVVILFFLPWLDHSPVKSIRYRPTWHKW
FT                   IYGIFMVNFLVLGYIGTQPPSPPLNITSQIGTLLYLAFFFLMPVWSRLGTFKQVPERVT
FT                   FHAH"
FT   gene            complement(179379..180020)
FT                   /gene="petA"
FT                   /locus_tag="AXYL_00170"
FT   CDS_pept        complement(179379..180020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="AXYL_00170"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13530"
FT                   /db_xref="GOA:E3HPF1"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPF1"
FT                   /protein_id="ADP13530.1"
FT                   /translation="MSQDTLVHDDDGAVDPNLPPDPSRRFWVTTACAVGGVAGVATAVP
FT                   LVSTFSPSEKARAAGAPVEVDIGDIPVGTMKTVEWRGKPVWIIHRSPEQLAGLKTQDAL
FT                   LADPDSKRPGFTPKYAENEGRSRKPELFVCVGICTHLGCSPTSHFETGGGGGLGADWQG
FT                   GFLCPCHGSTFDLAGRVYKNKPAPDNLEVPPYQYLTDTRIIVGVDEDNKA"
FT   gene            180161..180610
FT                   /gene="mscL"
FT                   /locus_tag="AXYL_00171"
FT   CDS_pept        180161..180610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="AXYL_00171"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13531"
FT                   /db_xref="GOA:E3HPF2"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPF2"
FT                   /protein_id="ADP13531.1"
FT                   /translation="MSKATGFVKEFRDFAVKGNAVDLAVGVIIGAAFGKIVDSLVKDIV
FT                   MPLVNFILGGSVDFSNKFLVLSMPAGYNGPMTYADLTKAGANVFAWGNFVTIIINFVLL
FT                   AFVIFWMVKAIYKARAKAEEAPAAPAATPEDVALLREIRDLLKKP"
FT   gene            complement(180737..181498)
FT                   /locus_tag="AXYL_00172"
FT   CDS_pept        complement(180737..181498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00172"
FT                   /product="class II aldolase and adducin N-terminal domain
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13532"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPF3"
FT                   /protein_id="ADP13532.1"
FT                   /translation="MLEKQAHADAFFARSANKLDFGNWSEKEKVALSCRILASEGHSET
FT                   LAGQITVRQEDGTFLTTPMAQAFDEIVPASVIRINDNMEVLDGPGTPNPAVRFHFWVYR
FT                   QRPDVQCIIHTHPPYVSTLSMTGQPLVVAHMDATPFHNDCAHLKEWPGLPIADQEGEII
FT                   SAALGDKRCILLANHGFLAAGSCVEEALYLSVLIERAARNQLQAAAAYGEVKPVNDALA
FT                   AESHDFLLKPSIVRASFAMFARRVERQMAAE"
FT   gene            181643..182668
FT                   /locus_tag="AXYL_00173"
FT   CDS_pept        181643..182668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00173"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   AraC family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13533"
FT                   /db_xref="GOA:E3HPF4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPF4"
FT                   /protein_id="ADP13533.1"
FT                   /translation="MPRASQTVNPSARPACSEADLNFAPQFRPFYAQEIAGYERELDKL
FT                   VLPGEFRALTEQPRLQLQACRLRAGGLVVSLESTPISVHHRAEHAADLAHAEFLASFVI
FT                   AGHGVIVQNEATLPLEPGDIIFRTTALPSEIRMYTDSRIVVVKGPLSRLLGAHSLAMSQ
FT                   FTAQRGVAALPMVQTAHRCLHHVFFDKAESNPTSSLFAEQALLALLASIYTSQALEKIP
FT                   GDARAPADNWQVLASYIDAHITDPELSVQAVADVLRVTTRWVHRLFKMRSLQYTSYVRE
FT                   RRLQLAREALEDPRRAHVEVKEIAASCGFQHASHFIRRFHERFGMSPALYRKTARSGDG
FT                   A"
FT   gene            complement(182704..184035)
FT                   /locus_tag="AXYL_00174"
FT   CDS_pept        complement(182704..184035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00174"
FT                   /product="shikimate transporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13534"
FT                   /db_xref="GOA:E3HPF5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPF5"
FT                   /protein_id="ADP13534.1"
FT                   /translation="MDAIQAAQPITQSHKKPNLFRVAVATVIGTAVEAFDFLAYGTAAA
FT                   LVFNKIFFPQFDPVTGTLAAFGAFASGMLARPIGGILFGHFGDRIGRKSMLTLSLLLMG
FT                   ICTVLIGLLPTYEQIGISAAVLLVVLRIGQGLSFGGEMGGAMLMAVEHAPPKWKAFFGS
FT                   LPLVGAPLGILLSVGSFALVTRLPEADFLSWGWRLPFLASAVLIVVGLFIRHGIDESPE
FT                   FEQVKREKALARQPLEDKMPLGELLRKHGKSLLLCIGCKIAEVTLIYTFLVFSVSYAVS
FT                   KLGFSRADALHALLYGAGLLMFTIPLFGVLADRIGARRVCGWGGMFLGLMAIPIFLAVG
FT                   SGSLMAYSLAVFVAMAFNYAIMIAPQSSLYSAQFPAELRYSGLSIGVQFSAAIGGGLAP
FT                   LISATLVQKFDSILPVGVYLAFLGIVAGTSAFLMKPTPQDLRRG"
FT   gene            complement(184091..184717)
FT                   /locus_tag="AXYL_00175"
FT   CDS_pept        complement(184091..184717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00175"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13535"
FT                   /db_xref="GOA:E3HPF6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E3HPF6"
FT                   /protein_id="ADP13535.1"
FT                   /translation="MLTLYDHPRSGNCYKVRLFLALIGRDYQSAFIDVLARKNQTAEFE
FT                   QISAFQQIPALTDGDTAIWDSHAILLHLAHHYAPEWLAPPARIGAMHAWISVSANEIAN
FT                   SLQPLRLTRVVSNAEAAHHLGVSEALLDVPGMQARTDRVLQRLDKRLAENAWLAGGDAP
FT                   SVADIACYGYLALAEEAAIDMAAYPAIEAWRKRIQQLPGYVPPGP"
FT   gene            complement(184986..185762)
FT                   /locus_tag="AXYL_00176"
FT   CDS_pept        complement(184986..185762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00176"
FT                   /product="NGG1p interacting factor 3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13536"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQJ6"
FT                   /protein_id="ADP13536.1"
FT                   /translation="MSKVDSHVLANWLDDTLQAARFKDYCPNGLQVEGRSEIAHIIAGV
FT                   TASEALLRVAVERGADAVLVHHGWMWRNEDRRVIGTRRARMALALKNDLNLYAYHLPLD
FT                   AHPTLGNNAQLARVLGLTPALRDDGAPQTCGPDNLVWLGVAEGVATLGQLGARVAERLG
FT                   RQPLVVGDPDLPLTRVAWCTGGAQGMLGDAVDAGASAYITGEVSESTVHLARETGVGFI
FT                   AAGHHATERYGVQALGQAVAERFGIKVEFVDIDNPA"
FT   gene            185782..186942
FT                   /locus_tag="AXYL_00177"
FT   CDS_pept        185782..186942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00177"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13537"
FT                   /db_xref="GOA:E3HQJ7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQJ7"
FT                   /protein_id="ADP13537.1"
FT                   /translation="MRRYWLIFAQAVTVCLGILFVVTTLRPDLLRLAGPAAGPQPAAAA
FT                   ATPPAARAQATVSYADGVARAAPSVVNVYTTKHVNVPLIPLPDDPVLRQFFGQVPGVTR
FT                   RQASTSLGSGVIVNQDGYVLTNYHVVQAADAIEVALADGRRDAAKVVGADPDTDLAVLK
FT                   LATLRALPAATLAPDRGLRVGDVVLAIGNPFGVGQTTTLGIVSALGRNGLGLNTYENFI
FT                   QTDAAINPGNSGGALIDAAGNLVGINTAIYSESGGSMGIGFATPIEIARKVMDEIVRTG
FT                   GVKRGWLGVEPQDVTPELARAFGLDRDTRGVIIAGVMRDGPAARGGLKVGDIVQSVNGK
FT                   RMGDTTSLLSEIAQLPPGQSAKLGILRGGKPAELAVVVGTRPGKPR"
FT   gene            complement(186980..187381)
FT                   /locus_tag="AXYL_00178"
FT   CDS_pept        complement(186980..187381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00178"
FT                   /product="helix-turn-helix family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13538"
FT                   /db_xref="GOA:E3HQJ8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQJ8"
FT                   /protein_id="ADP13538.1"
FT                   /translation="MGDTRQLYIALMSLAQRLHTLMRWRGIKSQNQLARISGVPQSCIH
FT                   RILMREDCYSPSRATLLRLARALDTSVPWLTDGVGPGGDAPPGSVGPPEGAPDGYCTEI
FT                   WALLRNQSESTKKAIVSAVRLMAKDPAAT"
FT   gene            complement(187428..188219)
FT                   /gene="tatC"
FT                   /locus_tag="AXYL_00179"
FT   CDS_pept        complement(187428..188219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="AXYL_00179"
FT                   /product="twin arginine-targeting protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13539"
FT                   /db_xref="GOA:E3HQJ9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQJ9"
FT                   /protein_id="ADP13539.1"
FT                   /translation="MTQDATQEEGQQETFISHLVELRTRLLRAVGAVVVVFIVLFIYPG
FT                   ASAIYDVLAQPMLASLPEGTRMIATGVITPFMVPVKVTMMAAFIVALPVVLYQAWAFVA
FT                   PGLYRHEKRLALPLIISSTFLFIAGMAFCYFVVFRTVFHFIATFAPQSITPAPDIEAYL
FT                   SFVMTMFMAFGITFEVPVAVVLLVKMGVVELSKLKAARGYVVVGAFIIAAVVTPPDVVS
FT                   QFMLAVPLCLLYEVGLICARMVTPKQGTESEASSDSLTERH"
FT   gene            complement(188216..188740)
FT                   /gene="tatB"
FT                   /locus_tag="AXYL_00180"
FT   CDS_pept        complement(188216..188740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="AXYL_00180"
FT                   /product="twin arginine-targeting protein translocase TatB"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13540"
FT                   /db_xref="GOA:E3HQK0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQK0"
FT                   /protein_id="ADP13540.1"
FT                   /translation="MFDVSFTELMVIGVIALIVIGPERLPKVARTVGHLLGRAQRYVND
FT                   VKSDIQREIELDELRKFKSEMEDAAQGVQQSLNETQASLQEPVQQFRAELDEVAREASI
FT                   KAESAAASDTPAEPERSIAPPPGQNHSLDLDLPPAAVPAPAATQQPAPSAPKADDAAPA
FT                   AKPVAPSGTPT"
FT   gene            complement(188812..189039)
FT                   /gene="tatA"
FT                   /locus_tag="AXYL_00181"
FT   CDS_pept        complement(188812..189039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="AXYL_00181"
FT                   /product="sec-independent protein translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13541"
FT                   /db_xref="GOA:E3HQK1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQK1"
FT                   /protein_id="ADP13541.1"
FT                   /translation="MGSFSIWHWLVVLVIVALIFGTKKLRNIGSDLGGAVKGFKEGMKD
FT                   ANGDKPAEPIAQQRVSGDTIDVQAKEKSNS"
FT   gene            complement(189054..189422)
FT                   /locus_tag="AXYL_00182"
FT   CDS_pept        complement(189054..189422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00182"
FT                   /product="HIT domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13542"
FT                   /db_xref="GOA:E3HQK2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQK2"
FT                   /protein_id="ADP13542.1"
FT                   /translation="MSDNCLFCKIAAGDIPSKKVYEDEDFVAFHDINPAAPVHLLLIPR
FT                   RHVTSMQDIKGEDAEWLGRMMSLAPRLAAENGCRPGPDGGFRIMINSGVEGGQEVPHLH
FT                   FHIIGGSRPWKGRVAPNA"
FT   gene            complement(189440..189790)
FT                   /gene="hisE"
FT                   /locus_tag="AXYL_00183"
FT   CDS_pept        complement(189440..189790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="AXYL_00183"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13543"
FT                   /db_xref="GOA:E3HQK3"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQK3"
FT                   /protein_id="ADP13543.1"
FT                   /translation="MTAQAASAAEILARIADTLETRRPENGGDPQASYSAKLLAKGPDA
FT                   FLKKIGEEATELVMAAKDGVPDRIVSETADLWFHCLVALTHFKLRPEDVLAELARREGL
FT                   SGLAEKASRPQD"
FT   gene            complement(189787..190200)
FT                   /gene="hisI"
FT                   /locus_tag="AXYL_00184"
FT   CDS_pept        complement(189787..190200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="AXYL_00184"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13544"
FT                   /db_xref="GOA:E3HQK4"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQK4"
FT                   /protein_id="ADP13544.1"
FT                   /translation="MNEMSNEPAWMADVVFDENGLIPAIAQDAENGQIMMVAWMNRESL
FT                   AETAATGRAVYWSRSRQRLWRKGEESGHAQEVHELRLDCDGDVILLKIHQQGGIACHTG
FT                   RASCFYRRLEGQSDQASWTTVDPVLKDPELIYK"
FT   gene            complement(190326..191144)
FT                   /gene="hisF"
FT                   /locus_tag="AXYL_00185"
FT   CDS_pept        complement(190326..191144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="AXYL_00185"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13545"
FT                   /db_xref="GOA:E3HQK5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQK5"
FT                   /protein_id="ADP13545.1"
FT                   /translation="MTTSSSPPGAGAPAQSALTRRIIPCLDVTAGRVVKGVNFVNLLDA
FT                   GDPVEIARRYNEQGADELTFLDITATSDGRDLILPIIEQVASQVFIPLTVGGGVRQVSD
FT                   IQRLLNAGADKISINSAAVANPELVRAASDYHGSQCVVVAIDARRVSAAGEPARWEVFT
FT                   HGGRKATGLDAVAWARRMAAYGAGEILLTSMDRDGTKSGFDLELTRAVSDAVPVPVIAS
FT                   GGVGNLQHLADGVTTGRASAVLAASIFHFGQHTVGECKRFMADQGIPVRM"
FT   gene            complement(191141..191881)
FT                   /gene="hisA"
FT                   /locus_tag="AXYL_00186"
FT   CDS_pept        complement(191141..191881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="AXYL_00186"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13546"
FT                   /db_xref="GOA:E3HQK6"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQK6"
FT                   /protein_id="ADP13546.1"
FT                   /translation="MLLIPAIDLKDGRCVRLRQGDLDDATVFSEDPAAMATRWLDQGAR
FT                   RLHLVDLNGAVAGKPKNEAPIKAILDAVGDDIPVQIGGGIRDLDTIERYLDAGISYVII
FT                   GTAAVKNPGFLQDACGAFPGQIIVGLDARDGKIATDGWSKLTRHDVLDLAKKFEDYGCE
FT                   AIIYTDIGRDGMLSGVNVEATVRLAQHVRIPVYASGGIAGIQDIEALCAVEEEGVEGAI
FT                   LGRSIYEGTLDFQAAQARADELAK"
FT   gene            complement(191938..192633)
FT                   /gene="hisH1"
FT                   /locus_tag="AXYL_00187"
FT   CDS_pept        complement(191938..192633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH1"
FT                   /locus_tag="AXYL_00187"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit 1"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13547"
FT                   /db_xref="GOA:E3HQK7"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQK7"
FT                   /protein_id="ADP13547.1"
FT                   /translation="MTTIAIVDYGMGNFHSVARALKYAAPDADIRICSQPQEIAAADRV
FT                   VFPGQGAMADCMRTLNESGLREAVVRAAREKPLLGVCVGEQMLFDSSEEGGTACLGLFP
FT                   GVVRRFAGPGFADPVSDDDACLADTGAAGLADTRPERLKVPHMGWNKVRQTRSHPIWAG
FT                   IPDDTHFYFVHSYYADPEDPDLTVGETEYGLAFTCAVAAANIFAVQFHPEKSAEHGLRL
FT                   YRNFVDWQP"
FT   gene            complement(192668..193255)
FT                   /gene="hisB"
FT                   /locus_tag="AXYL_00188"
FT   CDS_pept        complement(192668..193255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="AXYL_00188"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13548"
FT                   /db_xref="GOA:E3HQK8"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQK8"
FT                   /protein_id="ADP13548.1"
FT                   /translation="MRTAEITRNTNETRIRVAVNIDGTGKQTIDTGVPFLDHMLDQIAR
FT                   HGLIDLDIKAEGDLHIDAHHTVEDVGITLGMAIAKAVGTKAGLRRYGHAYVPLDEALSR
FT                   VVVDFSGRPGLEYHIPFTRARIGDFDVDLTREFFQGLVNHALITLHIDNLRGVNAHHQA
FT                   ETVFKACGRALRMAMEVDPRMGDVVPSTKGVL"
FT   gene            complement(193257..194396)
FT                   /gene="hisC1"
FT                   /locus_tag="AXYL_00189"
FT   CDS_pept        complement(193257..194396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC1"
FT                   /locus_tag="AXYL_00189"
FT                   /product="histidinol-phosphate aminotransferase 1"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13549"
FT                   /db_xref="GOA:E3HQK9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQK9"
FT                   /protein_id="ADP13549.1"
FT                   /translation="MSLPDRPEGNPASVATTAGVAGRIAGTVRADIRELAAYPVANAEG
FT                   CIKLDAMECPYELPEAAREDIARAVRDTPLNRYPAADLSALQEAVKTAFGVPDAADVLF
FT                   GNGSDELIHIVVQACCNPGDAVLSPWPSFVYFDMAARFDHARFVGVPLTADLTLDLPAM
FT                   LAAIREHQPKVVFLAVPNNPTGGLWSDEDVAAIIAAAPGLVVLDEAYQPFADRTWMPQV
FT                   LDAPNVVVMRTVSKIGLAGLRFGYLAGHPAWIAELNKVRPPYNLDVLTQATLSAVLRHK
FT                   PVLDEQAARLRADREPLAAALAQLPGVRVFPSAGNFVLARFSGKLDGNAVHLALKTRKI
FT                   LIRNFSNAHPLLANCLRISVGAPAENAALLSALQEILSA"
FT   gene            complement(194393..195697)
FT                   /gene="hisD1"
FT                   /locus_tag="AXYL_00190"
FT   CDS_pept        complement(194393..195697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD1"
FT                   /locus_tag="AXYL_00190"
FT                   /product="histidinol dehydrogenase 1"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13550"
FT                   /db_xref="GOA:E3HQL0"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQL0"
FT                   /protein_id="ADP13550.1"
FT                   /translation="MALINRLDSRDPGFKSALSTLLAFEATEDESIDRAAAGILADVRA
FT                   RGDAALVEYTQRFDRMPGASAQTLEIPKADWHAALAALPAAQRNALEAAAERVRSYHER
FT                   QRAETWTYTDADGTMLGQQVTPLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVQELVMV
FT                   TPTPDGVRNPIVLAAAAIAGVDRVFAIGGAQAVGALAYGTATVPAVDKIVGPGNAYVAA
FT                   AKRRVFGVVGIDMIAGPSEILVICDGKTPADWIAMDLFSQAEHDELAQSILLCPDAAFI
FT                   EEVQASIERLLPTMPRADILRVSLANRGALILVQDLEEACRIANDIAPEHLEISTEQPE
FT                   KWTAQIRHAGAIFMGRFSSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIQV
FT                   SHQGAQKLGRIAAELALGEGLQAHAASAQYRIDQP"
FT   gene            complement(195751..196428)
FT                   /gene="hisG"
FT                   /locus_tag="AXYL_00191"
FT   CDS_pept        complement(195751..196428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="AXYL_00191"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13551"
FT                   /db_xref="GOA:E3HQL1"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQL1"
FT                   /protein_id="ADP13551.1"
FT                   /translation="MNDATVVPPLTLALSKGRIFEETMPLLAEAGIEVPENPESSRKLI
FT                   LPTSDPGLRLIIVRASDVPTYVQYGAADLGIAGKDVLIEHAKEQPGGLYQPIDLNIAKC
FT                   RLAVAVRKGFDYEGAVHQGARLRVATKYVQSAREHFAAKGVYVDIIKLYGSMELAPLVG
FT                   LADCIVDLVSTGGTLRANDLVAVEDIMPISSRLIVNQAALKTRGARLQPLLDAFERATS
FT                   RNA"
FT   gene            complement(196425..197690)
FT                   /gene="murA"
FT                   /locus_tag="AXYL_00192"
FT   CDS_pept        complement(196425..197690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="AXYL_00192"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13552"
FT                   /db_xref="GOA:E3HQL2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQL2"
FT                   /protein_id="ADP13552.1"
FT                   /translation="MDKLRITGGSRLHGEISISGAKNSALPILCAGLLTADALTLSNVP
FT                   HLNDTATMLRLLGRMGMRAERDADGTVTLQANQVDKLEAPYDLVKTMRASILVLGPLLA
FT                   RFGEARVSLPGGCSIGQRPVDQHIKGLAALGAEISIEHGFVVARAKRLKGASVRTDMVT
FT                   VTGTENLLMAAVLAEGQTVLENAACEPEVVDLAELLIKMGARIQGHGTSRIVIDGVDRL
FT                   HGAEHRVISDRIEAGTFLCAVGAAGGDIVLRNTDADILGATLSKLTEAGLTIKTGPDWI
FT                   RCAMSSRPRAVGFRTLEYPGFATDMQAQVMALNAVADGTSVVVETIFENRYMHVQELRR
FT                   MGADIDIDGHTAIVRGVPKLSGATVMATDLRASASLVIAGLAAEGETLVDRIYHLDRGY
FT                   DQMEVKLRALGANIQRVTKEQA"
FT   gene            complement(197690..197935)
FT                   /locus_tag="AXYL_00193"
FT   CDS_pept        complement(197690..197935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00193"
FT                   /product="bolA-like family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13553"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQL3"
FT                   /protein_id="ADP13553.1"
FT                   /translation="MLPTPAQVRQYIADGLPCEHLDVQGDGSHFDAVIVSTAFEGKRLI
FT                   QRHQLVYAALGDRMKAEIHALSMRTLTPAEYQQAGK"
FT   gene            complement(197941..198753)
FT                   /locus_tag="AXYL_00194"
FT   CDS_pept        complement(197941..198753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00194"
FT                   /product="ABC-2 type transporter family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13554"
FT                   /db_xref="GOA:E3HQL4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQL4"
FT                   /protein_id="ADP13554.1"
FT                   /translation="MTQPAATASQPLVQPRLDAGSGFPTLLRKELLRFWKVSFQTIAAP
FT                   VITALLYLLVFAHVLEGRVMVYGSVPYTAFLIPGLMMMSMLQNAFANPSSSLIQSRITG
FT                   NLVFMLLPPLSHRDIFAAYVLAAIVRGLAVGLCVWVVALFFVSLIPAHPLWLAVFAVLA
FT                   CGIMGVLGLIAGLWSEKFDQLAAFQNFLIMPATFLSGVFYSIHTLPAFWQSVSHWNPIF
FT                   YTIDGFRYGFFSVSDVSPWRSLAVVTGVFLALSLYALRLLASGYKLRN"
FT   gene            complement(198750..199562)
FT                   /locus_tag="AXYL_00195"
FT   CDS_pept        complement(198750..199562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00195"
FT                   /product="ABC transporter family protein 3"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13555"
FT                   /db_xref="GOA:E3HQL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQL5"
FT                   /protein_id="ADP13555.1"
FT                   /translation="MSAVSLENVSKVYSPRQRGWQKLLGRAPAAGFQALDNVSLNIEHG
FT                   EFFGLLGPNGAGKTTLISILAGLAHASSGRATVCGYDVVADYKSARRALGVVPQELVYD
FT                   PFFTVRETLRIQSGYFGLRKNDDWIDEILFNLGLADKANSNMRALSGGMKRRVLVAQAL
FT                   VHRPPVIVLDEPTAGVDVDLRRTLWEFISRLNKAGHTIMLTTHYLEEAEALCGRIAMLK
FT                   RGRIVALDTTQALMARVGGVDLEDAFVRIMHAGDEQPAPALQPEEISS"
FT   gene            complement(199732..200361)
FT                   /locus_tag="AXYL_00196"
FT   CDS_pept        complement(199732..200361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00196"
FT                   /product="toluene tolerance, Ttg2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13556"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQL6"
FT                   /protein_id="ADP13556.1"
FT                   /translation="MRVSFVSLLQRLVFTGLLALGLTAGAQAKPDPNGSPDQFVLATAN
FT                   EALDVLKADGTVKAGNTARINQVVNEHILPYVNFQKTTRLATGRYWRQATDAQKKALAE
FT                   AFRGTLVRTYSGALTRVTPSTNVTALPFRGDPKADDVVVRTLISQANGQPTGVDYRLEK
FT                   TPQGWKIYDMNVEGIWLIENYRNQFAQQINQNGIDGLIQALNQRNQ"
FT   gene            complement(200401..201219)
FT                   /locus_tag="AXYL_00197"
FT   CDS_pept        complement(200401..201219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00197"
FT                   /product="VacJ like lipofamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13557"
FT                   /db_xref="GOA:E3HQL7"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQL7"
FT                   /protein_id="ADP13557.1"
FT                   /translation="MNKKAISRIATVAAAGALMAGCAAPQNPDPRDPWEGFNRGVYKFN
FT                   DTVDRAVFKPVAQAYTFVTPQPVRSCVHNIFSNVGDLWSGANSFLQGRGHDFVNTLGRF
FT                   LFNTTMGVGGCFDVASANGARRIPNDFGTTLGVWGFSQGPYLVLPFFGSSSVRDGAGLI
FT                   GDYAGTTYGYMGVDSIDNVRLRNSLWGLRVVDTRASLLSATDTIDRVALDPYSFVRDAY
FT                   LQRRAAMVLGQKVDDESALPNYEDDEDDAAPAAQPAAQPAAQPAAQPAAK"
FT   gene            complement(201301..201798)
FT                   /locus_tag="AXYL_00198"
FT   CDS_pept        complement(201301..201798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00198"
FT                   /product="Mce related family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13558"
FT                   /db_xref="GOA:E3HQL8"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQL8"
FT                   /protein_id="ADP13558.1"
FT                   /translation="MSREKTDFWVGLFVLLGAVALAFLALRAGNLSTFSFAPTYTLTAN
FT                   FDNVGGLKVRAPVKSAGVVVGRVAGISFDDKTFQAVVSVNLETAYQFPKDTSASILTSG
FT                   LLGEQYLGLSAGSEEENFADGGKIRYTQSAVVLEQLISQFLYGSAEKQGSNAPEPAAKT
FT                   PN"
FT   gene            complement(201811..202599)
FT                   /locus_tag="AXYL_00199"
FT   CDS_pept        complement(201811..202599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00199"
FT                   /product="toluene tolerance protein Ttg2B"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13559"
FT                   /db_xref="GOA:E3HQL9"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQL9"
FT                   /protein_id="ADP13559.1"
FT                   /translation="MSGSNNAIGALGGWVRTRVSGIGYFTRFFGAMLARSGIALSRPRL
FT                   VSQQVHFIGNYSLLIIAVSGMFVGFVLGLQGYYTLNRYGSEEALGLLVALSLVRELGPV
FT                   VTALLFAGRAGTSLTAEIGLMKAGEQLAAMEVMAVDPIRRVLVPRLWGGIIAMPILAAV
FT                   FSMVGILGGWVVGVLLIGVDAGAFWSQMQNGVDVWKDVANGVIKSLVFGVTVTLVALYE
FT                   GWQAKPTPEGVARATTRTVVVGSLAVLGLDFLLTALMFGN"
FT   gene            complement(202596..203432)
FT                   /locus_tag="AXYL_00200"
FT   CDS_pept        complement(202596..203432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00200"
FT                   /product="ABC transporter family protein 4"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13560"
FT                   /db_xref="GOA:E3HQM0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQM0"
FT                   /protein_id="ADP13560.1"
FT                   /translation="MPAQTSKTPEFALRLEGVALGYGDFTVLRDISMDVRAGQVVAIMG
FT                   GSGSGKTTLLRAATGQLTAQQGRVLAFGQDMAHVNRAELESLRTRMGVLFQQGALFTDL
FT                   NVFENVAFPLREHTKLAEPEVTERVLDKLDAVGLRAAAHLKVAEISGGMARRVALARAV
FT                   VLEPELILYDEPFAGLDPISLGITARLIRSLADRLGCASVLITHDVHESFAIADQVYLV
FT                   GQGKLAAAGTPEMLSASQDPYVQQFLKGEPDGPVAFQYPETPAFKKWLSQQEGRRA"
FT   gene            complement(203676..204737)
FT                   /locus_tag="AXYL_00201"
FT   CDS_pept        complement(203676..204737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00201"
FT                   /product="2-nitropropane dioxygenase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13561"
FT                   /db_xref="GOA:E3HQM1"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQM1"
FT                   /protein_id="ADP13561.1"
FT                   /translation="MASRLIDLLKLHHPIVQAPMAGGATTVELVSESSKAGVLGSLGAA
FT                   YMSPEQIEAAARDIRARTPLPFAINLFASVPEEPIRGDANRMLALMARYHQQLGLPAPA
FT                   APGPQADPLPQQIEAILRVRPAVFSFTFGRMPAAAIARCRELGILTVGTATTVREAVAL
FT                   QQDGVDAIVAQGAEAGGHRGTFLDGFEESLIGTMALVPQVADAVSVPVIASGGIMDGRG
FT                   IAAALALGADLAQMGTAFLTTQESGINEAYKALLPASRAEQSRVTRAFSGRPARGIENA
FT                   FMREADAIAADILPYPLQNALTRPMRTAGGKAGDTDVLSLWAGQGAPLARRETTADLVA
FT                   RLARETAAAQARR"
FT   gene            complement(204755..205732)
FT                   /locus_tag="AXYL_00202"
FT   CDS_pept        complement(204755..205732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00202"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13562"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQM2"
FT                   /protein_id="ADP13562.1"
FT                   /translation="MKALRPLIAALAATAAFSGAAQAQTADWPAKPITMIVPYAPGGFA
FT                   DTRVRLLARKLGDSLGQPIVVENKAGAGGVVGTNLIARAAPDGYTIGTGNLAPMAVNPT
FT                   LMKDMPYNPQKDLAPIILIENSPLVLSVNNELPVKTLADLIALAKKQPGKLSFGSSGVG
FT                   GAHHLSGEMFREQAKIDIVHVPYKGGSLAATDLMGGHISMMFEMGYSALPAIQGAKIHP
FT                   IAVTSAKRLAVLPDVPTMAESGLPGFESYNWQGIVAPAGTPAPIIAKLNAEFNRILKEP
FT                   DVQKAIADTGSQAGGGTPEEFGAFIKSETEKWAHVIKAGNIQLQ"
FT   gene            complement(205758..206984)
FT                   /locus_tag="AXYL_00203"
FT   CDS_pept        complement(205758..206984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00203"
FT                   /product="major facilitator superfamily protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13563"
FT                   /db_xref="GOA:E3HQM3"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQM3"
FT                   /protein_id="ADP13563.1"
FT                   /translation="MSTPIYPSVSASRSAAALAWPAALALAAAMGIGRFAFTPVWPLMA
FT                   QEDGLSLAQGGWLASANYAGYLLGALAAVVWPIRRLRGTLAASLLAVALLTLAMPLWHG
FT                   MAVWCALRLAAGYASASAFICVAAWRAVPAGDPREADASAVTFAGVGAGIALTGLACLA
FT                   LAAWNARADTVWMALGGLALALAAIAWPGLRRQSVAAATSTASAASAARLPRDIPRLAL
FT                   HYGVFGVGYIIPATFLPAMAKEIIPDPAIFGWAWPLFGLAAAVSCLLVPRLARGRDSVQ
FT                   VWRAAQALMALGMVAVALWHHIAAVILAAVLVGGTFMVITQAGMIAARRSAGASAPRAA
FT                   ALMTAAFAAGQILGPLLASYAARWGAGLPQVLAASAALLALSAWRLGKITTDDAGAGHN
FT                   AIGPRARSH"
FT   gene            207049..207921
FT                   /locus_tag="AXYL_00204"
FT   CDS_pept        207049..207921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00204"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 8"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13564"
FT                   /db_xref="GOA:E3HQM4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQM4"
FT                   /protein_id="ADP13564.1"
FT                   /translation="MRNLDLDALQIFKAVADQGGVARAAAHLNRVQSNVSTRLKQLEAS
FT                   LQAPLFRRQNRRLVLSDQGRVLLSYADRLLRLADEAQAAVRDGSPQGVLRIGTMESTAA
FT                   ARLPPILAAYHAAWPQVRIELVTGTSAALAAKVRNYEIEAAFVAQPFPAEGLAALDAFK
FT                   EELALISPLAWDPIDSPRDLGDRSVIAFASGCSYRRILESWLNQEGVAPGKVMEFASYH
FT                   AIVACVAAGSGVAIVPRSVLAVLGAEHTVRVGGLSGSHGRALTQLVWRADDDTPALQAL
FT                   RHKLAAPQG"
FT   gene            complement(207944..208582)
FT                   /locus_tag="AXYL_00205"
FT   CDS_pept        complement(207944..208582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00205"
FT                   /product="outer membrane protein W"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13565"
FT                   /db_xref="GOA:E3HQM5"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQM5"
FT                   /protein_id="ADP13565.1"
FT                   /translation="MFSLNGRIRATAIAGLIAAGTLAAPAHAHEAGDVLFKVGVTQVRP
FT                   SSNNGTVLNGSVGLDVNNNVRPSFTLTYMATRNIGIELLGAWPFQHDVSGSGLGKIGST
FT                   KQLPPTLSLQWHILPDSMIQPYIGVGINYTHFFDTKAEGALKGSNLKLGDSWGVAAQLG
FT                   ADFKINERWFMNADIRYIDIRSKVKLDGQHIGTARIDPWVATIGVGYRF"
FT   gene            complement(208777..210243)
FT                   /gene="gltD"
FT                   /locus_tag="AXYL_00206"
FT   CDS_pept        complement(208777..210243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="AXYL_00206"
FT                   /product="glutamate synthase subunit beta"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13566"
FT                   /db_xref="GOA:E3HQM6"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQM6"
FT                   /protein_id="ADP13566.1"
FT                   /translation="MGKITGFMEFQRLQEASEAPQKRLKNWREFVLHLSDDQAKQQAAR
FT                   CMDCGIPFCNNGCPVNNIIPDWNDLVYRQDWKRALDVLHSTNNFPEFTGRICPAPCEAA
FT                   CTLNINSDAVGIKSIEHAIIDKGWAEGWVSPQVPARKTGKKVAVVGSGPAGMACAQQLA
FT                   RAGHSVTLFEKSDRIGGLLRYGIPDFKLEKHQIDRRISQMEAEGVEFAPSTYIGNPSDP
FT                   VADGLTVRTPDSLLAEFDAVVMSGGSETPRDLPVPGRELSGVYYAMDFLRQQNKAVAGD
FT                   RLTNQTLAKGKHVVVIGGGDTGSDCVGTSNRHGAASVTQFELMPQPPESENKTMTWPYW
FT                   PLKMRTSSSHEEGCERDWSVTTKLLQGSNGKVEKLVGARVEWFKDEATGQMKMREVEGS
FT                   EFEIKADLVLLAMGFVSPVQTVLDAFGVDRDARGNVRANTDDYRTNVEKVFTAGDMRRG
FT                   QSLVVWAIREGRQCARSVDAYLMGSSELPR"
FT   gene            complement(210252..214991)
FT                   /locus_tag="AXYL_00207"
FT   CDS_pept        complement(210252..214991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00207"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /EC_number="1.4.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13567"
FT                   /db_xref="GOA:E3HQM7"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQM7"
FT                   /protein_id="ADP13567.1"
FT                   /translation="MPQITPIDSCPPPKATPIDASRIGLPSAQGLYNPKNEHDACGVGF
FT                   VAHIKGKKSHAIIQQGLKILENLDHRGAVGADKLMGDGAGILIQIPDTLYRDELGHQGI
FT                   TLPPPGEYGVAMVFLPKETASRLACEQELERSVRAEGQVVLGWRDVPVDVDMPMSPTVR
FT                   ACEPVIRQLFIGRGADVMVPDALERKLYVIRKTASHAIQNMHLAHGKEYFVPSASVRTV
FT                   VYKGLLLADQVGRYYRDLADTRTVSALALVHQRFSTNTFPAWPLAHPYRMIAHNGEINT
FT                   VKGNFNWLRAREGMMQSAVLGDDLKKLYPIVYEGQSDTATFDNCLELLVNSGYSLAHAM
FT                   MMMIPEAWEQHTQMDESRRAFYEYHAAMMEPWDGPAAVAFTDGRQIGATLDRNGLRPAR
FT                   YLVTDDDMVILASEAGTLSIPENRIVKKWRLQPGKMFLIDLEQGRIIDDAEIKLQLANN
FT                   RPYRQWIERLQIKLESLPAPRQAAVATQSPVSLLDRQQAFGWTQEDYKFILEPMASTGE
FT                   EVIGSMGNDAPLAVLSDRAKPFYNYFRQLFAQVTNPPIDPIREQLVMSLVSFIGPKPNL
FT                   LDINNVNPPLRLEVSQPVLDFAAMAQIRDIEQVTGKKFRSFELDITYPAAWGPEGIEAR
FT                   VAALCARAVDAVRSGYNILIVSDRLVDSERVAIPALLATSAVHQHLIRAGLRTNTGLVV
FT                   ETGSAREVHHFALLGGYGAEAIHPYLALESLGKMNDPEKAVKNFIKAIGKGLNKVMSKM
FT                   GISTYMSYTGAQIFEAVGLQTALVNKYFTGTASNIEGIGIFQVAEEALRQHRAAFSTDP
FT                   VLANDLDAGGEYAYRVRGEEHMWTPDSIAKLQHASRANNYRTYKEYAQIINDQSRRHMT
FT                   LRGLFEFRFDPSRAIPLDDVESAKDIVKRFATGAMSLGSISTEAHSVLAVAMNRIGGKS
FT                   NTGEGGEDELRYRAEIREGKSTIKDGDTLASVLGTDRIEADVELKKGDSLRSKIKQVAS
FT                   GRFGVTAEYLSSADQIQIKMAQGAKPGEGGQLPGHKVSEYIAKLRYSVPGVGLISPPPH
FT                   HDIYSIEDLAQLIHDLKNVNSKASVSVKLVSEVGVGTVAAGVAKAKADHVVIAGHDGGT
FT                   GASPVSSIKHVGTPWELGLAETQQTLVLNRLRSRIRVQADGQMKTGRDVVIGALLGADE
FT                   FGFATAPLVVEGCIMMRKCHLNTCPVGVATQDPVLRKKFQGKPEHVVNFFFFIAEEVRE
FT                   IMAQLGIRKFDDLIGRADLLDMRSGVEHWKAQGLDFARVFHQTQSDADVRQTEEQDHGL
FT                   AGALDHQLIERSKPALERGEKVSFIVPVRNRNRTIGAMLSGAVASRYGHEGLPDDTIHI
FT                   QCNGTAGQSFGAFLAHGITMDLVGEGNDYVGKGLSGGRIIVRSPNDFRGFGPDHIIAGN
FT                   TVLYGALAGEAFFNGVAGERFAVRNSGAATVVEGTGDHGCEYMTGGTVVVLGATGRNFA
FT                   AGMSGGVAYVWDPERTLKQRANLSMVELESIVPHAEQLAQNNIDVWHSAQRGGERETDE
FT                   TILRRLVEDHFRYTGSFRAREILGDWEASRGKFVKIMPTDYRRALGEMWRAANPQQLAA
FT                   "
FT   gene            complement(215360..216121)
FT                   /locus_tag="AXYL_00208"
FT   CDS_pept        complement(215360..216121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13568"
FT                   /db_xref="GOA:E3HQM8"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQM8"
FT                   /protein_id="ADP13568.1"
FT                   /translation="MARLPRLYAPGLPQLVQANFIQPLAAPSQPAPADILNQLATWLGE
FT                   SAQRHRVSVHGWLLANDRILLLATPADEEGLPRLMQTLGRNLAARLRGGRVFAGRYRSA
FT                   LLEPGAWVLPSLVWLETYPVRSGASQDPDSWPWSSAASHTGNTTAAPAQWQSDHADYWA
FT                   CGNTPFDRQANYRKRLQDGLSREETQRIDQAVSGQWALGGPAFIASLAHTASRRVAPGQ
FT                   RGRPRKKPAAASSDAESSSAPPTTTPTSTSS"
FT   gene            216355..217221
FT                   /gene="fghA"
FT                   /locus_tag="AXYL_00209"
FT   CDS_pept        216355..217221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fghA"
FT                   /locus_tag="AXYL_00209"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13569"
FT                   /db_xref="GOA:E3HQM9"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQM9"
FT                   /protein_id="ADP13569.1"
FT                   /translation="MAVALELISQHRCFGGWQRYYRHESAEIGLPMRFSVYVPPQAEQG
FT                   PVPVLFYLAGLTCTEETFMIKAGAQRLAAELGVMLVAPDTSPRGANVPGEEESWDLGSG
FT                   AGFYVDATTPAWRGHYRMYSYVTQELHGIVTGEALPGDASRTGIFGHSMGGHGALVLAL
FT                   RNPGKFRSVSAFAPIAAPSQCPWGKKAFGAYLGNKVEDWAAYDASALMRGAANPFPAGI
FT                   LIDQGESDQFLAEQLYPEVFEAACAVAGQPLDLQRHPGYDHGYYFISTFIEDHIRFHVE
FT                   RLGKPAP"
FT   gene            217315..218004
FT                   /locus_tag="AXYL_00210"
FT   CDS_pept        217315..218004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13570"
FT                   /db_xref="GOA:E3HQN0"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQN0"
FT                   /protein_id="ADP13570.1"
FT                   /translation="MVNGIAPFVWILLGAVVVLLPGIAMLLGRGGPRDERGRRIFQFRP
FT                   VRRLFGLMLVLLGCVSGLLALSLVQFFRLTADEPVAHIEVRQVADGQFQVSASAPGTGT
FT                   KQYVLYGDQWQIDARVVRWRLPALMAGVPPLYRLERLSGRYSDAAREASATRSVHALDD
FT                   WPAPDLASLKKNFPNWFPFVDVQFGSGAYMPMFDGARYQVLMDPRGALFVRPDGEATAE
FT                   GLKRLGW"
FT   gene            218232..219116
FT                   /gene="rpoH"
FT                   /locus_tag="AXYL_00211"
FT   CDS_pept        218232..219116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="AXYL_00211"
FT                   /product="alternative sigma factor RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13571"
FT                   /db_xref="GOA:E3HQN1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQN1"
FT                   /protein_id="ADP13571.1"
FT                   /translation="MKQPSTSLAASGNALALAIANPGALGTIDAYISSVNRLPVLSAER
FT                   ETELGRRLRDQEDLGAARELILSHLRLVVSVARQYLGYGLPHADLIQEGNVGLMKAVKR
FT                   FDPERGVRLVSFAVHWIKAEIHEYIIRNWRLVKVATTKAQRKLFFNLRSMRPDGQTLDP
FT                   DQVDHIARELNVRREDVSEMEVRLSGRDMSLENQDDDDDSYAPIAYLSDEGRQEPTRVL
FT                   ERAARDQLQSAGLTDALQALDPRSRRIVEARWLQDDGGATLHELAQEFGVSAERIRQIE
FT                   AAALKKMRGNLAA"
FT   gene            complement(219457..220296)
FT                   /gene="icc"
FT                   /locus_tag="AXYL_00212"
FT   CDS_pept        complement(219457..220296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="AXYL_00212"
FT                   /product="cyclic 3',5'-adenosine monophosphate
FT                   phosphodiesterase"
FT                   /EC_number="3.1.4.17"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13572"
FT                   /db_xref="GOA:E3HQN2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR013622"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQN2"
FT                   /protein_id="ADP13572.1"
FT                   /translation="MARIHSLTRRDDAPAMLVQLTDSHLFGEPETSMLGVNTDASLRAV
FT                   LRQIEADGKHPDLLLATGDMSQDGEAAAYRRLARVLSEAPALAQASIRCLPGNHDLPAV
FT                   MRQELPQWSAPVTDVGAWRVVALDTTVPGSNAGHLPASQLDLLEAALAETPGRHTLLAM
FT                   HHNPMQIDSHWHDSMMIDNPQALFKLLTRWPQVRVLLWGHVHHEFDRRRHNLRMLATPS
FT                   TCFQFSIRDGKHVVDNMAPGYRWIKLYQDGSMATGVRRVQDALWHGAKAAADNAQAA"
FT   gene            220483..223233
FT                   /locus_tag="AXYL_00213"
FT   CDS_pept        220483..223233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00213"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13573"
FT                   /db_xref="GOA:E3HQN3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQN3"
FT                   /protein_id="ADP13573.1"
FT                   /translation="MDVGFLVFGLAGLLTLVCFMPPLAGRLKLPYSVLLAIVGCLLGII
FT                   VHVHGWAPSWIGDFLDSLERFEISSETFLMVFLPVLLFETALSMNVRRLMDDIGPILMM
FT                   AIVAVVVCTVVVGVTLDAISPYGLVVCLLLGAIVATTDPVAVVGIFREVGAPKRLTTLV
FT                   EGESLFNDAASIALYSVLLAVLGGHGELTASGIFNDFIVHFIGGGLAGFAMGRLACFLF
FT                   AWLRGFPTAEITLTLTLAYLSFFISEHYLNVSGVVATVIAGLVVGSTGRTRMSPTTFEY
FT                   LSSAWEQFGFWANSLIFLFAAMLIPKLMAAADWQELALVAVVFVATLVARAIVVFGLLP
FT                   LLGLTRLGTKVSNPYKVVMLWGGLRGAVSLALALAVTEQTGVAEEARQFIAVATTSYVL
FT                   LTLFINGISLRPLIRMLGLNQLSPVERTIRNQALAVALEDLQGKTEEVAKTEHIGTEVR
FT                   DRIRAVFDASLTSVHDGQVSQMTDEQRVAVGLAIVAQREEEMFFDILKAQIVDWRMAET
FT                   LLARAERLEDAIRLGGIPGFERAIVADVRYSTGFRLALRLHYLFGFQGWLARELGQRFA
FT                   NLMSKRSVAQRLIAFAREQITPLLGEEATQRIVSLHQRRLDLIENAMQALNLQYPSYAQ
FT                   WLQESYLGRVAREMERIRYRDMLEQFLISGEVYADLMAQLKSRWAHIDKHPPLDIEMSA
FT                   AELIKRVPLFEGLSADSLRAISKLLKPRLALPDQRVLTKGRHGEEMCFVASGAVAVHLP
FT                   DNTMIELGSGEFFGELGLLGEQQLMPEVTSLGYSKLLMLSSRDFHALLARDEHLRERIQ
FT                   VVAKQRLRAIEVWKQFSQANAAPAPVPAPVSVPTPAQAAEAAEAAGAASGSDVLATRET
FT                   RDADAPVASDSLGNPADSAAGNPADNPANHPANSPALGEPGILPR"
FT   gene            complement(223276..224088)
FT                   /locus_tag="AXYL_00214"
FT   CDS_pept        complement(223276..224088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00214"
FT                   /product="NUDIX domain protein 1"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13574"
FT                   /db_xref="GOA:E3HQN4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQN4"
FT                   /protein_id="ADP13574.1"
FT                   /translation="MPKQLSDLYADLRARAQEPAPEGARALYIAGRRCGWATHAACDAL
FT                   RDAPGIATDGESLRIGADLQPGADLNSVLEQAAQLLRQANCLRGWRDELLDVLDGDDAL
FT                   GVIERAAVRPLGLLTKAVHLNAWTPDGRLWVARRALSKSTDPGMWDTLVGGLAGSREDL
FT                   ELALVRECGEEAGLDEPDLQRRSPLRTILRIHRRLPEGYQVEDVLTSTCVLAADVRPAN
FT                   RDGEVMEIATIDAATAVRQIAEGEFTLEAALVIIEDIMQRRAAGEIPA"
FT   gene            224453..225535
FT                   /gene="coxB"
FT                   /locus_tag="AXYL_00215"
FT   CDS_pept        224453..225535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="AXYL_00215"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13575"
FT                   /db_xref="GOA:E3HQN5"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQN5"
FT                   /protein_id="ADP13575.1"
FT                   /translation="MPGGPKVNQLNLHEGVTAISRDIMWLHWMLLTICIVIFIGVFGVM
FT                   FYSIWAHRKSRGHKAATFHEHLGVEVAWTVIPFIIVIAMALPATKTVVAMKDTSSADLT
FT                   VKVTGYQWKWGYEYLDGSATGIKFLSTLSTPRAQIENREPKGEFYLMEVDNHLVVPANK
FT                   KVRIVLTAADVIHSWMIPDFGVKQDAIPGFLRDTWFNADKPGIYRGQCAELCGKDHAFM
FT                   PIVVEVMAQADYDKWVEDQKKKMAANADDPNKEWTEAELVARGEKVFAANCVACHQANG
FT                   KGIPGSFPPLDGDKVVLGPKAEQINTVLKGKPGTAMAAFGGQLNDVEIAAVISYTRHAW
FT                   SNAGKGQDPTVLPKDVAAAR"
FT   gene            225640..227247
FT                   /gene="coxA"
FT                   /locus_tag="AXYL_00216"
FT   CDS_pept        225640..227247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="AXYL_00216"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00216"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13576"
FT                   /db_xref="GOA:E3HQN6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQN6"
FT                   /protein_id="ADP13576.1"
FT                   /translation="MSSVTVDHVSPGHGHGHDDHHHAIPSGWRRWLFATNHKDIGTMYL
FT                   IFSFVMLLEGGTLALLLRTELFEPGLQFFRPELFNQFTTMHGLVMVFGAVMPAFVGFAN
FT                   WMIPMQIGASDMAFARMNNFSFWLLPVAAIMLTASFFVPGGATAAGWTLYAPLSLQMGP
FT                   GMDLAIFALHIMGASSIMGAINIIVTILNMRAPGLTLMKMPLFCWTWLITAFLLLAVMP
FT                   VLAAAITMVLTDRHFGTGFFNAAAGGDPVLYQHVFWFFGHPEVYIMILPAFGIVSAIVP
FT                   AFARKKLFGYASMVYATASIAVLSFIVWAHHMFTTGMPVTGQLYFMYATMLISIPTGVK
FT                   VFNWVATMWRGSMTFETPMLFSIGFIFVFTMGGFTGLILSVAPIDIQVHDTYYVVAHFH
FT                   YVLVAGSLFALFAGAYYWVPKWTGRMYSEKLGKLHFWSTLISFNVTFFPMHFLGLAGMP
FT                   RRYADYAGQFTTFHQMATIGAFWFGLSQLIFLWAMLRCYRGKGDVAAAKPWEGAEGLEW
FT                   TVPSPAPFHTFETPPEVK"
FT   gene            227279..227404
FT                   /locus_tag="AXYL_00217"
FT   CDS_pept        227279..227404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00217"
FT                   /product="putative membrane protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13577"
FT                   /db_xref="GOA:E3HQN7"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQN7"
FT                   /protein_id="ADP13577.1"
FT                   /translation="MTPEQRRRNKIAGLVLLAFVIAVFAWTVLRGSALLSGVAVS"
FT   gene            227414..227638
FT                   /locus_tag="AXYL_00218"
FT   CDS_pept        227414..227638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13578"
FT                   /db_xref="GOA:E3HQN8"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQN8"
FT                   /protein_id="ADP13578.1"
FT                   /translation="MSDDLRETSQRKLSFLQTMKAVAWGFFGVRKGAGHREDVAKLNPV
FT                   HVIVAGLLAAAIFVTVLVLIVRWAVSSLT"
FT   gene            227677..228552
FT                   /gene="coxC"
FT                   /locus_tag="AXYL_00219"
FT   CDS_pept        227677..228552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxC"
FT                   /locus_tag="AXYL_00219"
FT                   /product="cytochrome c oxidase subunit 3"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13579"
FT                   /db_xref="GOA:E3HQN9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQN9"
FT                   /protein_id="ADP13579.1"
FT                   /translation="MSASHSVQGKEAPYYFVPADSGHPVRTAVALLFMGLSAAAWINGV
FT                   SWAKWTLLGGFIGLIVVLYYWFGDAIHESEIGLNSKRIDGSYRWGMSWFIFSEVMFFAA
FT                   FFGALWYTRTITTPWLGDMDHRLMLWPDFQAVWPNFGPAGVVEHFQTVGPFWLPTINTA
FT                   LLLSSGVTLTIAHHALRENHRGKTIFWLLATVVLGFLFVTCQAYEYHHAYTELNLKFNS
FT                   GAYGSLFYMLTGFHGFHVLLGATMLTVILVRLIRGHFTADHHFGFEGAAWYWHFVDVVW
FT                   LGLYLFVYWF"
FT   gene            complement(228657..228857)
FT                   /locus_tag="AXYL_00220"
FT   CDS_pept        complement(228657..228857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00220"
FT                   /product="putative membrane protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13580"
FT                   /db_xref="GOA:E3HQP0"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQP0"
FT                   /protein_id="ADP13580.1"
FT                   /translation="MRVFVVLAFIGILASLASALVYLMRDKGTTSRTVNALTVRIGLSV
FT                   ALFLFVLFAHHMGWIESTGLR"
FT   gene            228897..229703
FT                   /locus_tag="AXYL_00221"
FT   CDS_pept        228897..229703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13581"
FT                   /db_xref="GOA:E3HQP1"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQP1"
FT                   /protein_id="ADP13581.1"
FT                   /translation="MARPHSTRYTVAALLLLGVAVIILASLGQWQLRRGDERRAILAAI
FT                   EAGRKQAPLPLTPATDPAQMTAWRSAQASGVWLPQFSVLLDNRNHDGKPGYWLATPLLL
FT                   DADARRAVLVLRGWIPRVMGTQGQGPAQPPLPATPAGPQTVTGELSPRVPRLFEIWTLG
FT                   GAEQSALPASLPAADGVLPQVQNLPLDAYAKSTGLALLPTVLSQSAGNADDGLVRDWPQ
FT                   PSVDFQQNTSYAVQWFAFASIAAVAWLVVLGGAVRRMRRAQNAPGA"
FT   gene            229749..230378
FT                   /locus_tag="AXYL_00222"
FT   CDS_pept        229749..230378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13582"
FT                   /db_xref="GOA:E3HQP2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQP2"
FT                   /protein_id="ADP13582.1"
FT                   /translation="MARDLSSTKPARKRSLMPMLLVFLCSLAPIVAAIVVYMNPQWWPD
FT                   ESSNYGTLLSPQRPMPVAEELRLTTLDGKPFDLQSLKGKWLLVAADGGACPESCARKLF
FT                   IARNSHASQGKNVDRLARVWFITDDAPVPDKVLEAYKGTVMVRVNPDQLARFLLARDTA
FT                   AGQPGLEVPIWVIDPLGNLMMQYPAEADGVKVRKDISKLVYSSRIG"
FT   gene            230527..231567
FT                   /locus_tag="AXYL_00223"
FT   CDS_pept        230527..231567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00223"
FT                   /product="cytochrome oxidase assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13583"
FT                   /db_xref="GOA:E3HQP3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQP3"
FT                   /protein_id="ADP13583.1"
FT                   /translation="MEIERIKARYRKLVFFTWFLTLDLIMFGAFVRLTDSGLGCPDWPG
FT                   CYGSVTPLGAMGDIHEASQAMPFGPVTLSKAWIEMIHRYVGTILGMLIIGIVYMAWRYR
FT                   SQLGRSPRLAVVTLIAVCVQGAFGAWTVTHKLMPVVVTAHLVFGLSVLALMTWLSARER
FT                   PHLAIAAAAARWKPWVAGGFALLLVQVTLGGWVSTNYAALACMDFPMCHGAWVPEMDFH
FT                   GGYSIIRALGELPSGEMISQPALTAIHWVHRNFAFVVFLYLGILAWRLRAEPGLRGPAT
FT                   LMLALLGAQLLTGLTTIFFQWPLLIAVLHNGGAAGLTLAAVVLMVRLSTAGRAPAWDYG
FT                   PNSVRV"
FT   gene            231581..232474
FT                   /gene="cyoE"
FT                   /locus_tag="AXYL_00224"
FT   CDS_pept        231581..232474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="AXYL_00224"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13584"
FT                   /db_xref="GOA:E3HQP4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQP4"
FT                   /protein_id="ADP13584.1"
FT                   /translation="MTSIAAPQPGLFRQYFVLTKPRVTQLAVFCAVIGMFLAAPGIPDM
FT                   RRVLFGTLGIWLLAAAAFAINCLIEQEIDARMLRTARRGTARGTISSFQVLSMSGLLGG
FT                   AGMFVLYHMVNPLTMWLTFATFVGYAVIYTVILKPRTPQNIVIGGLSGAMPPALGWATV
FT                   ADSVPAEAWILVLIIFIWTPPHFWALALYRNHDYAKSGLPMLPVTHGNQFTRLHILLYS
FT                   VALVATTLLPYAIRMSGELYLLSALVLGGMFVSYAWRLYRAYSDELARSMFRFSILYLA
FT                   LLFGALLVDHWVGLLR"
FT   gene            232492..233097
FT                   /locus_tag="AXYL_00225"
FT   CDS_pept        232492..233097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00225"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13585"
FT                   /db_xref="GOA:E3HQP5"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQP5"
FT                   /protein_id="ADP13585.1"
FT                   /translation="MSVFSASRRLVLRASAAAAFTVALAACGDNAPVFKGSDISGTQLG
FT                   RGMELVDYNGKTRQLSDFAGKVVVVFFGFTQCPDVCPTSLAELTEVMKKLGPDADRVQV
FT                   LLITVDPERDTPEVLKQYVTAFDPRFLGLTGTPDQVKKAAASFKAYYAKAPTKDGNYTM
FT                   DHTAAFYLLDGKGESRVLANNNIGVDALTQDIKALLKG"
FT   gene            complement(233130..233348)
FT                   /locus_tag="AXYL_00226"
FT   CDS_pept        complement(233130..233348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13586"
FT                   /db_xref="InterPro:IPR022191"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQP6"
FT                   /protein_id="ADP13586.1"
FT                   /translation="MDAITLPQLEQAINYWRNISPSVGEESRLCPEAAALATPYALMIM
FT                   AHQREIPAAELSDKARAALAGWAAAGK"
FT   gene            233480..234145
FT                   /locus_tag="AXYL_00227"
FT   CDS_pept        233480..234145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00227"
FT                   /product="rickettsia 17 kDa surface antigen family protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13587"
FT                   /db_xref="GOA:E3HQP7"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQP7"
FT                   /protein_id="ADP13587.1"
FT                   /translation="MSTSAKIESARRAIHPLVAAAAIAVIVMCTVGVAAVMGWLPSPSA
FT                   NPHADEPVAEAGPEGANLAPAPQAAVPPAPAQQGAQASAAPRSQAQTQAPAPAQRPAPQ
FT                   ACASCGVVESVRQVQVPVKDNSDHLIGTIGGGVVGGVVGNQFGGGSGKTALTVLGAVGG
FT                   ALAGREVERNIRQQQTVTHYELTVRMNDGSTRQFRSAQPFAFASGDHVRVENNQLLRG"
FT   gene            234190..234936
FT                   /locus_tag="AXYL_00228"
FT   CDS_pept        234190..234936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00228"
FT                   /product="transcriptional regulatory protein AlgP domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13588"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQP8"
FT                   /protein_id="ADP13588.1"
FT                   /translation="MSDQHTNPFVLPGMGQHSDLSGNPLLASMEMMRQAWAGLTGPGGL
FT                   ASSLPMAPPMNLEDLDRRIAELRSVENWLRMNLSMLSSTIQGMEVQRSTISTLRAFVDS
FT                   AANLDMGAFQDSGAASPLEVVLGLKPGPKSAPKPAPAAEGAKAKGEEAAGQQQAAAPGM
FT                   SEQMGAAAQSASKAWWDLLQQQFNQIAAATAASMPAAPADAAAKAGPKTGESKAAAAPA
FT                   AKASKPAARKSAAPRKAAKKTGPDAS"
FT   gene            235012..236382
FT                   /gene="glmU"
FT                   /locus_tag="AXYL_00229"
FT   CDS_pept        235012..236382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="AXYL_00229"
FT                   /product="UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13589"
FT                   /db_xref="GOA:E3HQP9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQP9"
FT                   /protein_id="ADP13589.1"
FT                   /translation="MLNVVILAAGLGKRMQSDLPKVLHTLAGKPMLGHVLDSARQLKPA
FT                   RIIVVVGHGADRVKQAYEGQSDLHFVLQQPQQGTGHAVQQAVPLLEGDGKDDVTLVLYG
FT                   DVPLVQPETLQRLLDARGAGAAVLTEVLADSTGYGRIVRDASGNVCRIVEHKDASDAER
FT                   EIREVNTGILTAPTAQLKDWLSRIDNNNAQGEYYLTDVVGLAVVDGVPVGAAQPGASWE
FT                   TLGVNSRVQQAELERRWQAEQARRQLEAGVTLADPARFDVRGSLTCGRDVFIDVGCVFE
FT                   GQVSLADGVRVGPHCVLRDVSVGPGTHIEAYSHLQQAQVGRDARVGPYARLRPGAELGD
FT                   RSHVGNFVEIKKSVLGADSKANHLAYIGDADIGARVNVGAGTITCNYDGVNKHRTVIED
FT                   DAFIGSDTQLVAPVRVGRGATLGAGTTLTRDAPAEKLTVSRAKQVTVDGWQRPVKKS"
FT   gene            236379..237767
FT                   /locus_tag="AXYL_00230"
FT   CDS_pept        236379..237767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00230"
FT                   /product="major facilitator superfamily protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13590"
FT                   /db_xref="GOA:E3HQQ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQQ0"
FT                   /protein_id="ADP13590.1"
FT                   /translation="MTGQSGEAPASGAKPAPPDGLPTPRRYWAAATVMTGISLSVLDTT
FT                   IANVALPTIAVDLNASPAQAVWIVNAYNLAVVMMLLPLSALAERIGFRRMFTFGLMLFT
FT                   LASLGCALAGTLWQLTAARVFQGIGAASLMCMFGGLVRNIYPLKLLGRGISLNATTVAI
FT                   MSVLGPTIGSAILSVAPWPWIFAVNLPICALAMLGLRHLPEVPRNDVKLDWISALLCML
FT                   TLGVFISGVDMMGMDLLRGIGLVAIATAIGFVLVRRVGKQPAPLVPVDLLRIRPLAFAV
FT                   GASACTFAAQMASYVSLPFYFQQVLGRPYLEVGMLMGAWPVGTAIIAPLAGRLSDRYSA
FT                   ATLSGIGAAAMVVGMLWLAALPATVSNWPIVAGMFVAGMGFGFFQTPNNRALLSAAPRS
FT                   RSGAAGGLQATTRVFGQSFGTALVAIAFSISLAHGPGLALVLGTVCAALAVVVNTVRFS
FT                   KLRT"
FT   gene            237895..239217
FT                   /gene="ugd"
FT                   /locus_tag="AXYL_00231"
FT   CDS_pept        237895..239217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="AXYL_00231"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13591"
FT                   /db_xref="GOA:E3HQQ1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQQ1"
FT                   /protein_id="ADP13591.1"
FT                   /translation="MKITVVGTGYVGLVSGACLADMGNDVMCLDVDAAKIALLSQGGIP
FT                   IYEPGLEDLVRRNVQAGRLHFTDDVAQSVAFGDVQFIAVGTPPGEDGSADLKYVLAAAR
FT                   NIARHMTARKLIVDKSTVPVGTADKVRAVVEQELAARGVDIPFSVASNPEFLKEGAAIN
FT                   DFMSPDRVVVGADDDYTIGVMRRIYEPFQRTHDRLMVMDVRSAELTKYAANAMLATRIS
FT                   FMNEMANLAEALGADIEQVRRGIGADPRIGYHFLYPGAGYGGSCFPKDVQALVNTAAEN
FT                   ALPMRVIEAAEAANHAQKFRLSEKVVARFGEDLKGRKIALWGLSFKPNTDDMREAPSLT
FT                   VIAELTRRGAEVRAYDPVAMHEAGRVLAGKPGISFATDMYDALDGADALLIATEWKVFR
FT                   APDFDRVKALLKTPLIIDGRNLYTPADVRGLGFEYSGIGRA"
FT   gene            239214..240272
FT                   /locus_tag="AXYL_00232"
FT   CDS_pept        239214..240272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00232"
FT                   /product="glycosyl transferase, group 1 family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13592"
FT                   /db_xref="GOA:E3HQQ2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQQ2"
FT                   /protein_id="ADP13592.1"
FT                   /translation="MKILQLNFEKGWRGGERQTLYCMRAFRKAGHDVEVMCREGAPLAE
FT                   RARQEGFVAHTCRNVPGQLAFLAGAGRYDIVHAQTANTITWAVLTKWLHRRPVAFSRRT
FT                   SFVVKPGDEWKTGFKWRHADLFVAISEMAAGEPRRLGIEPVIIRSAVEPHQIDAENVAQ
FT                   LVREFDLAGKKVMATSAALIRDKDPVTLVRAVAELAKTRRDFVFLHFGAGGDREQQAKD
FT                   EARKLGIEDVYRFAGFRKGVEDFYSILDVFVMSSEEEALGSSVLDAFLQRVPVVSTDAG
FT                   GLKESLADGRGVLCAVGDFQTMAQGMARCLDDAAFRQEVTERAYEYVRNEHDVQKMGNR
FT                   YLAQFERLIARR"
FT   gene            complement(240285..240773)
FT                   /locus_tag="AXYL_00233"
FT   CDS_pept        complement(240285..240773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00233"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   AsnC family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13593"
FT                   /db_xref="GOA:E3HQQ3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQQ3"
FT                   /protein_id="ADP13593.1"
FT                   /translation="MQNAQIPLPELDDLDRRILEQLQDDSSLTNQELAQRVHASPPTCL
FT                   RRVRRLVDEGVIDRQVAILAAEKLGSTLTAIVEITLDVQAAESLDAFEQSMLTEPAVLQ
FT                   CYRVSPGPDFVVIAQVKDMPAYHALVHRAFTAQANVRNVRTFFSVHRAKFETRIDVRA"
FT   gene            240926..242758
FT                   /gene="glmS"
FT                   /locus_tag="AXYL_00234"
FT   CDS_pept        240926..242758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="AXYL_00234"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13594"
FT                   /db_xref="GOA:E3HQQ4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQQ4"
FT                   /protein_id="ADP13594.1"
FT                   /translation="MCGIVGAVAQRDITPILVEGLKRLEYRGYDSCGVAVYADGHLRRT
FT                   RSTQRVAELAEQVAQDKVQGFTGIAHTRWATHGVPATHNAHPHFSRLGNDEPRIALVHN
FT                   GIIENHDELRAELQAVGYVFESQTDTEVIAHLVNHLYAGDLFEAVQNAVRRLHGAYAIA
FT                   VFCRDEPHRVVGARQGSPLVVGVGQNENFLASDALALAGTTDQIIYLEDGDVVDLQLSR
FT                   VWIVDANGKNVDREVHTVHVHTGAAELGPYRHYMQKEIFEQPRAVGDTLQDIESITPEL
FT                   FGDQAYKIFKDIDSLLILACGTSYYAGLTAKYWIESVAKIPVAVEIASEYRYRDSVPNP
FT                   RSLVVTISQSGETADTLAALKHARSLGMENTLTICNVSTSAMVRECKLSYITRAGVEIG
FT                   VASTKAFTTQLTALFLLTLTLAQVRGHLTEEQEAEHLKALRHLPVAIGSVLALEPQIMA
FT                   WADRFASKENALFLGRGMHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVTEHMP
FT                   VVTIAPKDELLEKLKSNMQEVRARGGELYVFADADSKIQSAEGMHVIRMPENYGKLSPI
FT                   LHTIPLQLLSYHTACARGTDVDKPRNLAKSVTVE"
FT   gene            243320..244597
FT                   /gene="capL"
FT                   /locus_tag="AXYL_00235"
FT   CDS_pept        243320..244597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capL"
FT                   /locus_tag="AXYL_00235"
FT                   /product="protein CapL"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13595"
FT                   /db_xref="GOA:E3HQQ5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQQ5"
FT                   /protein_id="ADP13595.1"
FT                   /translation="MVKRIAVCGLGYVGLPVAVAFSKRFDVIGFDVDKRRIARLKEGDD
FT                   WTGEIERDVLLASPMQFTDQVSELENCDFFVVAVPTPVDEKNNPDFSLLVRACRSIGPV
FT                   LRPGCIVVFESTVHPGATEEICGPELEKISGLRCGVDFKLGYSPERINPGDREHPLEKI
FT                   VKIVSGQDEESLEIIAGVYEKIIDAGVHRASSIKVAEAAKVLENTQRDINIALMNEMSK
FT                   ICDLVGIRTSEVLAAAGTKWNFLKFSPGLVGGHCIGVDPYYLTSKAQELGYHPEVILSG
FT                   RRINDGMASHVASRVVQTLARNGRLNATTRVGILGMTFKENVPDIRNSKVVDLYKALGA
FT                   YGITPVACDPMVDPEQMEHEYGIKLVERDQFRDMDVLILAVPHRETMDSIWDDMPALVK
FT                   SGGMVCDLKSVLDSKRLQSDLLYWTL"
FT   gene            244637..247117
FT                   /locus_tag="AXYL_00236"
FT   CDS_pept        244637..247117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00236"
FT                   /product="tetratricopeptide repeat family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13596"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQQ6"
FT                   /protein_id="ADP13596.1"
FT                   /translation="MAAFTTAPIGTCRIHTPLRDAVGRYPIKLQLGRNYGFVHTSAEAL
FT                   QQARFMFGQGDIPADVQRVIFRPSNGEQARKGAHKPADLYVVELSSRKLLAIDGYPIQS
FT                   NYLVRYFSEFFADRTRTRMFWSMAHADRLAERRALLDQDPVFKGLTPEDRDLLARIVKR
FT                   DQTDEEIEQEMNQLVELLGRDKVVFVTHVNALTPDNAPIEQRQQLIAAVAASAQRIGVP
FT                   CYDPTPLMNKIGQGDAMENGGLDLTHYTPAFAERLCAEWFKTYMRPRMDASTTQPSAPK
FT                   LAADESADRIEKLWDSGQLREASRRVREVLRRHPGLPDHTLLFARIQEELGDYEGSLAL
FT                   LGSADGAMASGSKAEQILMRNQFKLGRHDVAYSLAAGLLGDEIETPEIVRIAAFSAGHL
FT                   GYVDEALGNWKQLFRISSPQDAVAVEAADTVLALLQASGDMEAAIRWVNEVRAVMPTHG
FT                   RGFAMLWRDRLLAGDRVGLRNMASESPALNDIQVLELVKEASWRGCIMAAATLAVSCKL
FT                   ANSEQEDIGSWLKSQSQAWADEGDRALEEGRLRDAAERICAHRLLTPDALAGVRAQRAF
FT                   ERAMRLGVRAALVAGNHKEVIDLTDIALDTQIDFPELHAMRGRAADALGDKQTAMRHLE
FT                   QAAAGDAAPFSTKLHFARVAFNGGWYGEAIDAYKTVLGHEGADQSARDEAERQLGRLGP
FT                   RAIRGAREILSAGDHQAAWNLLDRVAQSWPAMTEVDHEKRRILAVLYAESRALDPASTT
FT                   ERLALGERIVKLVPDDPIGLRLAAVGAMRLHRFEQALPYWRKLQERSDNPSQFDHYIQR
FT                   CQVWIEKINRRKAA"
FT   gene            247114..249168
FT                   /locus_tag="AXYL_00237"
FT   CDS_pept        247114..249168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00237"
FT                   /product="glycosyl transferase, group 1 family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13597"
FT                   /db_xref="GOA:E3HQQ7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQQ7"
FT                   /protein_id="ADP13597.1"
FT                   /translation="MNPPLITELAEAVSDLKAVQALLEEIVTASVRVQVAQENLPRAQA
FT                   LARDHMADSKVRFLLLRLKEAAGLNEGMAQQWATLLEECPDDFLIVRYCATRLVKERKI
FT                   DEALSLVDRHLPPSTQNPERLFSRAKLLSDIRAHEQSDALFRRLISENTDRNMRVEFAK
FT                   RLRKRGLLADAFDAIAPVMKHLTPGSKAAELANELASDYAFYQRFESEEGLIGKDVRIV
FT                   SMKHAILHFRDRQIVEHSAEKPVSVALVTGSLGPGGAERQLTRLAGELTRLAESPERRP
FT                   ADVIMMPKKVEVMVKQHTEPAGSTKKQGLDFFLPVLVKAQIQVTEINKLPAVSVAHQAV
FT                   PEGSLSRLLEQLPPPVHYGVTRLAPVLRANPFDVVSLWQDGTCLFGALAALLAGAPTIH
FT                   LVFRGLPPNIRKDRFREEYPELYQALAQVPGVVFVSNSCKAAEAYAEWLGIPITRFHIL
FT                   YNGVPDLATDASAADEEKWKAFHESTTDATETIGGVFRLEPDKRPQLWIKLAAMYLKDR
FT                   PQARFVIVGDGRLRENIEALAEELNVTDRLLLVGLSNHVGYWYSQMDASVLLSRYEGLP
FT                   NVLIEAQLVGVPVISTPAGGAGECFVENETGHLLSCVDHPDLHEACEKVASMVDQVRDN
FT                   EQLREHSRHRAQKLFSLDAMLTKFMGLCMPVVSENDERMDIEPMRLMQA"
FT   gene            249210..250364
FT                   /locus_tag="AXYL_00238"
FT   CDS_pept        249210..250364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00238"
FT                   /product="polysaccharide biosynthesis/export family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13598"
FT                   /db_xref="GOA:E3HQQ8"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQQ8"
FT                   /protein_id="ADP13598.1"
FT                   /translation="MHMYVPGSGLRRKAALTMVVLATLTLAGCQLPRSGPMLSEMTGAH
FT                   DDKDVIVMPASRELVQASRVPDVADFPVRYRDLTQAGFDRLVPGDGINVKVWERGGLGV
FT                   FAADPSGVSDLGNQEINSAGNVSFPILGKFQAAGMTLAQLHDAVVARLARLVVGADVSV
FT                   TRAADARGQMVTVQGNLTKPGMYAITQTSQRLSSALAQAAPVQTNPEQLVISLRRDNQV
FT                   ASVRLSDIYRNQNNDILLRAGDVITAYDSKEYLTVLGAAGNQGRVAISKRNYSVLDALA
FT                   DSKGLDDKLADPRSVFLFTPAKAGVEGKPDLLPVVYQFDLTRPEQVALAREFTVHEGQA
FT                   IYISDAPFTQVQKVLSAFRVTMSAGFSATRAIDSDSGGSSGISQ"
FT   gene            250372..251712
FT                   /locus_tag="AXYL_00239"
FT   CDS_pept        250372..251712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00239"
FT                   /product="ABC-2 type transporter family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13599"
FT                   /db_xref="GOA:E3HQQ9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQQ9"
FT                   /protein_id="ADP13599.1"
FT                   /translation="MSNEDRIKGWRSRRKDSSYAVGSGVAAWRLDPAALFEAKAPPAVL
FT                   LKPLVARLEGEPHDSVAARRAVYEAVQAELDAEILRGDVDETLADFSRRRLRVIVRLLE
FT                   MDIRDGVDVFAPGYMPAKLVAEDERLAAAHARRVERRKQDEAREARRHASRNDIALEVE
FT                   VSQDEAGDLAILRDRLQGLHEGHDPSHSVKVRPVGRTLLAMFIYQLRVMHGESRIALVW
FT                   ALVGPVVLLTLISSLYILMGTHYIMGMDVQTFSLLGATTWIMFRQIVFRSSTAYVSARG
FT                   LLNFQGVTPLMCALVQAFIYVSVYLVVFLVLISAGHALELITLPKSWSGFLLYVVLMGC
FT                   FGVALGLLFGSIATYWHFFLRLAPIIERFLQIFAAVFFVSEQLPENLRPWMLWLPLAHG
FT                   MQLLRSAYFEAYTSHDASLGYFLTSLVFLMVLALAAERLARPNVQPM"
FT   gene            251722..252438
FT                   /locus_tag="AXYL_00240"
FT   CDS_pept        251722..252438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00240"
FT                   /product="ATPase component of an ABC polysaccharide
FT                   exporter"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13600"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQR0"
FT                   /protein_id="ADP13600.1"
FT                   /translation="MIHFNGVTDEPYAFGSRQALLSNVDLAIPVGRYALLSPAPELHRQ
FT                   IVDVLCGLRPPRQGFVKHDGNVSWAIGRQGFIRGKANGLSMIDFVSEMYEIDADATHEL
FT                   VADLVSDPRTLAKPMEHWPLYARQEFSFALALAPAFDVYVIEGAIPFEPCRFTRLWLAL
FT                   FEERLVGRTLILSSYRQNQLADYCFKGLIYERSALSIEDDLDQCIRKYPPRRSRSESGT
FT                   GDDVFGGGFDEGGIGL"
FT   gene            252416..253591
FT                   /locus_tag="AXYL_00241"
FT   CDS_pept        252416..253591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00241"
FT                   /product="capsule polysaccharide export inner-membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13601"
FT                   /db_xref="GOA:E3HRU0"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRU0"
FT                   /protein_id="ADP13601.1"
FT                   /translation="MRAESASEGRSEIERRRRERQSALRERRRHRWINTLMVLAPVVCA
FT                   LIYVSLFATPRYEAESRFFVQSASGQQGGGGAAASLLTTGNAGGMLGGFVDGWAVADFL
FT                   KSRDAMQQLDKKVGLRQYLIRAGMDPINHLAEDSSEDDLFRAYQASVKVSFNALEQIDV
FT                   LRVSAFSSEDAAILSRALIELAENFVSSMNEKGVADKLKVSEEAVKLAEQKALAARETL
FT                   TAWRTTHGNIDPTATVTMLLNLSSQLEGELNTAQINLDKIRALGNKDHFMLRPAEMQVT
FT                   SLKKRIAAVRQRLSGGGNTEAKQLKSYEALRNAQVFADSNLTLAQQTYQQAMTDTLRLQ
FT                   RYLSIIAQPVPTDRPSSPRTGILLLQALALGFVLMFIARVAMALLRGLRHG"
FT   gene            253584..255488
FT                   /locus_tag="AXYL_00242"
FT   CDS_pept        253584..255488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00242"
FT                   /product="tetratricopeptide repeat family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13602"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRU1"
FT                   /protein_id="ADP13602.1"
FT                   /translation="MVDMAIADRPVGVDATARLRDVIKQIHSSAEPLNEMPALEPALRQ
FT                   AADGWRDARRLLVSPLVREGKLAAAIAALEIMVAVYPARADERRLLASLFGRTEQWDRA
FT                   IAEADAAAGIEPGAAALHAARIQLRVQAGRTAEAAEVARATRSMAQSEPGEAYAWLMAF
FT                   VRNGDAAEAADMAAALDPRELPNERVATMAVRALLEDGRVEAAIRFGDAALGAGHDCAV
FT                   LRSSLGLAHLRRGNEDDRKVHALAHFEAGLNAAPADVRLLTLHGETLLRAGRYKEALAP
FT                   LKQAVDLAPDLEQTRAFYARALRYTLQYDAAADQMMHLLEKSPEKPLWQRATISALSQA
FT                   GRKQEAETLFGKYVAQRGQRLPATFQEAMAQLEERLPTAPIPQARLDWAWSMRGDTSID
FT                   RAQWERRARWGHLVDHLLFDWLECREESVEEAMQVLGELDTGERFFAPLLAAGKGVVVA
FT                   TAHVGPMYAGLMALELVGIPSRWLATAPSIAQSSYSAALISTADQTEAQVAKACMRALS
FT                   SGYVLCLAIDGAANPAAPRTTFEGQEVTYSSFASHLAHRMGVPSVFYAPRWENGHVAYT
FT                   LEMLPAPQPGEDADAYSLRWQQAYFERLREHVAGPPENLRLSGGIWRHVTAADRSAQQ"
FT   gene            255501..256709
FT                   /locus_tag="AXYL_00243"
FT   CDS_pept        255501..256709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00243"
FT                   /product="pectate lyase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13603"
FT                   /db_xref="GOA:E3HRU2"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRU2"
FT                   /protein_id="ADP13603.1"
FT                   /translation="MKAAIKTAHWLFALAVLYGGAAAASEACKSPDEHCPSIAALLQQR
FT                   EGYGAQATGGLGGKFIDVTSDQDSGPGTLRAALAQAKKGPTWIRFASDMTIVLDTQLRV
FT                   PSNTTIDGRGKRVTLIDDGLGVYGSKNVILTHLTIDGRLSRLTQAVNVANNSRDVWVDH
FT                   MDLSRMSDRLLNVKNGSTDVTISWTKFHNSNKVMLLNNITSKNLYANYDRDSIARVTLH
FT                   HNYFLNTVQRNPRAQFGTFHLFNNLLEDWDFYGMSFSLEARALVEGNIFKNSTQRKCVE
FT                   PEFFPTVEGINVNYCHYIPIAAKRSALENGESDRGAYEKLKSEHGYTRDYKAFLRLKDN
FT                   LYLGDAKPVLQDYRAESAPTPPYCYGYEKPTPELAEKIRKFAGNTGGDTPLPASRLGSG
FT                   CPG"
FT   gene            complement(256767..257555)
FT                   /locus_tag="AXYL_00244"
FT   CDS_pept        complement(256767..257555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00244"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   AraC family protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13604"
FT                   /db_xref="GOA:E3HRU3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRU3"
FT                   /protein_id="ADP13604.1"
FT                   /translation="MARLAPTDAFNPDTMAQPVTGIASRLIQHDSGLHSHGRGQLLFAH
FT                   AGSIRLAMPGLIAVLPPIRVAWIPPATEHRVLIRGEVEYRSIYLDPARIAAPAANPAIL
FT                   SMTPLLREVFERISLEPFDTDWSADAPRNLLAVCMDELRMARQEPMLLPVPTDRRLAGL
FT                   DLEELPPELDALSGRVGASARTITRIFQRETGMSYQAWRQLWRLLRAVDLLAAGQSVTA
FT                   VAFDLGFASDSAFIAYFRQMTGKTPGRYLAPAYKPQAVFR"
FT   gene            257648..258778
FT                   /locus_tag="AXYL_00245"
FT   CDS_pept        257648..258778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00245"
FT                   /product="major facilitator superfamily protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13605"
FT                   /db_xref="GOA:E3HRU4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRU4"
FT                   /protein_id="ADP13605.1"
FT                   /translation="MYRRPPLPLVILLLSFPQIVETIYSPALPLIATAYQAAPEEAAQT
FT                   LSLWFVAFAFGVVAWGRLCDLWGRRPALLAGLAIYALGAGWAMAAGDFTQLIAARLVSA
FT                   FGAAVGSIVTQTALRDSYRGLELARVFSILGMALAVSPAVGMYAGQEIAAAGGVHGVFL
FT                   ALALLAVALLGASALRWPETRPQPHSTPPFGPTLRAMLQDRAIWRSAALIAIFNLAIFG
FT                   YYQLGPFLFARLENSWLGFGASGVALAAASLCGAFLNTVLLRRGCAPERLVLLGIVLLA
FT                   LGAGLVAALSQSSAFLVGMALIAAAYAIAIPNILAHALRAYANAAGTAGAILSLIYYNL
FT                   LGAGLVLAGLGQRLDLLLACCAALAVAAYAMKARGI"
FT   gene            complement(258842..259249)
FT                   /locus_tag="AXYL_00246"
FT   CDS_pept        complement(258842..259249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00246"
FT                   /product="OsmC family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13606"
FT                   /db_xref="GOA:E3HRU5"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRU5"
FT                   /protein_id="ADP13606.1"
FT                   /translation="MTGGASGHGRASGKAVSNDGELELELRLPKELGGNGGGTNPEQLF
FT                   AAGFAACFHGAMRLVAMKNNVPLPADFAIHCTTTFAREAFDGLFCIKARLEISLPGMAK
FT                   DMALALVHETETICPYSKMADQGIASSVHLS"
FT   gene            complement(259469..260218)
FT                   /locus_tag="AXYL_00247"
FT   CDS_pept        complement(259469..260218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00247"
FT                   /product="cyclic nucleotide-binding domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13607"
FT                   /db_xref="GOA:E3HRU6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRU6"
FT                   /protein_id="ADP13607.1"
FT                   /translation="MREPPADAGNERLSATRRRAQGAVDKMLDVVPWYKGLPELERTMI
FT                   RAELRVVSLAAGEFLFRAGSRSPGWYGVVQGLVKWSSPGADGKTLSLAGFSTGSWFGEA
FT                   TMIRRQRFEYEVVALRPSQIVILPRETCERLWNHNIEFTKALMTHLAQRVDWLMSSFTS
FT                   NVLLDVDTTVARAVAAQFNAERHSGTNGRLKVSQEEIAGLCGISRQRCNAALARLARAG
FT                   VLETYYGGLAILDVDELHRLADVKRST"
FT   gene            260362..261585
FT                   /locus_tag="AXYL_00248"
FT   CDS_pept        260362..261585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00248"
FT                   /product="receptor family ligand binding region family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13608"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRU7"
FT                   /protein_id="ADP13608.1"
FT                   /translation="MLPMQGMMCRSALACGLAVSLLHAPAAQAQISDDVIRIGFITDMS
FT                   GVYSGPDGPGGAEAIKMAIQEMGGEINGKKIELLTADHQNKADIASAKAREWFDQAGLD
FT                   MLIGGTNSSTALAMSKVAADKKRPIIVVGAGAPALTNEQCTPYTLNYAYDTVAQARGTG
FT                   AAVVKAGGKKWYFLTADYAFGNALQADTTKVVEAGGGTVVGSVRHPLAASDFSSFLLQA
FT                   QSSKADILALANAGADATNSIKAANEFGITKTMRLAGLIMFINDIHAMGLPASQGMYLT
FT                   DSWYWNTSDETRAWGRAFFERRKAMPSSLQAADYSAALQYLRAVKATGTDDADRVLAYL
FT                   RENKLNDVYIKNGVVRPDGRVVHDMYLLQVKTPEQSKEPWDYFNVVQTIDGNQAFTTKE
FT                   ESRCALWK"
FT   gene            261591..262505
FT                   /locus_tag="AXYL_00249"
FT   CDS_pept        261591..262505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13609"
FT                   /db_xref="GOA:E3HRU8"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRU8"
FT                   /protein_id="ADP13609.1"
FT                   /translation="MSKRKVIVTIAPTGGMAFKSQNPHLPTQPLEIAEDVYRCYNAGAS
FT                   VVALHARRPDDQATCDASVYREMNRLIRDRCDIVLNNSTGGGVHGDMVKETTPGTWEIL
FT                   WEERLKGMDAGAEMCTLDATTLNLAFGDREYLMNTPLSKARELAAGMQARGIKPEWEVF
FT                   SPTHILQDATTLIEEGLDEGPHFINLVMNVHRNFQNAMPFSVRHLQMMVDLLPKNSIFC
FT                   VSGIGPAQLEANIAALLLGGHARVGLEDNLYYRHGELATNVQLTERVVRVIREMDMEPA
FT                   TPAEAREILGLPLKSGIRPEFAL"
FT   gene            262518..263294
FT                   /locus_tag="AXYL_00250"
FT   CDS_pept        262518..263294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00250"
FT                   /product="short chain dehydrogenase family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13610"
FT                   /db_xref="GOA:E3HRU9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRU9"
FT                   /protein_id="ADP13610.1"
FT                   /translation="MSNSLQGKRVLITAGAQGIGLAIARRFLEAGAEVHVCDVDEAACK
FT                   AAAAEHPRLGVSVTDVSSEAQVQAMFGELTEKWGKLDALVNNAGVSGPTNRLEETTLDA
FT                   WQRTLDVNLTGTFLCARSAVPLLRAAGGGAIVNISSVAGRLGFSLRTPYSASKFGLAGL
FT                   TQTWAMELGPSNIRVNSVLPGVVSGDRVERIIAARAAASGVSNDAMREQLVDKVSLRRM
FT                   TSPQDIANQVAYLCSDEGAIISGQSISVCGNVEYLG"
FT   gene            263464..264447
FT                   /locus_tag="AXYL_00251"
FT   CDS_pept        263464..264447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00251"
FT                   /product="integral membrane protein TerC family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13611"
FT                   /db_xref="GOA:E3HRV0"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRV0"
FT                   /protein_id="ADP13611.1"
FT                   /translation="MTQVETFATLPMWAGFVGFVLVVLALDLYVLGGRHAHRVRPREAL
FT                   FWVGVWMALAALFGALMWWYLDATLGRAVAHRKTLEFYTGYLIELSLSVDNMFVFSLIF
FT                   GYFVVPLELQRRVLLYGVLGAIVMRVCMILAGVWLLSRFDWLFYVFGLLLVVTGARMLA
FT                   RADHQPDIARNPLVRMLRSSMRITKDYHGESFFVRIGGLRYATPMFVVLLMIEASDVVF
FT                   AVDSIPAIFAVTTDPFLVFTSNIFAIMGLRALYFLLADMRERFRYLKHGLAAVLIIIGG
FT                   KMLAAPWFHVPVQWSLVAVGLILLASVGASMFLPRRAAAKAAGPKG"
FT   gene            264471..264890
FT                   /locus_tag="AXYL_00252"
FT   CDS_pept        264471..264890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00252"
FT                   /product="universal stress family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13612"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRV1"
FT                   /protein_id="ADP13612.1"
FT                   /translation="MNTIILATDGSSHSDAAARYLVEGSLLNRDFTVHVLHCEADVTGD
FT                   VKAFIGQADIDAWHHEESDKAMKSVVDILRAGNVSFECHELTGHTPDKIVAHAIKVGAS
FT                   AIVMGSHHRAPFLDALLGSVCARVIAHAPCPVLLV"
FT   gene            264933..265742
FT                   /locus_tag="AXYL_00253"
FT   CDS_pept        264933..265742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00253"
FT                   /product="spermine/spermidine synthase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13613"
FT                   /db_xref="GOA:E3HRV2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRV2"
FT                   /protein_id="ADP13613.1"
FT                   /translation="MFLRNTQCFFMPDDVHNPSDTPPAGAPAAHLRPFVQNSGTRRTLH
FT                   FTQQEIQSSMSTLNPDALELEYTRMMMGFVLFNPDPERILMVGLGGGSLPKFCHRYLSG
FT                   SAVEVVEIDPAVIALRDTFMVPRDGERFRVIQADAAEHMRGLSDHADVIFLDGFGVGGI
FT                   PGPLCSAGFYADCFRALREDGILVINFHVNHPDHHEYMERVRASFGASMFEVVDDDMTN
FT                   SIVFACKGDLLDDPAAAQLRRPASMPKDAWRQLMPTMKVIGATLVQR"
FT   gene            complement(265747..267528)
FT                   /locus_tag="AXYL_00254"
FT   CDS_pept        complement(265747..267528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00254"
FT                   /product="acyl-CoA dehydrogenase, middle domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13614"
FT                   /db_xref="GOA:E3HRV3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRV3"
FT                   /protein_id="ADP13614.1"
FT                   /translation="MSQYQAPLHDIDFLTTAVFPLDPHLQRCGSALDAGLARSVVLEAE
FT                   KFAQGLLDPLNRVGDQQGCRLHEGGVSTPAGFQQAYRAFCEGGWNGLRQPEQYGGQGLS
FT                   CVLSTLTEEIWHACNPSFALCAMLTGGAIETLLHAASPALKDQLLPRLISGEWTGTMNL
FT                   TEPAAGSDLGAVRTRATPLEDGSYAISGQKIFITYGDHDLASNIIHLVLARTPDAPAGA
FT                   KGLSLFAVPKYLIQDDGSPGARNDVHCSALEHKLGIHASPTAVMQFGAGQGATGYLVGE
FT                   LNQGLMNMFVMMNEARCAVGNQGLAVAERAFQHAVWYARERSQGKVVGEEGAALPILRH
FT                   PDVRRLLLSMKSRIESMRALGMYLSMQRDLAHAGADLEVRSRAQARIDLLIPVMKGWFT
FT                   ETAQRITYDAVQVFGGMGFIEETGAAQYYRDARILTIYEGTTAIQANDLLGRKTVRDSG
FT                   AQATLLLDEISQLAEAMLAGAAPAREFGRSLRQGCTHLRETIAWLLERHAADPRATHAG
FT                   AVSYLELWGLVAGAWMQGLRLRAALGGGADGAALQAIQASAQFYAGNLLVQSGALRQAI
FT                   GEGGASIDAFPDACWST"
FT   gene            complement(267536..268162)
FT                   /locus_tag="AXYL_00255"
FT   CDS_pept        complement(267536..268162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00255"
FT                   /product="flavin reductase-like domain protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13615"
FT                   /db_xref="GOA:E3HRV4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRV4"
FT                   /protein_id="ADP13615.1"
FT                   /translation="MAAHIGLDAKKLSTRETYRLLTSCLVPRPIAWVSSVDAMGQGNLA
FT                   PFSFYTMVSTEPPLIALSISQHQGQDKDTAANILETGEFVVNFVTLEQLAPMHASSGRY
FT                   PADVDEAALLGVDMVASTRVRPRGVARSPIRLECKLAQALTFGIQSARLLVGEVIHFSI
FT                   AEHCMSDGRIDGSLLDPACRLGGPWYAGLGPRIFAGPAQSLSTSE"
FT   gene            complement(268163..269224)
FT                   /locus_tag="AXYL_00256"
FT   CDS_pept        complement(268163..269224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00256"
FT                   /product="CoA-transferase family III family protein 2"
FT                   /EC_number="2.8.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13616"
FT                   /db_xref="GOA:E3HRV5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRV5"
FT                   /protein_id="ADP13616.1"
FT                   /translation="MPHPPPLPLSGIAVADFSELLPGPFLTQNLLELGAAVTKIERPPH
FT                   GDNARRLYPGVFDAVNRGKPCVMLDLKQPAGVQAAREIIARSDVLVEGFRPGVMARLGL
FT                   GYDEAAAINPGLVYVSLSGYGQHGPNAQRPGHDINYLATAGALALAGSDPAMPAPGAGL
FT                   PVADLCGAMYALSSILAALMQRQHTGRGQHLDVSLTDCVAHWMNPRLGQFSSAGLASLA
FT                   AQRQDVLNKPAYGVFRTRDGACVAIAALEDHFWLRLVQAFALDLSTAETSSYHQRVTLA
FT                   TDINHAIAGHVAGLDAPDIIARLEAADVPVSLVEEPLALRGTPHARARGLFDGHAEARY
FT                   VRYPVRLAHMDEG"
FT   gene            complement(269235..270215)
FT                   /locus_tag="AXYL_00257"
FT   CDS_pept        complement(269235..270215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00257"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13617"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRV6"
FT                   /protein_id="ADP13617.1"
FT                   /translation="MFNKLFGPAAGVLAAAMALAPLNASADAAFPDRPIRFIVPFTAGG
FT                   ITDNVARTVGARASELLGQPIIVENRAGAGGNIGAEYAANSKPDGYTIFLGTQGTQVTN
FT                   PLIYKNASKPDKALVAVQGLTAIPNILVVNESRPYNTLEKLVAYAKANPGKLNTSSAGA
FT                   GTGTHLAAELFQSVAGVKFSHIPFKGSAPSITALIGGQVDISFDYPVSTESFIKSGKIR
FT                   ALAVTGEARLPSFPEVPTLAELGYPGATSVSWMGLFVPADTPAPVSAKLEKAFAQAIDD
FT                   PQIASRLIAFGGVPLKKSGVDFSSFVKDESVKWGNVVKEAKVQLD"
FT   gene            complement(270271..272373)
FT                   /locus_tag="AXYL_00258"
FT   CDS_pept        complement(270271..272373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00258"
FT                   /product="CoA binding domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13618"
FT                   /db_xref="GOA:E3HRV7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRV7"
FT                   /protein_id="ADP13618.1"
FT                   /translation="MFSDLAPLFDPSSLVLIGASDRPASIGQRALTNIVEHSSYTGELF
FT                   LVNATKDTVMGRRAYRSVMDLPNAPQTAIVVVPAPAAVSVLAECGRKGVKFAIVLTSGF
FT                   GETGEAGRQLEEQMRAIVRETGIRIYGPNCPGMNNNNRGLGFTFSPAFQYDRMPGPIGL
FT                   VTQGGGLGRTFLQASGRGIGIGLWCSSGNEVDLTASDYINHMAAMPEIKVIVTLLEGIN
FT                   DAPRFAAAALNAARQGKPIVALKVGKSAYGVKATQSHTAALSGSADINSAAFRQLGIVE
FT                   VDDIDELIDTAALLARGVPARAIRTAVYSFSGGTVALAADMLGSADLALAEFEPRTRQA
FT                   LAELLPSYAAIDNPVDTTAEILVQSDISYGSLLRVAQDPNVDVVLYPIPMEYGDTTLAA
FT                   CQNLVKVQAEIDIPIVPVWMSDKLGTGYQCLVDAGIAPIRTLGKAIKALAKWNSHGASA
FT                   RAFDPAWEPSIMHAAPQRDTPAPQAYAERAAKQLLSEAGVAVPFGRVCRTADDAVAAAA
FT                   QCDGPVVAKIVSPQILHKSDIGGVIVGLRTAEEIRNAWELIMARAREAYPQADIEGILI
FT                   EQMMAQRGVETLVGVHRDDLFGHVLTFGLGGVYVEVFRDVSRRLLPLTPAEARAMIAET
FT                   RCHQLLAGCRGQAPADIGALEKLLLAVSDFVTRGPYEVQELDLNPVLVSPDGAVALDAV
FT                   LIASAR"
FT   gene            272639..273391
FT                   /gene="fabG1"
FT                   /locus_tag="AXYL_00259"
FT   CDS_pept        272639..273391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG1"
FT                   /locus_tag="AXYL_00259"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase 1"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13619"
FT                   /db_xref="GOA:E3HRV8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRV8"
FT                   /protein_id="ADP13619.1"
FT                   /translation="MDLKIAGKVALVTGSGRGIGAQTARVLAEEGARVVITDIDGQTAA
FT                   ATAQRLRDEGHEAIGVQCDVCERDAVAAMMDAAASAFGGVDILVNNAGFTRDKYLGKMA
FT                   ESDWDSVVDTILKGAFHCTRAVLPGMMERKWGRIINIASRSVFGNPGQTNYTTAKLGLV
FT                   GFTRALSLEQAKFGITVNAIAPGFVETELIQSLPSYPALRDAALAKNPVGFLGQPDDIA
FT                   SSVAFIASERARYITGVTLYVTGGRFSS"
FT   gene            273434..274600
FT                   /locus_tag="AXYL_00260"
FT   CDS_pept        273434..274600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00260"
FT                   /product="acyl-CoA dehydrogenase, N-terminal domain protein
FT                   1"
FT                   /EC_number="1.3.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13620"
FT                   /db_xref="GOA:E3HRV9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRV9"
FT                   /protein_id="ADP13620.1"
FT                   /translation="MDFDFDTDQLALRDSIRRYMKAEVGPRIAACEADRRIPSDVLEGL
FT                   APFGYIGGLLPEDDGGFGLDFVTWAMMVEEAGYCWGSLRTILNITNIFLRLVNAYGTPA
FT                   QKEKFLRPVLASAKNVCVAISEPNHGSNVAGIELKAEDQGDHYVLNGSKLWITNGVNAD
FT                   YAIVLARTFSASCDGKLSLFLVEREQSPYEARLVDKMVLKASGTAELRFDGVRVPKENL
FT                   LGAEGTALKTMLTGLNYGRLNIAMGAVGAAQAALDLSIEYAKTRRQFGRPIGEFQLVQK
FT                   HIVDMMVRTEAARALGYKAAVAVQKGLPARVECSIAKLYGAEAAHEVAKIALSVHGGLG
FT                   YSTEYPLERIFRDTSGGTIPEGTAEVQTLIVGREVLGLSAINAAETAK"
FT   gene            274600..275130
FT                   /locus_tag="AXYL_00261"
FT   CDS_pept        274600..275130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00261"
FT                   /product="MaoC like domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13621"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRW0"
FT                   /protein_id="ADP13621.1"
FT                   /translation="MAAQIAVETPAPGALADLRYYWDDLPPGLAVETAARTITEADVVA
FT                   FAGLSGDYNRLHTDAVYAGQSKFGRRIAHGMLVGSIMSGLNTRTVLNQCLEPSILGLLE
FT                   MSYRFAKPTFVGDTIKVRILVAGRRLASDTSRGVVEFERQGINQNGETVCVCSVKMLVA
FT                   CRASQSIEQIVEK"
FT   gene            275132..275908
FT                   /locus_tag="AXYL_00262"
FT   CDS_pept        275132..275908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00262"
FT                   /product="citrate synthase 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13622"
FT                   /db_xref="GOA:E3HRW1"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRW1"
FT                   /protein_id="ADP13622.1"
FT                   /translation="MIKTEIGYTTPEVITVRGKNLATELLGKVDFVDMMLLVIFNRTPS
FT                   AAEKTMINHILVTACDHGLTPSAMSARLTYLGAPEAMQAAVAAGLLGAGSVFLGTTQNC
FT                   AEMLAAGAAGLSDDPDDAECDAAARAMLSASREKRQPVYGIGHPIHVNGDPRVPTLRQL
FT                   AQELGFHGKHWRLMDAVHRVLLQDRNKNLPMNVVGAIGAIICDMELDPMIARGLMLVGR
FT                   AGGLLAHLYEEREHPIGQHIWDLVLAQDERNVAPVR"
FT   gene            276005..276745
FT                   /locus_tag="AXYL_00263"
FT   CDS_pept        276005..276745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00263"
FT                   /product="bacterial transcriptional regulator family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13623"
FT                   /db_xref="GOA:E3HRW2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRW2"
FT                   /protein_id="ADP13623.1"
FT                   /translation="MPTFVSAAARAMAVFEVFAREKRELSNSDLARLLDLADSSCLDLL
FT                   HTLHQLGYLFRTQSRRYYPTGKLLLAVQQISTVDPIIHATREALEQLSERTGETAYIGR
FT                   IDGAAVKIVAVRDGKYPLRYILGLGERIALHASAMGKSLLGGLPPEAARKLLAAKPLRK
FT                   LTSATVTEPDALLAEIDKSRERGWYHTHGEGGDGADALAVSGWLGEECVAMAISGPSDR
FT                   FQSKRDEYVEVLRGVAGKVFTREP"
FT   gene            complement(276774..278117)
FT                   /locus_tag="AXYL_00264"
FT   CDS_pept        complement(276774..278117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13624"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRW3"
FT                   /protein_id="ADP13624.1"
FT                   /translation="MASIFGMLRKIGDLGTSADGVGALMATVPAGRNFYAEIDPPPGGA
FT                   AAGEAGLNGEAFIPGQCYFSVRMVEMRLTDAGNYIAAFLPLCAFFLRYTEAGAQREIPY
FT                   VVGYDAIQQAMGAAAPQSGAGRVVFRDVYIARNVPYNSDGLEMFAALCRFSDSSLTRGI
FT                   LDFVATTVSMFGGAVGGAVVKAGEGLLKPLSKLFGTDGVSIRFGVFDGLALRRSGYRVL
FT                   AGTDSQDRLQGLQLVDGVLHRQNGSGGLEPVNDVDYLVLAFEQRATLGEDMFSAAAALP
FT                   FHRKWTETTTALLSDNAVAARAAFQSLAVDIAGSPLLIERDRFALLAAYSSEREKWKAR
FT                   KKSLKSAAGDGKGQNIASAVADRQKAAAARNSPVAQPLDAARLLLAKSAAAGAGTPPAG
FT                   QDNASLTLALSALLDTLQPGANGKPGAPPAALSGASREMLSAILGESS"
FT   gene            complement(278141..279772)
FT                   /locus_tag="AXYL_00265"
FT   CDS_pept        complement(278141..279772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13625"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRW4"
FT                   /protein_id="ADP13625.1"
FT                   /translation="MEQPAQNNNWILLAGGDDVDEECWADRIQQLQRHEQKYPRIKPFV
FT                   GAPFRHVFNLENARQEIERCGTLPGLMIIDAKPAPQATKKKSGAAAVELLNWLAEHAPV
FT                   PVLVVTEAPSEAVQRCVLERPERLMWSNEIGKKRDGGADLAVVLDSVAAATQRRRLVIE
FT                   VAEKSVRYRIQFGPHDFRSPEMPYKRQPDIAALLTRVEKFSPYLDNQRVADWLESLSDM
FT                   GRQAFDVMVAETVGPPIATLIQRARDQEGVSSGDGLAWMDLRFDFNVSDHQSAAFFSLP
FT                   FELSCNADFKANDRRYLCQRIPMARRLHMEGMDSASDWEQTASRPAGPVRLLFIGANFS
FT                   GTISFQPEDGGDDIPSVTLPPLESVADELENLQALAKRLDGRLVVEDVPPLTGYALQDY
FT                   LEEKVTGGGYDILHFSGHAHSVRDSTMLVLPGSREGEGLQLSIRLVGRWMKAGNCKLLV
FT                   LSSCRGASVRTALEVMRAGAMGVLAFRWQVEEKTCARFIRRFYAAYFDPANTQGFAEAY
FT                   RRACAGSHDESRGSPTWASALAVVRD"
FT   gene            complement(279784..282612)
FT                   /locus_tag="AXYL_00266"
FT   CDS_pept        complement(279784..282612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00266"
FT                   /product="sensory box protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13626"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRW5"
FT                   /protein_id="ADP13626.1"
FT                   /translation="MFEFPQAQTDLDAGAQVRVPASASIPGDPAAMLRVMSRAGVPCLL
FT                   LDRDGVIIDISDTLAPSAQAFRGRAAAEAYGLGEPLTMGSGAVGGIYQAADGAPVPAQL
FT                   VPLCELESGKIVVLVNDGTPFRKAESRRFERTPYAVFRLDLDGVVRFANREAARALGQK
FT                   LDEVCGEPLARHFRKSDAPRIADAIRCCARNQEGDSMVAVIVTMPGREGEERLFQLVMT
FT                   PDPAPNGELLGVIAVIQSRALESARDEIRRIALDPSINGWRLKLDAILEQIRPLVPFEH
FT                   AVFGIYDRQVSLFRAIAVRPEGVELWPARWMELPPAIRPFLDSGQTWVEEMDRFVSDQR
FT                   FEPGDEVVRCYRDMGMQASVTLPVTRPGGYSSALSLCSRQPAQYGQRHLEILRALDLEP
FT                   VLMRFEKERDDERVTFAESLRETIMTAASLRRAAEDIVPRLAQFFSWDYVALFRVNRKE
FT                   SRYEIVTQHSLAPEYALPANYLQPIERGMLGQTLRQRQLLSLDDVGDPGDPRNDYTGPP
FT                   RPLRSAMTVPIRLNGRIRWLLDVESSVSHAFKGPDADDLLEIIESLEEGLDQHLLRQTK
FT                   QSLMAETEQAVVFVGREGSIIEMNRVAADMLGTEPGRCLEGETPVSITAFALPDDASAH
FT                   TLLTSDAGVRRERIELRGAGGQPRSVLATRTDLDPSLDMAIWFFTDIADMKWARDMRFL
FT                   RETVAEIADQTRTSLALACSLTTQTALLHEDAARGEQPEAIVTRAHALSQRIVAEIGKA
FT                   DITFERLASASEARQQAPPEHARVALHELLTRIIAALPQRDQGRIAPLAQVGAASGPMV
FT                   HADAETLSAAFRSILAYLLRCRSDDARVEIDISDDPDGCSVQLGLSAAQNWDTDQRAHA
FT                   VPDDALLNAERAAHDGAGLAIAQIVRTMQAHGGTLATQPPLAESAMPPAEAYESVLPPW
FT                   RSFTLRFPARSG"
FT   gene            complement(282659..284665)
FT                   /locus_tag="AXYL_00267"
FT   CDS_pept        complement(282659..284665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13627"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRW6"
FT                   /protein_id="ADP13627.1"
FT                   /translation="MAAKKQAGRAAPARKTVATRQPAAGKTPRSAPKRKSRSLPPALPF
FT                   RRTAKPDAFDVRDIPFHPNISVTPKTEMIPAMGLTVKHQEDTSACTGFALSTVVEYLLR
FT                   KSEREPRPAISPFMLYSMARRYDEFPGSVDDTGSSLRGALKGWFKHGACAQDLFPTLNM
FT                   PAAANETADDWWLDAVKRPLGAYYRIDTRNIVEMHAALNEVGILYASAGCHAGWDDGHG
FT                   VTPLKAPSTPGAQPFWIIPPDPQDSATDGHAFVIVGYTQDGFLVQNSWGEEWGTHGMAV
FT                   LTYDDWMRNAMDCWVVQLGVVTHEHTKISNSITLRTEGKRVTLAAGTVLRNREISPFIV
FT                   NVGNNGKLSNSGAFRTTPDDLRAIVDVHMNAAREKWGLKDKPMDVCVYAHGGLVGEEDA
FT                   AEAAAEWIPLLYEKQIFPVFLMWETDVITTVKNIIQDAAHSVPRTTGGLGERLERWWNQ
FT                   RLERWLARPGTVIWGEMKQNAQAMSAPVPKGMAQEEAAMIMLYKHFKAHVSQGRVRLHI
FT                   VGHSAGAIVASHFVHRLAADGGELESLNLMAPAVTLDTFRKLVVPNLKTRVKRYQQFHL
FT                   SDRAEEDDPTCGPYRRSLLYLVSESFEGGTTTPLLGMERYFRDAGIACDAVHVSPAGSP
FT                   APGSTNPPVAASTHGGFDNDKGTQQQIIAFIKR"
FT   gene            complement(284844..285647)
FT                   /gene="dkgB"
FT                   /locus_tag="AXYL_00268"
FT   CDS_pept        complement(284844..285647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="AXYL_00268"
FT                   /product="2,5-diketo-D-gluconic acid reductase B"
FT                   /EC_number="1.1.1.274"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13628"
FT                   /db_xref="GOA:E3HRW7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRW7"
FT                   /protein_id="ADP13628.1"
FT                   /translation="MSIPVFGAGTFRLQGQAVIDSVRNALDLGYRAIDTAQIYENETEV
FT                   GQAIAESGVARDALFVTTKIWVPHYARGKLIPSLQDSLAKLRSDYADLTLIHWPAPGNG
FT                   VAVEEFMTALAEAKARGLTRQIGISNFPIAETRAAIAAVGREQIATNQIELSPYLQNRK
FT                   LAAFLQEQDIPVTSYMTLAYGKVLKDPVIGQIAQRHDATPAQVALAWALQLGYAVIPSS
FT                   TKRENLASNLLAQDLRLTEADMAQIAALERNGREVSPEGLAAQWD"
FT   gene            285771..286670
FT                   /locus_tag="AXYL_00269"
FT   CDS_pept        285771..286670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00269"
FT                   /product="uncharacterized HTH-type transcriptional
FT                   regulator YafC 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13629"
FT                   /db_xref="GOA:E3HRW8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRW8"
FT                   /protein_id="ADP13629.1"
FT                   /translation="MKTTLDEMQVFIAIVDSGSITAAADVLGQTVSAASRTMSRLEEKL
FT                   QTTLMRRTTRRLELTEEGRAYLEQARKIVAAVEESEELMSLRRNQPAGRLRVDAASPFM
FT                   LHVIAPLVPGYRQRYPQVELELNSNEGNIDLLERRTDLAIRIGRLKDSSLHAVPLGHSR
FT                   VRVLASPGYLAKHGTPRRVADLASHVLLGFSQLEALNEWPLLEADGQALHIKPHVRAFS
FT                   GETLRQLALNDGGVVCLSDFMTRGDRDSGALQQLLVKQTQDVRQPINAVYYRNTAISSR
FT                   IKSFIDYMVQALGPRGFE"
FT   gene            complement(286690..287634)
FT                   /locus_tag="AXYL_00270"
FT   CDS_pept        complement(286690..287634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00270"
FT                   /product="ornithine cyclodeaminase/mu-crystallin family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13630"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRW9"
FT                   /protein_id="ADP13630.1"
FT                   /translation="MRFIDTEQTRNALSFDAVIPALREAFRGSATVPPRHVHAIQSGNA
FT                   HGTSLIMPAWSDRGYFGVKIINIFPENTHLGLPGLHATYNLYSATTGVPIAQVDGDIVT
FT                   AYRTAGAAALGADYLARADASTLLIVGSGRIAGLVAQAMRSVRPIQRVLVWNVRAAGAE
FT                   KLAGELRAQGFDAEAASDLEAAARQADIISCATLSTVPLIHGAWLRPGVHLDLIGSFKP
FT                   EMRETDAACFDGTSVYVDTSEAPTKSGDLLAAFEAGTLKHEDIRGDLHQLAAGELPGRR
FT                   GDQEITVFKAVGSALEDLTLATLVYESVSGERA"
FT   gene            complement(287735..288730)
FT                   /gene="dcaS1"
FT                   /locus_tag="AXYL_00271"
FT   CDS_pept        complement(287735..288730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcaS1"
FT                   /locus_tag="AXYL_00271"
FT                   /product="N-carbamoyl-D-amino-acid hydrolase 1"
FT                   /EC_number="3.5.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13631"
FT                   /db_xref="GOA:E3HRX0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRX0"
FT                   /protein_id="ADP13631.1"
FT                   /translation="MHACAFSLEIHIVSNAYPARKMGLAVAQMGAVNLADTRAAVVRRL
FT                   VEMMREAAARKAEFVVFPELALTTFFPRYWMEDAEAVERYFEKSMPNADVQPLFDAARE
FT                   LGIGFYLGYAELTPEGRQFNTAILVDRSAKVIGKYRKIHLPGHSGHKVGAPFQHLEKKF
FT                   FEVGDLGFGVWETNDVKIGMCLCNDRRWPETYRVMSLQSAELIVLGYNTPSLNIHWNEP
FT                   AHLRTTTHEIVLQASAYQNAVWVGAAAKCGHEDGHHMIGSSMIVAPSGEIVARASGEED
FT                   EVITANIDLAMGQAFRDHVFNFAKHRNPQHYKLIVERTGAGDPLPTAAID"
FT   gene            complement(288922..289347)
FT                   /locus_tag="AXYL_00272"
FT   CDS_pept        complement(288922..289347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00272"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   AsnC family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13632"
FT                   /db_xref="GOA:E3HRX1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRX1"
FT                   /protein_id="ADP13632.1"
FT                   /translation="MDTLDQNLLGLLRADARMSVATLAKKLDVSRGTIDNRIRKLEERG
FT                   IIRGYTVRLRPEVETEDIVAWMSIAVEGHETRKIVSLLMGEPSVAGLHDTNGRWDLLAE
FT                   LRVPTIDQLSEVLDRLRTLKGIAATETSIHLKTFKAL"
FT   gene            289472..290512
FT                   /gene="arcB"
FT                   /locus_tag="AXYL_00273"
FT   CDS_pept        289472..290512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="AXYL_00273"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13633"
FT                   /db_xref="GOA:E3HRX2"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRX2"
FT                   /protein_id="ADP13633.1"
FT                   /translation="MTTLLSTSDVAKIVALQGPQQVFAGLLDYLLADFLRWQEFDKSAR
FT                   VASHSATGVIELMPTADSEYYTFKYVNGHPGNPQAGLSTVMAFGALAQVSTGEPLLISE
FT                   LTLTTALRTAVTSALAARALARPDSRKMALIGNGAQSEFQALAFHYLLGIDTLHVYDVD
FT                   AGATRKLESNLASVPGLRVVRFDSAAEAVKGTDIVTTVTADKAYATILTADMVEPGMHI
FT                   NAVGGDCPGKTELHADVLRAGPVFVEYEPQTRIEGDLQQMPADFAVTELWRVLTGQAAG
FT                   RKQPAEVTIFDSVGFALEDFSALRWLRDAAIRHGVGARIEVAPQSPDPKNLFEVVRAAT
FT                   PVLAQA"
FT   gene            complement(290622..290834)
FT                   /locus_tag="AXYL_00274"
FT   CDS_pept        complement(290622..290834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13634"
FT                   /db_xref="InterPro:IPR009409"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRX3"
FT                   /protein_id="ADP13634.1"
FT                   /translation="MTRKYIDCREYPSEMNCSVALAADSEGELLEAAVQHATTVHKHAD
FT                   TPELRSQLKSLFHDGTPPVETPSRA"
FT   gene            complement(291031..292125)
FT                   /locus_tag="AXYL_00275"
FT   CDS_pept        complement(291031..292125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00275"
FT                   /product="GTPase family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13635"
FT                   /db_xref="GOA:E3HRX4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRX4"
FT                   /protein_id="ADP13635.1"
FT                   /translation="MDTPQLQDAIADAISTATRGAGRVNILVAGKTGVGKSTLLNAVFR
FT                   GDLAKTGAGKPVTQSTQEFTRAGHPLTIIDTRGLEVGDYERSRQQLADLIRERSASDDQ
FT                   DKHLHVAWLCIQDSSHRVEDAEIELCDMLSNAGIPVVAVLTKARKNSPFVDEARKLLPR
FT                   AKQVVAVRALPEWIEELDAELPPMGLDNLIEATALHIPEAQQRAYANALSTRNKKALEV
FT                   KKKRAEIEVNVAAGLAASAAAAPIPFSDAFALVPIQVGMIAKIGITFGMELDTAAITTL
FT                   VTSTLGASAATLIGRSVVSGLLKFIPGAGSAVGGTIAATTAGTITKLLGNAYVAVLYDF
FT                   CLKNPGKDIDIAMIAKGLKQRVTF"
FT   gene            complement(292197..293048)
FT                   /gene="panB"
FT                   /locus_tag="AXYL_00276"
FT   CDS_pept        complement(292197..293048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="AXYL_00276"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13636"
FT                   /db_xref="GOA:E3HRX5"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRX5"
FT                   /protein_id="ADP13636.1"
FT                   /translation="MSTTATLNAAAAAASAPRLSVPAFRARKRQEPLVMLTAYTARMAE
FT                   LLDPHCDALLVGDSLAQTIYGLPTTVPVTLDMMIAHGAAVVRGSRRALIVIDMPFGSYE
FT                   ESPEQAFRSAARILKETGAAAVKLEGGQSMAPTVAYLSARGIPVMGHVGLTPQAVNILG
FT                   GYGARGRGEAEYARIAADAAAVADAGAFSLVIEGVVEPLAASITEAVACPTIGIGASGR
FT                   CDGQVLVVDDMLGMFDRTARFVKRYDDLAGRIQQAAQAYAGEVRTRTFPEPAHLYGVSG
FT                   GA"
FT   gene            293363..294355
FT                   /locus_tag="AXYL_00277"
FT   CDS_pept        293363..294355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13637"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRX6"
FT                   /protein_id="ADP13637.1"
FT                   /translation="MPSPGLIPRLLRSRPLTKSLRYFYRHTRPAAYRHNETLWPFVALQ
FT                   RDAEGRLTGCELRGVQGPAITPLDRLPRDIGADAHLILSGPSVAQIDYARCRLDVAMGV
FT                   NGSIALRRQHPSLRFDYYAMLDAGFVNRRRELVAEVLAQDLTLFVTPEVYRWIGFLFDR
FT                   RSVRCRIALFEEVHQRALQPRARPEELEARLADDPGLVLFDARNPVHAHGFSLDPTRGL
FT                   FGGGTVAYTGLQLLAWLGAKTIYLHGLDLTAAAGPRFYESAATQLSTALDRQFSGHIEP
FT                   AFRQASRLLGKRGVKVYNLSPASRLGDDVFEKRDWSCLLPEQPISSMTP"
FT   gene            294352..295476
FT                   /locus_tag="AXYL_00278"
FT   CDS_pept        294352..295476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00278"
FT                   /product="glycosyl transferase, group 1 family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13638"
FT                   /db_xref="GOA:E3HRX7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRX7"
FT                   /protein_id="ADP13638.1"
FT                   /translation="MKILYTNFHQGDGGGHTTYVMSLARILCEKSQVTVAAPASSRLLA
FT                   EAAALPGVRTLALEFKSRPLQQLRALRQLRALLREQQFDVIHANGSADHRLCMLATVGL
FT                   GARRPFMVYTQHTDRSANSLGARVRAKWGTNRVICVCSHTFRRMKQSVFRNEDLRVVHN
FT                   GVDTEKCSPASRRETAQARDSLLPEGMQGRLVIGSNAGTAVYKNWMDMVTAVSMLPENQ
FT                   RRQVVVLIAGKLPDAEQMQRVLELGMSDQVVFTGLLDDVGPFLSALDVGFVLSSKLETI
FT                   SFACREMMAAGKPVIVSAVGGLPENVTDGRDGWVVPPASVDSIVQALSQILENRDALGV
FT                   MGAEARSTALREFSLTTFVGKTERVYRESQAQPA"
FT   gene            complement(295499..297421)
FT                   /gene="ushA"
FT                   /locus_tag="AXYL_00279"
FT   CDS_pept        complement(295499..297421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="AXYL_00279"
FT                   /product="5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13639"
FT                   /db_xref="GOA:E3HRX8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRX8"
FT                   /protein_id="ADP13639.1"
FT                   /translation="MNTWKRNAGAAMLSALALLAGCGGGDDDDDKPVEQPEQPVPGRAM
FT                   ELTILHINDHHSNLDSKKKDLKLKTASGSRVAVNADTGGFPRVTGAINALASQSANVLK
FT                   LHAGDATTGTLYFNRAGEPGEADAAMMNTVCFDAMTLGNHEFDKGDSGLKRFIDLLHAG
FT                   ACQTPVLSANVTFAAGSALNPSRAPGMVKPAVVLKRDGQDIGLVGLTIAAKTQQSSSPD
FT                   AGTVFSDETAAAQQQIDALRAQGVNKIVVMSHIGYDYDKQVIAQLSGVDVVVGGDSHTL
FT                   LGPASMADYGVGSPAGAYPTVLQDKDGKRVCLVQAWEYSQVVGELKVSFDANGDVTACA
FT                   GTPHVLMDGPLKVAGAAPSAADEAAIQADVLASGFLRMQAPDAQATAVLQPFKAKVDQF
FT                   SRSLVASVPQELCSRRVPGGPGSRDYSRSSAACNTLGSVSLRGGDIQQLVAQAYLDVAN
FT                   ASYGGADISLQSGGGVRVPLLGNVTAANVIEVVPFGNMLWRLDVTGAEVKSMLEDGMQA
FT                   VYGAGGSTGPYPYAGGLRWDVNAAQAQGNRVSNIEVRDQASGNWLPLDASRSYKLFVLS
FT                   FNATGGDGYKTLANVPASRRQDIGVLDADVLQAYIDKQAKDPASGLPVLNLLPASLYST
FT                   KTYSE"
FT   gene            complement(297592..298701)
FT                   /gene="adhC"
FT                   /locus_tag="AXYL_00280"
FT   CDS_pept        complement(297592..298701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhC"
FT                   /locus_tag="AXYL_00280"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.1.1.284"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13640"
FT                   /db_xref="GOA:E3HRX9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRX9"
FT                   /protein_id="ADP13640.1"
FT                   /translation="MKSRAAVAFGPGKPLEIVEIDVAPPQRGEVLVKITHTGVCHTDAF
FT                   TLSGDDPEGLFPAVLGHEGAGVVVEVGEGVTSLKPGDHVIPLYTAECRECKFCLSGKTN
FT                   LCQKVRATQGKGVMPDGTSRFSYDGKPLYHYMGCSTFSEYTVVNEISLAKINPAAPHEK
FT                   VCLLGCGVTTGLGAVHNTAKVKEGDTVAVFGLGGIGLAVIQGAVQAKAGRIIAVDTNPN
FT                   KFVLASAMGATDCVNPKDHDKPIQDVIVEMTDGGVDFSFECIGNVHVMRAALECCHKGW
FT                   GESIIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRTQLPGMVEDAMSGKIDLDPF
FT                   VTHTLPLERINEAFDLMHEGKSIRTVIHY"
FT   gene            complement(298731..299084)
FT                   /gene="frmR"
FT                   /locus_tag="AXYL_00281"
FT   CDS_pept        complement(298731..299084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmR"
FT                   /locus_tag="AXYL_00281"
FT                   /product="regulator protein FrmR"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13641"
FT                   /db_xref="GOA:E3HRY0"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRY0"
FT                   /protein_id="ADP13641.1"
FT                   /translation="MLVDGSRQIPYTPPLYLSEPAVPHSPEEKKRVVTRLRRIQGQALA
FT                   LERAVNEGTECGALLQQLAALRGAATGLMAEVLESHLRETFLQSAQGGRQDATIEPEAE
FT                   IDLLMRLVRSYLK"
FT   gene            299221..299964
FT                   /gene="hutC"
FT                   /locus_tag="AXYL_00282"
FT   CDS_pept        299221..299964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutC"
FT                   /locus_tag="AXYL_00282"
FT                   /product="histidine utilization repressor"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13642"
FT                   /db_xref="GOA:E3HRY1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRY1"
FT                   /protein_id="ADP13642.1"
FT                   /translation="MASNPPKLPIQANAPPAPLYAQVKQMIAQQIRSGAWPEHYRVPSE
FT                   SELVDELGFSRMTINRALRELTAEGLLVRMQGVGTFVAQPKARSALFAVNNIADEIAAR
FT                   KHRHHSRVVRLAEEPAGAEQALALDIRAGQPVYHSIIVHYEDDVPIQLEDRYVNVRLAP
FT                   DYLKQDFTQSTPYEYLTRVAPLSEGEHVVEAILAKPRECQLLQIERDEPCLLISRRTWS
FT                   GDHAVTLARLIHPGSRHRLEGKFTS"
FT   gene            299961..300569
FT                   /locus_tag="AXYL_00283"
FT   CDS_pept        299961..300569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13643"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRY2"
FT                   /protein_id="ADP13643.1"
FT                   /translation="MTQPEVHLYRAADYPRMPWRNGGGTTQEVACNPGGSAAAFDWRLS
FT                   IADVAQDGGFSAFTGCQRIITVLEGQGIQLTVDGSEQAPLGPRQAYAFAGDARVQCRLL
FT                   DGPIRDFNLIYAPARWHARLQWVAGAGPWTFHSAARDVLVMTAGGALTVRINGAPHALP
FT                   ARYDCLHAVSTDGLAEYRLQADAPLDACVIELLPRAAAM"
FT   gene            300699..302429
FT                   /gene="hutU1"
FT                   /locus_tag="AXYL_00284"
FT   CDS_pept        300699..302429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutU1"
FT                   /locus_tag="AXYL_00284"
FT                   /product="urocanate hydratase 1"
FT                   /EC_number="4.2.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13644"
FT                   /db_xref="GOA:E3HRY3"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRY3"
FT                   /protein_id="ADP13644.1"
FT                   /translation="MRSARIGRAAEPIKESLLDNSNRYRDVVIRAPRGKQLNAKSWLTE
FT                   APLRMLMNNLDPDVAENPKELVVYGGIGRAARDWDCYDKIVESLKNLNEDETLLVQSGK
FT                   PVGVFKTHANAPRVLIANSNLVPHWATWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIV
FT                   QGTYETFVEAGRQHYDGNLKGRWVLTAGLGGMGGAQPLAATLAGACSLNIECQQASIDF
FT                   RLRTRYVDEQARDLDDALARIAKYTQEGRAVSIALCGNAAEVLPELVRRGVRPDMVTDQ
FT                   TSAHDPLNGYLPAGWTWQDYRARAKREPAAVIKAAKQSMAVHVQAMLAFQRLGIPTFDY
FT                   GNNIRQMAKEEGVADAFDFPGFVPAYIRPLFCRGVGPFRWAALSGDPQDIYKTDAKVKE
FT                   LIPDDAHLHRWLDMARERISFQGLPARICWVGLGQRAKLGLAFNEMVRSGELSAPIVIG
FT                   RDHLDSGSVASPNRETESMRDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQ
FT                   HAGMVIVCDGTDEAAARIGRVLTNDPGTGVMRHADAGYEEAIECAKEQGLNLPMLAGKR
FT                   "
FT   gene            302502..303929
FT                   /locus_tag="AXYL_00285"
FT   CDS_pept        302502..303929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00285"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13645"
FT                   /db_xref="GOA:E3HRY4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRY4"
FT                   /protein_id="ADP13645.1"
FT                   /translation="MTQDSQAARGPLIERRSIDFIPEDERHGKLYSQFTLWMGANLQIT
FT                   AIITGALAVVLGGDVFWSLIGLFVGQIFGGAVMALHAAQGPKLGLPQMISSRVQFGVYG
FT                   AAIPIALVCLMYLGFTATGTVLSGQALGQLFGVSDTVGILIFAAVIVAATLFGYQVIHI
FT                   IGRIATVLGIIAFFYLFSRVIALGDVGQLLQIRHFTWSSFLLAVSLAASWQIAYGPYVA
FT                   DYSRYLPSRTSSFKTFLAVGLGSVLGAQIAMVLGVLAAAMAAGQFAGREVAYIVGLGGT
FT                   GTMAALLYFTIAFGKVTISTLNSYGSFMCIATIASGFRGHVDISRRQRALLVLVIVAAA
FT                   TAVALIGQHSFLNAFKSFILFLLAFFVPWSAVNLVDYYFVSRGQYDVAALSDPNGRYGR
FT                   WNWPGILVYVFGVLVQMPFISTKLYTGPMVERLGGVDISWIIGLVVPSILYYLFARREA
FT                   PPQHRGAARAPISTPTP"
FT   gene            303957..305486
FT                   /gene="hutH"
FT                   /locus_tag="AXYL_00286"
FT   CDS_pept        303957..305486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="AXYL_00286"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13646"
FT                   /db_xref="GOA:E3HRY5"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRY5"
FT                   /protein_id="ADP13646.1"
FT                   /translation="MELHLKPGHMTLADLRRVYQQPARVTLDPAAAGPIEASVACVERI
FT                   IAEGRTAYGINTGFGLLATTRIAREDLESLQSSLVLSHAAGVGEALDDAMVRLIMVLKI
FT                   NSLARGYSGIRRKVIDALIALVNAEVYPHIPLKGSVGASGDLAPLAHMSLLLLGESKAR
FT                   HRGAWLPAREALAQAGLEPLTLAAKEGLALLNGTQVSTAYALRGLFEAEDLLAAALVCG
FT                   SLSVEAMLASRAPFDARIHAARGQPGQIDVAAVYRDLLTEDSEVGHSHVNCDKVQDPYS
FT                   LRCQPQVMGACLTQIRHVAQVLEIESNAVSDNPLVFAEQGDVVSGGNFHAEPVALVADN
FT                   LALALAEIGALSERRISLMMDKHMSQLPPFLVSNGGVNSGFMIAQVTAAALASDNKALA
FT                   HPASVDSLPTSANQEDHVSMAPNAGKRLWPMAENVRDILAIEWLGACQGLDFRQGLKTA
FT                   PKLERARSLLREKVAHYERDRFFAPDIEAASQLIAARGLTELVPAGLLPSL"
FT   gene            305513..306730
FT                   /gene="hutI"
FT                   /locus_tag="AXYL_00287"
FT   CDS_pept        305513..306730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutI"
FT                   /locus_tag="AXYL_00287"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13647"
FT                   /db_xref="GOA:E3HRY6"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRY6"
FT                   /protein_id="ADP13647.1"
FT                   /translation="MRQVWRNCHAATMAQGQYSVIERAAVVTRDDRIEWIGPEAQLPPA
FT                   DAAREHDLGGAWLTPGLIDCHTHLVFGGNRSQEFEQRLQGVDYSTIAAQGGGIASTVRA
FT                   TRAASEDELYASARQRALHLMRDGVTTLEVKSGYGLDLPNERKMLRVARRLGQTLPLTV
FT                   SATCLAAHALPPEYAGRADDYIDEVARRMLPVLAAEGLIDAVDAFCEHLAFTPGQVERV
FT                   FQAARELGLPVKLHAEQLSPLHGATLAARYGAWSADHLEHLTESDVLAMAGGGTVAVLL
FT                   PGAFYALRETKLPPIDLLRRHGVPIAISSDLNPGTSPVLSLRLMLSMACTLFRLTPEEA
FT                   LAGVTAHAAKALGLQATHGTLEAGKYADFVAWQVQHPSELAYWIGGDLPKRVVRHGAPV
FT                   DAATLV"
FT   gene            306928..307629
FT                   /locus_tag="AXYL_00288"
FT   CDS_pept        306928..307629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00288"
FT                   /product="amidohydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13648"
FT                   /db_xref="GOA:E3HRY7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRY7"
FT                   /protein_id="ADP13648.1"
FT                   /translation="MAERIGELAPDLLVTNEMPFGPWLAADPAYDAARAADSVRIHEAG
FT                   LDALAALGVPAIVSSRPVHAGAKLANEAFALQDGRYTRLHHKQYFPEEPGYFEATWFHS
FT                   AMDGFEVFEVGGIRLGVQLCTELMFNERARAYGRAGAELIVAPRASSASTRRWLTAGAM
FT                   AALVSGCYVVSSNRAGRTASGQVFGGTAFAFQPDGEPLAQSSDTESIVAIEVDPARSRA
FT                   QQSLYPCYVRE"
FT   gene            complement(307637..309046)
FT                   /locus_tag="AXYL_00289"
FT   CDS_pept        complement(307637..309046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00289"
FT                   /product="major facilitator superfamily protein 7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13649"
FT                   /db_xref="GOA:E3HRY8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRY8"
FT                   /protein_id="ADP13649.1"
FT                   /translation="MLSFSRHTVYPAGVGLPASERPGALLAVMLALCMASLDTAIANTA
FT                   LPTIARDLQASDAGSIWIVSGYQLAMVAGLLPAAALGEILGHRRVYIVGLAIFILSSLA
FT                   SGLAPSLPTLVTARVLQGLGAAGVMSVNGALLRFIYPSRLLGRGLGLNAMVVGIAFAAG
FT                   PTVASTILLLGSWHWLFLINVPIGLLAFALGLRKLPETVRAPHRFDGLAAALCALTLGL
FT                   FVLGANELAHAAPLPRVALEWGVAAASLWLLMRRQAGHPAPILAVDLLRRPLFALSAAT
FT                   AVCAFAAQALAFVSLPFMLQTMLGYSQVQTGFLITPWAVVVAIMAPIAGRLSDRYAAGT
FT                   LGGVGLALLALGLALLALMPTAPSVWDICWRMAICGAGFGFFQSPNLRAIMMSAPASRA
FT                   GGASGMIGTVRLLGQSSGAALVAACFNVSSTHGAIAALWLGCGCAALACVASFSRLRFD
FT                   ATEPAQAGSTR"
FT   gene            309231..310265
FT                   /locus_tag="AXYL_00290"
FT   CDS_pept        309231..310265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00290"
FT                   /product="tripartite tricarboxylate transporter family
FT                   receptor 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13650"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRY9"
FT                   /protein_id="ADP13650.1"
FT                   /translation="MQFAVSRRRRRLLSAFALGVLGAAAAGRLHAVPMTRILVGFPPGG
FT                   GVDVIARLLARQLEAGLGEVVLVENRPGAGGMLAAQELLAARPDGHTLLFTNDHALAIV
FT                   PHIAKQAGYASPGDFAAVAQMTDQAAMALAVRADSPLRSLNDLRAHQDALFVGVPAPGS
FT                   VPELALELLDAHLGVVATAIPYGGGAPLVTDLQGGYLALGLTSLAELLDPVRAGRLRLL
FT                   AISGSARHPDVADVATFAEQGVAGLERGGVAGLFAPRGVAPARIEQLQQQVAQALESEE
FT                   VVAQLRLQGSRVRFGDAATLARNMDAVHQAWAERAQAWRARPATGTPGRVAAKSPAPRS
FT                   SPDS"
FT   gene            complement(310201..311892)
FT                   /locus_tag="AXYL_00291"
FT   CDS_pept        complement(310201..311892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00291"
FT                   /product="major facilitator superfamily protein 8"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13651"
FT                   /db_xref="GOA:E3HRZ0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRZ0"
FT                   /protein_id="ADP13651.1"
FT                   /translation="MLQPVSANTDLPADAQAAPAPVLQVSTLSPFAFPAFRIIWIANLF
FT                   ANLGTWAQSVAAAWIITTEQSSPLMVAMIQVAAAFPLVALSILTGVLADNYDRRKVMLT
FT                   GMLLELAGGVFITILAFAGLLHPITLIASVFCIAIGSAIVTPAWQAAVGEQVPRAHVGS
FT                   AVLLNSVNFNVARAVGPAIGGLLLGAMGAPWVFLLNCFCYGGLIWAIWRWRRELPLRRL
FT                   PPEGILEGVVAALRYTQHSTVTRVVMLRSFAFGLSASALWALLPLLAHEHEGGSALLYG
FT                   YMLGALGLGAILGSAFVRRVQAAWGAGGLVSVAAALLAACLLALGLTGTLWVAFPALLL
FT                   SGSCWIGVLATYNTTVQMLVPDWVKARALALYQTAIFGGLAAGSFMWGHFAGTMGVSGA
FT                   LATAGIMLGITVALMYRSRLPEHLDTSSLARADSTEPTMAAAGFNTQHGAVLVAVEYLI
FT                   EKDKLSALIGAAHPLRLMRLRNGAQQWQLFRDLEREGVWREVFLVESWMQYLRMIDRMT
FT                   LEDKMVLDKVRALHAGDKPPVVSRNVSYLAMNEAQGFSLRRDPESL"
FT   gene            complement(312039..312383)
FT                   /locus_tag="AXYL_00292"
FT   CDS_pept        complement(312039..312383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00292"
FT                   /product="sulfite:cytochrome c oxidoreductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13652"
FT                   /db_xref="GOA:E3HRZ1"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRZ1"
FT                   /protein_id="ADP13652.1"
FT                   /translation="MNRHFRRCLPALALACACLSPAAQALEIKLPQETATLHPGTGAGA
FT                   QHAALCLMCHSVDYVSSQPPMPLGFWDAEVKKMVGTYGAPIPADQVPLIVEYLNQAYPP
FT                   APAAAPAAKQ"
FT   gene            complement(312394..313629)
FT                   /gene="sorA"
FT                   /locus_tag="AXYL_00293"
FT   CDS_pept        complement(312394..313629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sorA"
FT                   /locus_tag="AXYL_00293"
FT                   /product="sulfite:cytochrome c oxidoreductase subunit A"
FT                   /EC_number="1.8.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13653"
FT                   /db_xref="GOA:E3HRZ2"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRZ2"
FT                   /protein_id="ADP13653.1"
FT                   /translation="MSTFDPNGRRRFLRQACTLGATGTLAGHALTSLAAPATVTLPFAN
FT                   GERELIAYPQKRPLIRQTSRPPQLETPFSVFNENLITPNDAFFVRYHLGNIPTAIDLNT
FT                   YRIKVSGLVDKPLDLSLADLKQQFGKPVELVAVTQCSGNSRGFFVPRVGGGQSGNGAMG
FT                   NARWLGIPLKRVLEKAGIRADARQISFEGLDRPVLPGTPEFVKALDVAHALDGEVMLAY
FT                   AMNGADLPMLNGYPVRLVVPGYYGTYWVKHLADIKVLDKEFDGFWMQKAYRIPDNDCAC
FT                   TPPGKAPEKTRPIGRYNVRSFITSLSAGARVARGKPVQVRGIAFDGGKGIREVQFSSDD
FT                   GKTWQAAKLGKDLGRYSFREWHADFTPKAAGDYTLKVRATNMAGDTQPLDPLWNPAGYM
FT                   RNVVEAVRVTAA"
FT   gene            313755..314150
FT                   /locus_tag="AXYL_00294"
FT   CDS_pept        313755..314150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00294"
FT                   /product="putative membrane protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13654"
FT                   /db_xref="GOA:E3HRZ3"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRZ3"
FT                   /protein_id="ADP13654.1"
FT                   /translation="MILTFNKRAFAALLAVTALEALIATLGAPYPLLRGFVGDVVAVGW
FT                   AYLVYRSFIRADVLPLALAALFTGYAVELGQYLARHFGWRLEQPLLRIVVGSVPDWWDM
FT                   LAYTLGFVLVLALAAWNRRRGATLRGA"
FT   gene            complement(314195..314410)
FT                   /locus_tag="AXYL_00295"
FT   CDS_pept        complement(314195..314410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13655"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRZ4"
FT                   /protein_id="ADP13655.1"
FT                   /translation="MNTRHPLGDAPIGQQLLTHYARRDAVRHATPLFPSSWAELFAPFR
FT                   NARLQPLRAAKPAARAHDDAPVCQAG"
FT   gene            314647..315378
FT                   /locus_tag="AXYL_00296"
FT   CDS_pept        314647..315378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00296"
FT                   /product="TENA/THI-4/PQQC family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13656"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRZ5"
FT                   /protein_id="ADP13656.1"
FT                   /translation="MAELMNRDEFRTALENAIKGKSANASPFSIAWAEGKLSRQHLQRW
FT                   AENHYHYVGPFADYLGYLYARTPDSYTEAKDFLLANMYEEEIGGDRHTDLLIRFAEACG
FT                   TTRERVVNPDNMSPTTRALQSWCYAVAMREDPIVAVAGLVVGLESQVPSIYRKQTPTLR
FT                   EKYGFTDEEVEFFDLHIVSDEIHGERGYQIVLEHANTVDLQQRCLKICEIGAQMRLLYT
FT                   TALYTDYVQQEITLPELGLAA"
FT   gene            315449..315748
FT                   /locus_tag="AXYL_00297"
FT   CDS_pept        315449..315748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00297"
FT                   /product="2Fe-2S iron-sulfur cluster binding domain protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13657"
FT                   /db_xref="GOA:E3HRZ6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRZ6"
FT                   /protein_id="ADP13657.1"
FT                   /translation="MPTIVFHKGGQTYTDVVKDNTNLVVRAGIKQFPYPHLRYECGMGK
FT                   CAKCACRVLAGAEHLPPVNWKEKKQLGERIDQGYRLACQLWLTSDIELVQDLEA"
FT   gene            315754..316083
FT                   /locus_tag="AXYL_00298"
FT   CDS_pept        315754..316083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13658"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRZ7"
FT                   /protein_id="ADP13658.1"
FT                   /translation="MDPVYVILTSKPGVFRTEADQGAVDILETYDYAFYGRALAVYCIA
FT                   RLHGDTKLVVTEETPPYVVNRVPSKFLEKFASVEAARKELAHLTRFGSMESTLTLRPGA
FT                   VAAEH"
FT   gene            316089..316430
FT                   /locus_tag="AXYL_00299"
FT   CDS_pept        316089..316430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00299"
FT                   /product="2Fe-2S iron-sulfur cluster binding domain protein
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13659"
FT                   /db_xref="GOA:E3HRZ8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRZ8"
FT                   /protein_id="ADP13659.1"
FT                   /translation="MVQITFISNGGLVATAPENSNLLRVSLKEKGGIPFKCGGGLCGTC
FT                   KCRIEEGLENTDAIKPKERKHLRPEDFEAGYRMACQTFVNGDVKVSWVIQNGKGVVVGA
FT                   ASDPVEAAT"
FT   gene            complement(316485..317204)
FT                   /locus_tag="AXYL_00300"
FT   CDS_pept        complement(316485..317204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00300"
FT                   /product="bacterial regulatory protein, GntR family protein
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13660"
FT                   /db_xref="GOA:E3HRZ9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HRZ9"
FT                   /protein_id="ADP13660.1"
FT                   /translation="MTTSPVSPQAAETQHSAPLKIGEQHPQLFAVIRDKLRERILSGEF
FT                   TPGDRLVEGRLSEEMGVSRIPVREALRALAAEGLVTIEPRRGASVSVLSDAVAYDMVEV
FT                   RATLEGLNAKLAAQRRDEKTVERLQAFLREGTEAARSEQLDKFLALNSQFHEMLATIGG
FT                   NVVLTDLMRSLRDRTALLFAPSNMLRAKQNWDEHSQILNAVIAGNGDLAALLASQHVHN
FT                   AAKAYTEAQQQPHASVA"
FT   gene            complement(317284..318027)
FT                   /locus_tag="AXYL_00301"
FT   CDS_pept        complement(317284..318027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13661"
FT                   /db_xref="GOA:E3HS00"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E3HS00"
FT                   /protein_id="ADP13661.1"
FT                   /translation="MTSSLPYPDLLQYATMAAVVFGAAIAQGVGGVGFAMFAAPVAAMF
FT                   FPQLAPGPLLTLGGFISLLTALRERAAIDWPSVSYALAGRAVGTLIAIYAMTRFAPQAL
FT                   GVLFAGLILVAVALSAAGLHFSATPGRVSGAGVASGIMGTMTSVGAPPIAIVMQHAAPP
FT                   RLRATLGMVLFLGSIFSLAMLAWAKRYTGYHAGLALSLAPFLLAGFAVSNRLRHRLPPR
FT                   AVRGVLLAVCALGALGVLAKAFWGH"
FT   gene            318257..319789
FT                   /locus_tag="AXYL_00302"
FT   CDS_pept        318257..319789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00302"
FT                   /product="citrate transporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13662"
FT                   /db_xref="GOA:E3HS01"
FT                   /db_xref="UniProtKB/TrEMBL:E3HS01"
FT                   /protein_id="ADP13662.1"
FT                   /translation="MQADVVLNAAHWMYLISVAAIILTMILRANVVVPSVIGTFLVVLA
FT                   ITGNPISALIGIFSASFVAAKELFNIFLVITFMTALLNALKTLQADVRMVQPFRRVMRG
FT                   GHSSFLIIALCTYVISLFFWPTPAVPLVSAILLPAAIAAGLPPLAGAMAIAIAGQGMAL
FT                   SSDYVIGVAPSISAKAAGAAVSAAVVADRALVLSLITGGVALVAAYLLIRKHIVPADAA
FT                   LLSAWQARAQDGSLARIEQSGSFDKAELARGTMGADPSLPSGPALSDEERRRVRWSKTF
FT                   AVVTPLAFLAVIAVMVLPRLFPSLPALRGGDAAALVGGVAFVVMMLVTLAAEGPRKMLD
FT                   VCPEHVTDGFVFAFKAMGSVLPIAGFFFVGANETAAQILGVPQAQAPGLLFEVISAGQH
FT                   LIPENHFLVAFGVLLVGMITGIDGSGFAGLPLTGTLSGALGPVVGVDPATLAAVGQMGA
FT                   VWTGGGTLIAWSSLIAVAGFARVNVLSLVRALLLPVLLALFVSTICAVLIWS"
FT   gene            319971..321431
FT                   /gene="aldHT"
FT                   /locus_tag="AXYL_00303"
FT   CDS_pept        319971..321431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldHT"
FT                   /locus_tag="AXYL_00303"
FT                   /product="aldehyde dehydrogenase, thermostable"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13663"
FT                   /db_xref="GOA:E3HT37"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT37"
FT                   /protein_id="ADP13663.1"
FT                   /translation="MDDLSQQTFLNHIGGSWMPSGTGKTAPNINPADTADIVGRFQVSD
FT                   AEDARQAVAAAEAAFAGWRDTPISKRAAILFRAAQHLEDHANDIARELTREEGKSLNLA
FT                   KDEVLRSAQTIRFYAVEGQSFTGETYPNDDPDMVVYSQREPLGVVTVISPWNFPISIPA
FT                   RKIAPALITGNTVVFKPSSDAPMSGYRLAEAFVQAGLPAGVLNFLTGPAGAVGEAITGA
FT                   RAVRAISFTGSTAAGEQIHRTAGLTTRTQMELGGKNPLIVLADADLDRAVDLAVKGGFS
FT                   LSGQACTGTSRVLVDKRVRQAYTDKLLARIKALTIGNGLDGNFDLGPLATAKQLDNVLG
FT                   YVAVGKQEATHLYGGERLTGAGFERGYYVSPALFTDVTQQMRIAREEIFGPVIALIEVD
FT                   GYEDAIAKANDTEYGLSAAIATTDARYAHRFARDIQAGTVKINRTTTGNLINAPFGGLK
FT                   HSSTSTFRESGRVGLEFYTQIKTVYRAG"
FT   gene            321471..321950
FT                   /locus_tag="AXYL_00304"
FT   CDS_pept        321471..321950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13664"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT38"
FT                   /protein_id="ADP13664.1"
FT                   /translation="MKQVYRLELEEARVMVRAAIAKSEEIGVLETICIVDDGGYPIALE
FT                   RMDGARITGPQIAWNKAFTAAGHKRSTHLFNTPPNGPALPGNEAFGIQWSFDGKFAVFV
FT                   GGFPIVVNNEVIGGVGLSGGNGEQDTKAGLAALAALATLLEPRGMKVLVEADIKK"
FT   gene            321963..322970
FT                   /locus_tag="AXYL_00305"
FT   CDS_pept        321963..322970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00305"
FT                   /product="2Fe-2S iron-sulfur cluster binding domain protein
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13665"
FT                   /db_xref="GOA:E3HT39"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT39"
FT                   /protein_id="ADP13665.1"
FT                   /translation="MAYRVHILQTDESFQVEEGESVLQAAERSAVKLPHECTFGGCGTC
FT                   RIKLESGAVDYEEFPMALTPEEAAEGYALACQARPLGDLCISVASSRQSFPEPRRLPAT
FT                   IHCIEKFCDDVIHLTLALPQEGMDYVPGQYMNVVLPDGETRSFSMASAPAGGLVDFHVR
FT                   RIPGGRYTDQWLGQAQAGAGVEIEAPLGVFSYHEEDWRPLIMMATGTGIAPIKAILESL
FT                   LDNEDCPPVTLYWGMRTEADLYLREVIESWAGRLYEFNFVPVLSRADADWLGRRGHVQQ
FT                   AVLEDHQDLSEHAFYLCGAPEMIREAKSLLAARGASLDHMYSDSFTFQHALAAA"
FT   gene            complement(322989..323426)
FT                   /locus_tag="AXYL_00306"
FT   CDS_pept        complement(322989..323426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00306"
FT                   /product="universal stress family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13666"
FT                   /db_xref="GOA:E3HT40"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT40"
FT                   /protein_id="ADP13666.1"
FT                   /translation="MYKHLLVAVDGSLLSESAFKRALVFAKEMGATITLIRAIPEDHLL
FT                   VYQAEMLGTTQAQHTDQARKNAQTYLDNLEMEARHALVPCNAVVTVNDHPHEAIVEAAQ
FT                   NQGCDLIIMGSHGRHGMTGFLLGSETQRVLARTRLPVLVYR"
FT   gene            323668..324288
FT                   /gene="ssuE"
FT                   /locus_tag="AXYL_00307"
FT   CDS_pept        323668..324288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuE"
FT                   /locus_tag="AXYL_00307"
FT                   /product="FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13667"
FT                   /db_xref="GOA:E3HT41"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR020048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT41"
FT                   /protein_id="ADP13667.1"
FT                   /translation="MSSPRRQAYARVLAIAGSPSQRSRSSVLLRHAAGILQSRGLGVGE
FT                   LGLRDIPAEELIEGNYASAAANTLRARVAAADAVLISTPVYQASFSGGLKAVLDLLDPK
FT                   ALAGKVVLPIATGGSPAHLLALEYGLKPVLSALGARHILAGVYATDAQVRVDEFGVGEI
FT                   DAEARRRLEDSVERLSEQVLPRGAFLNQSYDLGRLALAGGFSV"
FT   gene            324292..324777
FT                   /locus_tag="AXYL_00308"
FT   CDS_pept        324292..324777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00308"
FT                   /product="binding-protein-dependent transport system inner
FT                   membrane component family protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13668"
FT                   /db_xref="GOA:E3HT42"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT42"
FT                   /protein_id="ADP13668.1"
FT                   /translation="MRHAQAHPDTAILRWLAPALLAALWLGSGETAWQILPPLSLLAPL
FT                   LYQTVRGIRAVDPALVAAGRSHDLDGWSLYRHVLLPGALPFILTGLRQGLGLLWLTLIA
FT                   LELYATPAGPGRLPLLDSVPPGAATLLLGIALYAGLSLGSGALVSALERWLLRWRPR"
FT   gene            324774..325670
FT                   /gene="ssuB1"
FT                   /locus_tag="AXYL_00309"
FT   CDS_pept        324774..325670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB1"
FT                   /locus_tag="AXYL_00309"
FT                   /product="aliphatic sulfonate import ATP-binding protein
FT                   SsuB 1"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13669"
FT                   /db_xref="GOA:E3HT43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT43"
FT                   /protein_id="ADP13669.1"
FT                   /translation="MMFINPNEFELLQHLDVRERTEPDEAPEPAPQAALRVTLRKLAKR
FT                   YGDRIALQALDLEIAAGEFVAVVGRAGSGKSTLLQLLAGQLAPSGEQGGEPGRSPLLFD
FT                   NFPNWAPDSRVRLLLPDARLLPWKTVLHNVVLGLPGTAQAADALRQVGLDGHGGDWPAQ
FT                   LSEARRQRVALARALARHPGLLLLDEPFEGLDALSRIEAQRLLADLWRQQGFTAVLATH
FT                   DVAEAVALADRILVLDEGGLVLDERVGLAHPRGRGSAAFAALEARVLRAALRQQDTPDA
FT                   DRPLAPVIQIRHLRLAV"
FT   gene            325735..325950
FT                   /locus_tag="AXYL_00310"
FT   CDS_pept        325735..325950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00310"
FT                   /product="molybdenum-pterin-binding protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13670"
FT                   /db_xref="GOA:E3HT44"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT44"
FT                   /protein_id="ADP13670.1"
FT                   /translation="MSIQSINARNQFRGKIKEIILGPVVSEVDVDTPAGIVTSVITTRS
FT                   VKELDLQVGTEVLAFVKATEVSVAKL"
FT   gene            326074..327501
FT                   /locus_tag="AXYL_00311"
FT   CDS_pept        326074..327501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00311"
FT                   /product="integral membrane protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13671"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT45"
FT                   /protein_id="ADP13671.1"
FT                   /translation="MRRLQQWFIGWLCLGLVACFPATAQTKLDNAQLDQLMAPVALYPD
FT                   SLLSQILMGATYPDDVAAAAKWSAAHTSESGDKAVKAVEGEAWDPSVKSLVAFPSVMDM
FT                   MGRQPDWVKSVGDAFLAQPDAVMDSVQRLRVQAQKAGNLKSTPQQKVTSNTTNDKTVVV
FT                   IEPADPQVVYVPSYNPTVVYGAWAYPSYPPYYYPPPPGSVFATSLVAGIGFGLGVAAVN
FT                   SMWGGFDWGHNDVDIDVNRYNNINVNQRIDRTNINNNRTNWQHNPANRGNTPYADQASR
FT                   QRFDSQRQAGVQSRAQGQGGRTPGAAPAASSRDAARDRAAQSFEGRTGQSIAGHSGPSA
FT                   GRGQGAAGRGDAAAGRGQGQGQGQRAAQGGQGAQGARDRTQGGGQAQHNRPSSSVSTQD
FT                   RQAASQRQRADEAAARDRGRASNSANALSGAGNGDQMRQQHSRSEMNRGGGGGARGGGH
FT                   AGGGRGGGGGGHFGGRR"
FT   gene            327507..328373
FT                   /locus_tag="AXYL_00312"
FT   CDS_pept        327507..328373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13672"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT46"
FT                   /protein_id="ADP13672.1"
FT                   /translation="MDKGTLMTIARLRALGAASLLTLGLAAPVAAQSLYPSPQAAADAF
FT                   VDAMATSDLDGLAKVLGPNHRKIVPGGVAQDDIYRFLAAWSRKHEIVADGGRSWLAVGD
FT                   SGWTLPVPIVRAGQGWRFDPAAGTAEIRRRAIGRNELTAIATLRELQAAQGRYKDSVGQ
FT                   GRYASRLVSRPGQRDGLYWPEVPGAPQQAYGLDALSMGPEVPLDDAYYGYRYKVMPGAD
FT                   GSSYRIVAWPARYGQTGIDTFVIGPDGRVLESDLGPASAARAAALRERDISAGTWTDAD
FT                   AQPVGTK"
FT   gene            328547..329527
FT                   /locus_tag="AXYL_00313"
FT   CDS_pept        328547..329527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13673"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT47"
FT                   /protein_id="ADP13673.1"
FT                   /translation="MHFVRYALFGVGMALSAAAASAPIFVLNSLDANVSIVDPATYKEL
FT                   RRVPTGKEPHHLYLTPDEKSLMVANATSDSITLMDPKTGEVQRTLTGIVDPYQLQFSPD
FT                   MKWFVTAANRLDHIDIYSWHPLEKGFDLKLVKRIQAGKTPSHIMIDKNSTTAYVTLQDS
FT                   DQLIAIDLATQTPKWTVSVGKTPADVFLTPDQKTLLVALTGDSYVEAYDVSNGPAKLVT
FT                   RIKTAAGAHAFRAQGDHRHLFVSNRTANSISRIDLQTLAVTDTFPVPGGPDCMDVLADG
FT                   KTLLVTSRWARKLTVVDLEQKKVVNQVPVGKSPHGVWTLNHAPTR"
FT   gene            329601..330374
FT                   /locus_tag="AXYL_00314"
FT   CDS_pept        329601..330374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00314"
FT                   /product="polysaccharide deacetylase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13674"
FT                   /db_xref="GOA:E3HT48"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT48"
FT                   /protein_id="ADP13674.1"
FT                   /translation="MAVAVMLALAFPALGTAAPATCDKPVYLTFDTGHMGVAPLIADVL
FT                   ARHNVKVTFFLANERTLTDGSSLDDVWAPWWKARAAEGHVFGSHTYDHVYWQADLPGGK
FT                   FRVKPSAGPDAGKRAEWTPEQYCAEIKRSVTRFHQMTGKNMLPIYRAPGGKTSPALLKA
FT                   AKACGFEHVGWAPAGFLGDELPSDKYPNARLLDQALRTIKPGDILLAHLGIWSRQDPWA
FT                   PAVLEPLIVGLQRKGYCFATLDAHPSYRDWIATHH"
FT   gene            330377..331384
FT                   /locus_tag="AXYL_00315"
FT   CDS_pept        330377..331384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00315"
FT                   /product="fatty acid hydroxylase superfamily protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13675"
FT                   /db_xref="GOA:E3HT49"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT49"
FT                   /protein_id="ADP13675.1"
FT                   /translation="MDTLSQFFGECQQWLFETAIQPALFHLGMSNFIEDGYDATMWLLV
FT                   GLLQIAVLVLIFGPLQRLRPVEAVTDRRQIGIDVLYTLIHRLGAFRLLLFFTVDPLWDS
FT                   VFGQLHVWGFAAFQLDQYWPGVTDKAWVSLIIYLLLFDAVDYFYHRAQHRFGWLWALHA
FT                   VHHSQRQMTIWSDDRNHLLDDMLRDVLVVFVSQLVGVPPAQFVMVVAITQLAQSFSHAN
FT                   LRMHFGAIGERLLVSPRFHRHHHSIAYDASSPGPMGGYNFGALFPIWDVLFRTARFGVG
FT                   YGPTGIHDQQAELGGRDYGRSFWSQQWLGLKRMVGRDREPAAAPPAPPASAERA"
FT   gene            complement(331482..331985)
FT                   /locus_tag="AXYL_00316"
FT   CDS_pept        complement(331482..331985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00316"
FT                   /product="thioesterase superfamily protein 1"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13676"
FT                   /db_xref="GOA:E3HT50"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT50"
FT                   /protein_id="ADP13676.1"
FT                   /translation="MDEAFSHQLSMTILMTPDMANFSGNVHGGTILKYLDQVAYACASR
FT                   YAGQYVVTLSVDQVVFREPIHVGELVTFLAAVNYTGRTSMEIGIKVVTEDIRKKLVRHT
FT                   NSCYFTMVAVDEQGAPTAVPPLEPRNLEEKQRMEAARLRRELRQEMERRHGEIKRETTH
FT                   DGQP"
FT   gene            complement(332036..333508)
FT                   /locus_tag="AXYL_00317"
FT   CDS_pept        complement(332036..333508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13677"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT51"
FT                   /protein_id="ADP13677.1"
FT                   /translation="MRRLVALALSFAAVAALAPAAPVVAAPSAPTPAAAATEAAHQAAM
FT                   EGYLYFYPLVTMDLTRRQFTHPSRGAEGAPANTFRHGRALPQPGAATPWANPDMLRSAA
FT                   WLDLTSGPVVLSVPDTQGRLYTLTLLDMWTDVFATLGKRSTGTAKGNTVIVPPDWNGVL
FT                   PSGMARIDAPTAHIWAKNLIQTGGPADYPAVHGLQDGFVLTPLAQWNLPAQAQRVKSDP
FT                   SLNLRIPVREQVESMPTDAYFEYAAELLRKNPPHPTDQPMLAKLRGAGLIAGRPFDFAQ
FT                   LGHPAKQGMRRGLRTARERMTAAAGGTVRSVNGWHQETANLGVYGNSYLRRALTAQAQP
FT                   GAGLPEDLSVLLLAADSQGAPLDGAHGYTLHFESGQLPPAAALWSLAAYDAQGMPFANP
FT                   LSRYALGDRDPLRYNADGSLDLRISHAPPAPEEQSNWLPLPAAGPASLLLRVYAPEPAL
FT                   LDGLWTPPALLRDVPPEESVEAPAENTEKTQP"
FT   gene            333816..334406
FT                   /locus_tag="AXYL_00318"
FT   CDS_pept        333816..334406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00318"
FT                   /product="formate dehydrogenase-O, major subunit domain
FT                   protein"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13678"
FT                   /db_xref="GOA:E3HT52"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT52"
FT                   /protein_id="ADP13678.1"
FT                   /translation="MVNMNRRQFFKVTGATLAGSSLALLGAAPGTAMAEVRQYKLARMT
FT                   ETRNTCPYCSVACGLLMYGLGDGSKNARASIMHIEGDPDHPVNRGTLCPKGAALIDFIH
FT                   SPNRLKYPEYRAPGSDKWVRMSWDDALTRITKLMKADRDANFVEKTADGKTVNRWLTTG
FT                   MLAASASSNEVGYITHKTVRSMGILAFDNQARV"
FT   gene            334419..336884
FT                   /gene="fdnG"
FT                   /locus_tag="AXYL_00319"
FT   CDS_pept        334419..336884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnG"
FT                   /locus_tag="AXYL_00319"
FT                   /product="formate dehydrogenase-N, alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00319"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13679"
FT                   /db_xref="GOA:E3HT53"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT53"
FT                   /protein_id="ADP13679.1"
FT                   /translation="MAGLAPTFGRGAMTNHWVDIKNADVVLIMGGNAAEAHPCGFKWVT
FT                   EAKAHNKAKLIVVDPRFTRSASVADFYAPIRTGTDIIFLGGVIKYLLDKDKIQHEYVRN
FT                   YTDFSFIVREDFAFDAGLYSGYDAEKRTYNKASWDYERGDDGYVKTDPTLAHPRSVYQL
FT                   LKKHYSRYTEDMVERVCGTPKDKFLKVCEMLASTATTNRAATILYALGWTQHSIGSQII
FT                   RTGAMVQLLLGNIGIAGGGMNALRGHSNIQGLTDLGLMSNLLPGYMTLPNEPEQDYGKY
FT                   IESRTQKPLRPNQLSYWQNYSKFHVSLMKAWWGKSATAENNWAFDYLPKLDKLYDMLQV
FT                   YELMFQGKMNGYLAQGFNPLAAAPNKAKLNAGFAKLKFLVIMDPLVTETSEFWRNAGEA
FT                   NDVDPSKIQTEVFRLPTTCFAEEDGTLVNSGRWLQWHWKGAEPPGEAKSDIEIMALLFT
FT                   RLRKMYQDEGGKYPDPIVNLSWPYSNPQNPTAEELAKEYTGKALVELTDPKDPSKVMRK
FT                   AGEQLAGFAELRDDGSTISGCWIFAGAWGPGGNLMARRDNSDPTGIGQTLNWAWAWPAN
FT                   RRVLYNRASCDLTGKPFDPRRSLVSWNGKFWTGADIPDFKGDENPDGGMGPFIMNPEGV
FT                   ARFFARAGMAEGPFPEHYEPFETPLGYNPLYPKAKGVTSNPAARVFKDDLAAMGTVDKF
FT                   PYVATTYRLTEHFHYWTKHVRINAILQPEQFVEIGEALAKELGIANGSRVKVSSNRGYI
FT                   KAVALVTKRLRALTVEGKTVHHVGIPIHWGFVGLAKPGFLTNTLTPFVGDGNSQTPEFK
FT                   SFLVQVEKA"
FT   gene            336895..337794
FT                   /gene="fdxH"
FT                   /locus_tag="AXYL_00320"
FT   CDS_pept        336895..337794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxH"
FT                   /locus_tag="AXYL_00320"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13680"
FT                   /db_xref="GOA:E3HT54"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT54"
FT                   /protein_id="ADP13680.1"
FT                   /translation="MSMQSLDIKRRSATTTPPPGIREPITGSVAKLIDVSKCIGCKACQ
FT                   SACMEWNDLRDEIGTNVGVYDNPADLTEHSWTVMRFSEYENPQGDLEWLIRKDGCMHCE
FT                   DPGCLKACPSPGAIIQYTNGIVDFHEENCIGCGYCITGCPFNVPRISKKDHKAYKCTLC
FT                   SDRVAVGQEPACVKACPTGAIVFGTKEDMTQHAEERIVDLKSRGFDKAGLYDPQGVGGT
FT                   HVMYVLHHADQPGLYHGLPKDPQISPMVSLWKGLSKPVGVAVMALTALAGFFHYARVGR
FT                   NEVSEEDERRAEEEVRHE"
FT   gene            337787..338419
FT                   /locus_tag="AXYL_00321"
FT   CDS_pept        337787..338419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00321"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13681"
FT                   /db_xref="GOA:E3HT55"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT55"
FT                   /protein_id="ADP13681.1"
FT                   /translation="MSEDRHYRRIKRYTPGERTNHWIIAFTFILLALSGLALFHPSMYW
FT                   LTNLFGGGPWTRILHPFIGVVMFACFVVFAGHMWRHNLMTKADRQWMRQLNDVVENREE
FT                   KLPEVGKYNAGQKLLFYVLILCMLGLFASGIVIWREYFAFYFPIWVVRAASVLHAVSAL
FT                   VLICAIIVHIYAAIWVKGSLTAMLRGYVTAGWAWKHHRAWFREQIRK"
FT   gene            338573..339505
FT                   /gene="fdhE"
FT                   /locus_tag="AXYL_00322"
FT   CDS_pept        338573..339505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhE"
FT                   /locus_tag="AXYL_00322"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13682"
FT                   /db_xref="GOA:E3HT56"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT56"
FT                   /protein_id="ADP13682.1"
FT                   /translation="MQRILPRGEIEALDHNRIPRVSLPERGSVFAMRAARLRQLAADSP
FT                   VADYLLLMAHLVDAQHRALQDCAAPEASEERISLAQAHGMPPLQAVGWPRDPLWRGILG
FT                   QLIDHVAGVKDVPAEAVEVCATLRRALAENPESLEDLAEAVLSEQDQGVDGAAAPFVMA
FT                   ALQVYWTDLASRFDEKQLPVASPFGVCPVCASLPVASVVRVGGQFEGYRYLCCSLCATQ
FT                   WHMVRVKCSHCEDVESVAYQAIEGRTPAIKAETCDHCHTYRKIFYQDKDLQVEPVADDL
FT                   ASLMLDVLVGEAGYSRASGNPLLWHGSEE"
FT   gene            339507..340943
FT                   /gene="selA"
FT                   /locus_tag="AXYL_00323"
FT   CDS_pept        339507..340943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="AXYL_00323"
FT                   /product="L-seryl-tRNA selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13683"
FT                   /db_xref="GOA:E3HT57"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT57"
FT                   /protein_id="ADP13683.1"
FT                   /translation="MAAHTPDGGAAAVSDIPSLDRLLNAPGMQAALDQHGRTQVVAALR
FT                   RDLDAMRERARAGGLPRQELDADAVASRVAAALARAAEPKLRAVYNLTGTVLHTNLGRA
FT                   LLPDEAVASVLRALTTPANLEFDLDTGGRGDRDDLIDDLLCELTGAEAATVVNNNAAAV
FT                   LLMLNALADRREVVVSRGELVEIGGAFRIPDIMKRAGAKLVEVGTTNRTHAADYENAIG
FT                   PRTAMLMKVHCSNYAVTGFTKSVSVAEVAALAHARGLPATVDLGSGTLVDLTQFGLPKE
FT                   DTVRETIAAGADLVTFSGDKLLGGPQAGLLVGSKDLIRKIKKNPLKRALRVSKLTLAAL
FT                   EPVLGLYRAPEFLAQRLTTLRLLTRPQRDIQPQAERLRGALAHAAGEPYAVEAVPMFSQ
FT                   IGSGALPVDQLPSYGLAVRYTGSGRAGRHLDKLETRLRRLPVPVIGRIADDALWLDLRC
FT                   LEARDEADFAAQLAHLAEQA"
FT   gene            340940..342874
FT                   /gene="selB"
FT                   /locus_tag="AXYL_00324"
FT   CDS_pept        340940..342874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selB"
FT                   /locus_tag="AXYL_00324"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13684"
FT                   /db_xref="GOA:E3HT58"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT58"
FT                   /protein_id="ADP13684.1"
FT                   /translation="MIIGTAGHIDHGKTTLVRALTGVDTDRLKEEKARGISIELGYAYT
FT                   PLPNGDVLGFIDVPGHEKLVHTMAAGASGIDFGLLVVAADDGVMPQTREHLAILALLGV
FT                   ARGAVALTKTDRADAARLQAVRAEIAELAAGTFLQDAPLYAVCASQSGDAGVAELKAHL
FT                   DAQAQTMRRRDGAGLFRLAVDRVFTLAGHGTVVTGTAHAGLARAGDEAADLRLMPAGTR
FT                   VRVRSIHAQNQPSETGAAGQRCALNLAGMDKNAIARGDWIADARCFLPSRHVDVALTLL
FT                   ASADAPVRAWAPLHVHIGAARHVAHVVPLSAESLAPGQSGWVQLVFDEPVCVMPGDRYI
FT                   VRNAQATRTVGGGRVLDPNAPDRKRRSAARMQWLQAMSSMLDGAGLHPVLEHAALGLDE
FT                   DALQRLTGRPMAEIPAPHGALWLEARTPQAPRTLILAAHWDAMRVRVEQALAAFHQGAP
FT                   DEPGPDGSRLRRMAMPVGPDALWLAVLDDLQRDGRIVRNGPWLHLPGHTATLAPDESAL
FT                   AERLLPLLAAGAFDPPWVRDLARTLGEPEDRVRQLLRKLLRRGEVAQVVKDLFYHRDQV
FT                   AGLAALAQGLTAQPAGLNAAAFRDATGLGRKRAIQILEFFDRVGYTRRVRDAHVLRQES
FT                   AYGSTRLTQ"
FT   gene            342898..342993
FT                   /locus_tag="AXYL_00325"
FT   tRNA            342898..342993
FT                   /locus_tag="AXYL_00325"
FT                   /product="tRNA-Sec"
FT   gene            complement(343016..343555)
FT                   /locus_tag="AXYL_00326"
FT   CDS_pept        complement(343016..343555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00326"
FT                   /product="AhpC/TSA family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13685"
FT                   /db_xref="GOA:E3HT59"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT59"
FT                   /protein_id="ADP13685.1"
FT                   /translation="MISRRLLLQSGLSLAALPWFVRAASDDALKKATGPDWAPWTSATP
FT                   PLALPDLSGREKKLSSWRGNVLIVSFWATSCEPCRDEIPIMSAMAKRHREEGLRLVAVN
FT                   VGDSAAKISTFLAKWPVAGTVLHDRNSTVSKQWDAVGLPANYLVDRGGSIRYWHLGQLD
FT                   WKSDRVGGVVTGLLRA"
FT   gene            complement(343577..344677)
FT                   /locus_tag="AXYL_00327"
FT   CDS_pept        complement(343577..344677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00327"
FT                   /product="Tat pathway signal sequence domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13686"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT60"
FT                   /protein_id="ADP13686.1"
FT                   /translation="MDRRHFLRFSGALCAANAALPRAARADLAPVSADWRAFELTTDIT
FT                   VQDPGAHARIWIPVPYATDTAYQRGAQSSWQVSGGGSAQLTQAPGYGVQMLAVQWPDAQ
FT                   APRRVTVTSRFQTRNRRVDLSQPPAAGIPQESAAALREFLQPTALLPTDGIVKSTADQI
FT                   TRGHRGDLAQARAIYEWVVEKTCRTASTRGCGVGDVRYMLTANDLNGKCADINSLFVAL
FT                   ARAAGIPARDAYGLRVADSEFGYKSLGKAGDVTKAQHCRAEFYAAGYGWVPVDPADVRK
FT                   VMLEEPPGELPLTNAKVRAARVMLFGAWEMNWVAYNHGHDVVLPGAAHGPVPFLMYPNG
FT                   ETAAGRLDSLDPDSFSYKLIAKPIAI"
FT   gene            344817..345881
FT                   /gene="selD"
FT                   /locus_tag="AXYL_00328"
FT   CDS_pept        344817..345881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="AXYL_00328"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13687"
FT                   /db_xref="GOA:E3HT61"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT61"
FT                   /protein_id="ADP13687.1"
FT                   /translation="MTTQDVASAAVPRLTSLSHGGGCGCKIAPGVLSELLKRFGPAVSY
FT                   PDLLVGTETADDAAVYRLNDEQALIATTDFFMPIVDDPYDFGRIAATNALSDVYAMGGT
FT                   PIMALAIVGMPINVLPHSVIADILRGGEAVCKDAGIPVAGGHSIDSVEPIYGLAAMGLV
FT                   HPGRIKRNADARAGDVLILGKALGVGILSAALKKNRLDDAGYRAMITETTRLNRPGPAL
FT                   AAMEGVHAITDVTGFGLLGHTLEMARGAQLTAHVRRDALPWLPGVQAFAADGVITGASG
FT                   RNWASYGASVRLGEGVSDTERALLTDPQTAGGLLVACTPDAAQAVLDLFRQHGFDQAAV
FT                   IGDMRAGEPEVRVD"
FT   gene            complement(345901..347967)
FT                   /locus_tag="AXYL_00329"
FT   CDS_pept        complement(345901..347967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00329"
FT                   /product="sulfatase family protein 1"
FT                   /EC_number="3.1.6.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13688"
FT                   /db_xref="GOA:E3HT62"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT62"
FT                   /protein_id="ADP13688.1"
FT                   /translation="MLMRLFRSASGWQDWLANFQRSCLVLLAPWLISVLAQSAGRGYLL
FT                   LRHAAPGTYDALPQDVRRSLTTGLLFDIKVASIACAALLLLSMAAAAKPGLQQRWQHCL
FT                   PGLGAVMAMLFTAITIVSVFYFATFSRSIDIFVFGLVDDDTHAILMTLWHGYPLAQAGL
FT                   LLAAVLAGTWWLGRRWRGRVQRMRFKRRPFAPSLVRFVLIIAVTVLACRGSLGRFPLNK
FT                   DDTSISSLRLLNDIAPNGISAFSWALSDRGNDKRFEPVTAREGRLLYERFLGWPDDGLR
FT                   PFMAATGPNPAAAAQPPHVVLQVMESMGAHLNAYDRPGRDLLGALRPHWRQDWVFERFV
FT                   AEGNGTIESLSLLLVRSPIAAVGQSSAADTPFASNAFTPFLQRGYRVVFVTSGAATWRN
FT                   LGTFATKLGAHEFVDQQTLRARYPQAPTGTWGVPDEYMFRYIEERLAQGTEDGLPLFIV
FT                   ALSTTHHPPFIVPEGGQRGGLPLDDVASLPYFKSWNTLAAAFDTLRYANDQLGGFLTRL
FT                   KGSANASRTIVAVTGDHNILGIDYQDPKDAALARAVPFYLYVPPAYQAQARYDPARVGS
FT                   HKDILPTLYHLSLPQTPYFRSGCNLLAARPDPAWCFGFNNGHVMLTDEGAFRPDKPGRI
FT                   LPWAGPSGLALEAEQDATAEQWAEQVRLNAYPRLLHWQINYQVQELGRTGQAR"
FT   gene            complement(348075..348992)
FT                   /locus_tag="AXYL_00330"
FT   CDS_pept        complement(348075..348992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00330"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 9"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13689"
FT                   /db_xref="GOA:E3HT63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT63"
FT                   /protein_id="ADP13689.1"
FT                   /translation="MPYPLAKLPPLDLVRGFVAVGRRMSITLAAQDLHVTQSAVSRQIR
FT                   ALEAHLGVPLLVRGFRSVSFTSEGAQLFRMADVWLSQLGDLTEQLRAPERRTPVTVTTT
FT                   IGVASLWLLPRLGDFQAAYPHIDVRVAADNRLIDIDRESVDIAIRYSLRDGVPDSAAWL
FT                   FGEAVVPVAHPSLKARLLDAEELQRHVLLEFDDPTRPWLQWSEWLNARGLGRAPARGML
FT                   RFNQYDQIVHAALAGHGIALGRLALIAPMLADQRLEAVGGQAASATEHAYWLVRNTRRA
FT                   TPDADVVTRWLMEQAQATARDLTA"
FT   gene            349163..349375
FT                   /locus_tag="AXYL_00331"
FT   CDS_pept        349163..349375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13690"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT64"
FT                   /protein_id="ADP13690.1"
FT                   /translation="MSFRLADGSTMLLKHALGVRIVCHAGTLWLSEYQRFDDSVLQAGD
FT                   SITVGSDRDVVLSGLPDAQVALISQ"
FT   gene            349392..350045
FT                   /locus_tag="AXYL_00332"
FT   CDS_pept        349392..350045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00332"
FT                   /product="DSBA-like thioredoxin domain protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13691"
FT                   /db_xref="GOA:E3HT65"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT65"
FT                   /protein_id="ADP13691.1"
FT                   /translation="MTAPLPDTPRIEMWFDFASPYSYLAIERIDALAQEAAVRVDLRPF
FT                   LLGPIFQAQGWNDTPFRLFPGKGAYMMRDIARLAEKYGLVYNRPRLFPRMSVLPARIAL
FT                   LGQDEPWGRDFCVAVFRANFQRDLDIQSEDVVHGLLTDLGLDADALIARGKSEAAKEAL
FT                   RGQVDQARNLGLFGAPTFFVDGEMFWGNDRLEDALEWTRRVAPASAWTSSAARP"
FT   gene            350088..350255
FT                   /locus_tag="AXYL_00333"
FT   CDS_pept        350088..350255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13692"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT66"
FT                   /protein_id="ADP13692.1"
FT                   /translation="MKNASSAYRGAPMPGGRSFTQFRAARIRRVSFQWKQAVDAGTPDK
FT                   GSPHRGSRGR"
FT   gene            complement(350289..350666)
FT                   /locus_tag="AXYL_00334"
FT   CDS_pept        complement(350289..350666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13693"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT67"
FT                   /protein_id="ADP13693.1"
FT                   /translation="MAEQTPRVVATDEARSLIETLCAKHGPLMFHQSGGCCDGSSPMCY
FT                   AQGEFMVGGSDVLLGELEGCPFYMGEDQFAYWEHTQLIIDAVPGRGGAFSLDSAEGKRF
FT                   LLRSRLYSDEEWARVAPVSRG"
FT   gene            complement(350724..352253)
FT                   /gene="aldB"
FT                   /locus_tag="AXYL_00335"
FT   CDS_pept        complement(350724..352253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldB"
FT                   /locus_tag="AXYL_00335"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13694"
FT                   /db_xref="GOA:E3HT68"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT68"
FT                   /protein_id="ADP13694.1"
FT                   /translation="MDIATRITPDSYGTRLDLKTQYDNFIDGKWQKPADGEYFDNVTPV
FT                   TGQVLTRNARSKERDIELALDAAHRAAPKWGATPAAQRAHMLMQIADVMEANLERLATA
FT                   ETWDNGKPIREARAADIPLAIDHFRYFASCIRSQEGGLSEIDSDTVAYHFNEPLGVVGQ
FT                   IIPWNFPILMAAWKLAPALAAGNCVVLKPAEQTPLGILLLMELIGDILPAGVINVVTGF
FT                   GLEAGKPLASNKRIAKIAFTGETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVAAQ
FT                   DDDFLDKAVEGFVMFALNQGEVCTCPSRALIQESLYDKFMERALKRVAEIKQGNPLDAD
FT                   TMLGAQASTEQLEKILSYLDIGKQEGADVLAGGSRAQMQGALEGGYYVQPTVFKGHNKM
FT                   RVFQEEIFGPVVAVTTFKDADDALALANDTLYGLGAGVWSRDANTCYRMGRAIKAGRVW
FT                   TNCYHAYPAHAAFGGYKQSGIGRENHKMMLNHYQQTKNLLVSYSPKKLGFF"
FT   gene            352560..354440
FT                   /locus_tag="AXYL_00336"
FT   CDS_pept        352560..354440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00336"
FT                   /product="sigma-54 interaction domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13695"
FT                   /db_xref="GOA:E3HT69"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT69"
FT                   /protein_id="ADP13695.1"
FT                   /translation="MATHSRQHALTQARLLFNQQGAVPGGMVAEPILRSWRRCADLGFD
FT                   MRGVRRAELMTQGELREAQQRNEALRRLSEPAMSMLRREAGGSDGLVILSDAQGLVLDS
FT                   DGDTGFAQRASRVALMPGAPWDEAAAGTNAIGTALVEGRPIAVHGAEHYFEPNRILTCA
FT                   AVPITDSEGRTLGVLDLSSPARDLRPDVLELVRAAVDLIEHRLFEQAYEQHAVLRLHVD
FT                   HSGLGAPGEGLLAFQGDLLIGANRRALQALGLAPTALGVYRYADVFDGEMERCPDAAGR
FT                   VLTRSGAVYHARLRWPRSRAPQAPARPLLPPAAGPRPAAPNFDAATLGALARAVHLSDA
FT                   GVSILLQGETGVGKEVFARQLHARSKRASGPFVAVNCAALPESLIESELFGYEDGAFTG
FT                   ARRQGSKGLLRQAHGGVLFLDEIGDMPLMLQSRLLRVLQTREVSPLGAARPVSVDFALV
FT                   CATHRPLAHEGPDAPVRPDLYFRIAEYTVTLEPLRARADRLELLRGLWAAQGAGPVLPP
FT                   DIEAILVAYAWPGNYRQLVAVLRTLHVLAGPAGMVDADMLPADIRGAAAAPQPAGAEAD
FT                   PANLQAMTDAAIRDALAAHGGNVSRAARALGVHRSTLYRRAAALASPRAR"
FT   gene            complement(354450..355238)
FT                   /gene="trpC"
FT                   /locus_tag="AXYL_00337"
FT   CDS_pept        complement(354450..355238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="AXYL_00337"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13696"
FT                   /db_xref="GOA:E3HT70"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT70"
FT                   /protein_id="ADP13696.1"
FT                   /translation="MNDILAKILAVKAEEVAAARQMRSEAEVLREAQARQDVRGFAQAI
FT                   EDKISQGKAGVIAEIKKASPSKGVLRDPFNPPEIASTYAVHGAACLSVLTDVQFFQGSH
FT                   DHLRQARAACSLPVLRKDFVIDPYQIIAARAMGADCVLLIVAALSPAQLRDYETLAMEL
FT                   GMDVLVEVHDAKELDIALTLKTPLLGINNRNLRTFETSLSNTLDLLPRIPAGKRVVTES
FT                   GILKPEDVQLMRQHKVDAFLVGEAFMRAKDPGAELARLVG"
FT   gene            complement(355235..356266)
FT                   /gene="trpD"
FT                   /locus_tag="AXYL_00338"
FT   CDS_pept        complement(355235..356266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="AXYL_00338"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13697"
FT                   /db_xref="GOA:E3HT71"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT71"
FT                   /protein_id="ADP13697.1"
FT                   /translation="MTISPAEALTRCIEHREIFHDEMLHLMRMLMRGEMSPQIASALLM
FT                   GLRVKKETIGEITAAAQVMREFATPVVTPNPADLLDMCGTGGDGSHTFNISTTAMFVAA
FT                   AAGVPIAKHGNRSASSSSGSADVLEALGANLVLTPEQVAECIQATGIGFMFAPAHHGAM
FT                   KNVAAVRKELGVRTIFNILGPLTNPAGAANQLMGVFHPDLVGIQVRVLERLGSRHVLVV
FT                   HGKDGMDEASLGGATLVGELKDGKILEYEIHPEDYGLSMMSNRSIKVSNREQSRELVIE
FT                   ALENVEGTARDIVALNAGLAIYAGNKADSIPEALALAFELISTGAARAKLEEFCAYTRK
FT                   FLK"
FT   gene            complement(356279..356845)
FT                   /gene="trpG"
FT                   /locus_tag="AXYL_00339"
FT   CDS_pept        complement(356279..356845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="AXYL_00339"
FT                   /product="anthranilate synthase component 2"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13698"
FT                   /db_xref="GOA:E3HT72"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT72"
FT                   /protein_id="ADP13698.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFGELGEDVRVARNDQITLEEIAAMNPD
FT                   RICVSPGPCSPAEAGISVPVIQAFAGKKPILGVCLGHQAIGAAYGGDIVRAQQIMHGKT
FT                   VRISHTGTDIFTDLPTPYTVIRYNSLTIDPATLPDCLAVTATAPDGDIMGVRHKTLPLY
FT                   GVQFHPESVLSEHGHALLRNFLNLA"
FT   gene            complement(356903..358423)
FT                   /gene="trpE"
FT                   /locus_tag="AXYL_00340"
FT   CDS_pept        complement(356903..358423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="AXYL_00340"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13699"
FT                   /db_xref="GOA:E3HT73"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT73"
FT                   /protein_id="ADP13699.1"
FT                   /translation="MTEIEFKALAAQGYNRIPLVAETYADLDTPLGIYLKLAHAGPQGG
FT                   RMTCLMESVVGGERFGRYSFIGLPARTVIRASGTRTEVLHDGKVAETHDGDPLAFIEQY
FT                   QSRFKVALRPGMPRFCGGLAGYFGYDTVRHIEPCLGPAVKPFPAGMEGGTPDLMLMHVD
FT                   ELVIVDNLAGRIYLMVYADPSQPESYSRAQQRLHDLRARLRRPVEIPYSHASMQTEERR
FT                   DFKKEDYLAAVHRAKEHIAAGDLMQVQIGQVIAKPFRDSPLSLYRALRSLNPSPYMYFW
FT                   NFGDFQVVGASPEILVRQERVVEDGEPKSQITIRPLAGTRKRGGTPEEDAALAAELKAD
FT                   PKEVAEHVMLIDLARNDVGRVAQVGSVKVSDTMVIERYSHVMHLVSNVTGTLNPGMSSM
FT                   DVLRASFPAGTLTGAPKVEAMKIIDELEPVRRGIYGGAAGYLSYGGEMDVAIAIRTGVI
FT                   KDGTLYVQAAAGIVADSNPEAEWAETEAKARAVLRAAEQVQHGLDEPI"
FT   gene            complement(358684..359391)
FT                   /gene="gph1"
FT                   /locus_tag="AXYL_00341"
FT   CDS_pept        complement(358684..359391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph1"
FT                   /locus_tag="AXYL_00341"
FT                   /product="phosphoglycolate phosphatase, bacterial 1"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13700"
FT                   /db_xref="GOA:E3HT74"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT74"
FT                   /protein_id="ADP13700.1"
FT                   /translation="MTAFRAALLDLDGTLLDSIPDLAFAANAMRVELGMSPLREDVVAT
FT                   FVGKGVDNLVRRSLAGSLDAADPTAAEFDVARAAFYRHYHLSNGEKAQIYPGVIEGLKL
FT                   MREQGLKLAVVTNKPTEFTLPLLQRTGLAGFFDAVVCGDTCERRKPDPDQVLHACDLLG
FT                   VAAEEAVTIGDSVNDAQAGRSAGTQVLVVPYGYNEGRDVRELDVDGIVDTLVAAAEWVV
FT                   IWNQNRNAAKTGS"
FT   gene            complement(359407..360135)
FT                   /gene="rpe"
FT                   /locus_tag="AXYL_00342"
FT   CDS_pept        complement(359407..360135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="AXYL_00342"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13701"
FT                   /db_xref="GOA:E3HT75"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT75"
FT                   /protein_id="ADP13701.1"
FT                   /translation="MPSPIPNIMSTQQASTRITPSILSADFARLGEEVRNVVAAGADWI
FT                   HVDVMDNHYVPNLTIGPMVCAAIRPHVQVPIDVHLMVEPVDDLVPMFAKAGADYISFHP
FT                   DASRHVDRTLSLIRENGCKAGLVFNPATPLSYLDYVMDKIDLILIMSVNPGFGGQSFIP
FT                   GALTKLREARARIDAWMQAGGQEIVLQVDGGVKIDNIAEIRRAGADTFVAGSAIFGKPD
FT                   YAGIIKSMRDQIAIGETTAI"
FT   gene            360265..360639
FT                   /locus_tag="AXYL_00343"
FT   CDS_pept        360265..360639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13702"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT76"
FT                   /protein_id="ADP13702.1"
FT                   /translation="MKPYDLSVSVSPRFVPEQSDPAEQQFVFAYTVRITNTGEHPAQVI
FT                   SRHWIITDGNQRVQEVRGLGIVGQQPLLAPGETFEYTSGCPLPTPVGTMRGTYHCVGEN
FT                   GIPFEVSIAEFVLAMPRTLH"
FT   gene            360678..361979
FT                   /locus_tag="AXYL_00344"
FT   CDS_pept        360678..361979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00344"
FT                   /product="membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13703"
FT                   /db_xref="GOA:E3HT77"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT77"
FT                   /protein_id="ADP13703.1"
FT                   /translation="MKRILSLSVLSVLLAACSTPSDIPPDSGSSSIPGPSAPAADGPLV
FT                   VPSLASLPDTPPRALAGKYKAANWSEMPGWSNDDLSRFWPLFLRNCRGLMRPTSGNLAA
FT                   PARATPRAWQPVCAAAVDPARAPAAGDGEGVRRFLQTYLQPWRLNAADGKPATNTVTGY
FT                   YEPLVRGSRRQGGSHQWPLYTVPADLLTIDLGSIYPELAGKRVRGKLDGKRVVPYDSRA
FT                   AIESSGRRPPVLVWVDDPVDNFFLQVQGSGRVQLTDGPDSGKTIRVAYADHNGQPYASI
FT                   GRWLIDRGELSADQASMQNIRAWAQRNPKRVPEMLNANPAVVFFREEMVVDPEQGPKGA
FT                   YAVPLAPMRSIAVDAGFVPLGTPVFLATTYPASDRPLQRLVLAQDTGTAIRGAARADFY
FT                   WGYGDDAGQQAGRMKQRGQMWVLWPKQAGEPSAR"
FT   gene            361976..363145
FT                   /locus_tag="AXYL_00345"
FT   CDS_pept        361976..363145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00345"
FT                   /product="ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family protein 1"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13704"
FT                   /db_xref="GOA:E3HT78"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT78"
FT                   /protein_id="ADP13704.1"
FT                   /translation="MSHQIVVCGAGIVGLSTALALARRGQRVAVLAPRASVPPADSDRY
FT                   HPRVYAISPASQRFLAELGVWDAMPASRLTPVTAMEIHGDADGQVNLSAWQAALPQLAW
FT                   IVESGEIERVLIQAVRMFGIPWLEDRCTGYRDGAIDTESGARIEAELFVGADGAASPLR
FT                   EAAGLKHEAVSYDDTGLVVHLDAERPHQGTAFQWFRDDGVLALLPLPDTSAGPQVSMVW
FT                   SMRTELAQALLALPPEKQAARLETLLGDAAEGRLGRLKVRSKLHGFPLTLERAQMVAPG
FT                   IALAGDAAHRLHPLAGQGLNLGLGDVEALARVVAGREAYRTAGDLRVLHRYQRARAEPV
FT                   LAMRLATDGLHKLFASRATPLVWLRNAGMHWVEWAPLIKRRLITGASAN"
FT   gene            363290..364087
FT                   /locus_tag="AXYL_00346"
FT   CDS_pept        363290..364087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00346"
FT                   /product="thiol:disulfide interchange protein DsbC"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13705"
FT                   /db_xref="GOA:E3HT79"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT79"
FT                   /protein_id="ADP13705.1"
FT                   /translation="MNFRISATLAACFLAAGLGMSAGAAAQGDKSVSTQSVGQPGKGDK
FT                   SYSTTQVAPADPVADAVKDRFRQRFDGMDVTAVRRTPYGLFEVQLGMDLIYTDEKVTWV
FT                   MEGPLIDAMTRRDVTRETQERLSAVSFDQLPLDLAIKQVKGDGSRKVAIFEDPNCGYCK
FT                   QLRKTLEDVDNITVYTFLYPILSPDSKDKVRDVWCSKDPGAAWDDWMLRGKKPATANCD
FT                   VPEDKLLALGQKLMVRGTPTTFFADGSRVSGALPLEQFKARLN"
FT   gene            364149..365105
FT                   /locus_tag="AXYL_00347"
FT   CDS_pept        364149..365105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00347"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD binding domain protein 1"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13706"
FT                   /db_xref="GOA:E3HT80"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT80"
FT                   /protein_id="ADP13706.1"
FT                   /translation="MKIAILDDYHDVAKRYADWTSLGGDAEVRIFNNFIPEGQVEPSLE
FT                   SFDVIVAMRERTPFPAERIRALPNLRLLVTTGMRNNAIDMQACAEQGIIVCGAPGSADA
FT                   NTATAELAWAHILGLFKHLPAEDAAMRRGMWQTAMPEPLAGKRLGVLGLGKLGAAVAKV
FT                   GLAFGMDVVAWSPNLTDERAEAAGVKRVDKHELFATSDVVSLHLILSERSRHVVDAAAL
FT                   AAMKPTAYLVNTSRAGLVDQEALMDALVKFRIAGAGLDVYPEEPLSPTDTVRDLDNVIL
FT                   TPHLGYVSRENFEAFYQNALEAVKAWHAGKPIRVLNA"
FT   gene            complement(365166..366134)
FT                   /locus_tag="AXYL_00348"
FT   CDS_pept        complement(365166..366134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00348"
FT                   /product="PP-loop family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13707"
FT                   /db_xref="GOA:E3HT81"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT81"
FT                   /protein_id="ADP13707.1"
FT                   /translation="MNDIATPEVRFRTEAEEKARHEGNKLTKRLARETTRALSDYNMIG
FT                   EGDRVMVCLSGGKDSYAMLDILLQLQKRAPFKFELIAVNLDQKQPGFPDHILPEYLKTL
FT                   GVPFHIETQDTYSIVTRVLEEGKTMCSLCSRLRRGILYRVASELGATKIALGHHRDDIL
FT                   GTFFLNLFYGGKAKGMPPKLVSDDGRHTVIRPLAYVPETDLIAYAELKQFPIIPCNLCG
FT                   SQQNLKRKEVGRMIKEWDKQHPGRSWNVFNALSRVVPSHLMDRDLFDFVGLKPTGVPDA
FT                   NGDTAFDAEDPQEDSAEACGDAPQAQEPGAIVEKKVTFTRG"
FT   gene            complement(366137..366496)
FT                   /gene="folB"
FT                   /locus_tag="AXYL_00349"
FT   CDS_pept        complement(366137..366496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="AXYL_00349"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13708"
FT                   /db_xref="GOA:E3HT82"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT82"
FT                   /protein_id="ADP13708.1"
FT                   /translation="MPTRRIILSGLALDARIGILEHERRATQPLHVDAEFDVDIQRSVD
FT                   DHDIHSVLDYRRLREAIVEECTQAHVNLIETLSEQVAARLLADFQEIRALRLRISKPMA
FT                   FSDCAAVGVEIQITR"
FT   gene            366621..367523
FT                   /locus_tag="AXYL_00350"
FT   CDS_pept        366621..367523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00350"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13709"
FT                   /db_xref="GOA:E3HT83"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT83"
FT                   /protein_id="ADP13709.1"
FT                   /translation="MQQMHDSVIVGGGPAGASCALWLARLGLSPLLVEAGPRLGGLGND
FT                   NPFADDWIAVLPGVTGQQVAANIDASVRAAGVPLRLETRVTGVRPCKGGIEATLAGPDG
FT                   AQSLVRGRTLVIASGVRAKGLPDHAPGASWPGVLIGPGSPIVAQDYSGLSVAVLGGGDN
FT                   AFENYVYVRNRGARSVHLYARSVRAQQQWVTRAGREGVHIGPYKVDPASRSVDGRQYDL
FT                   ILVFYGWEPQAGFADSLHLARDERGYIRTDFATAETSVPDIYAVGEVAHRMHPCVVTSM
FT                   ADGVVAAKAIQRRWERGAE"
FT   gene            complement(367534..368331)
FT                   /gene="pcaD1"
FT                   /locus_tag="AXYL_00351"
FT   CDS_pept        complement(367534..368331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD1"
FT                   /locus_tag="AXYL_00351"
FT                   /product="3-oxoadipate enol-lactonase 1"
FT                   /EC_number="3.1.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13710"
FT                   /db_xref="GOA:E3HT84"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT84"
FT                   /protein_id="ADP13710.1"
FT                   /translation="MQDISHYTAGDGARIAYRYDGHADLPTLVLANSIGTTLHMWDAQI
FT                   PALTRHFRVLRYDYRGHGASSVPQGPYSLDRLGRDVLELLDGLGIERAHFLGLSLGGIV
FT                   GQWLGVHAPERVGRLILSNTSAYLGPAPQWDERIAATLRAEDMSETAETFLKNWFPASW
FT                   LRDGNPAVEPFRAMLLSTDKHGLAGAFAAVRDFDLRRTIALVPNPTLVIAGQHDTVTAA
FT                   SHGEQIAATIPGARLLTLPAVHLANIELPEAFEAAVMEFLLAA"
FT   gene            368432..369355
FT                   /locus_tag="AXYL_00352"
FT   CDS_pept        368432..369355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00352"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 10"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13711"
FT                   /db_xref="GOA:E3HT85"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT85"
FT                   /protein_id="ADP13711.1"
FT                   /translation="MSEFTLHDLQCFDAVARAGGFQAAAVTLHRSHPAVFAAVAKLERQ
FT                   LGLALLDRSGYRVSLTAAGQSFHARAQSLLRELTALRAHAEQLAMGEETELRIVIGDFC
FT                   PRPYVLGLLSRFFADCPATRLDLHFEAVSGPLERLYDGEADLILHRVDKNDARIEWVDL
FT                   VKVPFVPVVAPGFLREPVPRAIKPALLRDYTQCVMRDTATHSPSQDYFTVEGARQCTVA
FT                   DQLMKKEIILQGMGWGHMPRFLIDDELRDGSLLSIANRHLPGSVEELVAARRTDRAQGP
FT                   VSNRLWQYLQAAAPALRRALASRRGR"
FT   gene            369710..370903
FT                   /gene="urtA"
FT                   /locus_tag="AXYL_00353"
FT   CDS_pept        369710..370903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="urtA"
FT                   /locus_tag="AXYL_00353"
FT                   /product="ABC transporter, substrate-binding UrtA"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13712"
FT                   /db_xref="GOA:E3HT86"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT86"
FT                   /protein_id="ADP13712.1"
FT                   /translation="MSVYNRRRFLQHSGSMVLLSAASGMAALPRQAYAQDTVKLGLLHS
FT                   LSGTIAIAEASLVDAEKLAIEEINAAGGVMGRKIEPVVEDGASENAVFAEKARKLLDRD
FT                   KVAAIVGCYTSASRKALLPVLSRSKGLLYYPTYYEGQEQDARVFYPSQEATQSVIAAVE
FT                   WMAREKGKTFFLVGSDYIYPRTCNKIAKPAIARMNAKVVGEEYAPLGHTEFSSIINKIK
FT                   AAKPECIYSTVVGGSNVAFYKQLRAAGLDGTRVVLLSTVVSENEIEGIGKDNAAGYYAC
FT                   MGYFQSLQNPANEKFVKAFKAKYGQDRVIGDPMEVAYNSVYLWKLGVEKAGSFDPDKVI
FT                   AASAGLTLQAPEGTVRVHETNHHVWKKVRVGKARPDGQFDIVWESADLIEPNPFPKL"
FT   gene            370931..371875
FT                   /gene="urtB1"
FT                   /locus_tag="AXYL_00354"
FT   CDS_pept        370931..371875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="urtB1"
FT                   /locus_tag="AXYL_00354"
FT                   /product="urea ABC transporter, permease protein UrtB 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13713"
FT                   /db_xref="GOA:E3HT87"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT87"
FT                   /protein_id="ADP13713.1"
FT                   /translation="MAGGDAAGTAWNVTMNLDIAAMQFFNGISLFSILLLMAIGLAVVF
FT                   GLMGVINMAHGELMAMGAYTTYLVSAAFQHWAPGWMDVYLFAAIPLAFLVTFAFGYVLE
FT                   RGFIRWFYNRPLDTLLATWGLSLILQQAYRSIFGAQEVSVPLASWLSGAWEPTPDLQFP
FT                   LNRIFILGLTLLVAVGVYLLLYRSAWGLRVRAVTQNRAMAGAVGINTRRVDALTFALGS
FT                   GLAGIAGCVFTMIGSTNPGTGQLYIVDSFIVVVFGGVQSLLGTAFSGLAIAQSQTTLEY
FT                   LMSGSMAKVTILVLVIVVLYFRPNGLFANKTRG"
FT   gene            371880..372926
FT                   /gene="urtC1"
FT                   /locus_tag="AXYL_00355"
FT   CDS_pept        371880..372926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="urtC1"
FT                   /locus_tag="AXYL_00355"
FT                   /product="urea ABC transporter, permease protein UrtC 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13714"
FT                   /db_xref="GOA:E3HT88"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT88"
FT                   /protein_id="ADP13714.1"
FT                   /translation="MKALHRKTEEIAILLVAALILAVLPLSLDPFRLNLVGKYMAFAFV
FT                   AIGIVLTWGYSGVLSLGQGIFFGLGGYMMAMFLKLEASAPELPDFMVWSSVDSLPVWWQ
FT                   PFHSLTLTLLLIVVLPGLAAYLFSLAIFRKRVSGVYFAIVTLALAMTLTVLIIGQQGDT
FT                   GGANGITDFRTLLGWDIVGDDGKQALYFIEAGALIVAMLAALAIVRSRLGKILIAIRDR
FT                   EDRVRFSGYDTAHVKACIFAVAAVLSSIGGAFFTLQVGLISPGAIGVVASIEMVIYAAV
FT                   GGRLSIPGAVVGALLIGFLKSYLSETFPEVWLYFLGAIFIAVVVIMPNGLAGVFGQIQA
FT                   RRAAGSAR"
FT   gene            372923..373720
FT                   /gene="urtD1"
FT                   /locus_tag="AXYL_00356"
FT   CDS_pept        372923..373720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="urtD1"
FT                   /locus_tag="AXYL_00356"
FT                   /product="urea ABC transporter, ATP-binding protein UrtD 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13715"
FT                   /db_xref="GOA:E3HT89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT89"
FT                   /protein_id="ADP13715.1"
FT                   /translation="MSATLDLQEPASMDMSSDRPAPGAILSVEDLTVSFDGFRAVDGLS
FT                   LRVAQDELRVIIGPNGAGKTTLLDIICGKTRPSAGRVMFQGRDLVRMAEFDIVRAGVGR
FT                   KFQTPSVYEDLTVLENFEISLPNAHGVVRSLRFRRTADIRERIQDMAAQVFLQDRLAEK
FT                   AGRLSHGQKQWLEIGMLLMQSPQLLLLDEPVAGMSPREREQTAELLARISRGKSMVVIE
FT                   HDMDFVKRIAHKVTVLHQGRLLSEGTVAEVQADPRVLDVYLGH"
FT   gene            373735..374424
FT                   /gene="urtE1"
FT                   /locus_tag="AXYL_00357"
FT   CDS_pept        373735..374424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="urtE1"
FT                   /locus_tag="AXYL_00357"
FT                   /product="urea ABC transporter, ATP-binding protein UrtE 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13716"
FT                   /db_xref="GOA:E3HT90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT90"
FT                   /protein_id="ADP13716.1"
FT                   /translation="MFQIDKLNVSYGESHVVHDVCFDVAPRESVAIMGRNGMGKTTLLK
FT                   ALIGMLRSGSGSIRLDGVELAGMESYQRVRNGLAFVPQGRMIFPFLTVEQNILTGAERS
FT                   GLKAVPEYLYRFFPVLHEMRRRKGGNLSGGQQQQLAIARALISDPRVLILDEPTEGIQP
FT                   SIIKDIARVLNALREERGFAIVVSEQMLGFALDLADRFLVIDRGRIVHEACRENLDQEK
FT                   VRSFLTV"
FT   gene            374450..375487
FT                   /gene="amiE"
FT                   /locus_tag="AXYL_00358"
FT   CDS_pept        374450..375487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiE"
FT                   /locus_tag="AXYL_00358"
FT                   /product="aliphatic amidase"
FT                   /EC_number="3.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13717"
FT                   /db_xref="GOA:E3HT91"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT91"
FT                   /protein_id="ADP13717.1"
FT                   /translation="MRHGDISSSNDCVGVAVVNYKMPRLHTRAEVMENARKIADMVVGM
FT                   KRGLPGMDLVIFPEYSTHGIMYDAKEMYETASAIPGEETAVFADACRKANVWGVFSLTG
FT                   ERHEEHPNKAPYNTLILMNNKGEIVQKYRKIMPWVPIEGWYPGDCTYVSEGPKGLKISL
FT                   IICDDGNYPEIWRDCAMRGAELIVRCQGYMYPAKDQQVMVSKAMAWMNNVYVAVANAAG
FT                   FDGVYSYFGHSAIIGFDGRTLGECGEEDMGVQYAELSTSLIRDARKNMQSQNHLFKLVH
FT                   RGYTGKINSGEEATGVAACPYNFYANWINDPEGTRKMVESFTRSTVGTPECPMEGIPNE
FT                   DAKHR"
FT   gene            375557..376363
FT                   /locus_tag="AXYL_00359"
FT   CDS_pept        375557..376363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00359"
FT                   /product="protein CbbQ"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13718"
FT                   /db_xref="GOA:E3HT92"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT92"
FT                   /protein_id="ADP13718.1"
FT                   /translation="MPSPLDTYRIAQEPFYRPTGRETALYEHAYAHRLPIILKGPTGCG
FT                   KTRFVEYMAWKLGRPLVTLACNEDMTASDLVGRYLLDADGTAWHDGPLTLAVRHGGICY
FT                   LDEIVEARQDTTVVIHPLTDARRILPLDKKGEVVRAHPDFQLVVSYNPGYQSSAKDLKP
FT                   STRQRFVALDFDYPEPGHEAEIVAHEAGIAVGLADRLVRIAHSSRELKRHGLDEGVSTR
FT                   MLIYAGILIREGVSPAESCDMTMTRALTDDPDMAAALRALVDANLE"
FT   gene            376360..378345
FT                   /locus_tag="AXYL_00360"
FT   CDS_pept        376360..378345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00360"
FT                   /product="von Willebrand factor type A domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13719"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT93"
FT                   /protein_id="ADP13719.1"
FT                   /translation="MNMRAVLSAGEGAGAGARLAGTLDDKLRRLAARSGEDQAAAVRRW
FT                   IDLLHDEDAECAAAVAERLDQLMAKLTAGGLGRWMLAGLRRYERQPALLRAYFQLRDAY
FT                   AREALNGEAGAQDLEAAQARLSWLLCGLSGRAMGVEALRRPALDGPPSRPILAPTHLLV
FT                   PDSYTVLDGADRWALYRAAVAHAAAHLRYSPAAQPVASLKPMGVAVVSAIEDARVERLL
FT                   AVDYPGVRRWFLPFAPPPPDPADLGFAALIQRMSRLLMDPSLRDDNHWVNKARALFEAQ
FT                   SADLRDTAAFRRLASVLANDLGQMRVRFNPQQYAVPVPYRDDNAYLWDYGDAAEPPPEL
FT                   TLGSQGMAPEPRDAAPQGQEDVQQAADETELGRYRYPEWDYKLGRSRPDWCTVIEKLPG
FT                   WNGTAPPAPAAPVQRLALPQSRRLSRARRLRRQWEGDDIDLNAAIEVLIDRRLDLAPDA
FT                   RFFMRPGSQPCASSTLVLLDLSASANDLASDAGTTVLDLEKQAAMLLAQATSGEGDRIA
FT                   VHGFCSDTRAAVYYYRLLEPGAPVATALGRIGAAQARYSTRLGAALRHAGGLALLVPGE
FT                   RRAIIVVTDGEPSDVDAHDPRYLVDDAREAVLELRGRGVSVHCVALDAKAEPQLRAMFG
FT                   FRGYRIVTNPAALPQALVRVYARAAP"
FT   gene            378443..379597
FT                   /gene="amiC1"
FT                   /locus_tag="AXYL_00361"
FT   CDS_pept        378443..379597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiC1"
FT                   /locus_tag="AXYL_00361"
FT                   /product="aliphatic amidase expression-regulating protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13720"
FT                   /db_xref="GOA:E3HT94"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR039570"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT94"
FT                   /protein_id="ADP13720.1"
FT                   /translation="MANKDPIRVGVLFSETGATSTIGRSQLQGTLLAIDEINEAGGVDG
FT                   REIVPVRYDPRSDPATYSVLAEKLITQDRVNVIFGCYMSSSRKAVLPVVEKWNRLLFYP
FT                   TLYEGFEFSNNIIYTGAAPNQNSVQLAEFMTANFGARVYLIGSDYIYPYESNRIMGELV
FT                   LQRQDSAKLGERYVPLTATERDYREILDDIRNKRPDFIFSTVVGNSTACLYRAYADAGF
FT                   DPKTMPIASLTTSEAEISQMEPEVAAGHFTSAPYFQSIDSDINRRCLERLRRRFGHDCV
FT                   PNLCWEAAYFQMHIFANAFRDTGTDEIAQILPRVLQSEFQAPQGRVRIDPTNHHTCLYP
FT                   RVGRVNAKGQFTIVREATRSVHPDPYLVTHSLGDWTATLSSLDI"
FT   gene            379597..380226
FT                   /locus_tag="AXYL_00362"
FT   CDS_pept        379597..380226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00362"
FT                   /product="response regulator receiver/ANTAR domain protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13721"
FT                   /db_xref="GOA:E3HT95"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT95"
FT                   /protein_id="ADP13721.1"
FT                   /translation="MGDTASRQRAERATPSLLKDLRTLRIAVYHPDDADGRQLTQQLQR
FT                   IGCQVQTFWPPAPTLPEGLDAVFLAVRPDVIDLGFEWAKSDDAPMVIAIVTYENPTIVE
FT                   AVLRIGAKAVLPSPVRSFGLLSSLVVARQVYDDIKSHARRLRKLEGKLLGVRRIAEAKS
FT                   ILMRTRNVTEDQAYDLIREQAMNKRVTTEEIAGAIVNANEILSLGK"
FT   gene            complement(380243..381004)
FT                   /locus_tag="AXYL_00363"
FT   CDS_pept        complement(380243..381004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00363"
FT                   /product="Asp/Glu/Hydantoin racemase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13722"
FT                   /db_xref="GOA:E3HT96"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="InterPro:IPR028615"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT96"
FT                   /protein_id="ADP13722.1"
FT                   /translation="MTTSPRALRIGQIVPSSNTTMETEIPAMLRLRETIAPERFTFHSS
FT                   RMRMKQVTAAELASMDRESDRCAQELSDARVDVLGYACLVAIMSQGLGYHRVSQERLHQ
FT                   ATVDNGAPAPVISSAGALVEGLHAIGARKVSILTPYMKPLTKLVVDYIENEGIEVQDSL
FT                   SLEIPDNLKVGAQDPMAPASHVERLNTRGVDAVVLSACVQMPSLASIQPTQDRLGLPVV
FT                   TAAAATVYRMLKVLDLEARVPNAGELLTGKY"
FT   gene            381243..382124
FT                   /gene="catR1"
FT                   /locus_tag="AXYL_00364"
FT   CDS_pept        381243..382124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catR1"
FT                   /locus_tag="AXYL_00364"
FT                   /product="HTH-type transcriptional regulator CatR 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13723"
FT                   /db_xref="GOA:E3HT97"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT97"
FT                   /protein_id="ADP13723.1"
FT                   /translation="MEIRQLRYFAVLAEELNFTRAAARLHISQPPLSLQIAQLERELEV
FT                   KLFDRNNRRVTLTEAGEAFLNDVRALLASLKDATVRVRAVDQGLAGRIEVGLSGSHFMG
FT                   PVPALIARYKASHPQVSVLLNEMNPAAQLDALRGHRIDVSISRTAVDDEELQSMPLWPD
FT                   PVVAVLPKGHPLSARKRLELKDLAGQAFVMLRQDTSAFARTLAETCARAGLPLSAAQTV
FT                   AEVPAQLALVAAGLGVALVPRSTCRHATDRVAICSLPANISRAMVYAVTRRLGRRRALD
FT                   TFLQTAAQMKEE"
FT   gene            complement(382621..383904)
FT                   /locus_tag="AXYL_00365"
FT   CDS_pept        complement(382621..383904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00365"
FT                   /product="transposase, mutator type family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13724"
FT                   /db_xref="GOA:E3HQV7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:E3HQV7"
FT                   /protein_id="ADP13724.1"
FT                   /translation="MARNPKSAKQSSPPALPASAEQLLDELVTGPMTAEAVQDTFMLLK
FT                   KALIERALGAELGRHLGYPAGQTRPQASTNQRNGKSSKTVLTDDGPLKLDIPRDRDGTF
FT                   APILIPKHARRFTGFDDKIIAMYARGMSVREIRAFLDEQYGTDVSPEFISSVTEEVMEE
FT                   VQTWQNRPLEPMFPVVFFDALRVKIRDEGLVQNKAVYLALGVLPDGTREILGLWIETTE
FT                   GARFWMRVFNDLKTRGVQDILIAVTDGLKGMPQALEVVFPATTLQTCIVHLIRNSLGYA
FT                   GWKERRTIATALRPIYAAVSTEAAQQALDEFAKSPWGVKYPLIVKAWKGAWEHVIPFFV
FT                   FPPAIRRVIYTTNAIESVNAQLRKIIKTRGHFPTDDAAIKLLWLALRNITVKWGSATHH
FT                   WTEAMQQFAILYEDRFTRNRIDPQLGSQ"
FT   gene            complement(384060..385838)
FT                   /locus_tag="AXYL_00366"
FT   CDS_pept        complement(384060..385838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00366"
FT                   /product="M61 glycyl aminopeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13725"
FT                   /db_xref="GOA:E3HT99"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:E3HT99"
FT                   /protein_id="ADP13725.1"
FT                   /translation="MSMEKDNALPLLYRLAPHDPAGHRYRITLSIAAPSPGGQRLSLPA
FT                   WIPGSYLIRDFSRQIESLAAYSGSRRVPVEKIDNHTWQAAPCEGPLRVEYEVYAWDLSV
FT                   RGAHLDETHGFFNGTSVFLRVHGQDHLPCLVDLAPPRSIQGWKVYTSLPEARGHKGAAR
FT                   RHGFGLYLAPDYDALIDHPVEMGTPQVSSFVAHGAEHELVFTGVAPNLDLARITEDVRK
FT                   ICETQIAFFEPRSKRAPFLDSSDRYVFMTMVTGDGYGGLEHRASTALMTARKDLPVMGQ
FT                   QGQGEGYRGFLGLVSHEYFHTWNVKRIKPEAFVPYDLSQPDLTRLLWVFEGFTSYYDDL
FT                   LLLRSGAITQPDYLRLLAKTITSVARTPGRTKQSVAESSFDAWTRYYKQDENSPNALVS
FT                   YYTKGALVALGLDLLIRRETDGARSLDDVMRLLWGRYGRDFYQGKPQGLAEDGLPALIL
FT                   EATGVDTRLFIARHAYGTADVPLAELLEPQGIKLQWKTAANIPSLDVRTRKQGESLVLA
FT                   TVLEGGAGHKGGLSAGDVLVAVDGLRVDAPAGLELLLAQYRAGDRITVHVFRRDELREF
FT                   RVRLSPPEALDCVLTG"
FT   gene            385870..386646
FT                   /gene="fadB1"
FT                   /locus_tag="AXYL_00367"
FT   CDS_pept        385870..386646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB1"
FT                   /locus_tag="AXYL_00367"
FT                   /product="enoyl-CoA hydratase 1"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13726"
FT                   /db_xref="GOA:E3HTA0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3HTA0"
FT                   /protein_id="ADP13726.1"
FT                   /translation="MSESFVLVETRGRVGLLTLNRPKALNALNDQLMDELGAALLAFEA
FT                   DAGIGAVVITGSEKAFAAGADIGAMKDWSYMDVYGGEYITRNWETLKRIKKPVIAAVAG
FT                   YALGGGCELAMMCDIIIAADNAKFGQPEIKLGVIPGAGGTQRLPRAVGKAKAMDLALTA
FT                   RMMGAEEAERAGLVSRVVAADKLMEEAMDAATVIASMSLPSVMMAKECVNRAFEGSLNE
FT                   GLLFERRVFHSLFATEDQKEGMAAFTEKRKPDFKHR"
FT   gene            386903..388453
FT                   /locus_tag="AXYL_00368"
FT   CDS_pept        386903..388453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13727"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:E3HTA1"
FT                   /protein_id="ADP13727.1"
FT                   /translation="MRTSIATRRWSAAVLAGALSACFVTAAQAQSPRPSLRLVSETPYP
FT                   AASAPAAQMSEQELRDIAIDAYVYAYPMVLMELARRKATAVQTPLDGKAPVNQFGHKAA
FT                   FPDPRAGDVPWPSADALYSSLWFDVSRAPLIVNLPATGDRYMVLSALDMWSDVFASRGT
FT                   RTNGNGAQSFAIVGPGWQGSVPPGMDVIHSPTATGWLIGWTQAGGPQDYAAVNQIQAGM
FT                   TASPLAASATARPAVNRGSRSAYPQTGPGVGAAPIGSDLPPPMPVTVPDGTPAEQAAGM
FT                   DAASFFTLFFDVMRNNPSHANDTPILDRMRRIGLDSRQPFSYGRLNPAVQQALAQAQPL
FT                   AGRRIADGVSRLGTPMNGWSTVLSGIGTYGTDYTRRAAIAYAGLGAPTPEDVLYPVTVS
FT                   DSKGRALNSNEDYVLHFDKGQLPPANAFWSLHVYDANHGFADNPANRYVLRSTDGLKYN
FT                   ADGSLDIYIQRRDPGERKRSNWIASPAADAPFLLSMRLYSPQDTALDGLWAPPPVKED"
FT   gene            complement(388745..388945)
FT                   /locus_tag="AXYL_00369"
FT   CDS_pept        complement(388745..388945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13728"
FT                   /db_xref="UniProtKB/TrEMBL:E3HTA2"
FT                   /protein_id="ADP13728.1"
FT                   /translation="MSIQRRAIRVTENQNFIRHVVVKHCLLLTLTFNRTLPHFLLHGVL
FT                   LHQTSSLCFFAPIRTGASRCP"
FT   gene            388988..389305
FT                   /gene="atpI"
FT                   /locus_tag="AXYL_00370"
FT   CDS_pept        388988..389305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="AXYL_00370"
FT                   /product="ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13729"
FT                   /db_xref="GOA:E3HTA3"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:E3HTA3"
FT                   /protein_id="ADP13729.1"
FT                   /translation="MGLAAAVIAGVVGGAAAGWSALAGAGAYFIPNALFALRLAVSVRA
FT                   GKSSPFTFLSGELIKLFATALLLWLLSRVAQDSLVWPAALLGLILTLKGYLLLLMFRKL
FT                   S"
FT   gene            389388..390269
FT                   /gene="atpB"
FT                   /locus_tag="AXYL_00371"
FT   CDS_pept        389388..390269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="AXYL_00371"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13730"
FT                   /db_xref="GOA:E3HTA4"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:E3HTA4"
FT                   /protein_id="ADP13730.1"
FT                   /translation="MAAASDVSPQSAYIQHHLVHLNNTGEKQSAIAQFDIINYDSLFWS
FT                   GLMGLIVIFFLWRAARRATNGVPGRFQAFVEMIVDMVDDQAKGIVHNAKSRLFIAPLAL
FT                   TVFLWIILMNALDLLPVDLLPSIWRLTGLGAEHGDPLYYHRILPTADLNVPMGMSLGVL
FT                   LLMFYYGIKIKHPGGFVKELFTAPFHAHGIGAIVLAPFNLLLNLIEYAAKSVSLGMRLF
FT                   GNMFAGELIFMLIALLGGAWTGFNGASIGLGIGHILAGSIWAIFHILIVLLQAFIFMML
FT                   TLVYLGQAHEGH"
FT   gene            390388..390630
FT                   /gene="atpE"
FT                   /locus_tag="AXYL_00372"
FT   CDS_pept        390388..390630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="AXYL_00372"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13731"
FT                   /db_xref="GOA:E3HTA5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E3HTA5"
FT                   /protein_id="ADP13731.1"
FT                   /translation="MTNVAFVALACGLIIGLGAIGACIGIALMGGKYLEASARQPELMN
FT                   ALQTKMFLLAGLIDAAFLIGVGIAMLFAFANPFVG"
FT   gene            390775..391245
FT                   /gene="atpF"
FT                   /locus_tag="AXYL_00373"
FT   CDS_pept        390775..391245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="AXYL_00373"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13732"
FT                   /db_xref="GOA:E3HTA6"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:E3HTA6"
FT                   /protein_id="ADP13732.1"
FT                   /translation="MNLNATIIFQMLVFFVLGWFTMKFVWPPLTKAMDERRQKIADGLA
FT                   AAEKGKADLAQAQARVSLIEASAKSENHARIIEAEKQAASLIEQARREAEAERARIVAQ
FT                   AAQDAAQEVQRARDLLRDDVAALAVKGAEQILKREVDARAHAELLNQLRAQL"
FT   gene            391258..391797
FT                   /gene="atpH"
FT                   /locus_tag="AXYL_00374"
FT   CDS_pept        391258..391797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="AXYL_00374"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13733"
FT                   /db_xref="GOA:E3HTA7"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:E3HTA7"
FT                   /protein_id="ADP13733.1"
FT                   /translation="MAELSTVARPYAEALFSAARDDRAGLPAWSDLVSELAQVASNPDV
FT                   REAMADPRLGDKQRVELFSGLVKAELPQAARNFIELLVENDRLLLLPDIAAQFAVLRNR
FT                   HDGTAQAEITSAFELSDAQVKELVTALEQKFGLKLKPSVTVDPSLIGGVRVAVGDQVLD
FT                   TSVQAQLARMRDQLAA"
FT   gene            391826..393367
FT                   /gene="atpA"
FT                   /locus_tag="AXYL_00375"
FT   CDS_pept        391826..393367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="AXYL_00375"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13734"
FT                   /db_xref="GOA:E3HTA8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:E3HTA8"
FT                   /protein_id="ADP13734.1"
FT                   /translation="MQLNPSEISELLKSRIEGLGASADVRTQGTVVSVTDGITRIHGLS
FT                   DVMQGEMLEFPNNVFGLALNLERDSVGAVILGDYTGVSEGDQVKTTGRILEVPVGPELK
FT                   GRVVNTLGEPIDGKGPVNAKATDIIEKVAPGVIARRSVSQPLQTGIKAIDSMVPIGRGQ
FT                   RELIIGDRQTGKTAVAVDTIISQKGKGVTCVYVAIGQKASTINNVVRKLEEHGAMEYTI
FT                   VVAASASDSAAMQYLAAYAGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNEEYVEKFTNGAVKGQTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLETDLFNAGVRPAINAGISVSRVGGAAQTKVVKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDDATRRQLERGKRVVELLKQPQYQPLQVWELAVTLYTVNNGYLDE
FT                   VDVAQVLSFEKSLKDQLKAKHAALIQRIEDTKELSKDDEAELAAAIQEFKKHGAF"
FT   gene            393466..394371
FT                   /gene="atpG"
FT                   /locus_tag="AXYL_00376"
FT   CDS_pept        393466..394371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="AXYL_00376"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13735"
FT                   /db_xref="GOA:E3HUB2"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUB2"
FT                   /protein_id="ADP13735.1"
FT                   /translation="MPGIKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRAGRPY
FT                   ATKVREIAAHLMQANPEYSHPYLVEREIKAVGVVMVTTDKGLCGGLNTNITRVTLGKLK
FT                   EFEKNGIAVQATAFGNKGVGVLTRIGAKLVSQEVQLGDKPQLDRLLGAIKVQLDAYLEG
FT                   RIDALYVASTRFVNTMKQEPLFLRLLPLASGLDDPYQMGAEKLAKTSEVKSDYSWDYIY
FT                   EPDARSVIDDLLQRYVEGLLYQAVAENMASEQSARMVAMKAASDNAKKVIGDLQLVYNK
FT                   TRQAAITKEISEIVGGAAAV"
FT   gene            394415..395815
FT                   /gene="atpD"
FT                   /locus_tag="AXYL_00377"
FT   CDS_pept        394415..395815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="AXYL_00377"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13736"
FT                   /db_xref="GOA:E3HUB3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUB3"
FT                   /protein_id="ADP13736.1"
FT                   /translation="MSNGTIVQCIGAVVDIQFPRDHMPKIYEALTLADEGSSFAEKGLT
FT                   LEVQQQLGDGVVRTIALGSSDGLRRGMKVTGTGAPISVPVGTGTLGRIMDVLGRPIDEA
FT                   GPIQHEEKRGIHQPAPRFDELSPSVELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTV
FT                   NMMELINNIAKQHSGLSVFAGVGERTREGNDFYHEMEESNVLDKVAMVFGQMNEPPGNR
FT                   LRVALTGLTMAEKFRDEGRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEM
FT                   GKLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFQHLDSTVVLSRDIAALGIYPAV
FT                   DPLDSSSRQLDPQVVGEEHYAVARGVQQTLQRYKELRDIIAILGMDELSPEDKQAVARA
FT                   RKIQRFLSQPFHVAEVFTGSPGKYVPLAETIRGFKMIVNGECDALPEQAFYMVGSIDEA
FT                   FEKAKKLQ"
FT   gene            395825..396250
FT                   /gene="atpC"
FT                   /locus_tag="AXYL_00378"
FT   CDS_pept        395825..396250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="AXYL_00378"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13737"
FT                   /db_xref="GOA:E3HUB4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUB4"
FT                   /protein_id="ADP13737.1"
FT                   /translation="MATLHVDVVSAEEAIFSGEAKFVVLPGEAGELGILPGHTPLISRI
FT                   RPGTVKIVRADQGEENIFVAGGILEVQPGSVTVLADTAIRAADLDEARALEARQKAEQA
FT                   LANAKDKADIAVVEAELAMLAAQAIAARKLRQGGRSH"
FT   gene            396493..397305
FT                   /locus_tag="AXYL_00379"
FT   CDS_pept        396493..397305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13738"
FT                   /db_xref="GOA:E3HUB5"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUB5"
FT                   /protein_id="ADP13738.1"
FT                   /translation="MRDLVAQHPARQMRVRLHLVSLSPVRYAAAGAASRDTSADAAADA
FT                   VPEAPVPEADVQALARLAVALRRYDCCILPVAPSSLAWTRMALQQADAVLTTPLLLLIS
FT                   DVKAPAIEDLLSLGASDFETQPACRESLRVRLGRLARAAQGRGTARVEIREPATMYREA
FT                   RPQAGAGGLPRPAALRARVASDLVDHAVPGPRHQHPRLAHESFRIAKARVVDGFERDYI
FT                   RLALSRHGGNVAQAARACCKHRRAFWALMRKHGIEAAPYRQAAQEQGA"
FT   gene            397482..398555
FT                   /gene="hemE"
FT                   /locus_tag="AXYL_00380"
FT   CDS_pept        397482..398555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="AXYL_00380"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13739"
FT                   /db_xref="GOA:E3HUB6"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUB6"
FT                   /protein_id="ADP13739.1"
FT                   /translation="MSASVLKNDVFLRSLLREPVPYTPIWLMRQAGRYLPEYRQTRARA
FT                   GSFMGLAQNPEYASEVTLQPLERFDLDAAILFSDILTVPHAMGLGLDFAEGEGPRFARP
FT                   VRTEEDVARLEVPDMDKLRYVFDAVRTIRRDLDGKVPLIGFAGSPWTIACYMVEGQGSD
FT                   DYRLIKTMLYARPDLLHRILEINAEATLQYLNAQIDAGAQAVMLFDSWGGVLADGLFQQ
FT                   FSLAYTRKVVAGLKREHEGRRVPAIVFTKGGGQWLEQIAACGADAVGLDWTVDLAAARR
FT                   RTGDSVAFQGNLDPMALFGGGPAIRAEARRVLDAFGPVGKGGHVFNLGHGISRFTPPEA
FT                   VAELVDEVHQHSRSLRG"
FT   gene            398902..400947
FT                   /gene="priA"
FT                   /locus_tag="AXYL_00381"
FT   CDS_pept        398902..400947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="AXYL_00381"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13740"
FT                   /db_xref="GOA:E3HUB7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUB7"
FT                   /protein_id="ADP13740.1"
FT                   /translation="MRVALDVPLPGPFDYRSEAPVTVGLRVIVPFGRRKLIGVVVENPA
FT                   EPSFDPKQIRPIEEVLDDLPPFDEDWLRLARFAADYYQRPLGEVMLPTLPPPLRKPTAY
FT                   QGKRSAGGPVARLDGRKRKAARTPAQADQPPELNDAQREAVDTIGALNGFKPVLLHGVT
FT                   GSGKTEVYLRAAEKVLAAGRQVLLMVPEINLTPQLESALRARLEALVGPDGLAVMHSGL
FT                   SDGERLQAWARAQRGEARMLLGTRMSVFAPLGQLGLIVVDEEHDASYKQQDGLRYSARD
FT                   LAVWRAHDLGIPVVLGSATPSLETWQHAERGRYLRLTLPGRARASSLPSMRLVDTRRLQ
FT                   LKHGMSPQLLDALAQRLERKEQSLIFLNRRGYSPVLHCQSCAWVSNCPRCTAFTVLHRT
FT                   DGRGHRLQCHHCGYQAPVPRACPECGDQDLAPMGRGTQRVEEHLAELFPEARILRIDAD
FT                   STRKKGSAEALFASVHAGEVDILVGTQMVAKGHDFARLGLVGVLNADSMLFAHDFRAPE
FT                   RLFAQLMQVAGRAGRHQGNGEVLIQTGYPEQPVYQALLRHDYAGFARHALHERESTGLP
FT                   PFVYQALLTAEARELKVAQEFLERARSLPEGEWAADFPGLDAIMLYDPVPLRVVRVANI
FT                   ERAQLLAESSSRPALQAFLASWSHHLPYLANEARVRWQLEVDPLEI"
FT   gene            401186..403219
FT                   /locus_tag="AXYL_00382"
FT   CDS_pept        401186..403219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00382"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13741"
FT                   /db_xref="GOA:E3HUB8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUB8"
FT                   /protein_id="ADP13741.1"
FT                   /translation="MNPAQREAVLYLDGPCLVLAGAGSGKTRVITQKIAYLLRECGYMG
FT                   RNVVALTFTNKAAREMDERVKTLVDRKLSKGLIISTFHSLGVKMLREEARNAGLKPTFS
FT                   ILDADDAMAIIQELLNTTDKGRLRHVQGIISLWKNGLMEPDDAAREAITPADVEAANVY
FT                   RSYAATLAAYQAVDFDDLIRIPALLLANNEEVRTRWQNRVRYLLVDEYQDTNVCQYRLV
FT                   QLLTGSRAMFTAVGDDDQAIYAWRGATIENLAKLTTDYPNIKLIKLEQNYRSVQRILAA
FT                   ANQVIEKNPKLFDKKLWSDLGVGEPILVSAMDGEEQEAESIAMKVSASRFERQAQWKDF
FT                   AILYRSNHQSRILEQALRNLKIPYTISGGQSFFDKTEVRDVLAYLRILANDEDDPAFIR
FT                   AATTPKRGIGQATLQTLGQYAASRELSLLAAVAETGLESQLAPRQLEPLRTFTEFIRRM
FT                   QWRAGRGAASGKDAAPAEPAGVLLDDLLEAIQYERYLYELFEERPAQTRWQNVLELTGW
FT                   LKRKAEEDNMTLFDLVQHVALVTMLERGEEEEPDAVKMSTLHASKGLEYPHVYLAGVEE
FT                   GLLPHLGKDDEVGDPARAAENLASRIQEERRLMYVGITRAQRSLNLSWCKRRRRAREDL
FT                   VREPSRFIEEMGLGDVRVQEDEATAAMNPKERMAMLKALLKK"
FT   gene            403322..404176
FT                   /locus_tag="AXYL_00383"
FT   CDS_pept        403322..404176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00383"
FT                   /product="glutamine amidotransferases class-II family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13742"
FT                   /db_xref="GOA:E3HUB9"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUB9"
FT                   /protein_id="ADP13742.1"
FT                   /translation="MCRWLAYTGSPIQMESVLFKAKHSLIDQSLHSRLGATTTNGDGFG
FT                   LGWYSRQREGQPLEPPFRYRSVHPAWNDRNLREAARAIHAPLFVAHIRAATDTPAQETN
FT                   CHPFRHGQWLFVHNGVIRDYPLLRRDLMLMIAPAYFGSLEGSTDSEVMFLLALSFGLDE
FT                   DPLTALARMVGAVEETGRRHGVAQPINMTVCALDGQRLIAVRYSSEADSRTLFHNTCVR
FT                   HLRQLYPDNPQIAALDDDAFLLLSEPLTEMPGAWEEVPESTAIIAGGGTVAHYRFAPVP
FT                   PGA"
FT   gene            404313..404933
FT                   /locus_tag="AXYL_00384"
FT   CDS_pept        404313..404933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00384"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13743"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUC0"
FT                   /protein_id="ADP13743.1"
FT                   /translation="MTDSKTPQASVALAVFNHTGSTPDCFELHEHGVVCRQGDVRIYTA
FT                   FADIQDLFLFASGPDDGPGPINHFAYRTGSAQPWTLVPAEVGEFNKLMDAFRARYVAQR
FT                   LPVLEEKIADGARVAFRYVQSGNFPDLQTQELALSAEGLHIGGATWPYESLKRIDLNQW
FT                   TETISLQDENGETVFSCLAADVLSSDLFVNLVYDQLGRTAEYA"
FT   gene            complement(404959..405942)
FT                   /gene="dapD1"
FT                   /locus_tag="AXYL_00385"
FT   CDS_pept        complement(404959..405942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD1"
FT                   /locus_tag="AXYL_00385"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase 1"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13744"
FT                   /db_xref="GOA:E3HUC1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR019875"
FT                   /db_xref="InterPro:IPR026586"
FT                   /db_xref="InterPro:IPR032784"
FT                   /db_xref="InterPro:IPR038361"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUC1"
FT                   /protein_id="ADP13744.1"
FT                   /translation="MADSPTPLSAIAYGVATLAADGAILDTWYPRPSLADNSPATGTRH
FT                   LSPEEARAALGEHVPTALIRDTRRKVDIVAVRTAIASLDEPPVDAHDAYLRLHLLSHRL
FT                   IRPHDANLDGLFNVLANVAWTSAGPCAVDQVDTLRWHLRASGQILEIRGVDKIPRMTDY
FT                   VMPAGVRIADTARVRLGAHLSPGTTVLHEGFCNFNAGTLGASMVEGRISAGVIVDDGSD
FT                   IGGGASIMGTMSGGGKQVVSIGKRCLLGANSGIGISLGDDCVVEAGCYITAGTRVLTPE
FT                   GAVVKATSLAGQQGLLFRRNSQTGAVECLVRTAAWGTLNPDLHTGH"
FT   gene            complement(406023..406982)
FT                   /locus_tag="AXYL_00386"
FT   CDS_pept        complement(406023..406982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00386"
FT                   /product="autotransporter beta-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13745"
FT                   /db_xref="GOA:E3HUC2"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUC2"
FT                   /protein_id="ADP13745.1"
FT                   /translation="MLARAFAAHAVFAAGAAHAHAGQTRDLLADRPASPAPAQPGWLVA
FT                   VDNWQMLEGGANVARIKQRTTGVYGGGEFEAGAGWRLGGALGATRSRVNIDAADARLDV
FT                   YSYTAGAYGKKSFSAGPGKLNLLAAASYSWHDIDTRRHFEMPGIPRQTLTADFSAYTAQ
FT                   VFSELGYELALSPGATLEPFAGVAVRNVRTRSFSESGGSTALSADAGRIRQTTTTLGLR
FT                   GQTGFALGPTMGRLHATLGWRRAFGDVQPETTLVLDGGSVLTVAGAPIARSAALAGLGL
FT                   EVAVSRSAVIGLAYGGQYGGGNREHTGSLSLRWAFGSL"
FT   gene            complement(407020..408150)
FT                   /locus_tag="AXYL_00387"
FT   CDS_pept        complement(407020..408150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00387"
FT                   /product="peptidase family M20/M25/M40 family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13746"
FT                   /db_xref="GOA:E3HUC3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUC3"
FT                   /protein_id="ADP13746.1"
FT                   /translation="MSNTQSTEQIVAGIKSWLQCESPSNFPEGIAAMARIIADYAAAAG
FT                   LTVELSSLGPTTGPLLYATNRAPGDTRPGILILAHMDTVHPVGTLLENPVRIEGDRLYG
FT                   PGGYDMKAGIYLALSALSGLARPGATQLPVDFLVVPDEETGSHASRTHIERFAANAKYA
FT                   LVCEPARPNGGKCVTARKGTGMLNLNVKGRPAHAGMQHEKGRSAIREMAHQVLALEAMT
FT                   DYDRGITVSVGTIAGGTVTNTVPALCRCVVDFRVPDMGAAEDVLRRMRELCAVGPDVEL
FT                   DIDVELNRPPMVKTEAAADLLALVQGYAERAGFLLEDAPMTGGGSDANFTSAMGIPTLD
FT                   GLGADGDGAHTLNEHILISTLEQRMKFWELLLKELA"
FT   gene            complement(408190..409095)
FT                   /locus_tag="AXYL_00388"
FT   CDS_pept        complement(408190..409095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13747"
FT                   /db_xref="GOA:E3HUC4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUC4"
FT                   /protein_id="ADP13747.1"
FT                   /translation="MKPSEMSNVDRIAIELGHAGRNAILYVDEDRNSDRPFKLQTYRPY
FT                   GYTPDRPVVIVQHGVLRNGDEYRDFWVEAADKHKLLIVALTFSNEIWPGVESYNNGRVF
FT                   SAGGNPRHIDGWTYALVGNVIKDLIAGEITDGQNIYLFGHSAGGQFVHRLMSSQSHAPF
FT                   KAVAAGNPGWYTLPTFDHPFPEGMDGVGLTEEHLVKLLAYPMTILAGDQDIATDDPNLP
FT                   SEPAAMRQGPHRFARAQNYFEFGRKEAERRGVPFGWTLQVVPGIGHDGRAMSAVCASLW
FT                   FDGKMPDDAELARLAGQQVA"
FT   gene            complement(409095..410105)
FT                   /locus_tag="AXYL_00389"
FT   CDS_pept        complement(409095..410105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00389"
FT                   /product="oligopeptide transport ATP-binding protein AppF
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13748"
FT                   /db_xref="GOA:E3HUC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUC5"
FT                   /protein_id="ADP13748.1"
FT                   /translation="MSQADTPVIELKNVHKRFEQRPDLAQRILALTGRPIDRRTVYAVN
FT                   GVDLSIKRGEVVGLVGESGCGKSTLGRVVAGLHGQTEGQLLYQGQEARRLRGADKLAYT
FT                   LGVQMIFQDPQASLNPRQRLRQILGESLKVHKLAPAAQIPARIDQALKEVGLDPEYRDR
FT                   FPHQISGGQRQRIGIARALMVAPKFLVCDEPVAALDVSIQAQVINLFMDLREQHGFTYL
FT                   FISHDLGVVKHISDRVAIMYLGKIVEISTSAEIFARANHPYTQALMAEVPDVGRRGRKF
FT                   TPIKGEIPSPLNPPPGCTFNPRCPHAMPRCREQAPVLKEISAGHWSACHLNEANA"
FT   gene            complement(410102..411085)
FT                   /locus_tag="AXYL_00390"
FT   CDS_pept        complement(410102..411085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00390"
FT                   /product="oligopeptide/dipeptide abc transporter,
FT                   ATP-binding protein, c-terminal domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13749"
FT                   /db_xref="GOA:E3HUC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUC6"
FT                   /protein_id="ADP13749.1"
FT                   /translation="MSENILEVRGLRTAFHTEAGAWLAVDGVDLTVRRGEIVGLVGESG
FT                   SGKSVTGFSLLGLIDPPGEVVDGEVKFKGTDLRKLSEEQMRQLRGNRIAMIFQDPLMTL
FT                   NPVLRIGEQMMEAILTHEDVPRAEAEERCREALAMVGIPSPEKRLKSYPHEFSGGMRQR
FT                   VAIAIAMLNKPDLIICDEPTTALDVTIQGQILYRMQEICREHNTALIWITHDLGVVAEL
FT                   ADRVAVMYAGRIVESGPVEQVLDAPRHPYTKGLLDSMPGATQPGARLHQINGMAPSLAG
FT                   RPSGCPFRPRCTSAVTRCTEQAPTVTTEGARNYRCYVPITREAQPV"
FT   gene            complement(411218..412135)
FT                   /gene="dppC2"
FT                   /locus_tag="AXYL_00391"
FT   CDS_pept        complement(411218..412135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC2"
FT                   /locus_tag="AXYL_00391"
FT                   /product="dipeptide transport system permease protein DppC
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13750"
FT                   /db_xref="GOA:E3HUC7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUC7"
FT                   /protein_id="ADP13750.1"
FT                   /translation="MAQTPNSGRTRTVQPLAETPQRASILKKLHARPTLRGSVIALAIL
FT                   IVLVVFAPYFAPQNPYDLANLSLMDGRLAPRQALMDGSIAWLGTDDQGRDMLSAILYGL
FT                   RISLMVGLSAVVLATAVGGAIGLVAAYVGGVVDTVLMRIVDFILGFPTILVALVLLVVL
FT                   GRGVDKVILALVLVQWGHYARIMRSRALQERRKEYVEAAANLGYPAWRIMLFHLLPNCL
FT                   GPVMVFATIQIATAIALEATLSFLGVGVPITEPSLGLLISNGFQYLLSGDYWISLFPGI
FT                   ALLVLILSINIVGDRLRESLDPKR"
FT   gene            complement(412142..413119)
FT                   /locus_tag="AXYL_00392"
FT   CDS_pept        complement(412142..413119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00392"
FT                   /product="binding-protein-dependent transport system inner
FT                   membrane component family protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13751"
FT                   /db_xref="GOA:E3HUC8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUC8"
FT                   /protein_id="ADP13751.1"
FT                   /translation="MALFILRRLIQSLFVLLAVSVVVFFAVYAVGDPIELLVSPEASQA
FT                   AREAMIARLGLDLPVWQQYTGFLWRALHGDLGTSFVHGIPAIELIVQRIPATFELVVVA
FT                   IMLTCVFGIPLGLIAGLYRDQPLGRGIMASSVLGFSLPNFWQGMMLILLFAVWLGWLPA
FT                   TGRGDTVTVLGVPLSILTADGWSHLIMPAINLALANIALVLRLTASGVVEARSQDYVKF
FT                   ARAKGVKPGRIVRRHILRNILIPVVTVIGMEFGTLIAYSTITETVFAWPGMGKLLIDSV
FT                   YQLDRPVVVAYVMLVTLIFVIINLVVDILYATLDPRVQLVTPAQ"
FT   gene            complement(413169..414800)
FT                   /locus_tag="AXYL_00393"
FT   CDS_pept        complement(413169..414800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00393"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5 middle family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00393"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13752"
FT                   /db_xref="GOA:E3HUC9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUC9"
FT                   /protein_id="ADP13752.1"
FT                   /translation="MSAQTLYRSMLTAFAMAACTSAAIAQDAAGTLRIGLSSEPTSMDP
FT                   HYHQATPNDAMTSHMFETLVGQDAKMNLIPRLATAWKPVDDTTWEFTLREGVKFSNGQP
FT                   FTPQDVLFTFCRVVNNEQSISSSYPAIVQKFADVQVRDGNTLVIKTRQPYPLLPNDLTR
FT                   MGMLWNGIAEHGPISFDLQNKCGVTGAWPTVADFNTGRSVIGTGAYTLKSYVKGTAIEL
FT                   TRNDAYWGAKPAWKDVKLVPVPAAGPRLTGLLAGDFDLIENPAARDVKRISETPGFGHV
FT                   ITPSVRVVYFQPDVARSPSPGVKAADGKNPLQDARVRRAMSLAIDRKTIAARIMDGAAT
FT                   PANQFLPDGMFGTLPNPPELKYDPAAAKKLLAEAGYPDGFELVVSSTNDRYINDAQISQ
FT                   AVAQYLSRVGIKTTVDTMTRSVYFPKRAKREFSFAMGGWSSETGEASSFLQYWVSAFDK
FT                   EHGLGTSNYGGYDNPEFDRVFKRALVTVDPATREKLLQESLTLALADLPSIPLHFESSI
FT                   WAFRKGLTYEGRADQYTLAMSAKPAK"
FT   gene            complement(414870..415841)
FT                   /locus_tag="AXYL_00394"
FT   CDS_pept        complement(414870..415841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00394"
FT                   /product="succinylglutamate desuccinylase/aspartoacylase
FT                   family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13753"
FT                   /db_xref="GOA:E3HUD0"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUD0"
FT                   /protein_id="ADP13753.1"
FT                   /translation="MPTSAPASIPRPFLLACPNLSAERAGNTDTPGVWHFDSGVPGKHV
FT                   MLSALIHGNELCGAWALKDALAAGLRPRRGALTLAFCNLAAFDRFDPANYAPARFVDED
FT                   MNRVWSDDKLAVPISQERRRAAELRPWVEQADWLLDFHSMSNSDVPLQLTGMEQRNIDL
FT                   ALALGNPATIIADAGHAAGVRMRDYGRFGEAGDNGTRSLLIECGFHGAPEARGVAVDQM
FT                   ARFLLEAGAVDRGDLPADWFAPAASAQRALRVTHAVAAKSADFRFAQPWKGLETLAAAG
FT                   TLIGWSEGEPVVTPYDDCVLIMPSTANLRPGVTVVRLAQPIA"
FT   gene            416124..417038
FT                   /locus_tag="AXYL_00395"
FT   CDS_pept        416124..417038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00395"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 11"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13754"
FT                   /db_xref="GOA:E3HUD1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUD1"
FT                   /protein_id="ADP13754.1"
FT                   /translation="MHGIALKYFLEVAQAGSLSGASERLHVAVSAISRQIAKLEEEAGA
FT                   PLFERAARGMVLSEAGQLLLAHARRTMLEADSVLQEIAAIKGTARNEIRVASVEGVARI
FT                   FLPSVMARFRRDWPNIRFDLYVGSPAEVSRRVAEGSVELGMVFIAERIGGVSPRYSRRA
FT                   PVHAVMAADHPLAGRASVSLQDLSQYPLALTGPGTTTRQLFEMGCALESVQLEPALTCN
FT                   DSSPLHGFVFGSDAIMLSGYISVAWSLRRDELVAVPISNAELQSRTLQIQVMPGRVLPP
FT                   AAEAFVELLARELDDALQGRPAA"
FT   gene            complement(417177..418790)
FT                   /locus_tag="AXYL_00396"
FT   CDS_pept        complement(417177..418790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00396"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5 middle family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13755"
FT                   /db_xref="GOA:E3HUD2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUD2"
FT                   /protein_id="ADP13755.1"
FT                   /translation="MKLRTTLALAAAAIPLAAAQAQTLKIGLSAEPTSADPHYHKMTQN
FT                   DAFSAHVYSSLVGRSADMKLVPALATSWKTLDDQTWEFKLRDDVKFSNGKPFTSEDVLF
FT                   TICRTLNNETNVSQSYMDMTKRITDVQTPDAHTVIIKTGEPFPLMPAELARSLPIVWNG
FT                   IVEHGKLTFDPKKGCGVTGAWPTVADFNNGKDAIGTGPYTLKSYVKGTGIELVRNENYW
FT                   GPKPYWKEVKFVPVPSAGPRLTGLLSGDFDMIENPAARDLPRLKDNPKFGFVATPSTRL
FT                   VFFQPDVGRNPSPFVKSADGKNPLQDLRVRKAISMAIDRKTITARIMDGMATPAFQYMP
FT                   DGMFGALPKAPEIKYDPEGAKKLLAEAGYPNGFELTLSSTNDRYVNDGQVAQAVAQYLA
FT                   RVGIKTNVDAMTASIYFPKRAKREFSFSMGGWPAETGEASALFQLWVASLDSPNSLGTS
FT                   NYGGFSNADFDKVYKQAIVTVDAPKREKLLQESTQIALDNVPLIPLHFESSIWAFRKGI
FT                   TYEGRRDQYTLATSVTPEKQ"
FT   gene            complement(419177..419410)
FT                   /locus_tag="AXYL_00397"
FT   CDS_pept        complement(419177..419410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13756"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUD3"
FT                   /protein_id="ADP13756.1"
FT                   /translation="MSELTLNHTARLTDALERDLLRGALENQPNSHPLTGLKKAGQAVV
FT                   AAVAAVFSFIDEVNESMNKARAASSRFSGSQW"
FT   gene            complement(419531..420391)
FT                   /locus_tag="AXYL_00398"
FT   CDS_pept        complement(419531..420391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00398"
FT                   /product="carbohydrate kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13757"
FT                   /db_xref="GOA:E3HUD4"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUD4"
FT                   /protein_id="ADP13757.1"
FT                   /translation="MNTSAPSTGGTIDRAALPALFAPRSQDTHKGSFGTVGVVGGGPGM
FT                   TGAALLAARAALKTGAGKVLVGFAQEAAPLACDPLQPELMLRDARSLLEEDWGVTAWVA
FT                   GCGIGTGALAANALSELFVLRRGAPLVLDADGLNLLARGDIQPNWGDGPVVLTPHPAEA
FT                   GRLLGISAAEVQADRPGAAWTLAQRYQAWIVLKGAGTVVCSPDGDLRVNTSGNPGLATA
FT                   GTGDVLAGMLGSLIAQKLPLAQAVAGAVWLHGAAADALVAQGVGPIGLTAGELADAARA
FT                   LRNCG"
FT   gene            420505..421338
FT                   /locus_tag="AXYL_00399"
FT   CDS_pept        420505..421338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00399"
FT                   /product="enoyl-CoA hydratase/isomerase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13758"
FT                   /db_xref="GOA:E3HUD5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUD5"
FT                   /protein_id="ADP13758.1"
FT                   /translation="MSDITLEHYSAYESLKLRRHPGGVLEVIMGAKGGKPGKLSTADDR
FT                   MHRELADIWRDIDTDPDTRVVVIRGEGKGFSGGGDLDLVQQMADDFDVRTRVWREARDL
FT                   VYNIINCNKPIVSAMHGAAVGAGLVAGLLADISIAARDARIIDGHTRLGVTAGDHAAIV
FT                   WPLLCGMARAKYYLMLCETVTGEEAERIGLVSLCVDEAELIGRAFEVANKLAAGSQTAI
FT                   RWTKYSLNNWLRMAGPSFDTSLALEFMGFGGPDVREGIQSLRERRAPNFRPDSPF"
FT   gene            complement(421383..422123)
FT                   /locus_tag="AXYL_00400"
FT   CDS_pept        complement(421383..422123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00400"
FT                   /product="enoyl-CoA hydratase/isomerase family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13759"
FT                   /db_xref="GOA:E3HUD6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUD6"
FT                   /protein_id="ADP13759.1"
FT                   /translation="MSGGLQVNRDGAVLTLTINRPDRRNALDTATYAALTEQIALASAD
FT                   TALAAVILTGAGEHFTAGNDLRDFQAERGAGDSAGLTFLRALTMADVPVIAAVEGYAIG
FT                   IGVTLLQHCDFVHIGEGATLRMPFVALGLCPEGASSLLMPRLAGTRRAAEWLLQGKAFT
FT                   AQDACDAGLATSVTPKGQALAAAQATAADLARQPPAALRLTKAMLRRPDRQAIQDTLDY
FT                   EAQQFRIRLQSEEAQAAFAKFFKK"
FT   gene            complement(422120..423055)
FT                   /locus_tag="AXYL_00401"
FT   CDS_pept        complement(422120..423055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00401"
FT                   /product="2-nitropropane dioxygenase family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13760"
FT                   /db_xref="GOA:E3HUD7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUD7"
FT                   /protein_id="ADP13760.1"
FT                   /translation="MSLPVICAPMFIVSNPKLVVAQCTSGIVGSFPALNARPQSLLSDW
FT                   LDEVQAGLASHREANPGATVAPFAVNQIIHQSNDRLEQDLAVCASHRVPLIITSLRAPG
FT                   DLVKGVHDWGGKVFHDVTTIRHAEKALEAGVDGLILVCAGAGGHAGTLSPFALVSEVRR
FT                   FYDGPLILSGAITSGAHVLAAQAMGADFAYMGTRFIASEEANASEGYKSAIVDASASDI
FT                   LYTPFFTGIPGNYLKASIAAAGLDPANLPQPDSGASNFGSGRVKPWKDIWGAGQGVGGI
FT                   ASVLPTRQIVDTLRSEYADAKSRLAKGFGA"
FT   gene            423273..423896
FT                   /locus_tag="AXYL_00402"
FT   CDS_pept        423273..423896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00402"
FT                   /product="bacterial regulatory protein, TetR family protein
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13761"
FT                   /db_xref="GOA:E3HUD8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUD8"
FT                   /protein_id="ADP13761.1"
FT                   /translation="MATSAPPTQKRARAGRPPTVAAPRERILEEAAKLFARSGYDGSSV
FT                   SDLAGALGVSKAAIYHYYTTKQDIYDAIILAVLTGLTQAVAQEVGRAEGATARLRAFMV
FT                   GHARYFEQHHPEFVTMLIGYSGMALTEREDAARLRDGYEKRLRELIAQGVAAGEFRALD
FT                   VAAAGRGVLSMLNWMVRWYKPGQGDSAETIAAGYFDLLVGGMRA"
FT   gene            423944..425092
FT                   /locus_tag="AXYL_00403"
FT   CDS_pept        423944..425092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00403"
FT                   /product="acyl-CoA dehydrogenase, N-terminal domain protein
FT                   2"
FT                   /EC_number="1.3.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13762"
FT                   /db_xref="GOA:E3HUD9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUD9"
FT                   /protein_id="ADP13762.1"
FT                   /translation="MALDTETLNLLLDAVRRFVHERLIPAEDELAESGQVPPDIVNEMR
FT                   ELGLFGLSISPDHGGLGLTMEEEVRVVFELGQTSPAFRSLAGTNIGIGSQAIVLAGTDE
FT                   QRANYLPKLASGELIGSFALTEPDAGSDAMALRLSAVRDGDSYVLNGTKRYITNAPIAG
FT                   LFSVMARTAPERRANSISCFLVEAGTPGLTIGKPDKKMGQAGALTSDVVFDNCRVPASA
FT                   LLGGEEGNGFRTSMRVLDKGRLHISALCVGIADRLLSDAVKYAIERKQFGQPIAEFQLI
FT                   QAMIADSQAELYAARCMVLDAARMRDRGENTTMQAACCKLYATEMVGRVADRAVQIHGG
FT                   AGYMSEYAVERFYRDVRLFRIFEGTSQIQQLVIARETIKAHS"
FT   gene            425277..426506
FT                   /locus_tag="AXYL_00404"
FT   CDS_pept        425277..426506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00404"
FT                   /product="CoA-transferase family III family protein 3"
FT                   /EC_number="2.8.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13763"
FT                   /db_xref="GOA:E3HUE0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUE0"
FT                   /protein_id="ADP13763.1"
FT                   /translation="MSQRPAPLTGIRVLDLTRVLAGPWCTQNLADLGAEVIKIERPGAG
FT                   DDTRAWGPPYLKDEAGNDTTEAAYYLSANRNKLSVALDIASPRGAELVRELALQSDILV
FT                   ENFKVGGLSKYGLDYDSLKELNPRLIYCSITGFGQTGPYASRPGYDFMIQGMGGLMSIT
FT                   GERDDLPGGGPQKAGVAVTDLMTGMYSTVGILAALHERSRSGLGQHIDMALLDCQVSML
FT                   ANQNLNYMTSGVAPKRAGNAHQNLVPYQVFAASDGHLIVAVGNDSQFRNYCGAIGLPEL
FT                   SADPRFATNPQRVKNRAELVPLLTERMATGARDHWLAALEAVGVPAGPINTLDQVYEDP
FT                   QVLARGMKRELPHPTAGTVPIAASPLKFSDSPVEYRRPPPMLGEHTEQVLSEKLGLSAE
FT                   EILALAQSRA"
FT   gene            426537..428063
FT                   /gene="paaH1"
FT                   /locus_tag="AXYL_00405"
FT   CDS_pept        426537..428063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaH1"
FT                   /locus_tag="AXYL_00405"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase 1"
FT                   /EC_number="1.1.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13764"
FT                   /db_xref="GOA:E3HUE1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUE1"
FT                   /protein_id="ADP13764.1"
FT                   /translation="MKEIQTIGVVGAGAMGRGIAQIAAQAGLRVRLYDTSADAVAAARE
FT                   SLRQTWDKLAQKGKLSAADAQAALERVESATALTDMSNCQLVVEAIVERLDVKRDLFAA
FT                   LEGVVAEDCILASNTSSLSITAIAAACKHPQRVAGYHFFNPVALMKVVEVIDGLRSAPE
FT                   VGDALAELAHRMGHTPVRAKDMPGFIVNHAGRGMNTEGLRVAQEAVATFAQVDAVMREQ
FT                   AGFRMGPFELLDLTALDVSHPVMESIYRQFFDEPRFRPSPITTVRLAGGLIGRKAGEGF
FT                   YVYADGQKQVPAEPPVPALPENLKVWVSPRHAEGYARAAALVEKLGATLVTGSTPDADA
FT                   LILVTPFGEDVSTTVSAQGLNAARTVGLDALYAFDSAKRRTIMVSPATEAKWRDAAHAL
FT                   LAADGVPVTVIEDSPGFIAQRIVATIVNIASDIAQQQIATPKDIDLAVTLGLGYPVGPL
FT                   ALGDKLGADRILEILKSMQRVTGDPRYRPSLWLQRRVQLGMSLTQATGEQ"
FT   gene            complement(428163..429128)
FT                   /locus_tag="AXYL_00406"
FT   CDS_pept        complement(428163..429128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00406"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13765"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUE2"
FT                   /protein_id="ADP13765.1"
FT                   /translation="MNRRQFSRLLATSPLLLSALAQAQEGSAITLIVPYPPGGNTDYVA
FT                   RITSDSLRRTLGSSVVVKNQAGAGGTIATDALIRSRNDGNTLMVGSIGQVSLVRFLFNV
FT                   RYDPLNDLVPVANIASNPLVLTVPSSSRFQNLAQLIEYGRAKPGALTVAHGGEGSMSHM
FT                   SVLVFLKRAGIEATLIGYRGGAPALLDTMGGTTDLYSANISEILPYKDSGRIRFLGVSS
FT                   RQPVPQLPGVPAIADTIPGHEIETWNGLFAPPGTPAEVVDRLADAVQVMLRDPDVLSKF
FT                   DASGSQPRAGEVKDKFARRIRDDIALWTPLVSLIGVKPAN"
FT   gene            complement(429170..430549)
FT                   /locus_tag="AXYL_00407"
FT   CDS_pept        complement(429170..430549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00407"
FT                   /product="amidohydrolase family protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13766"
FT                   /db_xref="GOA:E3HUE3"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUE3"
FT                   /protein_id="ADP13766.1"
FT                   /translation="MDTLIKNGLVVTPQGRVRASIGIRDGKIAGLYEAGSEPDARNIID
FT                   ASGLAVLPGAIDMHSHHRQGSQKGFEYKDTILTATQQCAAGGVTTSVGMPNVNPPPNSL
FT                   DLLEKQFAIYRSDAVVDWNFNPAPTIESEMEAMTATGIAAFKIFMVVDTGRDYPHMPGI
FT                   GVHDHGKLLRIMQRCAELDVPLMVHPHDQALMDVIEQTYWDRGERDALAYARAYAAHDG
FT                   VIWETAIATLLRLQKAAGCHLHILHTQTAGSVQLIREAKAAGQKVTCEINPWALFLGCE
FT                   WSAIQRLGSYALSYWVPEKNVPGLWEGLNDGTIDIIATDHAPHTREEKEVGWTDGWKAH
FT                   TGTPSTQFYLSMFLTAAQEGKISLERVAEACSAKPAELFRLREKGEIRAGLDADLVLVD
FT                   LETEYEVRDEDVLSLVGWSPYAGRRLMGKPVRTLVRGATVYEDGKVVGAKGSGQMAAAT
FT                   R"
FT   gene            complement(430584..431672)
FT                   /locus_tag="AXYL_00408"
FT   CDS_pept        complement(430584..431672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00408"
FT                   /product="CobW/HypB/UreG, nucleotide-binding domain protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13767"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUE4"
FT                   /protein_id="ADP13767.1"
FT                   /translation="MANGETSETRIPVTLLTGFLGSGKTTLLNHWLRDPALAGAAVIVN
FT                   EFGEIGIDHALIASSNDNTIELTTGCLCCTVQGDLVETLRDLRAKRSAGTIAAFDRVLI
FT                   ETTGMADVVPVIQALMTFPVARSFRLNRVLTVVDAVNGPGTLAAHPEAVKQAAVADALI
FT                   VTKTELPGAQVAALVDTLARVNPGATRVVCNPAERPDATVLDGPDVYDVNVRPEQARQW
FT                   LNAAPYTDGHGHGGHGHEHTHKHHTHAHGHDHARIDSFCLDFAAPLQWPQVSAWLDALV
FT                   MAHPDELLRVKGILHIAGHERPIVLQAVQRLFHPPTELPDWPDTDRQSRMVFITKGLSK
FT                   DYVMQVWDAVRQRALPPAARAA"
FT   gene            431884..432657
FT                   /locus_tag="AXYL_00409"
FT   CDS_pept        431884..432657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00409"
FT                   /product="bacterial transcriptional regulator family
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13768"
FT                   /db_xref="GOA:E3HUE5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUE5"
FT                   /protein_id="ADP13768.1"
FT                   /translation="MAGDIRTRNRILHILQLYDRSAAWSVEEIAVEMDVSVSSAYRDVQ
FT                   ELVRADFLTPVMGARYVLGPTFAHFDLLMRHGDPLLKVAEPHMRRLVEATTPSSASVLT
FT                   RSYQDKVMCIHQEIGDPAARVGRYERGATMPMFRGATSKVILAHQSRRALERMYLAHEE
FT                   EARAISHWKSLKDLCLELDAIREAGVAVSDSEITPGTIGIAAPIFLEQRVVAGLSLIVR
FT                   AEHCRLEPFRAAVIEAASQISSQLAEVDGAWVARA"
FT   gene            complement(432676..433581)
FT                   /locus_tag="AXYL_00410"
FT   CDS_pept        complement(432676..433581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00410"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 12"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13769"
FT                   /db_xref="GOA:E3HUE6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUE6"
FT                   /protein_id="ADP13769.1"
FT                   /translation="MNLTTRQLRIFVLLAETLSFQRTAEMLHVTQPTLSKLLKETEETL
FT                   GVKLFERTTRMVRLSREGQDILEIAHRITALHEKGMLELDQRLRDRHNRVAVAALPTLA
FT                   ASLIPLLIQSLARKHPRVRVEVYDPIASEALQLLRERRVDIAVTTMNEEGASDLVYQEL
FT                   FTEPFVLFHSAQIKPDVRHWMPMELARLPLISMPPGTSVRVLTERAFQAAAQPFNPVYS
FT                   LRDLNTIARFVQHNCGIALLPESSLDNATQRGVRKTRLRQALSRSVGMYIRRESQPSGL
FT                   LRQTLDELRRLGRDRQSRPD"
FT   gene            433674..434468
FT                   /locus_tag="AXYL_00411"
FT   CDS_pept        433674..434468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00411"
FT                   /product="short chain dehydrogenase family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13770"
FT                   /db_xref="GOA:E3HUE7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUE7"
FT                   /protein_id="ADP13770.1"
FT                   /translation="MFRLDGKVALVTGCGTLGAGWGNGKAAAAVLARQGAAIFGCDLNI
FT                   DAARQSAQAVAAEGGKITVRQCDVTDGSQVAELVRACMETHGRIDVLVNNVGRSEPGDP
FT                   VSMPEDLWHDQIQVNLTSAFLCCKHVIPLMKSAGGGSIINISSIAGLRYAGKPQVGYAA
FT                   AKAALMQMTATTAVIYAQDGVRLNSVVPGLMFTPLVERLAQKYAKGDYEGFVAHRHAQV
FT                   PAGRMGDAWDVAHAVAFLASDESRYITGQQIVVDGGITMATR"
FT   gene            434484..435305
FT                   /locus_tag="AXYL_00412"
FT   CDS_pept        434484..435305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00412"
FT                   /product="short chain dehydrogenase family protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13771"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUE8"
FT                   /protein_id="ADP13771.1"
FT                   /translation="MNVHEQAGAGRLAGKVALIFGAGCVGPGWGNGRAIAVRFAQEGAV
FT                   VVAVDIRPESLPETLELAGRYRSRIETQICDVGDAAQVAALVQAVARRHGRIDILVNNV
FT                   GGPIPGGAAALTQADWRRQLDLNLTSVFTTCQHVLPIMQEQGAGAVVNVSSTSAIRWTG
FT                   APQVGYAAAKAGVMQFGRVAAVEYAGKGVRINTVLPGQLHTPLVDAFLAGQQSAGDIDA
FT                   LLERRRRRIPLPLSGDGRDTANAVLFLASDEARFITGTELIVDGGMSARCD"
FT   gene            435329..435841
FT                   /locus_tag="AXYL_00413"
FT   CDS_pept        435329..435841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00413"
FT                   /product="carboxymuconolactone decarboxylase family protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13772"
FT                   /db_xref="GOA:E3HUE9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUE9"
FT                   /protein_id="ADP13772.1"
FT                   /translation="MARIEYADIARPEIRPLVERIERERSSLPNLYRMLLNSPLVAQGW
FT                   LAYLTAIRQHSGLAPKLREMLILRVAVLNQADYEFEQHLPIALKAGCNEDQVQGLKTGD
FT                   FTSLDAGERAAMAYCDEMTREIRVRDATFAAVREAFDARAIVEITATVAAYNMVSRFLE
FT                   AIQIDHE"
FT   gene            435886..436851
FT                   /locus_tag="AXYL_00414"
FT   CDS_pept        435886..436851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00414"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13773"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUF0"
FT                   /protein_id="ADP13773.1"
FT                   /translation="MHSFKRFGGAFASLALGLALSAPAHAGYPAKPVQLIIPFAPGDTD
FT                   QMLRPITEKMGQYLGQPIVMNYKPGAGGGIGAAYTASAAPDGYTIVGSSPGALVVVPLA
FT                   NKEIKYTTESFAPVAAISLGGMMIVAPGKSRYKTLADVVADAKARPDAISYGTSGAMGI
FT                   SHLLGETFASEAKVKLRHIPFQGSTPAVTALLGGHTDIAVSAVGPAQAHIQSGGLRPLA
FT                   VFSSKRLAAYPDVPTLRELGYEVGSPTIYGLMAPKGTPPQVVDALYQAARKVVAEQGDE
FT                   VNKTLGGIGAEISVLSPQEYGAYLQEQRALFSKAIGLIRE"
FT   gene            complement(436925..437830)
FT                   /locus_tag="AXYL_00415"
FT   CDS_pept        complement(436925..437830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00415"
FT                   /product="cytochrome c family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13774"
FT                   /db_xref="GOA:E3HUF1"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUF1"
FT                   /protein_id="ADP13774.1"
FT                   /translation="MSNEQEHIEEHSSPIKTPKQLIVTIVLSFVIPIAIIILLVNMVVS
FT                   GNKTGAGSDTLSQEAVAKRIAPVAGFELVDANAPKVFKTGEQVFAAVCTACHTAGVAGA
FT                   PKVGDNAAWAPFITAGYDAMMNVALHGKGGMPAKGGNPTLSDYEVARAVVYMANKSGAS
FT                   LPEPAAPAAEGDKKEAAAAPAAAPAAPAAAPAAAAPAPVAAAPAPAAPAAAPQAAAAVN
FT                   PAGEKLYKSVCFACHATGVANAPKFGDKAAWDPFIKTGMDAMVKVAMQGKPPMPPKGGA
FT                   ANASEDDIRAAVQYMVDAAK"
FT   gene            438063..438137
FT                   /locus_tag="AXYL_00416"
FT   tRNA            438063..438137
FT                   /locus_tag="AXYL_00416"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGG"
FT   gene            complement(438394..440934)
FT                   /locus_tag="AXYL_00417"
FT   CDS_pept        complement(438394..440934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00417"
FT                   /product="ferric anguibactin receptor 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13775"
FT                   /db_xref="GOA:E3HUF2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUF2"
FT                   /protein_id="ADP13775.1"
FT                   /translation="MALRSPPRSSADKAAGVRTSQSGRSPQQPPYRRKANLLALAVSCV
FT                   LTSLPAAVLLSPGVATASEAPGSEQKKKYRIPSGKLSDVLAEFAALSGVYLTYDPQRLA
FT                   GLQNRPLDGVYSIREGFAHLLANSGFEALDNGAGRYVLRQAPPSDSGAPRQSAAGDGDA
FT                   TLLSPVIVTGLYRGDLTPVYAGGKVATGIRVGMLGYKDFMETPFSTIGYTEEAVRQAQD
FT                   LARVVGSTDAGVYDLGMRGTVREAFVIRGFDVDSGDIAFGGLYGLLPYTRVPLELVERV
FT                   EVLKGPSTMLNGMPPGGSVGGSINLVPKRATEKPLTRVTGMFVSDGQYGTHVDVGRRFG
FT                   DDQQVGIRFNGLYQDGRTSVEGQSKRTTLGAFGLDWRNERVRLAADLYANKDNGSSVNR
FT                   GITVGAGLQRPDVPNPRRSLEPDWTFSNVEDSAFVLRGEADVTDDIIVYGNYGKAKTDY
FT                   NGVLGVVFRVTDNDGRYRTNFGQQRQSLDRTAGDVGVMARLRTGGVKHEVAVSGSYYEQ
FT                   EVRSAIALGLLPSDWYTNIYDPQWGPAPARPLGKSDIPKTALSRLSSVGIADTMSFAGD
FT                   RVVLTAGLRRQNVIAESFNITTGARTSRYDESATSPAAALLVKATNQISIYGNYTEGLR
FT                   EGAIAPVGASNAGEIFAPYKTKQHEVGVKLDLGDFAATLSAYQIRLPSSYVDPVTNMFS
FT                   FEGEQRNRGLELGFFGEPTSGLRLMGGVAYLDAELTKTAGGVDQGRFVMARPKWQAKLG
FT                   VEWDVPGVPGLTATGNVQAITGQFYSRDNSLRTAGRTIFDAGMQYRTSIDGHDVVLNAN
FT                   VLNLANKAYWAAGGAGKLWLGAPRTFMLSASVDF"
FT   gene            complement(441095..442063)
FT                   /locus_tag="AXYL_00418"
FT   CDS_pept        complement(441095..442063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00418"
FT                   /product="FecR family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13776"
FT                   /db_xref="GOA:E3HUF3"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUF3"
FT                   /protein_id="ADP13776.1"
FT                   /translation="MSSTTAVIDSRILKEAAAWAITFQYESPSVADRQALELWCRKSPA
FT                   HAAAWMRTQAIFHVFDEVPREIGAEALESLQRSNGRRRSLRTVGMLLVVAPLGMLALRY
FT                   VPWREWTADVSTTAGERKQLTLPDESHLALNTRSAVNIKFSDTERRIRLVAGEVLISTQ
FT                   KDRVATPRPFLLDTPAGVVRALGTRFNVRQIDSDRFRVAVLESAVEIRPFGGTPRIVRE
FT                   GEQAEFDGTGVGSIARIENHVGLWEKGILLVKGMRLADVIAEIARYRAGVLRCDPAVAD
FT                   LRVSGSLPIGDTDAALAVLAESLPLKIESRSKYWVTVLARD"
FT   gene            complement(442084..442596)
FT                   /locus_tag="AXYL_00419"
FT   CDS_pept        complement(442084..442596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00419"
FT                   /product="RNA polymerase sigma factor, sigma-70 family
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13777"
FT                   /db_xref="GOA:E3HUF4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUF4"
FT                   /protein_id="ADP13777.1"
FT                   /translation="MSFLSDQSPAVNVESLYCNDHRWLQGWLRRKLGNAHDAADLAHDT
FT                   FLRILSSQAFNQHYSNEPRALLTHIAKGLVVDHWRRKAVETAYLDAISQLPAQHAPSAE
FT                   TRLLIIEALVRIDTMLAGMTPRIRQVFLMAQLHGMTLAQISEHMTMSLITVRRDIQKAL
FT                   LACLAVA"
FT   gene            complement(442914..443669)
FT                   /locus_tag="AXYL_00420"
FT   CDS_pept        complement(442914..443669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00420"
FT                   /product="bacterial regulatory protein, GntR family protein
FT                   4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13778"
FT                   /db_xref="GOA:E3HUF5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUF5"
FT                   /protein_id="ADP13778.1"
FT                   /translation="MSSPISTEAILDRSAGAPLWAQFRDVVRGKILQGELAVGDKLPTE
FT                   AEFGEQYGISRIVVREALADLVRNGLIYKIRGQGAFVSARERDEDFVSTVLGFSDEMER
FT                   KGRTVRTQVLRQELRAPTAHEASSLGLAEDGQVVALKRLRSVDGELQLLVETAVPADLV
FT                   PGLHRTRLENRSLYDVLRRQYGLRIVRAERWIDAVQPDAETCELLGMKEPEPLLRIESI
FT                   AYGANGRPLEHYRALHRCKSSRLHVQTTT"
FT   gene            complement(443666..445435)
FT                   /gene="glpD1"
FT                   /locus_tag="AXYL_00421"
FT   CDS_pept        complement(443666..445435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD1"
FT                   /locus_tag="AXYL_00421"
FT                   /product="glycerol-3-phosphate dehydrogenase 1"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13779"
FT                   /db_xref="GOA:E3HUF6"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUF6"
FT                   /protein_id="ADP13779.1"
FT                   /translation="MTPHTPTFARPASLAGRHFSTVIVGAGINGAGVFRDLSLQGVDCL
FT                   IVDKDDVAAGASSAPSRMIHGGLRYLESGAFSLVAEATRERNLLLRNAAHLVHPLETVV
FT                   PLSSRFGGLWGSMLRFAGLSASPGARGLCVVGLGLRLYDRLGRSQRIMPEHRIERVPQA
FT                   DGALFGTDVRWTATYYDAWIRHPEWLVLELIDDAHRGHPASVASNYCSVTACQGRTITL
FT                   RDALTGQSVQVTADTVVNATGAWLDRAAGALQGAGSRVMGTKGSHLILNHPALRSALQG
FT                   RMAYFEASDGRVCIVYPFLDRVLVGSTDIPVDDPDLAATDPAEIDYLLGVLREVFPRLD
FT                   FSRNDVVYTYVGVRPLAQSDADKPGQISRDHAVVIDPPNARREVPMVCLVGGKWTTFRS
FT                   LAQLAADAVLQQLGRARRQSTEQVAIGGGAGMPADAPGRQRFLDSIQAATALDRERVTE
FT                   LFMRYGSRAGAVAADFAAAGDKPLRHAPDHSAAEIRYLCRETAVQHLTDLVIRRTLLAI
FT                   RGHVTPALLAELADIAAAELGWNAERRQTELRACTATLRDRHCVQLPADETSWAKPADS
FT                   ALTAGSISNSLTT"
FT   gene            complement(445432..446892)
FT                   /locus_tag="AXYL_00422"
FT   CDS_pept        complement(445432..446892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00422"
FT                   /product="carbohydrate kinase, FGGY family protein 1"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13780"
FT                   /db_xref="GOA:E3HUF7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUF7"
FT                   /protein_id="ADP13780.1"
FT                   /translation="MGSTGLKAVAFEAGSGATLAASGGALPYRQLAQGGCELSADAIEA
FT                   ALALALQGVAAQLGRRVADVRALCCTGHGAGLYALDASGQLLEGRAVASTDQRAAARAR
FT                   ALDRSMGNALYDEVGCRPWAGQSSLIAAELFGADAGQLSRIRHLLFAKDYLGFLLTGEI
FT                   ATDASDASTAGLLSLKAGAWSTMAFEAAGLSGLAATALAPIAPSGTVIGRLRPAQAATF
FT                   GLPAGLPVALGAIDLLASLKAVNAERQGHAVAVLGTWCVNAVVAPIREPKPEVGAIVSF
FT                   GDPGRRLYLENSPSSMANVAWLARTLQFPDAAAAVECAMGVPLGADGLRFLPFINGGSW
FT                   PAGACAGYVGLQGHHTRAHMARAVIDAVVALHAWHLKRLAALGLGVPGRVAALGGGARD
FT                   LRLARLLAGFLGHAVERCGDDETGARGAALYAALSQNPGGDDLLPAPSETVEPLAAETQ
FT                   AHADFYASFHGLVDSMAPAFGHLAGPAR"
FT   gene            447102..448136
FT                   /locus_tag="AXYL_00423"
FT   CDS_pept        447102..448136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00423"
FT                   /product="Tat pathway signal sequence domain protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13781"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUF8"
FT                   /protein_id="ADP13781.1"
FT                   /translation="MRRDFLKTVAAAGASLAGANVFAQNTPQAPGLRGNANDVYVMNVM
FT                   VSGVEYWFPVYEMMKQLGHSLGVRTRYSGTPEYDVNKQLASFEQELARKPAGILLHPMN
FT                   PDPFIEPINRAAAMGIPVVTFAADSPNSKRVSFVTSDNDREGAQAADAIAAALNGKGEY
FT                   AVLENPGQDNHDRRVAAFINRMKTQHPGMKLVGRAASNQDPNKAYQATLSLAQANPGLG
FT                   ALFMPEANSALGAAQASIETKKNIKVLCCDVNAKILDMIKSGEVFGSVNPNQGVQGYMG
FT                   MMLLFLARNQQLIDPMNDAKRNGTNPMAVPFLDNGLSIVSKANADDFYWDKYLARRGTK
FT                   GINE"
FT   gene            448133..449656
FT                   /locus_tag="AXYL_00424"
FT   CDS_pept        448133..449656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00424"
FT                   /product="ABC transporter family protein 5"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13782"
FT                   /db_xref="GOA:E3HUF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUF9"
FT                   /protein_id="ADP13782.1"
FT                   /translation="MNATAALLELQGISKQFGASKALADVRFTLRRGEIHALCGENGAG
FT                   KSTLMKIIDGIHQPDSGDIYLEGERVVINGPAHAMRLGIGLVHQEIALCGDATVAENIF
FT                   MPAISAGAQAWMDYASLNQRAAGVLRRLGQDIDPGLRVDALGISSQQLVEIARALTLDC
FT                   KVLILDEPTAALTEVESVALFRVLHDLKAQGIGIVYISHRMAEIFEHCDRVTVLRDGRD
FT                   VHSADIAALSPDALVRCMVGRDLGNYYPPRQAAGDAPAEVLLEVEDIADGANVHGISFT
FT                   LRRGEILGISGLMGAGRSELAETVCGLRRARRGAVRLRGRPLRLRRYADALRHGIAYLS
FT                   EDRKAAGLFLDMPIEQSVSSMALGRISSRFGLLKRAAERSLAVELGARLKLKSDGVAID
FT                   ASCLSGGNQQKVAIAKLLATRPSVLLMDEPTRGVDVGAKSEIHHLLRELANQGVGVVVI
FT                   SSELPEIIGLCDRALVIRNGRLAGELAASDMTEERLLRLASGLSAQEAT"
FT   gene            449653..450684
FT                   /locus_tag="AXYL_00425"
FT   CDS_pept        449653..450684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00425"
FT                   /product="inner-membrane translocator 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13783"
FT                   /db_xref="GOA:E3HUG0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUG0"
FT                   /protein_id="ADP13783.1"
FT                   /translation="MMSDLKSQPAAEAVLPPPAASLPPGPRLGRRLGSFREAGLLLIIA
FT                   ALCVVMSFASPHFLTWENVRAMLLSFSIEGIVVVGMTILVIVGGIDLSVGSVVCLAMVI
FT                   TGKLFLMGLDPWTASLAAIAVCTMVGALIGGCVTRIGLSHFIASLAFMVIVRGLCLAIT
FT                   QGTPQSLFSLPPQFKFIGQGSIGGIPAVILIFAVIVIVSDFALRRAALLRKVFYTGSNE
FT                   KAALYAGIRTGRVKFWVTVLCSTLAGVAGVVYTARFGAATPNFGVGMELNVIAAVVIGG
FT                   ASLKGGSGTVLGAVLGLALLSVVTSSLILLDVSPYWQDVVKGLILLAAVTVDHLMNVRK
FT                   GSR"
FT   gene            450681..451661
FT                   /locus_tag="AXYL_00426"
FT   CDS_pept        450681..451661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00426"
FT                   /product="aldo/keto reductase family protein 1"
FT                   /EC_number="1.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13784"
FT                   /db_xref="GOA:E3HUG1"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUG1"
FT                   /protein_id="ADP13784.1"
FT                   /translation="MKTTTLGASGIACESVGLGTWAMGGWMWGGADDAAAIAAIQASVD
FT                   AGVRLIDTAPAYGLGHAESLVGQALKGRRQQAVIATKCGLVWHTRQGEHFFDEDGQAVH
FT                   RHLGRASIFHEVEQSLARLQTDYIDLYITHWQDAGTPVAETMDALLDLKRQGKIRAIGV
FT                   SNVDSDTLAEYLRHGPIDAIQERYSLIDREIESTLMPLCRNHNVGILGYSSLALGLLAG
FT                   PIDPGRRFTGDDQRAGNPRFSVANRGRLQGFFAELEPLRQRLDCSASQLMIAWTTRPGG
FT                   VTVALCGARTPQQATQNAAAAALALSPEDLAVIDQAAERHLQTLD"
FT   gene            451675..452523
FT                   /locus_tag="AXYL_00427"
FT   CDS_pept        451675..452523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00427"
FT                   /product="deoC/LacD family aldolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13785"
FT                   /db_xref="GOA:E3HUG2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUG2"
FT                   /protein_id="ADP13785.1"
FT                   /translation="MLYRKEARLNRLLSNGRCLDIAVDHGVCNEPGFLSGLEDMPAVME
FT                   QLAAARPDAIQLNYGQADLLQQRPGRDKPALVMRLDMGNPYNATTHRVMWAVLQNEQDP
FT                   VLPAVQMDAACVVVNLFMLPDEPDLFRQCVANIARVRADCDRYGMPLMIEPLVMAPHSA
FT                   RGGYMVDGDAEKIVTLVRLAREMGADIVKADPTTATRDFHRVVQAARCPVLVRGGGRED
FT                   LRQVFERSRELLDEGAVGLVYGRNVYQHADPSSVVRALMAMIHDNASAGQAWDMYEAGG
FT                   R"
FT   gene            complement(452569..452907)
FT                   /gene="fdx1"
FT                   /locus_tag="AXYL_00428"
FT   CDS_pept        complement(452569..452907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx1"
FT                   /locus_tag="AXYL_00428"
FT                   /product="ferredoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13786"
FT                   /db_xref="GOA:E3HUG3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUG3"
FT                   /protein_id="ADP13786.1"
FT                   /translation="MPKITVLPHAELAPEGAELEVRAGTTICEALLANGIEIEHACDMS
FT                   AACTTCHCIVRKGFDSLNEANESEDDLLDRAWGLEAQSRLSCQAIVAEMDLTVAIPKYT
FT                   INHAKEEH"
FT   gene            453116..454945
FT                   /locus_tag="AXYL_00429"
FT   CDS_pept        453116..454945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00429"
FT                   /product="His Kinase A phosphoacceptor domain protein 1"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13787"
FT                   /db_xref="GOA:E3HUG4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUG4"
FT                   /protein_id="ADP13787.1"
FT                   /translation="MQPAIGPTSASTPPSSSYAARIRQVQVDALRRSFPFALAGSLISA
FT                   CFSAFALVGVLPLHEIMLWLGATLMVGVLRWAAVVAYDRRRADPAAAQRWVRRMLAGNL
FT                   CSGILWGLPLAYWTFFVPLEYQLFFIVILFGLGTGAIYSNYMLLPVMYAFEVPAFAPMF
FT                   IALAAQPSAIHLALVTGGLAYLIATLAFIHRMNRTHLDALRLGYENLALLEQVRQEKIA
FT                   AERSDLEKSRFLAAASHDLRQPVHAVNLFLGLLANEPLSRHGRYLVDNITSALSAMGHL
FT                   FDALLNLSRLDAGVIEPRFETFRMQPLLDQLKAEYAPQAGEKGMRLRVRPCAASVRSDP
FT                   VLLERMLRNLISNAIVHSDGGCVLVGCRRVGNRLRVEVWDNGSGIPKAEQERVFWEFHQ
FT                   LANPERDRSKGLGLGLAIVRRTARLLGHELALRSEAGRSTVFTVTVPASDPAAAGLSIG
FT                   DAGVRLPRGPATEDSLHGKLALLVDDDAQNLAGLSMLFESWGCRVIAATSGNALFERVL
FT                   PLAETPALIVTDYRLREHETGIHVIERLREEYNDPDLPALLVSGDTDPARLTEAAARGV
FT                   PLLHKPVQVQALREHVTSLLYARKAVPLTGDAE"
FT   gene            454942..455580
FT                   /locus_tag="AXYL_00430"
FT   CDS_pept        454942..455580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00430"
FT                   /product="bacterial regulatory protein, LuxR family protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13788"
FT                   /db_xref="GOA:E3HUG5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUG5"
FT                   /protein_id="ADP13788.1"
FT                   /translation="MTAVLLVDDHAMFREALVMALGQAMPGMTIHPAASGQEALDALDR
FT                   QTAIQHVIMDFYLPDMAGAELLKRLRQRRAQLRILVLSASQDPEDMRRALEAGAQGFLN
FT                   KSASCQELAAALEAVSEAQPAHRSVSSSALLAGGQDEAALLRALTPRQNEVLCLMCDGL
FT                   RNKEISERLNMTEKTVKTHVSAILGTLGVLNRTQATLVARRGGVFGKPV"
FT   gene            complement(455519..457690)
FT                   /gene="cvaB"
FT                   /locus_tag="AXYL_00431"
FT   CDS_pept        complement(455519..457690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvaB"
FT                   /locus_tag="AXYL_00431"
FT                   /product="colicin V processing peptidase"
FT                   /EC_number="3.4.22.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13789"
FT                   /db_xref="GOA:E3HUG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033838"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUG6"
FT                   /protein_id="ADP13789.1"
FT                   /translation="MLERLTLGVKRRVPRLLQTEAAECGLACVGMIAGYHGHQQSLATL
FT                   RGRFPVSLKGATLATLIHVASQLGLASRPVKVSLGALSKLKLPCILHWEFNHFVVLTAI
FT                   NGRSATLIDPASGTRRCSIGELSASFTGVALELWPTPDFTEARDYKRVRLRELTGRVSG
FT                   LGGAFSQVLLLALALEILTVVQPFFLQWVVDHVLNTGDRDLLTTLALAFGLLMIMKQLT
FT                   SVARSWMLMVLGTTLNLQWRTNVFTHLLRLPVGYFEKRHLGDVVSRFGAIDAIQRTVTT
FT                   SFLEAVLDGLVMLITLVLMFLYSPPLAWIAVGAMALYGLARWSGYAPLHYATEEHIVHA
FT                   AKEQSHFLETVRGVKAIKLFQHQDDRRSRWLSLLVNEINADLRVQKWTLFFRTFNGLLF
FT                   GLSSIAILWLGARLVLDGQFTVGALLAFIVYKTLFDQRVAALLDKLVEVKMLRLQGERL
FT                   ADIVRETPEPVDEMPRTQDAQERSPAIEVRNLRFRYGPQEPYVLDGVSFRIEPGESVAI
FT                   TGPSGGGKTTLINILLGILAPTDGEVLIDGVPARGAGAASLRRIAGTVLQDDVLFAGSI
FT                   GENISFFDPQYDSERASRCARIAAIHDDISAMPMGYNTLVGDMGTVLSGGQKQRVLLAR
FT                   ALYKQPAILFLDEATSHLDIERERIVNTAIARLNMTRVIVAHRPDTIAAAGREISLAAG
FT                   KVASDSGQRPKPASRTRRRAAPLASPAYD"
FT   gene            complement(457693..458976)
FT                   /locus_tag="AXYL_00432"
FT   CDS_pept        complement(457693..458976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00432"
FT                   /product="HlyD family secretion family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13790"
FT                   /db_xref="GOA:E3HUG7"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUG7"
FT                   /protein_id="ADP13790.1"
FT                   /translation="MLTTFSWAASNAVTLYRKKALAAQHSVGLGDIVLIRPVSFALVTA
FT                   VLAGFVLTICLFLAFGSYTKRATVSGQLAPDTGLIKLYVPQAGIVLESRVQEGQHVAAG
FT                   DVLYVVSGDQQSALGETQEAISGQIRQREESLRLARQKTVLLQQSEHDSQTAAIASLKA
FT                   QLAAMDNQIAGQRARIKLAEDSANRYRGLMEKGYLSAEEADQKRAELLEQRNQLQALLR
FT                   DRIGLATDLSNRQAALADLALRQQNQLAQLDRDMADIAVDLTRSEARRRILVSAPQAGF
FT                   VTAVAAAAGQAVDNKRPLATIVPDGARLQAELLAPSRAVGFVAPGDRVLMRFAAYPYQT
FT                   FGQQAGIVQTVTRSASPEWQLNEAAANNGVQEDMFRITVSLDAPARGPQGQTLALRPGM
FT                   RLEADILQQTRRLYQWAFDPAQRLSGKL"
FT   gene            complement(459083..459259)
FT                   /locus_tag="AXYL_00433"
FT   CDS_pept        complement(459083..459259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13791"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUG8"
FT                   /protein_id="ADP13791.1"
FT                   /translation="MEKTEQPDQRRDAEQQVRPLSAEETRAVSGGWGPNRTNITFAPQK
FT                   SGWPAGKTLYMPK"
FT   gene            459683..459862
FT                   /locus_tag="AXYL_00434"
FT   CDS_pept        459683..459862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13792"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUG9"
FT                   /protein_id="ADP13792.1"
FT                   /translation="MKKTEQAGQQGTVDQRIRPLNAKETHQVSGGALGKKPGIIGRPAA
FT                   LGSSKSVTKANRYQ"
FT   gene            complement(459919..460596)
FT                   /locus_tag="AXYL_00435"
FT   CDS_pept        complement(459919..460596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00435"
FT                   /product="prolyl oligopeptidase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13793"
FT                   /db_xref="GOA:E3HUH0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUH0"
FT                   /protein_id="ADP13793.1"
FT                   /translation="MPGVLFIHGWGGSQEFDLSRAKGIAALGCVCLTFDLRGHGGTRAQ
FT                   QLQVTRENNLRDVVAAYDRLSLHPSLDSGSIAVVGSSYGGYLAALLCTLRRVRWLALHV
FT                   PALYRDDEWLVPKNQLNRDTLRAYRSAYVPPEENRALKACTEFSGDVLLVEAENDIYIP
FT                   HSTIMSYRSAFRRSHSLTHRIIDGADHALTEKPAQRAYTSILVNWVTEMVTGARMGEGR
FT                   TSI"
FT   gene            complement(460664..461797)
FT                   /locus_tag="AXYL_00436"
FT   CDS_pept        complement(460664..461797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13794"
FT                   /db_xref="InterPro:IPR021519"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUH1"
FT                   /protein_id="ADP13794.1"
FT                   /translation="MTSATHPRTAGIVAAFPRRAHASEHEVASLDAQASRVAALLGRRY
FT                   VPDYRPSRQRGGPTPYYVPDRSLVGMARAAILGITGEADLYGGVAPHAFVATKSISHGL
FT                   VGPQARRPAGWAATLADALRGVVLEGYTAFCPEDALAAGQRLLERGPIRVKPVDATAGR
FT                   GQVVARDLDALRAALAEQSPRVMERLGLVLEEDLEEVDTYSVGWAKVGEIEIAYVGTQS
FT                   LTDDNQGRPVYGGSELRVARGSFDALRALDLGDDERRAIDLACRYDAAIWAAYPELIAS
FT                   RRNYDVAIGRTADGAARAGVLEQSWRAGGASLAELAAMQAFALSPALMEVRAETRERYG
FT                   AGEPLPIAQRLVFHGVDSAIGQISKSGGIVETEDGGA"
FT   gene            461991..462914
FT                   /locus_tag="AXYL_00437"
FT   CDS_pept        461991..462914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00437"
FT                   /product="Ku protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13795"
FT                   /db_xref="GOA:E3HUH2"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUH2"
FT                   /protein_id="ADP13795.1"
FT                   /translation="MATRTIWKGAISFGLVHIPVGLHTATTESGVDFDWLDRRSMDPVG
FT                   YKRINKRTGKEIESKDIVKGVEYEDGQYVIISPDEIADAYPRTTQTIEIQQFVEAAEVS
FT                   FVYLERPYYVAPINKGQKVYALLRDTLVQSGKIGIAKVVIQTKQHLAALIPMGDALVLN
FT                   LMRWGDDVKSVEGLDLPKAGAKSMSPSASELKMAKMLVEEMSAEWDPADYQDEFKAAIM
FT                   GLVEQKVKAGKTETVIEPQEETPAYADNVIDLTELLQRSLRGGTSKGRAKAEAKPAKKS
FT                   APRSAAVKKAPAKKAAKSARQAKKAA"
FT   gene            462917..465445
FT                   /gene="ligD1"
FT                   /locus_tag="AXYL_00438"
FT   CDS_pept        462917..465445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligD1"
FT                   /locus_tag="AXYL_00438"
FT                   /product="DNA ligase D 1"
FT                   /EC_number="6.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13796"
FT                   /db_xref="GOA:E3HUH3"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUH3"
FT                   /protein_id="ADP13796.1"
FT                   /translation="MADSLKKYREKRNFAVTPEPPEGGESGDAGLVFVIQKHWASHLHY
FT                   DFRLELDGAMKSWAVPKGPSFDPSVKRMAVQVEDHPIAYNQFEGTIPKGQYGAGKVIIW
FT                   DEGRWTPIGDPRKGYKAGHLKFTLEGVKLRGRWALIRMKGKESDRQPPWLLIKESDEYA
FT                   REDQDFSVVDEMPDSVVPLRAKKKAEAARSKPQARAAKAVEAVAALPGKAAVLPASLKP
FT                   QLATLVDGVPRGADDWSYEMKFDGYRILARLEDGSVKLYTRNGHDWTARMPRLAQELAA
FT                   LEIANAWIDGEIVVLTREGVPSFQALQNAFDAAGTADIVFYAFDLPYVAGRDLRDEPLS
FT                   LRRDLLRQVIARCKGKHVKFSEAFDKPPADLVASACKLGLEGIIGKRLSAPYVSRRTDD
FT                   WIKLKCTQRQEFVIVGYTEPKGSRKGFGALLLAVHEPDGALRYAGNVGTGFDDRTLLDL
FT                   HRKLASIEQKTSALTQGKPRALKQVHWVQPTLIGEVSFGEWTGDGHVRHSTFRGLRTDK
FT                   PPKKITREVAMPAEKLSPRNSTAKAKAGGAAKPSKGMKLSNPDRVIDPSSGATKLDLAR
FT                   YYGLVAPLMMEHLRGRPVSFVRAPAGIQGEHFFQRHSESPIPGVTALPERLYPGHPSLM
FT                   EISNVAAILAAAQLNVVEFHTWNALKTSIGKPDRMLFDLDPGEGVDWPTVQQGAELVRV
FT                   LLQELGLRGWLKTSGGKGLHVVVPIRKQYGWDAVKDFSEAMVRHLAQTLPKLFVAKSGP
FT                   KNRVGKIFADYLRNGFGATTVAAWSARARPGLGVSVPVRWDELDGLKGSAQWTIANIHT
FT                   RLDAGNEPWDDYAPQAIGRAMKQLGVELRS"
FT   gene            465622..466101
FT                   /locus_tag="AXYL_00439"
FT   CDS_pept        465622..466101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00439"
FT                   /product="alkylhydroperoxidase AhpD family core domain
FT                   protein 1"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13797"
FT                   /db_xref="GOA:E3HUH4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUH4"
FT                   /protein_id="ADP13797.1"
FT                   /translation="MSQRLNAYAQSPELFKKFVEFGMLLKSGAIEQPILRLVEIRASQI
FT                   NGCGFCLDMHVKDAKIHGEQELRLHHVAIWRESGEFSPRERACLAWTEALTTLGAQGVP
FT                   DDIYERVRSQLSEKEISDLSFAVMAINGWNRLNVGFRTVPGSADKAYGLDRAKFN"
FT   gene            466111..466866
FT                   /locus_tag="AXYL_00440"
FT   CDS_pept        466111..466866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00440"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13798"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUH5"
FT                   /protein_id="ADP13798.1"
FT                   /translation="MKILVIGGTGLIGSKLVKLLNERGHEAIAASPATGVNTMTGEGLD
FT                   AALAGVDTVVDVANSPSFEDRAVLEFFQTSGRNLLAAEARAGVRHHVALSVVGTQRLAE
FT                   SGYFRGKIAQEALIVAGGIPYTIVHSTQFFEFLGGIVQSGTEGTEVRLSPAFVQPIASD
FT                   DVALAMADATLAPPVNGIVEIAGPERVRLADLVQRYMAKIGDTRSVRADAGARYFGALL
FT                   EDETLVPGAGPRLGKIDFETWFSRSGARK"
FT   gene            466887..467381
FT                   /locus_tag="AXYL_00441"
FT   CDS_pept        466887..467381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00441"
FT                   /product="OsmC family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13799"
FT                   /db_xref="GOA:E3HUH6"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUH6"
FT                   /protein_id="ADP13799.1"
FT                   /translation="MSKLRPPPQSLLEKYRGGDFHPLYTTSVTVRGGEAAHGRASGMAI
FT                   SDDGELIVELRLPVELGGTGGGTNPEQLFAAGYAACFHGALAMLAERAGLAIPEASVTA
FT                   TISFGRDPVDGLFALTADVNIHLPGVPTPIAEELVRNTERLCPYSKMAQGGIHSVVALT
FT                   Q"
FT   gene            complement(467385..468389)
FT                   /locus_tag="AXYL_00442"
FT   CDS_pept        complement(467385..468389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00442"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 13"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13800"
FT                   /db_xref="GOA:E3HUH7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUH7"
FT                   /protein_id="ADP13800.1"
FT                   /translation="MPTSLPAPSVTPPANGPDSLADSFATSYAGVMAFMAVAVEGNFAK
FT                   AGDRLGIGRSAVSRSVQKLEDQLGTRLFVRTTRSTSLTPEGQRFYEQCHPGVERIIQAL
FT                   DDMRELREGPPSGLVRVCSTVGFGRKVVAPLLNDFRKANPNISVELLLDDGPTDFTTDR
FT                   VDVSFRNGRMEDSQVIAKKVIPMQMMLCASPDYAARHGLPLSVDELSRHGCVNFLLASG
FT                   RVYEWEFKVGGHLRKFAPPAMLTFNDADLVLQAVLDGHGIAQMAGYQVCEHLRAGTLVA
FT                   CLPQYAPDDRGHYLCFLSRQHLPARMRVFIDFMTERIRAQDLQIIDSLLLKQA"
FT   gene            complement(468531..468965)
FT                   /locus_tag="AXYL_00443"
FT   CDS_pept        complement(468531..468965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00443"
FT                   /product="cupin domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13801"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUH8"
FT                   /protein_id="ADP13801.1"
FT                   /translation="MSNLTKLTLSFIAAGALLGQPAHAASHHGAPAGKPADPIVTEVMN
FT                   KDLPDIPGRDAVMLVVDYPPGAADPLHRHDASAFVYVLEGSIVMQVKGGKEVTLTPGQT
FT                   FYEGPDDIHTVGRNASQTKPAKFVVVLIKKKGAPALIPIQ"
FT   gene            complement(469084..469962)
FT                   /locus_tag="AXYL_00444"
FT   CDS_pept        complement(469084..469962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00444"
FT                   /product="RNA polymerase sigma-70 factor, sigma-70 family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13802"
FT                   /db_xref="GOA:E3HUH9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUH9"
FT                   /protein_id="ADP13802.1"
FT                   /translation="MTGSVTLFDRHRPRLYAIAYRMLGSVAEAEDVVQDAWLRWHGADR
FT                   SSLENPEAWLVTVTTRLSIDSLRAAKAERENYVGVWLPEPMLMAAPSTPEQIHELADDV
FT                   SVAFLFMLERLSPDARAAFLMREVFDADYEDIAQTLDKTQAAVRQLVRRAKQQLRQGSP
FT                   REAVPRATLQRLLQAFADAMQRSDFHGLHALLSDDAELIGDGGAKVSAFASLVGGKRLA
FT                   QLFYAGKRRYRDALRTEVVQVNGQWTLLRFIDGNLESVQSYETDGKRLTRVLVQRNPDK
FT                   LARIAAALAQR"
FT   gene            complement(470108..471109)
FT                   /locus_tag="AXYL_00445"
FT   CDS_pept        complement(470108..471109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00445"
FT                   /product="membrane protein-like protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13803"
FT                   /db_xref="GOA:E3HUI0"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUI0"
FT                   /protein_id="ADP13803.1"
FT                   /translation="MHLGKSYRLGEFVIWTRRKIYVLLALSLAPALLYQVAGLKWLTLP
FT                   LSVVSLLGTATTFVVGFKNVQTYARTVEAQKIWMSIVSASRYWGVISRNYAGDAERGAA
FT                   LVQRHLAWLTALRYQLREPRVWETVASRPNAEYRKQYVIPERAEPLESALSRYLPAQDV
FT                   PVLMHADDRAAQLLAMQGRAARGLLDAGAITAAEYADLNSRIRELLDLQGQAERIKNFP
FT                   YPRQYAIINTLFVRAFCVALPFGLTGQFALLGQDAGGIMQGQMAWLAVPFSVIISWIYT
FT                   SLEQVGESTENPFEGSANDVPISRLSAMIERDLAQMAGDADLPALPVAMIAL"
FT   gene            471493..472326
FT                   /gene="cpo"
FT                   /locus_tag="AXYL_00446"
FT   CDS_pept        471493..472326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpo"
FT                   /locus_tag="AXYL_00446"
FT                   /product="non-heme chloroperoxidase"
FT                   /EC_number="1.11.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13804"
FT                   /db_xref="GOA:E3HUI1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUI1"
FT                   /protein_id="ADP13804.1"
FT                   /translation="MTSNTYITNDGTQIYYKDWGDGPVVTFSHGWPLNADAWDGQMHYL
FT                   ANNGFRVIAHDRRGHGRSSQPSSGNDMNGYADDLAQLIEALDLKHITMVGHSTGGGEVA
FT                   RYIGRHGSKRVARAVLIGAVPPVMLQSAANPEGLPLEVFDGIRAGVASDRSQFYKELAI
FT                   PFYGANRPDAKVSQGMLDQFWLWSMQSGQKNAYECVKAFSETDFTEDLKNIDVPTLFMH
FT                   GEDDQIVPVHDAAKKAARLVKNAKEIYYPGAPHGLTATMQDRINADLLAFIRATA"
FT   gene            472354..473253
FT                   /locus_tag="AXYL_00447"
FT   CDS_pept        472354..473253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00447"
FT                   /product="metallo-beta-lactamase superfamily protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13805"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR039344"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUI2"
FT                   /protein_id="ADP13805.1"
FT                   /translation="MFAIENAESIDLVPSRYAVQIGDIDALVVSDGVLPLPTSTMATNA
FT                   DPADLAAWLEHMFMPPDAFDWPLNVMVARSGDQTILIDAGLGGQFAGFPRAGMFPQRLE
FT                   SAGIALESVTDVIITHMHMDHVGGLLVPGVKERLRPDVRIHVCATEVAFWTSPDFSHTV
FT                   MPKPVPAVLKSTATSFYNEYRDQLRLFEDRHEVAPGVIVRMTGGHTPGHSVVDLVSGGE
FT                   RLTFAGDAMFPVAFDHPEWQNGFEHDPEESARVRIGLFQELARNRGLLVAAHLPFPSVG
FT                   RVAVDGDAFRWVPVIWDF"
FT   gene            473329..474078
FT                   /locus_tag="AXYL_00448"
FT   CDS_pept        473329..474078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00448"
FT                   /product="short chain dehydrogenase family protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13806"
FT                   /db_xref="GOA:E3HUI3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUI3"
FT                   /protein_id="ADP13806.1"
FT                   /translation="MGKLQGKTAVVTGGNSGIGYAAAEAFIAEGARVAILGRRRQAVDA
FT                   AVARLGAAAFGVVGDVADLATHAALAAEVRERFGAVDIYMANAGMNNIEPSAAVSVGSY
FT                   DAQFGTNTRAVFFGVTGVLPLMRDGGSIIVTSSIASAKVLENHAVYAGSKAAVEAFARA
FT                   WALEFKSRRIRVNVLSPGPTDTPILEKLGVAEAHRPAFEQGMASLIPLGRLAQSSELAR
FT                   AALFLASDDSSFITGVNLRVDGGIALT"
FT   gene            474806..475675
FT                   /locus_tag="AXYL_00449"
FT   CDS_pept        474806..475675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00449"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 14"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13807"
FT                   /db_xref="GOA:E3HUI4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUI4"
FT                   /protein_id="ADP13807.1"
FT                   /translation="MTLAAEELHASQAAVSARIAAFEEELGVRVFVREKGKQLSLTPVG
FT                   LEMLEPAEELLAHARAFTGRFATTDARLSQISIGLSGTVAQAILEPMVATLARQWPNVT
FT                   VHLQSLTSTDIRQQLLEGQLDIGLLLGSIEEPTVVNRKLLELEYSWVYSPSLMARDIEP
FT                   SLDRLKQLPLLCYPVDSLAYSAIATYFAAPQMQGFKLIVVRSFSVMLRLVRAGAGYAVL
FT                   PIELIRDELDSGKLLPIPFSRPFPNQTYFASYIDQPSIPLRAAMAECICEVAWQVSNGL
FT                   LKDPSLAE"
FT   gene            complement(475709..476668)
FT                   /locus_tag="AXYL_00450"
FT   CDS_pept        complement(475709..476668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00450"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   8"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13808"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUI5"
FT                   /protein_id="ADP13808.1"
FT                   /translation="MAGLLSVACALLPAARAAEPSDWPTRPVTLVVPFPPGGGNDAVAR
FT                   QIAGPTGQALGQPLVIDNRPGAGGTIGSAAVARARPDGHTLLLCSTSSLVVATALYPDL
FT                   PYRVDDLVPVVHIANTPMIWVADPGAPASSLKEFIAAAKQAPGKYSFASGGRNTMPHLA
FT                   GLAVKTRHGLDMLHVPYRGSTPAYGDLATGRVNLMMDSIVSALPFVESGRVKGLAVSMA
FT                   QRMPQLPSVPTLAEQGLDDLNFMGWVGICAPRDTPPEITAKVARSVQQALAEPGLLETL
FT                   ARQIVESVGAGPEAFARTIAHDALVWRQIIAASRAEQD"
FT   gene            complement(476885..477130)
FT                   /locus_tag="AXYL_00451"
FT   CDS_pept        complement(476885..477130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13809"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUI6"
FT                   /protein_id="ADP13809.1"
FT                   /translation="MSEAAHLVQYIVVPYRAAANGVAPGEIRPASSEFGAIRIANSMAS
FT                   KFAGVAAYEVLIDKETGDMESPRILMQIGTVPALDD"
FT   gene            477328..478452
FT                   /gene="gtdA1"
FT                   /locus_tag="AXYL_00452"
FT   CDS_pept        477328..478452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtdA1"
FT                   /locus_tag="AXYL_00452"
FT                   /product="gentisate 1,2-dioxygenase 1"
FT                   /EC_number="1.13.11.4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13810"
FT                   /db_xref="GOA:E3HUI7"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUI7"
FT                   /protein_id="ADP13810.1"
FT                   /translation="MEANRYDAYREETIGRANVADSPELIAYYQELARLETGALWTVAN
FT                   KIEPWAPRSASVPVVWRYQDLRGHVLRSSELVSPEEAGRRVIYLNNPGRRDVAAAVGWL
FT                   YSGLQVMKPGELASAHKHSHSALRFIMEGRGAFTVVDGHKMTLGANDFVLTPNGTWHEH
FT                   GVAEDGTTCIWQDGLDIPLVNAMEAGFYAVHPDLNQTVTYPVDDTTAAWANAALRPQVS
FT                   GWTKPYSPLFKYEWEPTYEALRRYARTTAGSPYDGILLEYVNPATGGPVMPTIGASMQL
FT                   LRPGEHTKAHRHTGSFIYQVAKGSGYSIIDGKRYDWTERDIFCVPSWAIHEHVNLSSND
FT                   DACLFSFNDLPVMRALALYREEAVKENDGHQVLI"
FT   gene            478541..479452
FT                   /locus_tag="AXYL_00453"
FT   CDS_pept        478541..479452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00453"
FT                   /product="fumarylacetoacetate (FAA) hydrolase family
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13811"
FT                   /db_xref="GOA:E3HUI8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E3HUI8"
FT                   /protein_id="ADP13811.1"
FT                   /translation="MRLVTFRAHPTAAARLGALAEGYVIDLALLGRAGGVDLPDDMLAF
FT                   IDLGPVAVAQASKLMEAYRGNWPVGSALPQENVKLLAPIPRPRKNIFGIGLNYVEHVAE
FT                   SSRTLDTSADLPKQPVIFSKPPTTVIGPGDAIEHNAKITQQLDWEVELAVIMGRRASRV
FT                   AEADALSYVFGYSVMLDMSARDCRRAGQWIYSKGQDTYAPFGPCIVTADEIPDPQVLDL
FT                   WLTVNGEKKQGSNTRHMLFKVPFLISDISAGITLEPGDIIATGTPEGVGAGRKPQEWLW
FT                   PGDVVVACVEGIGTLRHPVVAV"
FT   gene            479502..480686
FT                   /locus_tag="AXYL_00454"
FT   CDS_pept        479502..480686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00454"
FT                   /product="receptor family ligand binding region family
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13812"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVE7"
FT                   /protein_id="ADP13812.1"
FT                   /translation="MIKKQILGGALSVALGAAASMGAAQAAEPVKIGFIATLSTPAGYI
FT                   GEDERDAFNLAIKQGGGKLGGVPVQLVIEDDGLKPANAKQAADRLLQSGVKLYTGVNFS
FT                   NVLAAVVPSVVKSGAFYVSLNPGPSNFAGEKCDPNYFVASYQNDAFHTAGGVAANELGY
FT                   KKVVLLAPNYQAGRDAIEGFKRTYKGEVVAEIYTKLDQSDFSVELARLRSLAPDAIYQF
FT                   HPGGTGINFVKQYAAAGLNKSIPMLMPSFSMDARMIKATGDASAGAYITGIWSQDFDNA
FT                   QSKAFVQAFKEAYGRVPTDYAMQAYDTAQLIGAGLKATGGDLSKAAEFRAALRQPEFTS
FT                   LRGKFSMNTNQHPIQDLYLMRIEKGTDGSLSPHLVRKLVSDDKDAYAQFCKMPS"
FT   gene            480683..481597
FT                   /locus_tag="AXYL_00455"
FT   CDS_pept        480683..481597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00455"
FT                   /product="inner-membrane translocator 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13813"
FT                   /db_xref="GOA:E3HVE8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVE8"
FT                   /protein_id="ADP13813.1"
FT                   /translation="MTLLFEQLLNGLQFGAMLFMLAAGLTLIFGIMGVVNLTHGSFYMV
FT                   GAYCAAYAIGTTGSFLAGVLAALLGAGLYGISVEVLVIRKLYKRDHLYQVLATFGLLLF
FT                   SNEAVSLIFGRRPPLVGIPSFLEGAVTLAPGFQYPLIRLSFIAIGALVAVGLWWLVNRT
FT                   RIGMLIRAGADDREMVDALGIDIRKLYTLVFGLGALLCGLAGVMAAPLLAVEIGMGERI
FT                   LITTFVVIVIGGVGSVRGALAGALLVGMVDSLGRAFLPQLLSTMFSPATADPLAAGMAS
FT                   ASIYVLMAIVLIAKPGGLFPARG"
FT   gene            481600..482580
FT                   /locus_tag="AXYL_00456"
FT   CDS_pept        481600..482580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00456"
FT                   /product="inner-membrane translocator 5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13814"
FT                   /db_xref="GOA:E3HVE9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVE9"
FT                   /protein_id="ADP13814.1"
FT                   /translation="MAYTLTNRARWGLGGLVVLILLPAAALASGSPFLIGVVTRFLIYG
FT                   LAAVSLDLVIGYGAMVSFGHAMFFGLGGYAVGIIAFHTAEAGPIFGWAGSNAALVVWPI
FT                   ALIVCALAGWLFGYLALRTRGVQFIMITLAFGQMVYFVLVSLQFYGGDDGLMIPQRNEL
FT                   PGINLESPMVFYYVCLALLTLWTLLCIRVTNSRFGMVLQALRQSERRSINLGVAPTPYR
FT                   LSAFVLSAMGTGLAGVLWANYAGLVTPDMAAWTKSGELMAIVILGGVGTLLGPIAGAAV
FT                   FLGLEQMLSSLTEHWLLYMGPILVLVVLWGEKGLFGKLLETRHAD"
FT   gene            482570..483340
FT                   /locus_tag="AXYL_00457"
FT   CDS_pept        482570..483340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00457"
FT                   /product="ABC transporter family protein 6"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13815"
FT                   /db_xref="GOA:E3HVF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVF0"
FT                   /protein_id="ADP13815.1"
FT                   /translation="MPTDASASLLRLTQLRKAFDAVVATNGVDLDVRAGEIHAIIGPNG
FT                   AGKSTLIAQICGEIRPDSGTIHLDGQDVTALRAFERARLGLGRSFQITELCQEYTALEN
FT                   VILSRMLKSGRAFQAWSNPRHDAALKTEAMQWLTHVGLEDRRHVRSADLAHGEKRQLEL
FT                   AVALARAPRLLLLDEPMAGMGPEESARMTRLLQGMKGDYGILLVEHDMDAVFALADRIS
FT                   VLVYGRVVFSGSPEEVRRHPEVRAAYLGEEHVEG"
FT   gene            483327..484019
FT                   /locus_tag="AXYL_00458"
FT   CDS_pept        483327..484019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00458"
FT                   /product="ABC transporter family protein 7"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13816"
FT                   /db_xref="GOA:E3HVF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVF1"
FT                   /protein_id="ADP13816.1"
FT                   /translation="MLKVEGLTGGYGSSKVLFGMSFEASEGEVISLIGRNGMGKTTTIK
FT                   TLMGMLPATGGAVQFRGRTLGRAAPSSVARLGVGLVPEGRRVFGSLTVQENLVATSRAA
FT                   PGGWDLERVYTLFPRLKERRGQSSRTLSGGEQQMLVVGRALMTNPKLLILDEATEGLAP
FT                   LIRQEIWRCLRALKGEGQTILVIDKNLPEMATLVDRHYIVDKGRVAWSGQPAELSAQPE
FT                   LAQRYLGI"
FT   gene            484213..484926
FT                   /locus_tag="AXYL_00459"
FT   CDS_pept        484213..484926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00459"
FT                   /product="bacterial regulatory protein, GntR family protein
FT                   5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00459"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13817"
FT                   /db_xref="GOA:E3HVF2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVF2"
FT                   /protein_id="ADP13817.1"
FT                   /translation="MEEITLSEQVYRLLRRDIMRGAFAPGQSLRLELLKQRYGSSFSPI
FT                   REALNRLRSERMVISTTSRGFSIAPLSVEEMWDACETRILIDCDALRRSLANADDAWET
FT                   RLVGAYHALTLAAQRAEAAAQPSEELDELLEARHLEFHHALIGACRSHWLLDLSTQLYA
FT                   QTERYRRPARAGATAYGPERSVDDEHRQLLDAAISRDVEGSVAMLAAHYRKTAQFIERI
FT                   ISQPQSQPQSQARHA"
FT   gene            484919..485803
FT                   /locus_tag="AXYL_00460"
FT   CDS_pept        484919..485803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00460"
FT                   /product="alpha/beta hydrolase fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13818"
FT                   /db_xref="GOA:E3HVF3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVF3"
FT                   /protein_id="ADP13818.1"
FT                   /translation="MHNSHIDLFFPTIAEREVQYNARESVPDFDACVRRYAESSARVRT
FT                   RRPGVLDLHYGMGQDERLDLFLPAASQAPAPLFVFIHGGYWRAQRKEDAPVMAEAFNAA
FT                   GAAVATLEYTLVPEATLGEVVREVRSAVAWLYRNVAAYGVDPERIYVSGSSAGGHLAGM
FT                   LVAPGWPARYGVPDDVIKGTLALSGLFDLRPLCDVLPNTWLQLTPEQAAHQSPIFHLPE
FT                   RAGPMLLAVGGLETQGFKNQTAAYEAAWNAAGLASTRIPTPHCNHFDLVNELEDPDSDL
FT                   TRATLAMMGLGAR"
FT   gene            485835..486749
FT                   /locus_tag="AXYL_00461"
FT   CDS_pept        485835..486749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00461"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13819"
FT                   /db_xref="GOA:E3HVF4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVF4"
FT                   /protein_id="ADP13819.1"
FT                   /translation="MADLKLLEDLIALAQTGSFVRAAELRHVTHPAFGRRIRALEAWAG
FT                   APLIERQRLPVVLTAEGEALLKTATQVVEQMGQVRHRIRSFGAGGEAVLRIATGRSLAR
FT                   TLVADWIARLRHRTPKVLTEGTQVELSTGMMQDMAARLEQGRVDLLCCYEHPALSVQLS
FT                   PGRYRYMTLGTDKLVPVSQADSRGRPRYVLQEGGPSVPLITYAGGLAMERIVGDRLEAT
FT                   PYALAPFLRSDSLDAAHGAVAKGLGVAWLPWSMVAADCRRGALAALGGRSEEISFEVRL
FT                   YRSRARLADLAEAAWEATASRKA"
FT   gene            486900..487889
FT                   /locus_tag="AXYL_00462"
FT   CDS_pept        486900..487889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00462"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   9"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13820"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVF5"
FT                   /protein_id="ADP13820.1"
FT                   /translation="MKSVLHPLRATLAALCAVSALAAASSAHADYPERAISLVVGYPAG
FT                   GSVDLTARLFGEELAKRLGQSVVVENVGGAGGTIGAQRVARATPDGYTLLLGSTNEMVI
FT                   ASMINNAVKYDSVKDFAPLGVIASQPMLLAASKNSGVKTAAEYLQKLRASAPGSFNYGS
FT                   SGVGTTLHLAGEMINQSTGTRAEHVPYRGVAPLVTDLMSGQLDYGMLVLSSGLPQVRGD
FT                   KIVALGVTEKKRSPVAPDLPALAETPGFEGVDISVWFALYGPAGLPEPVAAKLRGALAD
FT                   TLKSEQFRAKMQEAGGVLSQPGLDPAAYQAEETKKYGALVKAAKIEAQ"
FT   gene            487939..488883
FT                   /locus_tag="AXYL_00463"
FT   CDS_pept        487939..488883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00463"
FT                   /product="succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13821"
FT                   /db_xref="GOA:E3HVF6"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVF6"
FT                   /protein_id="ADP13821.1"
FT                   /translation="MEFKLPVPDLSAERAGNTGTPGVWHFDSGLPGRALMLSALVHGNE
FT                   LCGAWALKDLLAAGLRPRRGSLTLAFCNLEAFDRFDHANHDASRFAAEDMNRVWSAERL
FT                   DHPTTPDRKRGAELRPWVERADWLLDLHSMHEPGAPLLLTGVLPRNIALARRLKAPQHV
FT                   IVDAGHKDGVRMRDFGQFGDPARADACALLIECGFHGELAARDVARDMVARMLVESGVA
FT                   DAADVLAGWLMPDAANQRVLEVTDAVVAPSMDLRFSEPWTGLETFEQAGSILGWADGQP
FT                   IVTPYDRCTLVMPSLRQLKPGVTVVRLARDYAG"
FT   gene            complement(488899..489420)
FT                   /locus_tag="AXYL_00464"
FT   CDS_pept        complement(488899..489420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00464"
FT                   /product="lipocalin-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13822"
FT                   /db_xref="GOA:E3HVF7"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVF7"
FT                   /protein_id="ADP13822.1"
FT                   /translation="MRRTATFLLALAASVAGIVHAAPPPMQTVESVDLKRYAGMWYEIA
FT                   NFPMFFQRDCVGDTTAEYTAHADGTVGVNNRCRTKDGDIDTASGTATVVEGSNNAKLEV
FT                   SFFKPFKGDYWVIGLDPEYRWSVVGTPDRKYLWILSRSPQLPKEELDKALDAAKAQGYQ
FT                   LDELRYTPQK"
FT   gene            complement(489501..491072)
FT                   /gene="gshA"
FT                   /locus_tag="AXYL_00465"
FT   CDS_pept        complement(489501..491072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="AXYL_00465"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13823"
FT                   /db_xref="GOA:E3HVF8"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVF8"
FT                   /protein_id="ADP13823.1"
FT                   /translation="MTDTAANRLSRLEANRSLLTQTLRGIEKEGLRVDEQGVLSRKPHP
FT                   AGLGSALTNEHVTTDYSESLLELITGTHKDVDSLLAELTNTHRHVYSVLDHELIWNQSM
FT                   PATLPSEADIPIAWYGKSNTGMLKHVYRRGLAVRYGKTMQCIAGVHYNFSLAEDLWSVL
FT                   DTQPGSIQDRRSRGYIGLIRNFTRYSWLLMYLFGAAPALSSDFLRGREHPLQKLGDSTL
FT                   YLPYATSLRMSDLGYQNKAQSQLKLCYNDLDTFLGRLYEAVTQPWPDYQKIGTHRDGEW
FT                   IQLNTNVLQIENEYYSSIRPKRATGRCERPITALAERGVQYVEVRCLDIDPDSPVGIDA
FT                   ATSRFVDAFLLFCTASDSPFFPANGYCQRSADNFSAVVKEGRKPGLMLDREGQSIGLAQ
FT                   WGHELLDQIAPYAALFDSALGGSAYAEALAAQRAKLDQPDSTPSARLLASLTESRLSFH
FT                   DYSLDLSRKHADALRAQALPADLAAAYEQAAAQSTAEQQRLEQSDTEDFDTYVARYHAA
FT                   LKAPRK"
FT   gene            complement(491105..491998)
FT                   /locus_tag="AXYL_00466"
FT   CDS_pept        complement(491105..491998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00466"
FT                   /product="alpha/beta hydrolase fold family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13824"
FT                   /db_xref="GOA:E3HVF9"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVF9"
FT                   /protein_id="ADP13824.1"
FT                   /translation="MTPAPDGTPLANYVWPAAPNVPPPIAGPGTPSIYLLHGLSEHAGR
FT                   YDRLARWLSARGWTVGAHDHRGHGRSGGRPATLSHEDDLVVDAVDRLRAWTAAHGRPPI
FT                   LLGHSLGALVAVRIALRRMVEIDGLVLSSPPFVVHVPPWVRRTLTWMSLHAPDLRVPHG
FT                   LAPARISHDPAVVKAYRSDPLVRRQMTGRLARFVDEGGRESLREAPLLACRTLLMVAGD
FT                   DSIVAAEGSRQFAQRAPAELLTLRWYDTAWHEIFNETAPIADPVYADLDEWLARTAQAL
FT                   SLSPVLTPSAQEAGTP"
FT   gene            492059..492598
FT                   /locus_tag="AXYL_00467"
FT   CDS_pept        492059..492598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13825"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVG0"
FT                   /protein_id="ADP13825.1"
FT                   /translation="MTISSLFRFMFKKAGAIAALALLITACSPSYNWREVDVADGHARA
FT                   AFPDRVTTDTRDLKLDAHTLRFTLASATVGEAVFAVGSAPLPPDIAKDPAAKQALGMAL
FT                   MHSLYANMQSPPPNEWPAYGQDIEVQGKAMGKPGWLRARVWVTDTMLIEAVAAGTVESL
FT                   PAERAQEFLRSVVIKP"
FT   gene            complement(492588..492839)
FT                   /locus_tag="AXYL_00468"
FT   CDS_pept        complement(492588..492839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00468"
FT                   /product="bacterial regulatory protein, LuxR family protein
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13826"
FT                   /db_xref="GOA:E3HVG1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVG1"
FT                   /protein_id="ADP13826.1"
FT                   /translation="MGSALNPSSSPAQAIKPLSERQASCLHWAALGKTSWETARILGVS
FT                   ESTVNFHLCNACEKLGVRGRRAAVVAALRLGLIEPVTA"
FT   gene            493021..493917
FT                   /locus_tag="AXYL_00469"
FT   CDS_pept        493021..493917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00469"
FT                   /product="membrane transport family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13827"
FT                   /db_xref="GOA:E3HVG2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVG2"
FT                   /protein_id="ADP13827.1"
FT                   /translation="MSAVVQFYFSSIVLMLPLLFCAGIGVYWGKRDLPFGGSFITMLVT
FT                   SVTTPALVFHTFVTTHLDDRALADVAVATLLALLLCALVCALLLKACKLPVRTLLPTAF
FT                   LPNAGNLGLPISQMAFGDAGLSVAVAFFAVSSFVMHTVAVRLLPGVNTKGSWKSPILLA
FT                   SLVAVALRLMHVPVPAWLIETSRMLGAVTVPLMLLSLGHALALIPSNGLRDGAKVAAIR
FT                   LAVGLGAGLAVVWALDLEPVLAGALSLQMAMPCAVVSYMYVKRYTTQGDTAAGAVLVST
FT                   VAFLLLAPVILWFSRGV"
FT   gene            complement(494009..495058)
FT                   /locus_tag="AXYL_00470"
FT   CDS_pept        complement(494009..495058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00470"
FT                   /product="malate/L-lactate dehydrogenase family protein 1"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13828"
FT                   /db_xref="GOA:E3HVG3"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVG3"
FT                   /protein_id="ADP13828.1"
FT                   /translation="MKPHGPAPALEEKDMAHIYLDELQLLAAAGLAAAGANAAMADSTA
FT                   RALVFAESQGLSSHGLSRVPFYAGHLRAGRAIGSAVPRIVHERGGAALIDAGSGLAFPA
FT                   CAMAIEQAGLRAREHGVAFIGVGNSHHFGEAGYHLEALADLGMVGLALSNSPAAMPAWG
FT                   GKRPLFGTNPIAAVFPRRGGARLVIDLSLSQVARGKLMIAARDNQPIPLGWALDADGQP
FT                   TTDPKAGLAGSMLPAGGVKGAMLALIVELLACALTGSHFGFETESFFVDAGGPARLGQA
FT                   FMAIDPGALAGNNTYLDRVEVLVDAMLEDDGVRLPGDRRRKLRDEALKHGVDIPDALMA
FT                   QLRAMSGTA"
FT   gene            complement(495055..495990)
FT                   /gene="serA1"
FT                   /locus_tag="AXYL_00471"
FT   CDS_pept        complement(495055..495990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA1"
FT                   /locus_tag="AXYL_00471"
FT                   /product="D-3-phosphoglycerate dehydrogenase 1"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13829"
FT                   /db_xref="GOA:E3HVG4"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVG4"
FT                   /protein_id="ADP13829.1"
FT                   /translation="MHILISEFMDAPAVDALRQRFNVRYAPELVEQRDALLAAVAEADG
FT                   LIVRNRSKVDAALLQAAPRLRTVGRLGVGLDNIDLEACAARGIAVIPATGANARAVAEY
FT                   VVGTVLMLLRGAYASTAEVAAGAWPRNALSQGLEAHGRTLGIVGFGGIGRLTARLAQGL
FT                   DMRVAGCDAALPPDHPAWRETGVTAMPLDELLAQADAVTLHLPLTPGTRRLLDAGRIAR
FT                   MRPGAALINTSRGGIVDEAALADALRTGHLRGAALDVFEQEPLPAGSPLADAPNLILTP
FT                   HIAGLTQEANTRVSDMVAAGVTMALTGGDR"
FT   gene            complement(496011..497021)
FT                   /locus_tag="AXYL_00472"
FT   CDS_pept        complement(496011..497021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00472"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   10"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13830"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVG5"
FT                   /protein_id="ADP13830.1"
FT                   /translation="MNSEHDYHPDAAQRRRLLAALGAAGLCALAPWQRALAQKAWPERP
FT                   INYVVPFPPGGLTDVAARQVGKALSDAERWNVVVENKPGGSANIGAAHVSHAAPDGYTW
FT                   LAITLSHAANATLFAGKAGYDLTRDLTPLAGLASSPIMVVVNAKSDIKSMADLAKAARS
FT                   KSLSAGSSGNGTPPHLTLALYQKLTGVPMMHIPYKGGAPSLTDLIGGHLDVVFSNYPES
FT                   LAHVKNGSLRALAITTRERGADLPDVPTVKEAGLPDLIVENFTGVLAPAGTPPELVQRI
FT                   GDAIVRQVSQPAIKQALLQLGFVPQPRGPAEFGAYLKSEVDRWAKIIRDANIQIA"
FT   gene            complement(497201..498376)
FT                   /locus_tag="AXYL_00473"
FT   CDS_pept        complement(497201..498376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00473"
FT                   /product="D-galactarate dehydratase/altronate hydrolase
FT                   family protein 1"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13831"
FT                   /db_xref="GOA:E3HVG6"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVG6"
FT                   /protein_id="ADP13831.1"
FT                   /translation="MSIINASTTFQGYRRDNGRVGVRNHVIVLPVDDISNAAAEAVANN
FT                   IKGTLALPHPYGRLQFGEDLELHFRTLIGTGCNPNVAAVVVIGIEEGWTKRVVDGIAAT
FT                   GKPVMGFSIELHGDHDTIMRASRCAKEFVHYATALTRSECPIADLWVSTKCGESDTTSG
FT                   CGANPTVGNAFDKLYGLGSTLVFGETSELTGGEHIVAERCANDAVRERFMFMFNRYQAM
FT                   IDRWKTSDLSESQPTKGNIAGGLTTIEEKALGNIQKIGKQCRVDGVIDKAEIPDGPGLW
FT                   FMDSSSAAAEMVTLCAASGYAVHFFPTGQGNVIGNPILPVIKICANPRTVRTMSEHIDV
FT                   DTSGLLQREIDLNQAGDKLLECMLATANGRWTAAEALGHREFVLTRIFESA"
FT   gene            complement(498404..498685)
FT                   /locus_tag="AXYL_00474"
FT   CDS_pept        complement(498404..498685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00474"
FT                   /product="D-galactarate dehydratase/altronate hydrolase
FT                   family protein 2"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13832"
FT                   /db_xref="GOA:E3HVG7"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVG7"
FT                   /protein_id="ADP13832.1"
FT                   /translation="MIHAVLHDAKDTVAVAVVEGVTAGTELNAWIMDEDKIIHVRASQD
FT                   IPIGHKVAMKDMAVGDTVFKYGVDIGRVVEPIQAGQHAHVHNIKTKRW"
FT   gene            498854..499609
FT                   /locus_tag="AXYL_00475"
FT   CDS_pept        498854..499609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00475"
FT                   /product="bacterial regulatory protein, GntR family protein
FT                   6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13833"
FT                   /db_xref="GOA:E3HVG8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVG8"
FT                   /protein_id="ADP13833.1"
FT                   /translation="MNTSLSSTVPLGSPLYAQVKQAVLAALAQGEWKQGEAIPPEKLLA
FT                   ERFGVSIGTLRKAIDELAAENILVRHQGRGTYVAVHTRNHHFFKFFRIVRQDGDKSYPA
FT                   TELLRFRRVRASAIAREKLNLAAGAMVFEFLNVLSLNGDVVMMDEICLPESCFPGMAEE
FT                   HLRDRASTLYALYQDVFGVNVIATDERLRTCVAERAQARALGVAEGSPLLEIRRVAFSY
FT                   KRQAVEWRISRVNTERYEYLGQEPWEAGA"
FT   gene            499768..501027
FT                   /gene="metX1"
FT                   /locus_tag="AXYL_00476"
FT   CDS_pept        499768..501027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX1"
FT                   /locus_tag="AXYL_00476"
FT                   /product="homoserine O-acetyltransferase 1"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13834"
FT                   /db_xref="GOA:E3HVG9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVG9"
FT                   /protein_id="ADP13834.1"
FT                   /translation="MTTPAQNLAGDSASGFIPAPVTTSDAVDPGSVGLVAPTFIRFDEP
FT                   LPLQSGQSLAAYELAVETYGTLNAQRSNAVLICHALNASHHVAGQAADNPSDVGWWDNM
FT                   VGPGKPVDTNIYFVIGVNNLGSCFGSTGPASINPESGKPWGAAFPVLTVEDWVRAQARV
FT                   ADHFGVDRFAAVMGGSLGGMQALSWAITLPDRVANCVVIASTPRLSAQNIGFNEVARRA
FT                   IITDPDFHGGDYYAQDTVPRRGLSVARMLGHITYLSDDDMAEKFGRAQRAPAENGAYHY
FT                   GYDVEFEVESYLRYQGEKFTRYFDANTYLLITRALDYFDPARTTGGDLARALAPAKADF
FT                   LLVSFSTDWRFPPERSREIVRALLKNASPVTYAEIDAPHGHDAFLLEDARYHAVVRGYY
FT                   ERIARELGLGDAAQTEGRAA"
FT   gene            501024..501638
FT                   /gene="metW"
FT                   /locus_tag="AXYL_00477"
FT   CDS_pept        501024..501638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="AXYL_00477"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13835"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVH0"
FT                   /protein_id="ADP13835.1"
FT                   /translation="MTPVTPRPALNVLRPDLARIASWIEPGSRVLDLGCGDGALLAHLR
FT                   DHRQVRGAGVELDDNCVIACVRRGVEVIQQNLEDGLALFDDKQFDTVVLSQTLQSMHRT
FT                   EHILREMARVARFGVVSFPNFGYWPHGWAILRGRMPVTGQMPYQWYNTPNIHLCTLRDF
FT                   EQLAGEVRLSILERATFNEGREVKLLPSWRSTLAVYRFASP"
FT   gene            501776..502990
FT                   /locus_tag="AXYL_00478"
FT   CDS_pept        501776..502990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00478"
FT                   /product="major facilitator superfamily protein 9"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13836"
FT                   /db_xref="GOA:E3HVH1"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVH1"
FT                   /protein_id="ADP13836.1"
FT                   /translation="MAPLLVLGFASGLPLALTSGTLQAWATVENVPLQQIGFLTLVGSA
FT                   YTLKFLWAPLVDRYAPPLLGRRRGWMLLTQLLLAVAIMAMGALSPSSTLQTLALLAVLV
FT                   AFLSATQDIAFDAYCTDVLRKDERGAGAAIKVMGYRLAMIVSGGLALILADQWIGWGNT
FT                   YVLMGGLMLLCALATFWAPEPEHVARPPRTLREAVGEPLREFFTRRGALAVLLLIVLYK
FT                   LGDAFAGALSTTFLIRGAGFTPTEVGTVNKVLGLAATIIGALAGGSLMSRWGLYRSLMA
FT                   FGLLQAVSNLAYWLIAVSPKNLWLMAAGVGIENLCGGLGTASFVGLLMALCRQQFSATQ
FT                   FALLSALSAVGRTYLAGPLTPPLVEAMGWPGFFLLTVVIALPGLVLLHLLRGTIETMEK
FT                   QGEEA"
FT   gene            complement(503062..503931)
FT                   /locus_tag="AXYL_00479"
FT   CDS_pept        complement(503062..503931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00479"
FT                   /product="universal stress family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13837"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVH2"
FT                   /protein_id="ADP13837.1"
FT                   /translation="MTQQTGPILLATDLSARGDRALDRALQLAKELGTKLIVLHVMESH
FT                   ATPARLTTPVWRRLSTDHKALAERELAEDLAAADVPTEVVVVSGDPLVRIMETADSYGC
FT                   SLIVTGTARDETLGRLLLGTTVEKLARQARQPVLVVKTRPRRPYRDVLVATDFSAGSRQ
FT                   ALRAALQLVPNADLTLFHSYDIPFQGKKAPEDAITRSFYHAAEQSAQEFIAETPELAQV
FT                   AAPKVVLECGQPETVLSEYSFNHRSDLVVTGTHGRTGILRTAIGSVAERLLESLPSDVL
FT                   IVRLLGEE"
FT   gene            504076..504792
FT                   /locus_tag="AXYL_00480"
FT   CDS_pept        504076..504792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13838"
FT                   /db_xref="GOA:E3HVH3"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVH3"
FT                   /protein_id="ADP13838.1"
FT                   /translation="MARMQAMAAAACRLNTMGASPTFPRPMFPDLSPTLLHTLYLVAIV
FT                   AEAMTAALSAGRRDMDWMGVCIIACVTALGGGSLRDVLLGHYPLTWVVHPEYLWMTAGA
FT                   AIITALIAPVMRRLRSVFLLADALGLVAFTVIGCQVAQVMQLPVTVVLISGMITGCAGG
FT                   VLRDVLCNEVPLLFRKELYASVSFVTGGLYLGSQALGLSANAAVPIALAAGLAVRLLAL
FT                   RFNWQMPKFVYRDDWD"
FT   gene            504904..505605
FT                   /locus_tag="AXYL_00481"
FT   CDS_pept        504904..505605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00481"
FT                   /product="bacterial regulatory protein, GntR family protein
FT                   7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13839"
FT                   /db_xref="GOA:E3HVH4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVH4"
FT                   /protein_id="ADP13839.1"
FT                   /translation="MDIKAPATIPYFLQEQIRELIVDGTIRPGQPLREQELEQRFGTSR
FT                   SPIREALRLLELSGLVTHIQRKGFRVTLYTEAQIRHLYLLRAELEAYCLRQAAEVDDLA
FT                   PLLAEQRGHDAAIAAALAAGDAQAAIGAACEFYLAAARSTGNTPLASMLSKLYEQIEPL
FT                   RYLLARQAMPFSGIQVCTRGVIEALAVRDVERAIDMTRSYLADVLPGVLEAYRHAAQQD
FT                   GEEPAPRYGRA"
FT   gene            complement(505661..506428)
FT                   /locus_tag="AXYL_00482"
FT   CDS_pept        complement(505661..506428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13840"
FT                   /db_xref="GOA:E3HVH5"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVH5"
FT                   /protein_id="ADP13840.1"
FT                   /translation="MTTRIDMNCDMGESYGAWTMGNDAAVLQFVSSANIACGFHGGDPA
FT                   TMRKTVAAALARGVALGAHPSLQDLAGFGRRVIQISPDEAYDIVVYQIGALAGVAASQG
FT                   ARLHHVKAHGALYNMAAKDEGLARAICQAVKDVDATLILYGLAGSKLIDAARAIGLAAA
FT                   NEVFADRSYQDDGSLTPRSRAGAMIEDLDQAVAQVVRMVREGKVRSVDGKDVPVQADTL
FT                   CIHGDQPNALIFADGIRKALEQAGIEVRTPPRA"
FT   gene            complement(506442..507437)
FT                   /locus_tag="AXYL_00483"
FT   CDS_pept        complement(506442..507437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00483"
FT                   /product="biotin-dependent carboxylase uncharacterized
FT                   domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13841"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVH6"
FT                   /protein_id="ADP13841.1"
FT                   /translation="MSLTVIKPGMLSSFQDRGREGYQHQGIPAAGAMDERAHRLANALA
FT                   GNQDEHATLEMTLTGPTLRFDAAACFALAGADLGATLNGQDIPVHRPLVARAGDTLAFG
FT                   ARPAVGVRGYLALHGGFALPRVMGSESTYLRSGFGGFQGRALAKGDQVPLHAPLAASRD
FT                   LDALQEALWNQRVYLPAALGAKRREFIRFLPGMHWEEFSGATRQAFGGGAEFRISPQSD
FT                   RMGYRLLGPALSMSQPRQMLSEAACFGTVQVPSGGEAIILMADRQTTGGYPKIAQIATV
FT                   DLPVLAQCAPGQTLRFQLIELEEAQRLDGERERAFTQLQDALTPLRALLA"
FT   gene            complement(507434..508165)
FT                   /locus_tag="AXYL_00484"
FT   CDS_pept        complement(507434..508165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00484"
FT                   /product="allophanate hydrolase subunit 1 family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13842"
FT                   /db_xref="GOA:E3HVH7"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVH7"
FT                   /protein_id="ADP13842.1"
FT                   /translation="MNAISEPPSPAETSWRILPQGDRCLIISFGDQIDAAVGRTCLAAA
FT                   GKLRDARLPGVTDVVPSFVAVAVHYRPGASGGPTYTQLAERIGQLLSAGIAADTLGGRE
FT                   IDIPVCYGGEHGPDLAEVAEAAGLTPEGVIQLHSQPRSMVFMLGFAPGHAYLGVHDEKL
FT                   NIPRRASPRTAVPAGAVAVANRQTVIYPNRLPGGWNIIGATPLTMFDPAREPAALLQPG
FT                   DSVRFVPISSEEFDRIRGARP"
FT   gene            complement(508190..508621)
FT                   /locus_tag="AXYL_00485"
FT   CDS_pept        complement(508190..508621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00485"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13843"
FT                   /db_xref="GOA:E3HVH8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVH8"
FT                   /protein_id="ADP13843.1"
FT                   /translation="MTAQTNLPPFHLAFPVRDLAEARAFYGEKLGCPEGRSSPEWIDFN
FT                   FYGHQIVAHLAPSECGHKATSAVDSHNVPVRHFGAVLSMEQWEAMAKRLTDAGTEFVIE
FT                   PYIRFKGEVGEQATMFFLDPSGNALEFKAFKNMDSLFAK"
FT   gene            508766..509662
FT                   /locus_tag="AXYL_00486"
FT   CDS_pept        508766..509662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00486"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 16"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13844"
FT                   /db_xref="GOA:E3HVH9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVH9"
FT                   /protein_id="ADP13844.1"
FT                   /translation="MIVIKEFKTFLAVARDGTFTGAGAQLGLTQSAVSAQIKRLEEYLG
FT                   VALFDRSARAAVLNLHGREMLPQAEELVAMAERMAAAAGAGHVSGSLRIGAIASVQQHL
FT                   LAQALGEFRAGYPDVRVRIVPGVSLSLLGQVDAGEVDMALLIRPPFALPPELGWQPLLR
FT                   EEMVLAMPESMARAPWRELLATQPFIRYDRASFGGRGVDLFLKKQRITVHEAVELDEIE
FT                   AIANLVRHGLGVALLPRLLGLDLAGLRLVSLDEAAFHREIGIIGRLPFDAASVRGKMAE
FT                   CLVRAASAADGAHRPAR"
FT   gene            complement(509659..510804)
FT                   /locus_tag="AXYL_00487"
FT   CDS_pept        complement(509659..510804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00487"
FT                   /product="PepSY-associated TM helix family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13845"
FT                   /db_xref="GOA:E3HVI0"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVI0"
FT                   /protein_id="ADP13845.1"
FT                   /translation="MRLLAGSASPARAVRSKTWYLVHKWTSLVCTLFMLVVCVSGLPLI
FT                   FHDEIVEWLDAPPPWPSVAPDPSAPALDGLIAQALHHHPAHRIVEVEVAARSPRVILAL
FT                   APGDQAPSGTSSIQLHYDARSGLLQQSVDSADEGLGTRAMTIMTRLHIDLYALLPGQLF
FT                   LGFMALLFSVAVISGAVLYHPYMKKTPFGTVRATRAKRLKWLDLHNLLGIVTLVWALMM
FT                   GVTGAIHELAVPLFRYWLSHDVQAAVATTDGHPPAGPSQLASAQQAYATARAAVPGRVV
FT                   ESLRFPDAGLGLPQHYLLWAKGETPLAAHLFDGVLVDARTGQLTAVLEMPWYLRVLQFS
FT                   RPLHYGDTAGLPLKLIWAALDLITIVVLGSGLYLWRKRKKN"
FT   gene            complement(510804..513254)
FT                   /locus_tag="AXYL_00488"
FT   CDS_pept        complement(510804..513254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00488"
FT                   /product="TonB-dependent siderophore receptor family
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13846"
FT                   /db_xref="GOA:E3HVI1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVI1"
FT                   /protein_id="ADP13846.1"
FT                   /translation="MRRLPPPAYPVSSLARLPRPAAVARKALLGAILMTGAGVGTVHAQ
FT                   AAGPAAASPSVRAYDVPAGPLAGALSRYADQANILLSVPAAMTAGKTSPGVRGTHTVDG
FT                   GFRQLLNGTGLEAVRQADGGYSLRPAPVSAETTLPAVLVTGSATAAYNEPYPGGEVARG
FT                   AKIGLLGDRDFLDTPFSVTSYTSKLIEDQQAQNLGDVLLNDPSVRNTYSRGAGRDEFNV
FT                   RGFTLFNYDVAYNGLYGISPRNSTSLIGIERVEVLRGPNALLNGMAPYGSVGGSINLVP
FT                   KRADAEPLNRVTLSYLENSQFGLQADIARRFGEDQRTGVRLNVLRSGGDMNISGAGEDM
FT                   GAISLGLDYRGNRFRIEGDINYQNRVTDARSGLLFPPPSGEDIGHAPDPKRNFFPDWTY
FT                   WKAKEWTGDVRAEYDLSDDWTVYGALGARKHDFESLQTTWLMLDSAGMIGSVPARLNER
FT                   LLSKTGEVGIRGRFNTGPIKHEPVLSASFLDIDYSSARVRSTTTVFSDLYDPADLAKPN
FT                   IPKPTDLGKTSETRLYSVALADTLSAMDGAVQLTGGLRQQRVQSVNYNPATGERVSDYG
FT                   KSALTPAFALTVRPTTQLALYGNYIEGLSQGGTAPAEAVNAGETFKPGVSKQYEVGAKY
FT                   DFGTVATTLSAFQIEQPSAYLDPVTLRYQASGRQRNRGVEFLIQGEPARHVRLLGGVAY
FT                   TAGVLTKTEGGVNDGNVAPAVPRWQFNASAEWDTPFAQGLTLMARVLRTSTQYVDAANT
FT                   QQLPAWTRFDVGARYAMNINRTPVTLRATVENVFNKHYWLSAAREGLTVAAPRTLLLSV
FT                   TAEF"
FT   gene            complement(513446..514459)
FT                   /locus_tag="AXYL_00489"
FT   CDS_pept        complement(513446..514459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00489"
FT                   /product="FecR family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13847"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVI2"
FT                   /protein_id="ADP13847.1"
FT                   /translation="MPAPPRPVLADGPLPVQADYESLKAAAEWYAVLQDAEAGSRQHVD
FT                   WQRWLDARPEHHRAWAHVMAVSRRFALLRNDGEREAAEKAVQVASRRPSSRRRAVGHVL
FT                   ALGGAGILGWLAWRHTPLPAIVTAWRSDYATGVGEQRNIVLADDTRVWLNTRSAINVDF
FT                   NQDRRLLTLADGEILVETGQDTQRRPFFVDTRYGRAQALGTRFTVRQTDEDVLLAVYDG
FT                   QVGIQNLAGRNALVRAGEQRRYTGDDISAAAPADPAREAWSRGVILAENLSLADLIAEL
FT                   GRYHLGHVGVDPRIAGLRVVGRYPANDLDRTLAMLARDLPIRIQRTLPWWVTLAPR"
FT   gene            complement(514462..515007)
FT                   /locus_tag="AXYL_00490"
FT   CDS_pept        complement(514462..515007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00490"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13848"
FT                   /db_xref="GOA:E3HVI3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVI3"
FT                   /protein_id="ADP13848.1"
FT                   /translation="MSAADLPVHQDLHALYSDHHGWLLGWLRRKLGNAADAADLAHDAF
FT                   LRLIIRPAPDGFASAGAARAYLRAMAQGLCTDLWRRREVEQAWLESLAAQPMAHAPSPE
FT                   HQSLVIETLMEVGEWLGRLPEKVRTAFIQAQIHGLSTREIADHMGVSMRMVQKYLAQAM
FT                   LHLALIDAGLAASGIRRP"
FT   gene            complement(515183..516382)
FT                   /gene="serA2"
FT                   /locus_tag="AXYL_00491"
FT   CDS_pept        complement(515183..516382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA2"
FT                   /locus_tag="AXYL_00491"
FT                   /product="D-3-phosphoglycerate dehydrogenase 2"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13849"
FT                   /db_xref="GOA:E3HVI4"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029015"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVI4"
FT                   /protein_id="ADP13849.1"
FT                   /translation="MAQIVLFENIHPSARAVFEAAGYSDIVTHAASLPASQLSDALRGA
FT                   QVAGIRSRTHLDAALLSGNLDLRVVGCFCIGTNQVDLDAAMQRGIPVFNAPFSNTRSVA
FT                   ELVLGEAILLLRRIPEKNARVHQGHWDKSASGAFETRGKTLGIVGYGNIGSQISTLAES
FT                   LGMRVIYHDVEAKLPLGNARPAATLNDLLEQADVVTLHVPGGKTTEKIMNAETIGRMRR
FT                   GAILINASRGTVVDIDALHAALKSGHLAGAALDVFPTEPKGADEPLASPLIGLPNVILT
FT                   PHIGGSTQESQENIGREVAEKLVRFLQAGTTKGAVNFPELPYLEPAGGTRILHVHRNAP
FT                   GALGTLDNLMAQHGLNIVSQTLQTRGQIGYVITDVEGEVNDIVMTTLRDHPITVRCDRL
FT                   "
FT   gene            complement(516553..517011)
FT                   /locus_tag="AXYL_00492"
FT   CDS_pept        complement(516553..517011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13850"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVI5"
FT                   /protein_id="ADP13850.1"
FT                   /translation="MNLSRLTRRLALAAALCAPAFATAQTPVKVEVWKTPTCGCCEDWV
FT                   KHMRDSGFAVTTHDVQDTGPIRRNAGMANYGSCHTAAVEGYAIEGHVPASDVRRLLLEK
FT                   PDAAGLAAPGMPLGSPGMDGPEYGGRKTPHDVVLVDKQGGAKVFQAYR"
FT   gene            complement(517087..518487)
FT                   /locus_tag="AXYL_00493"
FT   CDS_pept        complement(517087..518487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00493"
FT                   /product="heavy metal sensor kinase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13851"
FT                   /db_xref="GOA:E3HVI6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVI6"
FT                   /protein_id="ADP13851.1"
FT                   /translation="MNPLRVRSMQARLTLLLGAIALLVSSLAGATLFWALKREVERQEI
FT                   TEVSGKLELIDHLIDMQNNARGLNDLAATFDEMRTGQGQLGIWIVDAHGRSVYGGPAPE
FT                   TLATSDGRQVVLQTADGGRMRGLRVAMNDRILPGAQLTVAVSTRTSSQFLYAYGTALVL
FT                   ICALWVGATVVLAAWAVRRSMAPARRLSEQAASIQPDNLARRLPLEDTDRELHDLVRSF
FT                   NRTLERLQAAYQQMEGFNADVAHELRTPLATLINGTQVMLSSPRDAAELRDALESNLEE
FT                   LEDLKTLVNDMLFLARADRGERAADLAPVSLAAEARRVAEYYEAMLEESGVHLRCVGDA
FT                   TVAANAGLVRRALANLISNAIKATPRGGEIVLACSASPAGARLEVRNPGAPIPSADLPR
FT                   IFDRFFRSTHARTPRSEGHGLGLAIVRAIARMHGGEVDAASGAHGTVVGITLRAPDGHA
FT                   SSANITKT"
FT   gene            complement(518484..519173)
FT                   /gene="irlR1"
FT                   /locus_tag="AXYL_00494"
FT   CDS_pept        complement(518484..519173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irlR1"
FT                   /locus_tag="AXYL_00494"
FT                   /product="transcriptional activator protein IrlR 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13852"
FT                   /db_xref="GOA:E3HVI7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVI7"
FT                   /protein_id="ADP13852.1"
FT                   /translation="MRILVIEDEPKLADYLKKGLSEQSHVVDLARDGVDGLHLALEGVY
FT                   DLIVLDVMLPGVDGFGVLAAVREQKDTPILMLTARDAVEDRVRGLEGGADDYLVKPFAF
FT                   SELLARVQALLRRGRSQEPTLLRLADLELDLARRRAQRGGRRLDLTAKEFNLLALLLRR
FT                   QGQVLSRTTLAEQVWDMNFDSDTNVIDVAVRRLRSKLDDPYDTKLLHTVRGMGYVLESR
FT                   PAHGRPA"
FT   gene            complement(519247..520554)
FT                   /gene="phoR"
FT                   /locus_tag="AXYL_00495"
FT   CDS_pept        complement(519247..520554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="AXYL_00495"
FT                   /product="phosphate regulon sensor kinase PhoR"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13853"
FT                   /db_xref="GOA:E3HVI8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVI8"
FT                   /protein_id="ADP13853.1"
FT                   /translation="MIWLRTLFLVALWAVAALLAQWLIGDPAGWILFSVALAAMLLWRS
FT                   WRLHLVSHWANHPDTSPPASVGPWDDILAPLYRYTRARARELNETQNTMQGMLAAAQAL
FT                   PDGAVTLNEDFQIDWCNRMARQHLGLRLPADRGHNLLNLLRAPEFVEYAHRPSWPDPIL
FT                   VRLGQQGQERLMMMQLTAYASNQRLLITRDVTQIERLETTRRDFVANVSHELRTPLTVL
FT                   AGFLETLRDMPADALPAEQREQYIDMMHEQAQRMQAIVEDLLTLSTLESSPGSDPRAVN
FT                   MGALLQKARQQIEALSGGRHVLEWHIDESLDVLGAETELTSALSNLLTNAVRYTPDGGT
FT                   ITVRWEREEDGGARYSVQDTGIGIPARHLPRLTERFYRVDRGRSRAVGGTGLGLAITKH
FT                   IAMRHDAELLITSEPGKGSVFALRFPPDRIAIDSPA"
FT   gene            complement(520567..521265)
FT                   /gene="phoB"
FT                   /locus_tag="AXYL_00496"
FT   CDS_pept        complement(520567..521265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="AXYL_00496"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13854"
FT                   /db_xref="GOA:E3HVI9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVI9"
FT                   /protein_id="ADP13854.1"
FT                   /translation="MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDADQAQTLIRAE
FT                   LPDLILLDWMLPGTSGLAMARKLRNDERTRAVPVIMLTAKGSEQDKVDGLEAGADDYIT
FT                   KPFSPKELMARIKAVLRRRAPQLTDDVIDVGGLKLDPVTHRLSGNSQSLQIGPTEFRLL
FT                   HFFMTHPERVFSRSQLLDQVWGDHVFVEERTVDVHIRRLRKALEPSGHDAHVETVRGSG
FT                   YRFTAQLPTR"
FT   gene            521427..522203
FT                   /gene="ubiE"
FT                   /locus_tag="AXYL_00497"
FT   CDS_pept        521427..522203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="AXYL_00497"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13855"
FT                   /db_xref="GOA:E3HVJ0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVJ0"
FT                   /protein_id="ADP13855.1"
FT                   /translation="MQNPSESQHSADSASQSTHFGFQTVPEGEKARKVAEVFHSVAQRY
FT                   DVMNDFMSAGLHRVWKAFTIGRAAIRPGMKVLDIAGGTGDLAKAFAKRAGPTGEVWLTD
FT                   INDSMLRVGRDRLTDAGLLVPTAVCDAERLPFPTGHFDRVSVAFGLRNMTHKDRALAEM
FT                   TRVLKPGGKLLVLEFSRVAKPLAPAYDWYSFNVLPWLGKKVAKDEASYRYLAESIRMHP
FT                   DQETLADMLRTAGLDRVQYFNLTAGIAALHEGVKLG"
FT   gene            522383..523387
FT                   /locus_tag="AXYL_00498"
FT   CDS_pept        522383..523387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00498"
FT                   /product="Tim44-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13856"
FT                   /db_xref="GOA:E3HVJ1"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVJ1"
FT                   /protein_id="ADP13856.1"
FT                   /translation="MSKFCLSRFVAAALIAISGAALVTASFDAEARRAGGGSSVGRQSS
FT                   NVTQQRQATTPPAAANNTAGATAAPAAAGAATAGAAGAAAKSGASRWLGPIAGIAAGLG
FT                   IAALLSSMGLSGAFAEFLGSALLIAAVVFAVMFIIRRLRGAGPRTATQGAFNGSNNTPG
FT                   QQQQPMWRESLKPAAPAAAAAVAAPVAAAAPAAMPKAGDDNNWFVPGDFDTPNFLKQAK
FT                   DQFVRIQAVWDSGSTDGLREFLTDDLITELKPQLAERGAAPNKTEVVLLNAEMLGIETV
FT                   SDGHLASVRFSGMLREAPGAEAFRFEEVWNLFKPANGGWLLAGIQQIPVDLAS"
FT   gene            523573..524211
FT                   /locus_tag="AXYL_00499"
FT   CDS_pept        523573..524211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13857"
FT                   /db_xref="GOA:E3HVJ2"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVJ2"
FT                   /protein_id="ADP13857.1"
FT                   /translation="MLPFPFLPTPSRLAVSALNALLRREDWARERLARHAGKTVRFALG
FT                   GFSLGLTIDSEGLAAQADAAVVPDVTLTVAPEKLPLPRLGADRETPDFAEATHISGDAA
FT                   LAQVVADLSKQLRWDPEDALARVVGDIAALRLVGGARAAAGGARTAGLRLAENVSEYLS
FT                   EESGMLASRPALEQWRLDLAELNARADALARSAAALQTRLASASAKRGV"
FT   gene            524215..525768
FT                   /gene="ubiB"
FT                   /locus_tag="AXYL_00500"
FT   CDS_pept        524215..525768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="AXYL_00500"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13858"
FT                   /db_xref="GOA:E3HVJ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVJ3"
FT                   /protein_id="ADP13858.1"
FT                   /translation="MFPLLRLFRIILVSLRYGLDELVLSSLNHPLATCLLRVIRLGTRP
FT                   RKPRGLRLRLALESLGPIFVKFGQVLSTRRDLIPADIADELALLQDRVPPFPSAQAAAC
FT                   IETALGAPPEKLFAQFEVDPVASASIAQVHFAVLHDGREVAVKVLRPGMLSIIEKDLSL
FT                   LKVVARIIERLGADGRRLKPREVVAEFDKYLHDELDLVREASNCSQLRRNFGPESGRGD
FT                   MLIVPEVIWEYTASTVFTMQRMYGMPVGQVERMRQAGIDIPTLARTGVEIFFTQVFTDG
FT                   FFHADMHPGNIYVSDRPDTLGSYIALDFGIVGSLSEFDKNYLAQNFLAFFHRDYRRVAQ
FT                   LHIESGWVPPDTREEELEGAVRAVCEPYFDRPLSEISLGQVLLRLFQTSRRFNVEIQPQ
FT                   LVLLQKTLLNVEGLGRQLDPNLDLWKTAKPYLERWMRQRVGFKGLRQSLEKEAAQWSQM
FT                   LPALPRLVHDHLSRPNVSPALLAEMIQLRRAQEQNNRLVAALVGVAAVAIGVALWALTR
FT                   "
FT   gene            525954..526832
FT                   /locus_tag="AXYL_00501"
FT   CDS_pept        525954..526832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13859"
FT                   /db_xref="GOA:E3HVJ4"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVJ4"
FT                   /protein_id="ADP13859.1"
FT                   /translation="MLYPELFKTMEAVRWNMAHDIPWGDFDRSKLSDEQAHTIKMNAIT
FT                   EWAALPATEMFLRDNRGDSDFCAFMSVWFFEEQKHSLVLIEYLRRFCPDLVPTEEELHN
FT                   VRFEFDAAPELETLMLHFCGEVRLNHWYRRAAEWHTEPVIKAIYKTVAQDEARHAGAYL
FT                   QYMRRALHDRGQDTSEQARLAFSKIGVLMASAGRTQQALHPTNLHVNKDLFPNDTVQSR
FT                   LPEPGWLEHWLDTQIRFDGEWEQKVATRILHILSKLMDRSFETVKDLNRYRKEMTALIV
FT                   PKEKQIILGGA"
FT   gene            526855..527343
FT                   /locus_tag="AXYL_00502"
FT   CDS_pept        526855..527343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00502"
FT                   /product="D-beta-D-heptose 1-phosphate adenosyltransferase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13860"
FT                   /db_xref="GOA:E3HVJ5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVJ5"
FT                   /protein_id="ADP13860.1"
FT                   /translation="MPAARFESKVLSRDECVAAVAAGRLPRPLVFTNGVFDILHRGHAT
FT                   YLDQAAQLGATLVVAVNTDESVRRLGKGAERPLNRMEDRAALLAALGCVTVVTSFHEDT
FT                   PEALIGQLKPDLIVKGGDYDMEKLPETALVKSWGGRAVAIPFEFERSTTALVKKIQSQ"
FT   gene            complement(527365..528696)
FT                   /locus_tag="AXYL_00503"
FT   CDS_pept        complement(527365..528696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00503"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13861"
FT                   /db_xref="GOA:E3HVJ6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVJ6"
FT                   /protein_id="ADP13861.1"
FT                   /translation="MRVRLLTALLVFTCAASVGPSLVRAQNLIQIWQSALGNDPIYAAA
FT                   RANYRAGLEKEPQARSLLLPLISAEAGGAYQETRSTRGLGVAYSGGRGVWDLSLTQPLF
FT                   DWGRWQNFEQSKLIVADVEVQLQQAYQDLLLRVADAYFNVLYAQDTLTATEAEKAAVAG
FT                   QLESAKRNFELGNATITDTYEAQSRYDLVVAQELRLQNDLEVRRDELAKIIGTAPGALA
FT                   ELPYGVQLPAPQPARVADWSNQAEASSLDVLRAQLLTRIAGREIQIAKSGHYPTLNLRA
FT                   SSGSASDAVMRNAAPGKPIDSTIGVVLSIPLYSGGGVSSQVTEKVQLEQKARHDYEAAR
FT                   RQAVQSARQYYTGVTSGLARIQALEAGEKSSRAAVEANRTGYEVGVRINLDVLNAQQQL
FT                   YATQRDLALARYSTVLTSLRLKATSGILAETDLEAINRLLREPR"
FT   gene            complement(528776..529456)
FT                   /gene="pcm1"
FT                   /locus_tag="AXYL_00504"
FT   CDS_pept        complement(528776..529456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm1"
FT                   /locus_tag="AXYL_00504"
FT                   /product="protein-L-isoaspartate O-methyltransferase 1"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13862"
FT                   /db_xref="GOA:E3HVJ7"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVJ7"
FT                   /protein_id="ADP13862.1"
FT                   /translation="MNASTLPDVEQARFNMVEQQIRPWDVLDANVLQALFDVRREQFVP
FT                   PALRALAFSDLELPLEINAVNTRQNMLAPKVEARLAQELLLTKSDCVLEIGTGSGYQAA
FT                   LLGYLAQQVTSVEIDSRLVTFAQQNLQMSNVTNVKVETGDARNGWGSTEYDAILVTGSV
FT                   PTVPDALKYQLRVGGRLVVVVGQAPVMTACRITRTTAASFETVNLFETVIKPLRGVAVS
FT                   QFKF"
FT   gene            complement(529558..530400)
FT                   /gene="thiD"
FT                   /locus_tag="AXYL_00505"
FT   CDS_pept        complement(529558..530400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="AXYL_00505"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13863"
FT                   /db_xref="GOA:E3HVJ8"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVJ8"
FT                   /protein_id="ADP13863.1"
FT                   /translation="MSSRQQAASGRPIPNALTIAGVDPSGGAGILADVKAMSALGAYGC
FT                   AVIAALTAQNTQGVTGISAVQPAFVGQQIDTLFADVRIDAVKIGMLGQQPVIQVVAEKL
FT                   AKWTPAHVVLDPVMVAKSGDLLLERDAVGAMREALLPQATLLTPNLPEAGVLLEERPVE
FT                   TVKEMRRVAERLRNKLAHSGERWVLVKGGHLPGSETIDLLHDGDRMIELPGHRIETVNT
FT                   HGTGCTLSAALAALLPQTGDVPEAARRAKAYLTEAIRHAERLSVGSGHGPVHHFHAWW"
FT   gene            complement(530397..531200)
FT                   /locus_tag="AXYL_00506"
FT   CDS_pept        complement(530397..531200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00506"
FT                   /product="thiazole biosynthesis protein ThiG family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13864"
FT                   /db_xref="GOA:E3HVJ9"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVJ9"
FT                   /protein_id="ADP13864.1"
FT                   /translation="MTTQDTLTIAGRAYSSRLLVGTGKYKDFEQTRAALDASGTEIVTV
FT                   AIRRTNIGQNPGEPNLLDYVPPSKFTLLPNTAGCYSADDAVRTLRLARELLDGHDLVKL
FT                   EVLGDPQTLFPNMPETLKATKTLVDDGFKVMVYCTDDPIQCRMLEDLGAVAVMPLASLI
FT                   GSGMGILNPWNLRLIIDQARVPIVVDAGVGTASDAAIAMELGCDAVLMNTAIAGARDPI
FT                   LMASAMKKGVEAGREAFLAGRMPKKLYSGAPSSPTEGLITAGAPK"
FT   gene            complement(531354..532331)
FT                   /locus_tag="AXYL_00507"
FT   CDS_pept        complement(531354..532331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00507"
FT                   /product="periplasmic binding family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13865"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVK0"
FT                   /protein_id="ADP13865.1"
FT                   /translation="MTHASARSRIVPGLFLALSTLLCAVGATAGQAAAQTAAGSAASPA
FT                   TASGPASATAAAIQVRDDQGRAVSLTAPARHAVTLAPHATELVFAAGAGDRIAATIRGS
FT                   DYPPAARQLPVIGDGTQPDPERVAAVRPDLLIAWQPAAAAPLARVMDKLGVPVFYSDPQ
FT                   TLAAIPDAVERMGTLFGTEAQARPAAQALRARLDALAARYAGRRPVRVFVQAGLDPIYT
FT                   LNNSSIVSDALRVCGGVNVFGQAPVVAPQVTLESVLAARPEAVLAGISRPQDAARNLAA
FT                   WQALGLPAARLGHVYGVDADALYRPGPRLIDAAETICADLDRLR"
FT   gene            complement(532385..534430)
FT                   /locus_tag="AXYL_00508"
FT   CDS_pept        complement(532385..534430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00508"
FT                   /product="TonB-dependent Receptor Plug domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13866"
FT                   /db_xref="GOA:E3HVK1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVK1"
FT                   /protein_id="ADP13866.1"
FT                   /translation="MKIRSIRRYAGALLCSAPAVAAAQQTASTTPQLDAVTVTAQRVPT
FT                   DGRTLPVSISVITAEDIAAASARTMQDVLSTQAGIHLINTSSSSDNSIVDLRGFGITGA
FT                   SNTLILIDGVKQNTNDLSAPSLGVVPLDQVERIEIVRGSGSVQYGGGTTGGVINIITRS
FT                   DFAKEPVTARATATFGSYGLRQYDAAVALNNEKVGVDAYMQSLHSDGYRDHSGERREGG
FT                   GGGITFRHDDGSIRLYGRTTTQKLELPGPRTINPTTGLNEYQDDPRGSKNDIDFVKTTT
FT                   TTFGLQLEQAIGAGTLYADLSTREKKLDGLTYDGFGDIQRDQKLEENIASVRYRLPING
FT                   GHSIVFGADGQEAKTTANQNAYYDFQPSKWQSRQHQYGLFAEGQVRATDSTYVTAGVRR
FT                   QYASDDLDVISGSGTASDRSNHLTAWQLGVRQDLPAGFGVYGKVGRSFRLPNADELLSV
FT                   QNPLAPQTSTDKEIGVTWQSASSSARLSYFRYDLTNEIQYNPLADGIWGPGTGANTNLD
FT                   PTRRQGIELEGHTAISSSVSLDANLTWMEAQFRSGTYAGVDLAGKTVPLAPKWLANAGV
FT                   TWRPTDAFLWNVTAQYVGKSRMDNDQANQFAKELDAYVLFNTKVAYKFTRNIEGAIGVN
FT                   NIFDRQYATYGIRGGNASFEMLGPVANYSLYPAPGRNFYASLTLRY"
FT   gene            534872..538645
FT                   /gene="metH"
FT                   /locus_tag="AXYL_00509"
FT   CDS_pept        534872..538645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="AXYL_00509"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13867"
FT                   /db_xref="GOA:E3HVK2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVK2"
FT                   /protein_id="ADP13867.1"
FT                   /translation="MSYPRLPYPPEAYTHGGEFARLLGKRILILDGAMGTMIQRYKLGE
FT                   ADFRGERFAAHGKDVKGNNELLSLVRPDVISEIHRQYLEAGADVIETNTFGATTIAQGD
FT                   YELPALAYELNLVSARLAREACDAYSTPDRPRFVAGALGPQPKTASISPDVNDPGARNV
FT                   TFEELRVAYVEQLNGLLDGGIDIVLIETIFDTLNAKAAIFATEEVFEARGVRLPVMISG
FT                   TVTDASGRILSGQTVEAFWNSVRHARPITIGLNCALGAALMRPYVAELARICDTYVCVY
FT                   PNAGLPNPMAETGFDETPADTSALLEEFARAGLVNMSGGCCGTTPDHIREIAAKVMSLT
FT                   PRAVPDIPVKTRLSGLEPLNIDEDTLYVNVGERTNVTGSKMFARLIREEKYDEALAVAR
FT                   QQVENGAQIIDINMDEAMLDSVACMRRFLNLIASEPDIARVPIMIDSSKWEVIEEGLKC
FT                   VQGKPVVNSISMKEGLEPFRHHARLCRRYGAAVVVMAFDELGQADTLERRKEICGRAYK
FT                   ILVEEEGFPPEDIIFDPNVFAVATGIDEHNHYAVDFIEGTRWIRENLPHARISGGVSNV
FT                   SFSFRGNEPMREAIHTVFLYYAVKEGMTMGIVNAGQLGVYADLDPKLRDLVEDVVLDRA
FT                   EPVGKTEADDERTPTERLVQFADSVKGSGAKKEEDLAWRDAEVEKRLSHALVHGITTFI
FT                   VEDTEEVRQKIFDRGGRPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVA
FT                   HLIPFIEEEKRQIAAAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGV
FT                   MVPCAQILEKAKEENADIVGLSGLITPSLEEMAYVASEMQRDEYFRSRKLPLMIGGATT
FT                   SRVHTAVKIAPNYEGPVIYVPDASRSVGVATNLMSDQSETYLAELAEEYEEVRRRHANR
FT                   KATPILPLAEARASRPAIDWDNYTPPRPKFIGRRTFKSYDLAEIAKYVDWGPFFQTWSL
FT                   FGPFPAILDDKVVGEQARKVYADGLAMMKRIIEGRWLTANGVVGFYPANSINDEDIEVY
FT                   KDETRSEVLFTYRNLRQQGAKREGVSNKSLSDFIAPKSSGKLDYIGMFAVTAGLGIEKK
FT                   EAEFEKALDDYSSIMLKSLADRLAEGFAECLHARVRQDLWGYAPDEALSNEDMIAEKYV
FT                   GIRPAPGYPACPEHVIKTDMFRVLDGADIGMMLTDSYAMYPASSVSGFYFSHPQSQYFN
FT                   VGVIGEDQLQDYAARSGRSIEDLKRTLAPNLG"
FT   gene            complement(538733..539509)
FT                   /locus_tag="AXYL_00510"
FT   CDS_pept        complement(538733..539509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00510"
FT                   /product="citrate synthase 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13868"
FT                   /db_xref="GOA:E3HVK3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVK3"
FT                   /protein_id="ADP13868.1"
FT                   /translation="MKTPETRLCAHHLTGMSYRDVDLVEDLIGKKTFTEVMIMQILGRE
FT                   ARPVDLRIVDAVLVTLMEHGLTPSAIATRLIYMSAPENLQGAVASGLMAVGSQFVGTME
FT                   NCSRLLDRIRQADDGHAEALTIAREFRASRSALPGFGHHLHKPDDPRSIKLLALARAEP
FT                   DLKGDSLKALRLLSAAIDETYGKHITINATGAVAALLSEIGVPTELMRGFAVISRAAGL
FT                   VSHVAEEQQSPSGRYIWETIDHAIPYVGKGKTHHGE"
FT   gene            complement(539506..541023)
FT                   /locus_tag="AXYL_00511"
FT   CDS_pept        complement(539506..541023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00511"
FT                   /product="AMP-binding enzyme family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13869"
FT                   /db_xref="GOA:E3HVK4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVK4"
FT                   /protein_id="ADP13869.1"
FT                   /translation="MYPIDFFFRAAEQYPDRIALDGPEGQVTYSQLAADTRALAAALQE
FT                   LDPAPQTRVAICAGNSARHILALLAVLASGKVWVPLNYRSTEREIGRILDATEPSIVIV
FT                   DSVGAPLAPAAQAPQDRRHIHLDDASAPLPLDALLARCAGRDPQRHALPRDATQAIKFT
FT                   GGTTGLPKGVMQPYHAWNAGIINQIASWGLTQEDRYVVAAPITHGTGTYLLPVLARGGA
FT                   HLLLDGVTPASITAAFRERGGTLSFMPPTLIYMIMAQPGVSRADFPRLRNLIYGGAPMP
FT                   VEKIDRAREFFGPVLGTTYGQTEAPQIVTALRPADLEAPENRASVGRVTWLTDMAIMAP
FT                   DGALLPRGEIGEVVVQGDLVMSGYWRLPEKTAETVLDGWLHTGDTGLIDARGYLFLKDR
FT                   LRDVIITGGFNIYPVDVENALSAHPAVYECSVFGLPDDKWGEAVHAAVQFHPGAQASAD
FT                   ELKAHVRALLGPVATPKQFHIHDSLPRSSVGKVLKNAVRDAAQKETP"
FT   gene            complement(541034..542017)
FT                   /locus_tag="AXYL_00512"
FT   CDS_pept        complement(541034..542017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00512"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   11"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13870"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVK5"
FT                   /protein_id="ADP13870.1"
FT                   /translation="MKMQSKRWAAAAAALGALLAAPALAAKPYPERPVTLVVGYAAGGA
FT                   TDIVARLMAKSLSEELGQTIVVENKTGANSNIGAEIVARAAPDGYTLYVGSIANTINRT
FT                   LYSQLNYDFVKGFEPVGLLATIPNILVVNPKLPVKTVQEYVAYAKKNPGKLTCASSGSG
FT                   SSIHLSCELFKMQTGTDILHVPYRGSGPAVADLLGGQVDSMFDNLPSSLPHVQAGKLRA
FT                   IGVTSPQRLPSAPDTPTLAESGLPGFEVESWFGVMAPAGTPKPVVERLNQAINKALASP
FT                   ALQASYQQSGFYAPQQPNTPETYAQKIASEIDKWGKVVKSANLKAN"
FT   gene            542156..542917
FT                   /locus_tag="AXYL_00513"
FT   CDS_pept        542156..542917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00513"
FT                   /product="bacterial transcriptional regulator family
FT                   protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13871"
FT                   /db_xref="GOA:E3HVK6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVK6"
FT                   /protein_id="ADP13871.1"
FT                   /translation="MLRRGLRVLGVLRQAGAAGMHVVDIARAAGMQRTTAYRYLDVLVQ
FT                   EGYALRESEAPRWRVAELGVMMAGDPHAQAVRGLRPVLRQISDVSGDSAFLICRAGNDS
FT                   LCLHREVGNYPVQVLAVTVGHRQPLGVGAAGLALLAALPPDESEEVIAQNEQALRAYGG
FT                   MTVAQMRRLVENTRGRGWSVVGNAAVPGVLGVGVALCDAGGYPRLAVSVSSLISRMQAA
FT                   RQRSIADLIRAQLAQDEVRAQRWALPGFPGG"
FT   gene            complement(542914..543459)
FT                   /locus_tag="AXYL_00514"
FT   CDS_pept        complement(542914..543459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13872"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVK7"
FT                   /protein_id="ADP13872.1"
FT                   /translation="MSEIYPHDAPGPHLIRNGRLEADAWRVFTPEPEVPAEGQVPGDAP
FT                   GWIVPLSVWKTSRATLRRHQHPVAVQLDPDADLRDLAEADGTLDPAGIAFIAVDFPVYT
FT                   DGRGYSLAQLLRTRYQWQGELRAVGDVMIDTIHYQARVGFDSFLVKPGHDPHKALDAFK
FT                   TFTVHYQKTYRVPAPAAA"
FT   gene            complement(543452..545194)
FT                   /gene="cysI"
FT                   /locus_tag="AXYL_00515"
FT   CDS_pept        complement(543452..545194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="AXYL_00515"
FT                   /product="sulfite reductase"
FT                   /EC_number="1.8.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13873"
FT                   /db_xref="GOA:E3HVK8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVK8"
FT                   /protein_id="ADP13873.1"
FT                   /translation="MYVYDPVDQQLVEQRVAQFSDQTRRFLDGQLTEDEFRVLRLQNGL
FT                   YIQRHAPMLRVAIPYGILASRQLRTLAHIARKWDRGYGHFSTRQNIQFNWPKLEDVPAI
FT                   LAELATVQMHAIQTSGNCIRNTTTDHFAGVAPDELVDPLVWCEIIRQWSTLHPEFAFLP
FT                   RKFKIAVSGAVQDRAAVGVHDIGLQAVERDGKLGFRVWIGGGLGRTPIVGKLINPFVEW
FT                   QDLLTYLQAALRVYNLHGRRDNKYKARIKILVKDLTPEVYAQQVDEQWQLIKGGPDTIT
FT                   QEFVDTIRTRFVWPKYDAAAAQDVDNTAALAAADPRFARWLRTNVHPHKAAGYAAVTVS
FT                   LKPTGVPPGDITADQMDAVANLADDYGFGELRVSHEQNLILADVRRARLHELWTTLQTL
FT                   NLATPNIGLLTNIIACPGGDFCALANAVSIPVAEAIQRQFDNLDYLFEIGELDLNISGC
FT                   INSCGHHHVGHIGILGVDKAGEEWYQVTIGGRQNGAAKPLPDIESTRGGGAAIGRIIGP
FT                   SFARDQVAGVVDRLVRTYLGLRDSEEERFIDVVDRVGIDPFKQDVYSDPAFAKPAQHAE
FT                   AAHV"
FT   gene            complement(545432..545623)
FT                   /locus_tag="AXYL_00516"
FT   CDS_pept        complement(545432..545623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13874"
FT                   /db_xref="GOA:E3HVK9"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVK9"
FT                   /protein_id="ADP13874.1"
FT                   /translation="MLSFLRTVKSVLWGFFGVRRGRGYDADIANNKPAPLILTGLLMAA
FT                   CLVVILVLVARWAVNAAL"
FT   gene            complement(545700..546635)
FT                   /locus_tag="AXYL_00517"
FT   CDS_pept        complement(545700..546635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00517"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 17"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13875"
FT                   /db_xref="GOA:E3HVL0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVL0"
FT                   /protein_id="ADP13875.1"
FT                   /translation="MDEKLDARRTHYFMQVMSRGSVRGAAEVLDMDPSAVSRAIAALER
FT                   DCGIALFERRGRGVVPTDAGHILARYIKRQQDIQESFFSEIDSLRKAERGHIDLVLGEG
FT                   FVELMFERVLPGYWRSHPEVTLDIDVARTSEIVQRIVDDRAYIGLVFQPPNDARLRTHY
FT                   SRPEPIRAIVRDDHPLTRLRRPLLLTDLADYPGASMQEGFGVRQHIQAAEISEQVRLRN
FT                   VLTTSSFKALWQFAAAGIGYALTPPIAVTADMRAQRLASLPLANPILNQGSLHVLSRAG
FT                   RHVSPAARELLEHIVRGIGAPAGSMPDTVE"
FT   gene            546925..548265
FT                   /locus_tag="AXYL_00518"
FT   CDS_pept        546925..548265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00518"
FT                   /product="putative membrane protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13876"
FT                   /db_xref="GOA:E3HVL1"
FT                   /db_xref="InterPro:IPR021450"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVL1"
FT                   /protein_id="ADP13876.1"
FT                   /translation="MSHASASLAAPSMPLSGRIRMLAAILLVVVISEAIGSATFNVGPG
FT                   KIVLQPMLWAIFIGAIVAACGQRLPAGLNIDTAMQTRISGYLQYALLPFLAKLGLMVGG
FT                   ALPQVREAGWALVFQEFGHFFGTMAIGLPLALLLGIKREAIGATFSVGREPSLAIIGER
FT                   YGMNSPEGRGVMAEYITGTVIGALFVALMAGFITSLNIFDPRSLAMGAGVGSGSMMAAG
FT                   VGAIASQQTPEVAHQVAALAAAANLLTTVVGVYFTLFISLPTTIFLYDKLEPVLGRFSR
FT                   GKAETAAAADDGAAQETPAHGAKMGFGDRLTAYVICGLFALVGNRLGYNVPFADALPGM
FT                   GIIILLVVIADLVLRVVPKLPAVFVLSLIAMTAGCPGVLPYSDQIIAMVGKVNFLPFTT
FT                   VILAMAGLSILKDLPAFRKLGWKIVVVSLAANAGTFLGATMIAEFFH"
FT   gene            complement(548326..548832)
FT                   /locus_tag="AXYL_00519"
FT   CDS_pept        complement(548326..548832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13877"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVL2"
FT                   /protein_id="ADP13877.1"
FT                   /translation="MNVAAISAIHRADAPYPARSAALDATRPFLETQGIAHVRAAKAAA
FT                   AGHAAPTIRERDHQPPALTVIGASNADALRDLHAESRMRRALEAFTTQPDPTAQHAGSA
FT                   NDLGTIEGLMPLQAYRVAMGNPQVQELQTTVAMKAAGLGIPKVANIGATENVTDQARYR
FT                   PGHTP"
FT   gene            complement(549040..549639)
FT                   /locus_tag="AXYL_00520"
FT   CDS_pept        complement(549040..549639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00520"
FT                   /product="glutathione S-transferase, N-terminal domain
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13878"
FT                   /db_xref="GOA:E3HVL3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVL3"
FT                   /protein_id="ADP13878.1"
FT                   /translation="MKIFYSPASPFVRKCMVIAHELGLADRIERLPSAAGPVARDQSII
FT                   PSNPLGQVPTFITDDGQALYDSRVVCEYLNDLGGGALFPAGKDRWQVLTEQSMADGMLG
FT                   AALLARYETVLRPEALRWDGWVEGQLGKVRDGLALVEKSAASLNGRLDIGTITIGCALG
FT                   YLDFRFPDLDWRAGHPATAAWYETFSQRPSMQATKP"
FT   gene            complement(549665..551371)
FT                   /locus_tag="AXYL_00521"
FT   CDS_pept        complement(549665..551371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00521"
FT                   /product="FAD binding domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13879"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVL4"
FT                   /protein_id="ADP13879.1"
FT                   /translation="MEGITWNKEVDALVVGSGAGGMAAALTAREEGLDVLLVEKTGRVG
FT                   GSTAISGGALWIPLNAQTEAAGHPDSFDKVWTYLEQTVGAAAPDDMKRAYLEAGPRMMD
FT                   YLASRGILDVAARTASPDYYPDLPGAAMGGRSLDPLEFDGRKLGQDFRTLRDPLKEFTV
FT                   LGGMMVNITDVRHLLRATRSFTAWRHSMKLVLRYAADRARGYHRGTRLLLGNALAAQLF
FT                   HGLLARRIEYWLDTPALALHRDASGRVLGAAVARGGKTLNIRARRGVVMATGGFPWDPE
FT                   RRAQSYPQPTGLWSMSPRDNTGDGIRLSETAGAALGTGHASPAFWAPVSVLESADGQRL
FT                   HYPHLVWDRAKPGLIALNSAGQRFVNESASYHEFVQAMYRNNGAAPSVPAFLLCDQRFI
FT                   DTWGLGLALPGGRPRQHLIDAGYLLQGATLAALAARLGVPCDALQATVDRYNTHAAQGR
FT                   DPDFGKGSTAYNRYLGDPEHEPNPCLAPLGPGPYYAVKVYPGDIGTACGIAANRDAQAL
FT                   DAAGAPIPGLYVAGNDMQSVMGGAYPGPGITLGPALTFGWIAGQHLAHAQH"
FT   gene            complement(551377..552105)
FT                   /locus_tag="AXYL_00522"
FT   CDS_pept        complement(551377..552105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00522"
FT                   /product="short chain dehydrogenase family protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13880"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVL5"
FT                   /protein_id="ADP13880.1"
FT                   /translation="MNLGTALVTGGASGMGLAIVERLAHDGFRVVLADRNAELAAKEAQ
FT                   ALQTQGLDVEHRVVDLTDEAATRALARSLAPLAALVNNAGLFDERKFFEVDSADYRRAF
FT                   DVNLLAAATLTQEAARDMAPGAKIVNIASRAYLGAKNHPHYVASKAALVGYTRASAMEL
FT                   AARGILVNAIAPGLIDTPLLRNLTPERLAAQLALQPTGRAGQPQDIANAVSFLAAPHMD
FT                   FITGQVIFVDGGKSLGGSGA"
FT   gene            complement(552115..552867)
FT                   /locus_tag="AXYL_00523"
FT   CDS_pept        complement(552115..552867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00523"
FT                   /product="short chain dehydrogenase family protein 7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13881"
FT                   /db_xref="GOA:E3HVL6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVL6"
FT                   /protein_id="ADP13881.1"
FT                   /translation="MISMQDKRVLVTGAGRGLGAAIAQGFARQGAAVIVADVDAALAAA
FT                   TAQAIRVAGGKAADAVLDVTDAAAVRAFAERSATEHGHLDILINNAGISARAPFDDPKT
FT                   PEIWERLMSVNLQGTFNVTHAFVEQLKATRGAIVNLCSIVAYGCSISTAGYVVSKGGVR
FT                   SFTEVLARDLAPHGVRVNAVAPGLMETEMTVGQRAQAQGTDWYMQRAPMARAGRADEIV
FT                   GPVLFLASDMASYVNGVVLPVDGGYLAV"
FT   gene            complement(552887..553606)
FT                   /locus_tag="AXYL_00524"
FT   CDS_pept        complement(552887..553606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00524"
FT                   /product="ABC transporter family protein 8"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13882"
FT                   /db_xref="GOA:E3HVL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVL7"
FT                   /protein_id="ADP13882.1"
FT                   /translation="MAEYLLEVEAVSAAYGNIRALQDVSLKVPQGAIVALLGANGAGKS
FT                   TTLNVISRLVAPTAGSVRFAGEPIHRLAADAIVGRGIVQVPEGREIFRDMSVRENLEMG
FT                   AYLRTDRPAVKQDLDMVCDTFPRLRERYEQKAATLSGGEQQMLATGRAMMARPRMILLD
FT                   EPSMGLSPLVVEQIFDIVLRLNREQGITILLVEQNVKLALSVSSYAYILENGEIALEGE
FT                   SAALASDEGVQRAYLGA"
FT   gene            complement(553599..554363)
FT                   /gene="braF1"
FT                   /locus_tag="AXYL_00525"
FT   CDS_pept        complement(553599..554363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braF1"
FT                   /locus_tag="AXYL_00525"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   ATP-binding protein BRAF 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13883"
FT                   /db_xref="GOA:E3HVL8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVL8"
FT                   /protein_id="ADP13883.1"
FT                   /translation="MSSHPYLDVQGLTVKFGGLTAINGLSMQVERGRIHALIGPNGAGK
FT                   STTFNCISRYYRPSSGSIQFDGVDITRKKPHEMAALGVARTFQNLELFGALSVRENALL
FT                   GTYAHGADSAGKLLRPAAAQTRERVEHLLERVGLADFLDTPACSLDFGRQKMLELARAL
FT                   AISPKLLLLDEPAAGLRNREIETLDRLLTELCERDGITVLLVEHVMQLVMSISDRITVM
FT                   SFGEKIAEGTPAEVRSNPRVIEAYLGKGAAGG"
FT   gene            complement(554360..555358)
FT                   /locus_tag="AXYL_00526"
FT   CDS_pept        complement(554360..555358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00526"
FT                   /product="inner-membrane translocator 6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13884"
FT                   /db_xref="GOA:E3HVL9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVL9"
FT                   /protein_id="ADP13884.1"
FT                   /translation="MSKKIDHALLALMAVVLAILPFAASGYVIYVVNLLMVFVVLALGL
FT                   HLVIGETGQFALSHAAFYGVGIYTAGLINNLWHPPFFISIVAGGLLAAALGYVIGALAL
FT                   RMRDIYLALSTFAFGEAMQWVFLNWQSVTNGSNGFRISPATLFGYELVSDAKAYPFVVL
FT                   IAALLLWATVALSRSQLGSAFRAVRESDVAAQAMGVNVNAIKRTAFTLSAAYAGIAGGM
FT                   YTTFASFIHPESLGFQTTILILTMVVVGGIGSVRGAIAGALAFGLISELLRQALSFQEI
FT                   IYGVILMGFMMFAPKGLFAGRGARGRAPAPATPLPSTPNKAAAKPTQRSAA"
FT   gene            complement(555355..556257)
FT                   /locus_tag="AXYL_00527"
FT   CDS_pept        complement(555355..556257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00527"
FT                   /product="inner-membrane translocator 7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13885"
FT                   /db_xref="GOA:E3HVM0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVM0"
FT                   /protein_id="ADP13885.1"
FT                   /translation="MSFADIWLFLQQGVLSGLVTGSVYALLAVAVVIIFKTTDVPNFAQ
FT                   GEIFMVGGYIALFLTLVMGWPYLVVIPITLLAVAVLSGLFQRVVMERVIASKGVGVQMV
FT                   IATLGLAYALKGLVRQTGLGDTPRSLPPLASTDAIIIGDAVLTQLDLVIFAVAVAVMLL
FT                   LFGMFTYTRVGRAMRAVGMNPKAARLVGVNLTRIRMLVWALAGLISAVAALLITPKILI
FT                   TPDIGHIAILAYAAAIVGGITSLPGAVVGGFVIGVAENLVGLFISTNAIVVAPFVAIMV
FT                   VLLLRPQGLLGGKLQVKKV"
FT   gene            complement(556326..557540)
FT                   /locus_tag="AXYL_00528"
FT   CDS_pept        complement(556326..557540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00528"
FT                   /product="receptor family ligand binding region family
FT                   protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13886"
FT                   /db_xref="GOA:E3HVM1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVM1"
FT                   /protein_id="ADP13886.1"
FT                   /translation="MKKSSRYAAAAALCAWALSTGALAQQEPGITDKTIKIGLFAPLSG
FT                   SGMAYGFDVLNAAKMWYAKVNKEGGVHGRQIELVIEDDRCNANDLVAAVKKLNEQDKVF
FT                   LLNGGSCSAAVVASREYVEREKVPLVMLNASGDGALYPPSKYIYGAFSISQHAVGGSMV
FT                   QFAAEHLKAKKIGYINHDDAYGGWNLEAAQAQVKQLGDASLQVQSVNPNITDVTAPMLK
FT                   IRAANADVLLLTTYARPAALIIKKAQELGWNKPIVLAVNGTADLKQLVENVGNKDAFKN
FT                   VYIQEVLSDVPGGSKLTWVYDMYKQAYPDLAAKPGHPQTYMPYGLPPAMAVVNALKAAG
FT                   PQPTREKVLQALETMKFDSGVMAGPIEFGPNDRAAQESAIYIKFDGTNMSLVPGAFKSV
FT                   WQYQK"
FT   gene            complement(557624..558418)
FT                   /locus_tag="AXYL_00529"
FT   CDS_pept        complement(557624..558418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00529"
FT                   /product="short chain dehydrogenase family protein 8"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13887"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVM2"
FT                   /protein_id="ADP13887.1"
FT                   /translation="MSNVSTPAGMGPAPRLALVTGGGGGIGARICQELASAGLRVIVSD
FT                   VDAARARRVADELGAPHASHAFDVSDEHSVDNAFEQIEAQHGPIAVLVSAAGLLLFQEN
FT                   GERPLIKDTTLDIWERSFAVNARGVFLCGRAYLRRREAAPLAHGRIVTFTSVAAQLGGY
FT                   RSSASYIAAKSAVLGLTKAMARESAHLGVTVNGIAPGLIDTDMLRSTVTSSGALAAAAQ
FT                   AIPLGRIGTVDDVAAAVRFLASEEAGYITGSVIDVNGGYRMQ"
FT   gene            558624..559301
FT                   /locus_tag="AXYL_00530"
FT   CDS_pept        558624..559301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00530"
FT                   /product="bacterial regulatory protein, GntR family protein
FT                   8"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13888"
FT                   /db_xref="GOA:E3HVM3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVM3"
FT                   /protein_id="ADP13888.1"
FT                   /translation="MDTLSQHVTDTLRDWVLHGKFSPGARLEEIPLAEKLGVSRTPVRA
FT                   ALATLGNEGLLEHLPKRGYTVRAYDIGEIVAAYEVRAALEGLACRQAALRGLSNDAVAV
FT                   LKNCLDEGDRILGKGVLLAEDHLPYQQVNITLHNGILEAAGNPWVRRFATQAQAIPYAS
FT                   DRIILWEDHGIILRSHDDHHRIVNAIIARDGARAEDLMREHVYYAGIILKNNYERLAQA
FT                   YRV"
FT   gene            complement(559353..560105)
FT                   /locus_tag="AXYL_00531"
FT   CDS_pept        complement(559353..560105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00531"
FT                   /product="short chain dehydrogenase family protein 9"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13889"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVM4"
FT                   /protein_id="ADP13889.1"
FT                   /translation="MISMQDKWVLVTGAGRGLGAAIARGFAQQGATVIVADVDADAAAA
FT                   TAQAIRDAGDKAAEAVLDVTDAAAVRAFAQRFATDHGNLNILVNNAGIGALERFEDPKT
FT                   PETWDRVMSVNLQGTFNVTHAFVEQLKAARGVIINLCSVVAYGCSTSPASYTVSKGGVR
FT                   SFTEVLARDLAPHGVRVNAIAPGLMETDMTAGVRGRPQGTDWYTQRTPMARAGRAEEIV
FT                   GPVLFLASDMASYVNGVVLPVDGGYLAV"
FT   gene            complement(560320..560970)
FT                   /locus_tag="AXYL_00532"
FT   CDS_pept        complement(560320..560970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00532"
FT                   /product="carbonic anhydrase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13890"
FT                   /db_xref="GOA:E3HVM5"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:E3HVM5"
FT                   /protein_id="ADP13890.1"
FT                   /translation="MFPKRLTEGYQSFLGGRFPSESSRYQKLAESGQNPEILIIGCCDS
FT                   RVSPEVIFDAGPGEMFVVRNVANLVPPCDPDSESSYHGTSAAIEFAVNGLNVKHIVVLG
FT                   HASCGGIRSFFDDAKPLTKGDFIGKWMSQIEPVAQRLGPGTGDRQANLKRLELATVEHS
FT                   LNNLMTFPSIRRRVEKGDLELHGTYFGVATGLLYLRDPATGEFKPCLESPAAA"
FT   gene            complement(561191..561529)
FT                   /locus_tag="AXYL_00533"
FT   CDS_pept        complement(561191..561529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13891"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWI2"
FT                   /protein_id="ADP13891.1"
FT                   /translation="MKLALASFALLAGLSGAAGAQGLVYGVTLGNVQAVRDVNQNVSAI
FT                   TGLLSNQSARHVNSAMLTFVLFDAQGREIGRVRDDVVGPLAPGQIKQIRAVTPLQFTRV
FT                   TALGVDAR"
FT   gene            561892..562227
FT                   /locus_tag="AXYL_00534"
FT   CDS_pept        561892..562227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00534"
FT                   /product="PsiF repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13892"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWI3"
FT                   /protein_id="ADP13892.1"
FT                   /translation="MLSRTSQLASAFLLTACFAGAAFAQTPAAPAPAKTPTPQQQRMAD
FT                   CNKSAEGKKGDERKTYMSSCLKGEAAAPAKELTPQQQKMKDCNAKATSQQLTGDKRKTF
FT                   MSTCLKG"
FT   gene            complement(562308..563783)
FT                   /locus_tag="AXYL_00535"
FT   CDS_pept        complement(562308..563783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00535"
FT                   /product="indoleacetamide hydrolase 1"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13893"
FT                   /db_xref="GOA:E3HWI4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWI4"
FT                   /protein_id="ADP13893.1"
FT                   /translation="MSDTSNQPLPAASPVDLTVTEAAALIRQGRLTSVALTQACLDRID
FT                   ARADLNAFITVDRAGALAQARARDAAGGQADGTALPLAGVPIAIKDNIHVAGLPNTAGT
FT                   PALKHFRPAEDAPVVRRLREAGAVIVGKTNMHELAFGVSGYNTAFPGTHGEGTRNAYDA
FT                   SLIAGGSSSGSGAAVGARLTPAALGTDTGASVRLPAAVNGAVGFRPSVGRYDGAGITPI
FT                   SHTRDTPGPIANSMDDIVLLDAVLAGDPQPLSALPPAGMRLGLCGYFWQGLDPQVQAVM
FT                   DAALTKLRAAGVQLVELDMPGLEASNAAVGMPVCLHEQKGDLTDYLERYETGVTFEQVV
FT                   AQISSPDVKGIFDGLIVPGVLPLPSGEVLPLQPLYERAMATHRDELINVYRRAFQDHAL
FT                   DGLLFPTVPIQPMAATPDASSFESFGRLARNVDPGSNAGLPGLSVPAGLSADGLPVGLE
FT                   VDGLPGEDRKVLAVGLMLENVLGRLQGPGRSGG"
FT   gene            complement(563876..564646)
FT                   /locus_tag="AXYL_00536"
FT   CDS_pept        complement(563876..564646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00536"
FT                   /product="ubiE/COQ5 methyltransferase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13894"
FT                   /db_xref="GOA:E3HWI5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWI5"
FT                   /protein_id="ADP13894.1"
FT                   /translation="MTASTHDAAVDRQFSPRATAYLTSAVHAQGEDLLQMAGIAAQHPE
FT                   ARLLDLGCGGGHVSFHVAPHVKHVTAYDLSQQMLDVVAGEAAKRGLANLATCQGKAEYL
FT                   PFDDGEFDLVMSRYSTHHWQDAGRGLREAFRVLKPGGIAVFADVVSPGEPLLDTWLQTI
FT                   EVLRDTSHVRDYSVAEWTRMLTEAGFTLQGLAPRRLPLEFQSWVVRMRTPDTLVAALRH
FT                   MFGIAPDVVRTHFEVQDDASFTSDTATIVVRKPG"
FT   gene            564763..565581
FT                   /locus_tag="AXYL_00537"
FT   CDS_pept        564763..565581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00537"
FT                   /product="transcriptional regulator 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13895"
FT                   /db_xref="GOA:E3HWI6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWI6"
FT                   /protein_id="ADP13895.1"
FT                   /translation="MTTSPQTGAAGHEGSPLRRQALGEFVRSARSRITPQMAGLPEGMR
FT                   RRTPGLRREEVAQLCGISVTWYTWIEQGREVSVSPSVWSRIAGVLQLARAERAYLFDLA
FT                   DCADPQHGRDDAGAPGPLQECVNAINAPAYVLDRAWNVLAYNEPLRELFDNWPARDAEP
FT                   NLLRYIFLDPAARELVVDWDQRARRVVAEFRADAGAHLDEPGVLALLDSLNRQSPVFAH
FT                   WWTRHAVVEREGGLREFQHPGRGKLAYQQITFRLATHPDLKLVMLLGGGE"
FT   gene            complement(565614..566291)
FT                   /locus_tag="AXYL_00538"
FT   CDS_pept        complement(565614..566291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00538"
FT                   /product="bacterial regulatory protein, GntR family protein
FT                   9"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13896"
FT                   /db_xref="GOA:E3HWI7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWI7"
FT                   /protein_id="ADP13896.1"
FT                   /translation="MTINLAPMQRENMTARIYREIKQKIMMGELRPGDTITLRSITDTL
FT                   GVSQTPVREALLQLVSERALTLSPGKSVKVPELTVAQLQELRSIRLELECFAARRAVPH
FT                   ATPALIAELRGIHANLMASRDQQLMAPVLARNFDFHFALYSAAQMPHLLFIIENLWVQT
FT                   ASYLSYLYTPPFPVLPDGHPHEGIIAGLEAADTEAVVREIRRDIEGHGEFLIRYLTEHG
FT                   LVK"
FT   gene            566453..568180
FT                   /gene="atrC"
FT                   /locus_tag="AXYL_00539"
FT   CDS_pept        566453..568180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atrC"
FT                   /locus_tag="AXYL_00539"
FT                   /product="acetolactate synthase catalytic subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13897"
FT                   /db_xref="GOA:E3HWI8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWI8"
FT                   /protein_id="ADP13897.1"
FT                   /translation="MSALHPLAAPGLTHQGTVAHLIARALIRHGVTHVFGQSLPSMLHL
FT                   ACEELGLTQVAYRSENAGGYMADGYARVTGKPAIVTAQNGPAATLLVPPLAEALKVSIP
FT                   VIALVQDVNRDQTDKNAFQEFDHIGLFSSCTKWVRRVTEASRVEDYVDQAFAMACSGRP
FT                   GPVALMLPADLLNEAAAATQRQANLGYFPLDRNVAADEAVQTAADLLAAAQRPVVIAGG
FT                   GVHVSGACHALAALQESAHLPVGTTVMGKGSVDERHPLSLGVVGYFMGPNSASRDLRPL
FT                   VADADVVLLVGSRTNQNATDSWKLYPKSARYIHIDVDGGEIGRNYEALRLAGDARETLL
FT                   ALQRALANRDLSAAQSRRAGLEAAIQAGRASSWEASRAVRLSDQQPIRPERLLEEIRQD
FT                   VDQDTIVVADASYSSIWIANYLTSLAPGMRFLTPRGLAGLGWGFPMAMGAKVARPRAHV
FT                   VCVVGDGGFGHVWSELETARRMGIKVTLVVINNGILGFQKHAENVKFGAHTSAVHFHPV
FT                   DHAAVARAAGCLGVRIESPSDLAGALREARRAEQTTLVEVMCDENAFPPITFFTAGQA"
FT   gene            568177..568932
FT                   /gene="phbB1"
FT                   /locus_tag="AXYL_00540"
FT   CDS_pept        568177..568932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB1"
FT                   /locus_tag="AXYL_00540"
FT                   /product="acetoacetyl-CoA reductase 1"
FT                   /EC_number="1.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13898"
FT                   /db_xref="GOA:E3HWI9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWI9"
FT                   /protein_id="ADP13898.1"
FT                   /translation="MKKDPSRVALVTGAGRGIGLEVVRQLLAKHYRVVAVSREGVDAEK
FT                   LGGSCAQLRTERADVTDYASMQALVENVRAKWGPVSVLMNNAGISPKQANGNSSGILDI
FT                   NPQEWESVLQVNLTSILRLCQMVLPAMRDQGWGRIVNVSSLAGRAKSLVAGGSYMASKA
FT                   GVLGLTRAIAAEMGPHGITANAITPGRILTEMAQQAAPSVNENYAAQIPVRRLGTPEEV
FT                   AAAMVFLAAEEAGFINGAILDINGGFYMP"
FT   gene            568970..569929
FT                   /locus_tag="AXYL_00541"
FT   CDS_pept        568970..569929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00541"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   12"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13899"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWJ0"
FT                   /protein_id="ADP13899.1"
FT                   /translation="MKGASKLAALAAATALCAAAAPAWAWPDKEVTLTVNYGAGGNTDV
FT                   ASRELARAMEVDLGRSVVVFNRPGALGTIGPAYVAKQPADGYNVGVVTLSSIAIMPHLM
FT                   TIPYAARDFDFVAAYGRYRYGVVVRADSPYQTVADLVAAAKQGPGIFFGAPSAPNNLAM
FT                   FDLGRVTGAKFEQVSYKSGSETVSALLGKQVDAIVQNPSDVTSYIQSGRLRLLASASPI
FT                   RWPEFPDVPTLKEAGYDVEIDSWLGLAVPKGTPESVRTRLEQSTKTAVASDRLRQTYKQ
FT                   LGVDPVWLSGQDYANMIGTTYEQMGRAIKAANLPRMTN"
FT   gene            complement(569950..571020)
FT                   /gene="mutY"
FT                   /locus_tag="AXYL_00542"
FT   CDS_pept        complement(569950..571020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="AXYL_00542"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13900"
FT                   /db_xref="GOA:E3HWJ1"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWJ1"
FT                   /protein_id="ADP13900.1"
FT                   /translation="MDFAPRIVDWQRRHGRHDLPWQNTRDPYRIWLSEIMLQQTQVATV
FT                   IPYYERFLQRFPDVAALGAAAQEDVMPYWAGLGYYARARNLHRCAQEIARDWSGRFPPT
FT                   AEAIATLPGIGRSTAAAIAAFAYGERAPILDGNVKRVFTRHFGIAGDPTKREVEQKLWA
FT                   LADAQVEAAPGLDMAAYTQGLMDLGATLCTRGKPACDACPAADSCVAKREGRQAELPTP
FT                   KARKAIPERETCMLVLRHEGAFLLQQRPEPGIWGGLWSLPEFDVSQDPDSASRALGLEP
FT                   EQRFELAAFAHTFTHYRLHIRPWLVPVRAAGLRESARPERWVQAEELASVALPAPVKKL
FT                   LQGLVEAGMQDSLFKG"
FT   gene            571189..574800
FT                   /locus_tag="AXYL_00543"
FT   CDS_pept        571189..574800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00543"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase
FT                   family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13901"
FT                   /db_xref="GOA:E3HWJ2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWJ2"
FT                   /protein_id="ADP13901.1"
FT                   /translation="MNAPASPALRAALESVQLDDKYTLESGRAWMSGIHALVRLPMMQR
FT                   VRDARAGLNTAGFVSGYRGSPLGGVDQNMWKAAKYLKAHHVEFQPGINEDLAATAVWGS
FT                   QQVNLFPGAKYDGVFGMWYGKGPGVDRCGDVFKHANAAGTSRHGGVLVVAGDDHPAKSS
FT                   TLPHQSDHILKACMIPALFPSSVQEVLDYGLHGWAMSRYAGVWVGMKCITDIVEVSASV
FT                   DVDPCRVEILLPQDFQLPADGLNIRLPDTPLQQEARLLDYKLYAALAYARANKLNRELW
FT                   HVPQRDARFGIMTSGKAYLDTRQALSDLGLSEAVCQRIGLRLFKVGMVWPLESTGMQRF
FT                   AEGLDEILVVEEKRQVLEYQLKEELFSWIGSGKKIPRVVGKFDDKDGGEWSVPQGNWLL
FT                   PAHYEFSPAMVARAIAARLLRFELPADVRAGIEARLAFISGREQELARPRVVEERKPWF
FT                   CSGCPHNTSTRLPEGSRGMAGIGCHYMVRWMDRSTDVFTQMGGEGVPWVGQAPFTEEKH
FT                   VFANLGDGTYFHSGLLAIRAAVAAKVPITYKILFNDAVAMTGGQPVDGPLSVPMISRQM
FT                   AAEGIEKIVVVTDEPGKYKQIEGLAPGVPVRHRDELDAVMRELREHPAVSVLIYDQTCA
FT                   TEKRRRRKRNAYPDPARRVLINERVCEGCGDCSQKSHCLSVEPLDTEFGRKRTINQSSC
FT                   NKDFSCLKGFCPSFVTVEGGKLKKPGALEQDGAIDEDVPHPAARELHQPYGVFIAGVGG
FT                   TGVVTIGQLLGMAAHLEGKGCSVLDMAGLAQKGGAVYSHVVLAQTPDHLLNTRVAMGEA
FT                   DLLLAGDLVVATSAESMARVNPDRTRILFNSDTAPTAAFVSNPDWTLPGANLIADLAAA
FT                   CGKEHLATVDAAALAVGLLGDAIYSNPLMMGYAYQKGWIPLSQEALLRAIELNGQQVPN
FT                   NLSAFAWGRRAAHDLAAVKRLIANGGAPSRPEGIIELKRPRAASPVLELKKPTGELEQL
FT                   VAVRKAFLTDYQNAAYARQYTELVDKVVRAEREATGTNRLALAVARYYFKLMAYKDEYE
FT                   VARLYSDGEFVKRVRAQFEGDWKLRFHLAPPLFARRDKNGHLIKRSYGPGMLRVFRVLA
FT                   KMRGLRGTKLDPFGYTAERRAERELIREYGETMTAILSKLNRGNLERAVALASLPEEIR
FT                   GYGHVKDAAMERVALRRGELLKGFSASVVSIGGVRVA"
FT   gene            complement(575859..577325)
FT                   /gene="glpK"
FT                   /locus_tag="AXYL_00544"
FT   CDS_pept        complement(575859..577325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="AXYL_00544"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13902"
FT                   /db_xref="GOA:E3HWJ3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWJ3"
FT                   /protein_id="ADP13902.1"
FT                   /translation="MFDREGVVRGVGQREFRQHYPRPGWVEHDASEIWHSQLDVAREAL
FT                   RNAGATAADIAAIGITNQRETTVIWERATGRPLARAIVWQDRRTAPMCDQLRQDGHADF
FT                   LQSRTGLVLDAYFSGTKLAWLLDHVPGARQMAERGELAFGTVDTWLIWQLTGGAVHSTD
FT                   PSNASRTMLFDLHTQDWNDEILALLKIPRSVLPAIAPSSAVVGEALPEWLGGSIPIAGV
FT                   AGDQQAATFGQACFTPGMAKNTYGTGCFMLMNVGDKPVQSRNHLLSTVGWGLPQAGNGG
FT                   WRPTYMLEGGVFVAGAAVQWLRDGLGIIQRSEEIESLAASVADTDDVFMVPAFAGLGAP
FT                   HWDPYARGTLVGLTRGTTRAHIARATLESIALQSAELLTCMNGDSGIALTELRVDGGAA
FT                   RNDLLMQMQADLLGVPVVRPRVSESTALGAAGLAGLAVGFWSGLDEFASKWQAERTFEP
FT                   TWPESVRAARMKRWRQAVELSKGWSDSAGK"
FT   gene            complement(577372..578754)
FT                   /locus_tag="AXYL_00545"
FT   CDS_pept        complement(577372..578754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00545"
FT                   /product="major facilitator superfamily protein 10"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13903"
FT                   /db_xref="GOA:E3HWJ4"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWJ4"
FT                   /protein_id="ADP13903.1"
FT                   /translation="MIPFIVGCALFMQMLDATVVATALPAMARALGSTPVRLNVAITSY
FT                   LLSVAVFVPVSGWAADRYGARRVFVAAIGLFTLSSVACALSQDLPQLVLARIVQGMAGA
FT                   MMVPVGRIILLRTVPKQDLLKAMSFLSIPALLGPVIGPPLGGFMVTYMSWHWIFLINIP
FT                   IGILGIFLVLRYVAEIREESAPRLDWPGFLLSAICLATLVSGFEAIGRDVMPLSMLLGL
FT                   IAVGTVCGLLYGWHAKRTEHPIIDLSLMRIPTFAISTLGGNLCRFAVGATPFLLAMLLQ
FT                   VGFGLTPFAAGLITFASAAGALLMKFVATPIVKHFGFRRVLTVNAVLAGAFIVICGAFT
FT                   PTTPVWLMIAILLVGGFFRSLQFTGVNTLTYADIPPSKMSRASSFAAMAQQLGISLGVG
FT                   VAAVTLNISMSLRGAETLAIRDVVAGFIVVGVLCMASTFSFRRLEPLAGAHLNGAKQSD
FT                   DE"
FT   gene            578925..579113
FT                   /locus_tag="AXYL_00546"
FT   CDS_pept        578925..579113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00546"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13904"
FT                   /db_xref="GOA:E3HWJ5"
FT                   /db_xref="InterPro:IPR021853"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWJ5"
FT                   /protein_id="ADP13904.1"
FT                   /translation="MATNYESEITLFLKDFKQSHPGTEERQREGRARLWDKPQDSELLE
FT                   GFRAARVPQRPYVYQAD"
FT   gene            579130..580020
FT                   /locus_tag="AXYL_00547"
FT   CDS_pept        579130..580020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00547"
FT                   /product="ScpA/B family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13905"
FT                   /db_xref="GOA:E3HWJ6"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWJ6"
FT                   /protein_id="ADP13905.1"
FT                   /translation="MAQHASVPGDALAALVEPPVDSTPDTIDSVAFARLYGEPLFQMPT
FT                   DLYIPPDALEVFLEAFEGPLDLLLYLIRKQNFNVLDIPMADVTRQYLSYVDQIRIHNLE
FT                   LAAEYLLMAAMLIEIKSRMLLPVKKSDTGEEAEDPRAELVRRLLEYEQMKLAAKKLDAM
FT                   PQLGRDFVSSQAVADLSVERMLPEVSVDDLRAAWADIMKRAKLNQHHHITREQLSVRDH
FT                   MTHILRRLNDVRFMEFGDLFMERVREGAPAAVVVVHFIAMLELARESLLEITQAEPYAP
FT                   IYVRLAYTSVAAVAA"
FT   gene            580057..580911
FT                   /gene="panC"
FT                   /locus_tag="AXYL_00548"
FT   CDS_pept        580057..580911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="AXYL_00548"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13906"
FT                   /db_xref="GOA:E3HWJ7"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWJ7"
FT                   /protein_id="ADP13906.1"
FT                   /translation="MKVVHTIQELRDHLRGQNRVSFVPTMGNLHEGHLSLMKLARQHGD
FT                   PVVASIFVNRLQFGPNEDFDQYPRTLAADIEKLERERDVYVLFAPNEREMYPEPQSFRV
FT                   QPPDDLGDILEGEFRPGFFEGVSTVVLKLFSCVQPRVAVFGKKDYQQLMVVRNMCRQFQ
FT                   LPVDVLAHETVRAEDGLALSSRNRYLSEADRAEAPALYAALQRAGQRLAQGERDAAALE
FT                   REATETLTRRGWQVDYVALRRQRDLKRPEAADLQAGEPLVALAAAKLGATRLIDNLELA
FT                   YTA"
FT   gene            581028..581456
FT                   /locus_tag="AXYL_00549"
FT   CDS_pept        581028..581456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00549"
FT                   /product="bacterial regulatory protein, LuxR family protein
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13907"
FT                   /db_xref="GOA:E3HWJ8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWJ8"
FT                   /protein_id="ADP13907.1"
FT                   /translation="MQAPRPDLEAVLSSLTPRERQIVTYVAAGRPNKVIAIDLGISLRT
FT                   VEAHRSRIFTKLQVRNAMQLACRLCEHGRSGASPVPGAADTDREHALIPMPLAGSASPS
FT                   YVLHEAPGPEYGRCLASSASSSSSSFSYPGADPGRDTD"
FT   gene            complement(581550..582329)
FT                   /locus_tag="AXYL_00550"
FT   CDS_pept        complement(581550..582329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13908"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWJ9"
FT                   /protein_id="ADP13908.1"
FT                   /translation="MTARVEIGTRSRKLSVMGLLLAGTALGAAGCAQQKTEGYYDPPAE
FT                   STVTDAQYQGSGAGYRSIIRAPSQVQIALKPDAPRKNQNQAAQAAAGGQTTEDGQAVPA
FT                   DTEHTTTASAASAPVAASPAAPNAAVQSLVPQPQTYMGTLPCFSPAMQCTAQRVTLTLA
FT                   PNGRWRGRVAYLENDPKKGPPVTEQGCWDATEERPPRVILMDGKGNGRAEFVVAANNVL
FT                   RVRSIDGQTPNLNYNLTRQPDLDPIDELAKAAAPKCP"
FT   gene            582524..583381
FT                   /gene="pilD"
FT                   /locus_tag="AXYL_00551"
FT   CDS_pept        582524..583381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="AXYL_00551"
FT                   /product="type 4 prepilin-like protein leader
FT                   peptide-processing enzyme"
FT                   /EC_number="3.4.23.43"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13909"
FT                   /db_xref="GOA:E3HWK0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWK0"
FT                   /protein_id="ADP13909.1"
FT                   /translation="MTAMRHVFDLPLGVFIGLAALAGLFVGNWLTVLTHRLPRMMEQEW
FT                   QAHCQEAAGKPPAASRYGLWSPASHCRACDTPVAGWRRLPLLGWLLLRGRCGACGAAIG
FT                   WRYPAIELLTCALFAACAWRFGATPLALSAMGLSAALVALAWIDFESTLLPDALTQPLL
FT                   WAGLLVNLFDAFASLQMAVVGAVAGYVFLWVIFHVFRLLTGREGMGYGDFKLLAALGAW
FT                   FGVEALPTLLLSASLLGVLIGGALTLSGRAGRGQPLPFGPYLALAGVVTLLVGGELGLG
FT                   QFLQ"
FT   gene            583413..584042
FT                   /gene="coaE"
FT                   /locus_tag="AXYL_00552"
FT   CDS_pept        583413..584042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="AXYL_00552"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13910"
FT                   /db_xref="GOA:E3HWK1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWK1"
FT                   /protein_id="ADP13910.1"
FT                   /translation="MLKIGLTGGIGSGKSRVADMLAEWGATLVDTDEIARTLTAAGGAA
FT                   MPAIEREFGPRALTPDGALDRAWMRDQAFSDPQVRLRLEAVLHPVIGHETERQADAARG
FT                   VYLVFVVPLLVESLPRWRSRLDRICVVDCDPDTQVARVRQRSGLTEPAIRRIMAAQAAR
FT                   ASRLEVADDVIVNDGGTTPDQLRAQAKTLHDRWLALASTTGRQAPG"
FT   gene            584103..584855
FT                   /locus_tag="AXYL_00553"
FT   CDS_pept        584103..584855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13911"
FT                   /db_xref="GOA:E3HWK2"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWK2"
FT                   /protein_id="ADP13911.1"
FT                   /translation="MIVYEYPFNERIRAYLRLEYLFDRLFFFAREGDSRLHQVAVTSLF
FT                   DLLDACERTDVKGAVLQDLERQRMALVGLRDHPGVAQDALEAMLREMEKVTTALAAPGK
FT                   TGQSLRENEWLTSLRGRLSVPGSATQVDMPSYFAWQNKSEAARCADLQAWVAPFIPLYD
FT                   GLTLALRLLRESGRKSDVVGEQGAYQQMLGGKQFQLLRVWLDPSQGVFPEISANKYMIW
FT                   IRFSTQDGEFKPQQVARDVPFQMTLCSS"
FT   gene            585099..586370
FT                   /locus_tag="AXYL_00554"
FT   CDS_pept        585099..586370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00554"
FT                   /product="efflux transporter, RND family, MFP subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13912"
FT                   /db_xref="GOA:E3HWK3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWK3"
FT                   /protein_id="ADP13912.1"
FT                   /translation="MPDSRPVSPPTRWTRRRLLGLALVLLVAAGVAWLVLRPAAKPGGA
FT                   GGPGARGGRPPAGAMMTPAVPVRIATATKQDIDIYLKSLGTVTAYNTVTVRSRVSGELV
FT                   EVAFQEGQRVKAGDLLAQVDPRAFQVALDQARGTQMQNLAQLENARRDLQRYQALYKQD
FT                   SIAKQQVDTQAALVRQYEGTVKSDQANVDNARLQLDYARITAPISGRLGLRQVDRGNLV
FT                   SSSDTNGLVVITQTQPISVVFTLPETQLPEVRAEIAAGKTLAVDAYDRADTRRIATGQL
FT                   ETMDNQIDVTTGTLKLKARFENADDALFPNQFVNVRLHVLTRKDVTAIPTAAIQQGSAG
FT                   AFVFLVQPDNTVQVRQLKLGAVNNGMVAVNEGLQPGDRVVVEGTDRLRAGAKVEVAGGS
FT                   DVIPAARDKNLGAGAPAGTTPPSK"
FT   gene            586384..589482
FT                   /locus_tag="AXYL_00555"
FT   CDS_pept        586384..589482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00555"
FT                   /product="multidrug resistance protein MdtB 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13913"
FT                   /db_xref="GOA:E3HWK4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWK4"
FT                   /protein_id="ADP13913.1"
FT                   /translation="MSPSRLFILRPVATTLSMVAILIAGFIAYRLLPVSALPEVDYPTI
FT                   QVVTLYPGASPDVMTSLVTSPLERQFGQMPGLNQMSSTSSGGASVITLQFNLTLPLDVA
FT                   EQQVQAAINAASNLLPSDLPVPPTYNKVNPADAAVLTLAITSPTMPLPQVRDLVDTRVA
FT                   QKLSQIPGVGLVSVAGGQRPAVRVQVNPQALAANGLSMSDLRTAIVGANVNQPKGNLDG
FT                   PQRSTTINANDQLKTPTDYNDLIIAYKNNAPLRLSDVARAVEGAEDTRQAAWAGDKPAI
FT                   LLNIQRQPGANVIDVVNRIQALLPQLRAALPATLDVSVVSDRTQTIRDSVADVQFEMML
FT                   AVALVVMVTFVFLRSLTATLIPSVVVPLSLVGTFGIMYLAGFSINNLTLMALTIATGFV
FT                   VDDAIVMIENIARHIEEGETPLQAALKGASQIGFTLISLTFSLIAVLIPLLFMTEVVGR
FT                   LFREFAITLAVSILISLVVSLTLTPMMCARLLRAESEQKHGRFHQATGAFIDRVIAGYD
FT                   RWLQVVLRHQPLTLIVALATFALTVLLYLVIPKGFFPQQDTGLIQAITQAPQSISFPAM
FT                   SDRQRTAARLVLEDPDVQAVSSFIGVDGSNATLSAGRMQIALKPQSERNGDLRTVMARL
FT                   EQALAKQDGLTVYMQPVQDLTIEDRVSRTQYQMTLSNPDLKVLSEWTPKLVNRLRQVPG
FT                   LKDVTDDLQDDGLQTWVEIDRDAASRLGITAAVIDEALYNAFGQRLISTIFTQSNQYRV
FT                   VLEVEPQFQVTPASLGQIHVPTSTGAQVPLSSVAHISEGKTVLAVNRLDQFPMVTVSFN
FT                   LAPGASLSGAVEDIIAAEAEIGLPTGVETRFQGAALAFQNSLSSTLWLILAAVVTMYIV
FT                   LGVLYESYIHPITILSTLPSAGVGALLALLISGTELDMIGIIGIILLIGIVKKNAIMMI
FT                   DFALDAERKRGLSPRAAIHEAALLRFRPILMTTLAALFGALPLMLSTGTGAELRQPLGL
FT                   VMVGGLLLSQVLTLFTTPVIYLMFDRMSRRWRGVEQAPAGDAS"
FT   gene            589479..592592
FT                   /locus_tag="AXYL_00556"
FT   CDS_pept        589479..592592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00556"
FT                   /product="multidrug resistance protein MdtC 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13914"
FT                   /db_xref="GOA:E3HWK5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWK5"
FT                   /protein_id="ADP13914.1"
FT                   /translation="MILSAPFIVRPVATTLLSLAVVLAGMLSFFLLPVAPLPQVDIPTI
FT                   SVSASLPGASPETMASSVATPLERSLGSIAGVTEMTSSSSQGSTRITLQFDLSRDINGA
FT                   ARDVQAAINAARSLLPTSLRSNPTYHKSNPSDAPIMTLALTSDTLSQGQLYDIASTIVA
FT                   QKLSQVDGVGEVTVGGSSLPAVRVTVLPGALANRGVSLDQLRATLANANANRPKGVLEN
FT                   DRYHWQIMASDQLSRAEQYRPLIVAWKDGAPVRVSDVARVEDSVEDLYQTGFYNDRKAI
FT                   LMIVRRQADANIIEAVDAVRAQLPILQALMPADAHMTVAQDRTPSIRASLHEAELTLII
FT                   AVGLVVLVVLLFLRRWRAAIIPSVAVPVSLIGTFCIMYLSGFTLNTISLMALIVATGFV
FT                   VDDAIVVLENIMRHVERGMSPMRAALRGSREVGFTVLSMSLSLVAVFIPILLMGGVVGR
FT                   LFREFAVTLSAAIIVSLVVSLTLTPMMCARLLRQEAPEEKPPGRLARWSERGFESMLDG
FT                   YRRSLRWALTHSRLMMLILAVAVGLNVYLYTVVPKGFFPQQDTGQLLGFFRVDQGTSFQ
FT                   ATLPKLEALRKVVLADPAVQSMTGYAGGRGGSNSSFMQIQLKPLEERQVSADVVINRLR
FT                   GKLQNMPGARMFLVSQQDIRIGGRQSQGSYDYTLMAGDLQLLRTWMPKVQQAMAQIPEI
FT                   TDVDTDVEDKGRQINLVIDREAATRLGVSMSTISTVLNNSFSQRQVSVMYGPLNQYHVV
FT                   LGVDPKFAQDIESLRQVEVITAAGARVPLSAFTRLENANAPLSVQHQGLFVADTISFSL
FT                   APGVSLGQATSAIDAAVARIGLPSDQIQAGFQGTAAALQQTLAQQPWLILAALVTMYIV
FT                   LGILYESFVHPLTILSTLPSAGLGALLALLLVRYDFTLIALIGVFLLIGIVKKNAIMMV
FT                   DFALDAERTQGMSPRDAIFQACLTRFRPIMMTTMAAIFGALPLVLATGAGVEMRQPLGI
FT                   TIVGGLVLSQILTLYTTPVVYLYLDRFRLWAARRRGPKGGSSASIEPT"
FT   gene            592589..594112
FT                   /locus_tag="AXYL_00557"
FT   CDS_pept        592589..594112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00557"
FT                   /product="multidrug efflux system lipoprotein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13915"
FT                   /db_xref="GOA:E3HWK6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWK6"
FT                   /protein_id="ADP13915.1"
FT                   /translation="MMRIAKPVPPLFLPRSIATAALCALLGACAVGPDYQRPALDVGTA
FT                   YKEGQGEVEGWKPARPLDQAERGAWWQVYDDATLNGLVERLNASNQTVAQAEANYRQAL
FT                   GLVRGARAGFFPTVGAGAGMTRSGSGGGQNGSTSSSGSNVSNQYSLTGSVSWEVDLWGR
FT                   VRRSVESSEASAAASLADLGATRLSAQAALVQAYLQLRVLDEQKRLLDATVAAYEKSLQ
FT                   LTQNRYAVGVAGQADVAVARTQVESTRAQSIDLDWQRGQLEHAIAVLMGQAPSQFSLPP
FT                   TVFALQLPQIPVGLPSELLERRPDVAAAERRAAAANAQIGVAQAAWFPSLTLSADGGFR
FT                   NGQFAELLTAPARFWSLGPALALTIFDGGAREAQVEQARASYDAQAAAYRQAALTGLRE
FT                   VEDYLIQLRVMENEQVVQRRALESARESLRLTQNQYKAGLVDYLSVAVVDATALNSERN
FT                   ALSLLGNRFAASVNLIVALGGGWEGLPPAGAQARADNQAAPAAATPAQP"
FT   gene            complement(594169..594438)
FT                   /locus_tag="AXYL_00558"
FT   CDS_pept        complement(594169..594438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00558"
FT                   /product="putative membrane protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00558"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13916"
FT                   /db_xref="GOA:E3HWK7"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWK7"
FT                   /protein_id="ADP13916.1"
FT                   /translation="MHVLLTIVGGLLLLAVFALFGKQWGGDAAGSIAAAKWFLPAWLLM
FT                   SVVNMWVGVTRAGYTVREELPILLLVFAVPAAAAWLVVAFMPRG"
FT   gene            complement(594449..595222)
FT                   /locus_tag="AXYL_00559"
FT   CDS_pept        complement(594449..595222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00559"
FT                   /product="short chain dehydrogenase family protein 10"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13917"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWK8"
FT                   /protein_id="ADP13917.1"
FT                   /translation="MADHGIKGKTVIIAGGAKNLGGLIARDLAQQGARAVAVHYNSAGT
FT                   KADADATVAAVQAAGAQAVALQADLSSAGAMEKLFADAVAAVGRPDIAINTVGKVLKKP
FT                   FTEITEAEYDEMTAVNSKSAFFFLKEAGRHVNDNGKICTLVTSLLGAYTPFYAAYAGTK
FT                   APVEHYTRAASKEFGARGISVTAVGPGPMDTPFFYPAEGADAVAYHKTAAALSPFSKTG
FT                   LTDIEDVVPFIRFLVSDGWWITGQTVLINGGYTTK"
FT   gene            595370..596278
FT                   /locus_tag="AXYL_00560"
FT   CDS_pept        595370..596278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00560"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 18"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13918"
FT                   /db_xref="GOA:E3HWK9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWK9"
FT                   /protein_id="ADP13918.1"
FT                   /translation="MDRIDLFRVYARVVECANFSRAADTLGLPRSTVSAAVQELEGRLG
FT                   ARLLNRTTRQVAPTQEGAAFYERCLRLVADMEEAENLFRHASVGPGGMLRVDVPGRVGR
FT                   LIVAPALPAFLEAYPQIDVTLGVTDRAVNLIEEGVDCVLRVGVLPDSGLVARPIGMLGL
FT                   INVASPAYLARHGVPSTPDDLAAGHSCVNYASPSTGRLAPWEWLDGGVSRTVPLRGRVT
FT                   VNSAEAYIASCVAGLGLIQIPAYDVQPQIAAGELVEVMPDHRPAPMPMTLLYPQRRSPS
FT                   RRVQVFADWLEALLRPACGLG"
FT   gene            complement(596361..597779)
FT                   /locus_tag="AXYL_00561"
FT   CDS_pept        complement(596361..597779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00561"
FT                   /product="amidase family protein 3"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13919"
FT                   /db_xref="GOA:E3HWL0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWL0"
FT                   /protein_id="ADP13919.1"
FT                   /translation="MSDIAFATLSELAQGLAEGRYSSVELARHYLDRIDRANPALGAYV
FT                   SVDREGALRLAEAADARRRAGYGLLGPLDGLPVAVKDLCDIQGQVTTAGSQAWRERRST
FT                   VTATPVTRLVDAGMVVLGKTHMVEFAFGGWGTNPVMGTPRNPWDLVRARIPGGSSSGSG
FT                   VAVAAGLAPAALGSDTGGSVRIPAALNGITGLKTTRGLISLYGSVALSHTLDSIGPLTR
FT                   DTRDSLLLTAAMSGPDPRDPVTRGVPAYRYRDPRAGAKPLAGTRIALMPQAQYPIAIDA
FT                   AVQNALDDTRRALADLGAECVEAPFPFDFHDMMLRNGLIIAAEAYAQHRDYIEDDSLPL
FT                   GRYVRARILGGKQTSAADYVLALQAHARACEAWQDWMRDYDAVLAPCLPFAACPLEDVD
FT                   EAATPLAAFTRPGNYVNASGLALPAGFSADGMPIGVQLLGKPNGEDALGRIGMAFQAAT
FT                   DWHLRRPDLSAIQL"
FT   gene            complement(597844..599076)
FT                   /locus_tag="AXYL_00562"
FT   CDS_pept        complement(597844..599076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00562"
FT                   /product="receptor family ligand binding region family
FT                   protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13920"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWL1"
FT                   /protein_id="ADP13920.1"
FT                   /translation="MHAKPWLSRLPALALAVAALTPALGAAQTSDKIRVGMTVSSTGSF
FT                   ALASQSGVRGVELWVDDVNRRGGIEVKGKKYPVELVKLDDRSDKQMVTRVYERLIVDEK
FT                   VDLVFAPFGSTLTAAAATVTERLGKYMMVWSAASDDLYKQGFKNMVSGTQMPVSAMLRA
FT                   NMELAANQGVKKVAILYSDEPFPAGLAEGGKEQAAKNGMQVVLFEKYPKGQKDFSTILQ
FT                   KARAAGAEALVPTSYEGDLISMTRQMKQLDINFPYVFMVYASTPQFQAIGADSNYIYSH
FT                   TNYHPAINWKVNAGMTREQFAAAYDQRFPKAEFPPDFQTALAYGAGALTEEIVKQAGNT
FT                   DAAALKKASLDLSGKLTVMAGPYAIDETGKQLLMPFPVVQLLPGKGMVPVWPADVATQK
FT                   PVYPAPDWNKR"
FT   gene            599208..600122
FT                   /locus_tag="AXYL_00563"
FT   CDS_pept        599208..600122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00563"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 19"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13921"
FT                   /db_xref="GOA:E3HWL2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWL2"
FT                   /protein_id="ADP13921.1"
FT                   /translation="MNKLNYRQTEMLWAIVMAGSISGAARLLNISQPAVSRMLAHTEKA
FT                   MGVTLFERVRGKLRPTSQVQSLFEEIEKTQRMMQRVNDLADALAEHGTGVLRLASIPSL
FT                   AQFLVPRAVARFQQRHPELLLRLNTTALPTLITDVLQGEAELGLVVMQADHPFLTSQPL
FT                   HVGRMVAAIPKAHPLAGRAEVSLADLSPHPHIVVGTRMPFGMLVLGAFEQAGLPCRMCA
FT                   DVPWSQLACALVNAGVGIAIVDEFTVMQNTMPDVVIVPLAERIPLNISAVYASNREPSA
FT                   IALEFIKELRGVLAEAFPAENKG"
FT   gene            600212..601204
FT                   /locus_tag="AXYL_00564"
FT   CDS_pept        600212..601204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00564"
FT                   /product="inner-membrane translocator 8"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13922"
FT                   /db_xref="GOA:E3HWL3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWL3"
FT                   /protein_id="ADP13922.1"
FT                   /translation="MSSSPVLAAGAASHRAQDQRAVRLRTRIAIIVFAGLAAGLALIPM
FT                   ATSNISFAFYLMLWITMASAMNICVGFTGYLPFGYVVFYGVGSYATGICYKILGWPILP
FT                   SLLAAGGVGVAIALLLAPTLRLRGVYFGIVSLALATIVKLIISNLPQSFTGGSMGIILS
FT                   NANNPTHSYYAMLAVMGATLATVTWLSVSSLGRALKAIRDDDGAAACVGIHVPNTRLKA
FT                   WLLAALFPALAGGIEAWYTNVVDPEYAFHVLITAKSIIYAMAGGFGTILGPVVGTLALL
FT                   GIDHVIWQKFPVVNLLLLGLIIVLLMLFLPRGIVGSLIKRKPQLRRYIA"
FT   gene            601214..602095
FT                   /locus_tag="AXYL_00565"
FT   CDS_pept        601214..602095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00565"
FT                   /product="inner-membrane translocator 9"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13923"
FT                   /db_xref="GOA:E3HWL4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWL4"
FT                   /protein_id="ADP13923.1"
FT                   /translation="MTGLIIQGLINGLILGAIYGLIGVGLNVIFGVLRVVNFAHGEFLV
FT                   LGAYFAFYLMEYAGINPLVALPLAFAAFFLAGYLLYFVLIPRLSKADDPEISSLLLMFG
FT                   VSIMLGAIMLLVFDADARSLPYEIEPVFLKFGPVLIPTVRLLALVIALAIIGALTVFLY
FT                   RSQLGKALRAIIMNRDAVRIVGINAERLSAVAFGLGIGLAATSGVLVAMVFPAFSPFMG
FT                   NDYTLIGFIVIVLGGLGHPVGALVGALLFGVTEQVSVVFFNPSIATICGFALMVATIFI
FT                   RPSGLFGRQALR"
FT   gene            602110..602817
FT                   /gene="braF2"
FT                   /locus_tag="AXYL_00566"
FT   CDS_pept        602110..602817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braF2"
FT                   /locus_tag="AXYL_00566"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   ATP-binding protein BRAF 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13924"
FT                   /db_xref="GOA:E3HWL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWL5"
FT                   /protein_id="ADP13924.1"
FT                   /translation="MLKVSNLKKRFGGLVALQGVDVDVPRGSILGIIGMNGSGKTTMLN
FT                   CINGIYTPDEGRIELDGQNIAGKQIHEVARLGVGRTFQVPRIFRQLTLLDNLEVAQQQT
FT                   GRSADERYAQSEYWLHKVELHRLRHNYAEELSGGQQKLVELARIMVARPKVVLLDEPFA
FT                   GVNPALAQLLISVIRELPGEHDCSVVLVSHDLTSIYQLSHHIIVMNEGAILSQGNAEQV
FT                   RADPRVVEAYLGA"
FT   gene            602819..603559
FT                   /locus_tag="AXYL_00567"
FT   CDS_pept        602819..603559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00567"
FT                   /product="ABC transporter family protein 9"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13925"
FT                   /db_xref="GOA:E3HWL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWL6"
FT                   /protein_id="ADP13925.1"
FT                   /translation="MSTSILALEDVTVAYHGDITILNHVNIQARAGKVTGVIGPNGAGK
FT                   STVLKTMFGFLPPRTGRITLRGADISAQPSHERASHGVAFVPQHRSLFGELSVHDNLLL
FT                   GCWPFRKDKARVRQRIDSVYDRFPILAQKRDDPVSSMSGGQQRFVEFGRALLIEPSVIL
FT                   LDEPTAMLAPKISKEIYTLIRGFADEGMTVVLVDQNVRRCAEVSDYMYILELGRNKAEG
FT                   GREAFDDGGGLREMVASWMDYKID"
FT   gene            604058..605251
FT                   /locus_tag="AXYL_00568"
FT   CDS_pept        604058..605251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00568"
FT                   /product="bacterial low temperature requirement A protein
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00568"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13926"
FT                   /db_xref="GOA:E3HWL7"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWL7"
FT                   /protein_id="ADP13926.1"
FT                   /translation="MTFFASANLLRRRDGHEARVTYVELFFDLVYVFAVTQISHSLLHD
FT                   LTLMGALHALVLWFAVWLGWQYTCWVTNWFDPDAVPMRVMLFAVMLAGLVSGAALPGAF
FT                   GATGLVFAVSYVLIQVGRTLFIVLHLGPAHPLAPNFRRMLAWLCVSAVLWVAGGLSQDG
FT                   TRLALWALAVACEYLSPMIGFRFPGLGRSSTREWTIEGGHLAERCQLFVIVALGETLLI
FT                   SGATLADLERWNAPALIALLAAFLGTAAMWWVYFDTSSRDGSEAIVHSDDPGRIGAWFH
FT                   YVHVILIAGVIVSAVANELVILHPDGRIAMPAAAALIGGPALYLAGNGIYKTVVYGRFP
FT                   LSHVVGLVLLAVLAPVAFVTDNLMVGGLTTLIMILVAAWESVSRRRAHASAPQGIVE"
FT   gene            complement(605355..606317)
FT                   /locus_tag="AXYL_00569"
FT   CDS_pept        complement(605355..606317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00569"
FT                   /product="NUDIX domain protein 2"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13927"
FT                   /db_xref="GOA:E3HWL8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWL8"
FT                   /protein_id="ADP13927.1"
FT                   /translation="MSEKIVDVAAGLILRPDGMLLLGQRPEGKPWAGWWELPGGKLEPG
FT                   ETVLQALARELQEEIGIRVTQSRPWVTYVHAYPHTTVRLAFCHVTGWEGEPRSLENQRL
FT                   EWVAPAQAASVGDLLPATLPPLRWLQLPTSYGISSVGSRAGVAAFLGRLEAALARGVKL
FT                   VQLREPQWPDGVASPSLHEVLQQVQKRCRAAGARVLVNSVHPAAWWREADGVHLRAADA
FT                   AKLTARPELPAGALVGASAHDNAQVVHARELGADFAVLGPVLDTPSHPGAATLGWEGFV
FT                   EGNRDAGIPVFALGGQSTQTVSQALRHGAHGIAGIRGLI"
FT   gene            complement(606310..607176)
FT                   /locus_tag="AXYL_00570"
FT   CDS_pept        complement(606310..607176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13928"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWL9"
FT                   /protein_id="ADP13928.1"
FT                   /translation="MTATEFSTLIQRAERVLAQLEAWLPPATPEIDWTAHAYRWRKRGA
FT                   RGWLDAVRHVARIDMADLQHIERQKGIIDRNTLQFLEKKPANNVLMTGARGTGKSSLVK
FT                   AMLAAYGDRGLRLIEVDKSDLGDLADIVELVAARPERFIVFCDDLSFEEGEAGYKALKS
FT                   VLDGSVSASGDNVLIYATSNRRHLMPEYMSENLAAKHQLDGEIHPGETVEEKISLSERF
FT                   GLWLSFYPFKQDDYLDIVYHWLRELGCPEAQIEPSRTEALQWTIERGSRSGRVAYQFAR
FT                   DWAARHV"
FT   gene            complement(607201..608427)
FT                   /gene="argJ"
FT                   /locus_tag="AXYL_00571"
FT   CDS_pept        complement(607201..608427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="AXYL_00571"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13929"
FT                   /db_xref="GOA:E3HWM0"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWM0"
FT                   /protein_id="ADP13929.1"
FT                   /translation="MAVNLQIPSESEIFPVAGVEIGVTEAGIRKANRRDLTVFRFAPGT
FT                   SVAGVFTRNRFCAAPVQVCQTHLAAGGPISALVINTGNANAGTGEEGLQKAKDTCAALG
FT                   KLLGVPAAEILPFSTGVILEPLPLDRLVAGLPAAIADLGADHWFSAAHGIMTTDTLPKI
FT                   ASAKVQIGGKTVTFTGISKGAGMIRPNMATMLSFLATDAGIAQPLLAKLAGEIADASFN
FT                   RITVDGDTSTNDSFIIAATGKSGVEVNAESDPAYAAVREALTAAALELATKIVRDAEGA
FT                   TKFMTIRVEEAGNTEEALKVAYAVAHSPLVKTAFFASDPNLGRILAAVGYAGIDDLDVS
FT                   NIRLWLDEVLVAKDGGRNPAYQEADGQRVMKQAEIQVRIALGRGQVSDTVYTCDFSHEY
FT                   VSINADYRS"
FT   gene            complement(608527..609549)
FT                   /locus_tag="AXYL_00572"
FT   CDS_pept        complement(608527..609549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13930"
FT                   /db_xref="GOA:E3HWM1"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWM1"
FT                   /protein_id="ADP13930.1"
FT                   /translation="MIPVSLPGGNFYVLMAASLACLATLLTWLAVLATTSSARAWLGGH
FT                   RRGGAIVMALLAIIGAIFPYQQFSLWFSARQSAQSDAERKTVLAQPTQLAGLEMPAGTV
FT                   LSLAKPGDLTSFDLAVFPEAHPASIQGVAATRLFRYPASSKQAETLSVEIARDQAQDGW
FT                   LCAHGHRLEFVLREGRPSFASCHLAIGNTLNQQPVPPGAWLKVVNGAPAADAPRWLLRT
FT                   EGSDALEVARMPLLKVDMQLDSQRRMLDFEGLLARETVLGDMTYQPGTRVLAANLRLPG
FT                   AQPGDLLFSPSRGRSARRAGGEDVPAGKSVLQAPDGAVRSVLSNREAGVLDVAAMRIGP
FT                   "
FT   gene            complement(609600..610094)
FT                   /locus_tag="AXYL_00573"
FT   CDS_pept        complement(609600..610094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00573"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   MarR family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13931"
FT                   /db_xref="GOA:E3HWM2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWM2"
FT                   /protein_id="ADP13931.1"
FT                   /translation="MTDTPDLESRAAPDDHHALRLWLRMLTCANLVESEIRSRLRTEFD
FT                   TTLPRFDLMAQLQRAPKGMKMGELSRHMMVTNGNITGITDQLEKEGLVVRTKVESDRRS
FT                   SLIKLTPLGKKSFARMARAHESWVKSMFGDLPEGTRNALFQALGELKLQVVATRSESAK
FT                   N"
FT   gene            610454..611617
FT                   /locus_tag="AXYL_00574"
FT   CDS_pept        610454..611617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00574"
FT                   /product="receptor family ligand binding region family
FT                   protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13932"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWM3"
FT                   /protein_id="ADP13932.1"
FT                   /translation="MRLITSLLAAAALVPALASADTIKVGIANDISGPFSALGAEARDG
FT                   FNLAIKQLGSKLGGQPAEFVQTDMGGNPDQARQLVTRYIQRDKVDFFTGPIGSNVALAV
FT                   GPALFAAKVPYLSNNPGPSQFAGAQCNAYWFGTSYQNDAFHEAAGKVAADRGFKKMFIM
FT                   APDYPAGKDALNGFKRGYKTAPGDEVYTKLGQIDYAAELAQIRAAKPDAVYIFLPGGMG
FT                   INFVKQFVSTGLAQSVKLIGPGFSADEDVIQAVGEPMLGMYNTAQWAHDLDVPQNKTFV
FT                   EAFRKEYNGRYPSVYAAQAYDVIMAMDAAVKQAGGKVSDREAIVRALEKADYPSVRGSF
FT                   TYGKNHYPIQSYYLRVVDKDGSGRITNKLVGKVFDKYQDVYVGECKL"
FT   gene            611824..612744
FT                   /locus_tag="AXYL_00575"
FT   CDS_pept        611824..612744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00575"
FT                   /product="inner-membrane translocator 10"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13933"
FT                   /db_xref="GOA:E3HWM4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWM4"
FT                   /protein_id="ADP13933.1"
FT                   /translation="MTFTLIVEQLLNGLQFGLMLFLIAAGLTLVFGIMDIMNLAHGSLY
FT                   MAGAYVAAETMQRTGSFTAAVLVAAVATGIVGVVLELTLIRRLALRDHLAQVLGTYAVI
FT                   LIANDLVKMIWGPAPVMLNMPAALSGPVRLLPDLLYPAYRLMIIVFGVAAAAGLYWFVT
FT                   RTRAGVLVRAGASNRQMATLMGVRVPLLFLGVFVLGAMLAAVAGALLGPITSVQVGMGE
FT                   EILILVLVCIVIGGIGSIRGAFVGALLVGMVDTAGRAFLPMLLRQVFSPAVASSVGPTL
FT                   AAIAIYVLMAAVLVFRPSGLFPARG"
FT   gene            612747..613712
FT                   /locus_tag="AXYL_00576"
FT   CDS_pept        612747..613712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00576"
FT                   /product="inner-membrane translocator 11"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13934"
FT                   /db_xref="GOA:E3HWM5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWM5"
FT                   /protein_id="ADP13934.1"
FT                   /translation="MKSIIWTVVLLAALAVFPLVAPALGLDFYISFVRRVLIYALAATS
FT                   LNLILGYGGMVALGHAAFFGAGAYAVGILAMSGVTSALIVWPAAMLLAAVLACITGAIS
FT                   LRTRGVYFIMITLAFAQMLFYIFISLRQYGGEDGLNLPGYSTLPGIDLAHDVSFYYLVL
FT                   ALFALIMWVFSRVVASRFGTALQGIRENESRMESMGYPVYRIKLMAFTLSGAVAGLAGA
FT                   LLANHNLFISPSLMHWTQSANLLIMVLVGGIGLRYGGVAGAVVMLTLEEVLRLWTEYWH
FT                   LPLGVLLLCVVFGAPRGLVGLFGPLFSGRAAAPQSGKVGS"
FT   gene            613709..614476
FT                   /locus_tag="AXYL_00577"
FT   CDS_pept        613709..614476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00577"
FT                   /product="ABC transporter family protein 10"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13935"
FT                   /db_xref="GOA:E3HWM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWM6"
FT                   /protein_id="ADP13935.1"
FT                   /translation="MNAAVTPALQATGLVRRFGALVATDNVSLSLNPGEIHALIGPNGA
FT                   GKSTLIHLLSGTLTADSGTLKVGGRDVTGMNAHQRVSAGLSRSYQITNIFKQSSVLDNL
FT                   VLAVQAHAGSSFRFWKPRAAESALYEQARELARECAIDASLLERPAGTLPHGEQRKVEF
FT                   ALALAARPDVLLLDEPMAGMGPDETVRLTELIESMRGRAAMLLVEHDMQAVFRLADRLS
FT                   VLVYGRVIATGTPDEIRANPEVRQAYLGDEETA"
FT   gene            614476..615180
FT                   /gene="livF1"
FT                   /locus_tag="AXYL_00578"
FT   CDS_pept        614476..615180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF1"
FT                   /locus_tag="AXYL_00578"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   ATP-binding protein LivF 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13936"
FT                   /db_xref="GOA:E3HWM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWM7"
FT                   /protein_id="ADP13936.1"
FT                   /translation="MLTIESAKSGYGASQVLFGVDLQIGAGQVVTLLGRNGMGKTTLLR
FT                   TLFGQLPLRGGKIQFAGQDISGWSPDRIARVGVAIVPEGRQCFPNLTVREHLTAFVAGR
FT                   NPDIGEPWTPERVFELFPRLHERARNMGNQLSGGEQQMLAIGRALVTNPRLLILDEATE
FT                   GLAPKIREEIWNCLARLRQAGQTILVIDKYVERLLSLADRHVILERGKVVWTGDSQALD
FT                   ADRGLWERYLGV"
FT   gene            615525..617480
FT                   /locus_tag="AXYL_00579"
FT   CDS_pept        615525..617480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00579"
FT                   /product="HAMP domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00579"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13937"
FT                   /db_xref="GOA:E3HWM8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWM8"
FT                   /protein_id="ADP13937.1"
FT                   /translation="MALLLACVVALAPAALIGWQVLDGVREHFGRAFSDNFTQLNRQRI
FT                   LAPVSRELALSLRLADSEVTRRWLRHEGDPAARELFFREADGYRRDLLGRAYFIASAAS
FT                   GNYYFNDDQPLSETPRYTLSKSAADDAWFYLTLASAAKYNINVNPDLKLQTTKVWINVQ
FT                   VRDGDRVIGLTGSGLDVGGFLREFVNSGQPGVTPIIVDEEGAIQAHMDASLIAYNSGAG
FT                   GAGAGRGTVFNLLDGGEGRAELAAAMKAARTDPQSVQSAWIKMDGIRQLVSVAYMPELH
FT                   WHVLTVVDLGAARVLDTDWLWPAAIGLVVLFAAMLLCFGYAIERLMLRPLRRLQQSARA
FT                   IADGSYDVRLPPGGQDEIGDLSRAFGVMADKVRQHTAELETKVRERTSELEDANRAMAA
FT                   AHKKIDDSIDYASLIQRAILPDRQLTQSLGAHHFVLWKPRDVVGGDFYVFRSDGANCLL
FT                   GIMDCAGHGVPGALMTMLARAAIDLAITEAGPADPAAILTRTDNAIRAMLADAQLPRAL
FT                   ATNTDAALVYIDRQAGTLRYAGAKISLYASNGEELREVPGGKRALGDKRTEIYENIELQ
FT                   MEPGWTFYLVTDGFLDQAGGEHGFGFGNTRFAEMLKTHARRPLTEQATAFTQALAEYQG
FT                   GQPQRDDITLLSFRFE"
FT   gene            617504..618043
FT                   /locus_tag="AXYL_00580"
FT   CDS_pept        617504..618043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13938"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWM9"
FT                   /protein_id="ADP13938.1"
FT                   /translation="MNASDLYALGERFNQNRTLLCFNGPISRSLIEEIGNALKNYLNAE
FT                   HARPAEAMDVFSVYIEMIQNIRQYAAQHGDVDASATVVIGRRDESRYVVSAGNLVKSED
FT                   GQSLVARIQELAALDKAALKAEYKTQLHKPRAQGVASGAGLGLIDIARRAGAPLEASLT
FT                   PATAPGQAFFSLSVVI"
FT   gene            618081..618458
FT                   /locus_tag="AXYL_00581"
FT   CDS_pept        618081..618458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13939"
FT                   /db_xref="InterPro:IPR018530"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWN0"
FT                   /protein_id="ADP13939.1"
FT                   /translation="MNDLNIPGTQSTPAITADTAAGVLAMRGDSYPENSFELFGPVIEW
FT                   VEAYLLSSAAPLKLELELLYLNTSSIKSVMDIFDLLEAAHGKGREVSVTWFYDMRNERV
FT                   GELAEEFKEDCTFPFSVIGRQ"
FT   gene            618455..619252
FT                   /locus_tag="AXYL_00582"
FT   CDS_pept        618455..619252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00582"
FT                   /product="diguanylate cyclase, GGDEF domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13940"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWN1"
FT                   /protein_id="ADP13940.1"
FT                   /translation="MKSDAAQLDKRIAELLADPAYQDHPLHEALDALWRHTAEQMARIE
FT                   RVTQLSDAYQSMAHERELGLCDRFDRQLRRLTRIARISDHYQSMMRDLNSALLETSNRD
FT                   ALTGLLNRRALMEMIKQEVLRVSRGGSTFVVAMLDVDHFKSVNDRYGHETGDRALVELA
FT                   GALCNNLREYDLCGRWGGEEFLVLLPSTQPEAAQRVMDRLVGAVRALAITVGDGVLGLT
FT                   VSIGMAYHQLGETFSETLSRADQALYLAKQDGRDRVELGFPKR"
FT   gene            619292..621868
FT                   /locus_tag="AXYL_00583"
FT   CDS_pept        619292..621868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00583"
FT                   /product="c-di-GMP phosphodiesterase A"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00583"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13941"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWN2"
FT                   /protein_id="ADP13941.1"
FT                   /translation="MLDSYPGVTDERPQGGAWHPGTYLASMDRALLLFDFNPAGSLLNA
FT                   NANFLALVGHVREEALALRHDMLCDSMDEGKGIVGGEQVWARLLGGKHFTGTCRYRKSD
FT                   GGFVWIEATYMPIADEAGEVVRISVISRKSIADADRQEEVRLLLLGINETGNAVAVSGK
FT                   DGRIVYVNDGFHRMLGFARGDAVNQELGELLAGGRQDGGTREELDRRIACREGYHKDVL
FT                   VYDRAGRPLWVSVMANSVFDERGALVNIVDVLTDITPTKVHEVLQRRVLQAMVNEASVV
FT                   EVMNMVCREVEHLAPEVAASVLRVDDAGLLRPLAAPSLPQAFADALDGVAIGPQAGACG
FT                   TSAFLGRPVIVPDISTDPLWDDYRHLPLPEDIKACWSSPIKSSDGRVIGTFGFYFRERR
FT                   LPDDFHHRLVDVCVYLCALALEREEARARIRQLAFYDELTGLPNRNLLLAQAEQAIARA
FT                   EPERKRVAVLFLDLDRFKQVNDTLGHPIGDALLRDVAQRLRRLARAADIVGRLSGDEFV
FT                   MLMPDFEHGRLTAAAEHVLVALAQPFSVGGITLNPSVSIGISVFPENGRDMDTLLRHAD
FT                   MAMYQAKTAGRNRISFFSAEMNRQAQERLALEAALRDALEAKALRLHYQPQVGLENGHL
FT                   YGVEALARWRHPTLGDISPARFVPLAEECGLIGDLGDWAVREACSQLAVWRTKGLQVPS
FT                   VSVNLSATNFHNLNLPRMIEATLTEFGLAAADLMLEITEGVVLDATAGTLRTIAELHRL
FT                   GVRLSMDDFGTGYSSLGHLRRLIVDELKLDRSFVQGLESDDAARALTSAVIRIGESLSL
FT                   PVVAEGVENEEQRRFLIEQGCAAGQGFLFSPPLPAGDLEEWLRGRP"
FT   gene            623119..625470
FT                   /locus_tag="AXYL_00584"
FT   CDS_pept        623119..625470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00584"
FT                   /product="2-amninobenzoyl-CoA monooxygenase/reductase 1"
FT                   /EC_number="1.14.13.40"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00584"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13942"
FT                   /db_xref="GOA:E3HWN3"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWN3"
FT                   /protein_id="ADP13942.1"
FT                   /translation="MKIVCIGGGPAGLYFGLLMKLQDPANEVTVIERNRPYDTFGWGVV
FT                   FSDATMQNLREADPVSAQTIGDAFNHWDDIDINFKGRSIRSGGHGFIGIGRKKLLNILQ
FT                   ARCEDVGVKLVFENFVQDDQAIAREYDADLVIASDGINSQVRTRYADTFHPDIDQRRCR
FT                   FVWLGTKKVFDAFTFAFVQTEHGWFQAHAYRYEDGMSTFIVETPEETWQAAGIEQMSQE
FT                   EGIAYCEKLFAPWLDGNPLISNATHLRGSAIWIRFPRVICNTWVHWNTLDTARGERRVP
FT                   VVLMGDAAHTAHFSIGSGTKLALEDSIELARCLSGAEGSVEAGLKHYEEVRSVEVLKIQ
FT                   NAARNSTEWFENVERYADLEPEQFAYSLLTRSQRISHENLRLRDPAWLEGFERWIAERA
FT                   GAAGAPGQRPAIPMLTPYQARGVRLKNRIMVSPMAMYSCTNGVPGDFHLVHLGARAMGG
FT                   AGLVMVEMTCVSPDGRITPGCPGLWNDEQRDAFARIVGFVHGNSDARIGLQLGHAGRKG
FT                   STQLGWQKIDHPLAEGNWPLMSASALPYIEGVSQTPQAMTRADMDDVRDNFVAAARRAE
FT                   QAGFDWLELHCAHGYLLSSFISPLTNHRIDEYGGSLENRLRFPLEVFHAVRAVWPETKP
FT                   MSVRISASDWVEGGITADDAVAIARHFKDAGADMIDCSSGQVSKEEKPVYGRMFQTPFA
FT                   DRVRNEAGIPTIAVGAIFEADHANGIIASGRADLCALARPHLADASWTLREAARVGYRD
FT                   VSWPSQYFAGKRQLETNFERAAAMAQLDIK"
FT   gene            625467..626258
FT                   /locus_tag="AXYL_00585"
FT   CDS_pept        625467..626258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00585"
FT                   /product="short chain dehydrogenase family protein 11"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13943"
FT                   /db_xref="GOA:E3HWN4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWN4"
FT                   /protein_id="ADP13943.1"
FT                   /translation="MNATPLPLAGRHALVTGGARGIGLACARALLQRGARVTLLGRDGA
FT                   ALDAATDSLASLGQVQAVSADIANEASVRAAFAQAEAEFGPVLVLVNNAGQAVSQRFDR
FT                   TDAALWQSMLDVNLTGTFHCIQAALPGMLQEKWGRVINVASTAGLIGYGYVSAYCAAKH
FT                   GVIGLTRSLALETAQKGVTVNAVCPGYTETDIVRGAVSNIVDKTGMTADEARAKLAERN
FT                   PQGRLVQPEEVAETVAWLALPASASVNGQAIAVDGGEVMTG"
FT   gene            626303..627160
FT                   /locus_tag="AXYL_00586"
FT   CDS_pept        626303..627160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00586"
FT                   /product="enoyl-CoA hydratase/isomerase family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00586"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13944"
FT                   /db_xref="GOA:E3HWN5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWN5"
FT                   /protein_id="ADP13944.1"
FT                   /translation="MSTQPEEHTMKHHKRPFAGYQAKTFLWQVSADGKIGTVTLNRPER
FT                   KNPLTFDSYAELRDLFRALVYATDIKVVVVTGAGGNFCSGGDVHEIIGPLTKMSMPELL
FT                   DFTRMTGDLVKAMRACPQPIVAAVDGICAGAGAMVALASDMRLGTPAARTAFLFTRVGL
FT                   AGADMGACTLLPRMIGQGRASELLYTGRAMTAEEGASWGFFNAVHEPGALADAAQTLAA
FT                   QLAAGPTFAHGVTKKLLHQEWNMGVDEAIEAEAEAQAICMQTRDFRRAYDAFVAKQKPV
FT                   FQGD"
FT   gene            627163..628332
FT                   /locus_tag="AXYL_00587"
FT   CDS_pept        627163..628332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00587"
FT                   /product="acyl-CoA dehydrogenase FadE25 1"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13945"
FT                   /db_xref="GOA:E3HWN6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWN6"
FT                   /protein_id="ADP13945.1"
FT                   /translation="MRDASWLDWPFFDDAHRKLAHEVDAWCEASLGDVDHHDADGACKK
FT                   LVRAMGEAGWLRYAVAGGPGGAWGGALPEVDSRAVCILRETLARHEGLADFAFAMQGLG
FT                   SGAISLMGSDELRQRYLPRVARGEAIAAFALSEPDAGSDVAAMACEAKLDGDHYVLNGA
FT                   KTWISNGGIADFYCVFARTGEAPGARGISAFVVDADTPGFEVSERIELIAPHPLATITF
FT                   DNCRIPVSHRLGDAGQGFKLAMMTLDIFRASVAAAALGFARRALDEGLARSKSRRMFGQ
FT                   TLSDLQLTQAALGDMATAIDASALLTYRAAWMRDVLKQRTTREAAMAKMTATESAQTVI
FT                   DRALQMFGGAGVVSGMPVEKLYREIRALRIYEGATEVQKLIIARELLKA"
FT   gene            628395..630035
FT                   /locus_tag="AXYL_00588"
FT   CDS_pept        628395..630035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00588"
FT                   /product="2-aminobenzoate-CoA ligase"
FT                   /EC_number="6.2.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13946"
FT                   /db_xref="GOA:E3HWN7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWN7"
FT                   /protein_id="ADP13946.1"
FT                   /translation="MEASAHIDTFARDNLPPGEQWPEFLLDGPDVAYPKRFNCAVELVD
FT                   AMVERGHGERVALRWSQDGKPATMTYRELAALTNRIARVLAEDMGLVPGNRLLLRGPNN
FT                   PMMAASWLAAIKAGLVTVPTMPLLRAKELKQIIDKAQIQAVLCDARLKDEAEFCTQPSH
FT                   EHHCPGLTKVMYFNDNAPDALDALAAAKPDDFKACDTAADDVCLIAFTSGTTGAPKGCM
FT                   HFHRDVLAMCDLFPKHVIKPGPDDIFCGTPPLAFTFGLGGLLCFPLRVGASTVLAEKLS
FT                   PESLLQLIQDFRATIVFTAPTFYRQMAALVGKFDLSSLRKSVSAGEALPDATRQLWKQA
FT                   SGIEMIDGIGGTEMIHVFVSSPPESVRAGAIGRVVPGYVAQIVDDEMKPVPNGTVGRLA
FT                   IKGPTGCRYLADERQLRFVQQGWNLPGDTFLQDDDGYLFYQARNDDMIVSAGYNIAGPE
FT                   VEDALLRHEAVAECGVVGAADDERGQVVKAFVVLKPGYEAGNELVAALQQFVKANIAPY
FT                   KYPRAIEFVEALPRTETGKLQRFALRKMA"
FT   gene            630056..630481
FT                   /locus_tag="AXYL_00589"
FT   CDS_pept        630056..630481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00589"
FT                   /product="thioesterase superfamily protein 2"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00589"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13947"
FT                   /db_xref="GOA:E3HWN8"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWN8"
FT                   /protein_id="ADP13947.1"
FT                   /translation="MAAPFISQVEVRFRHCDPAGIVFYPRYFEMINDFVEEWFDKGMGL
FT                   PFHALHVERHIGTPMASVQCDFSAPSRWHERLRQVLEVQRIGGASFKALVRFEGPDGQL
FT                   RLSATLTIVTVDLRTMKSMPLPADLRERMQAYLVPAA"
FT   gene            630524..630928
FT                   /locus_tag="AXYL_00590"
FT   CDS_pept        630524..630928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00590"
FT                   /product="endoribonuclease L-PSP family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13948"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWN9"
FT                   /protein_id="ADP13948.1"
FT                   /translation="MKILQPPDWMAPRGYSNGVLTEMQVGSKLVFVGGQVGWNGQQQFE
FT                   SDDLADQVRQTLANIVAILAEGGAKPEHIVRMTWYVTDKDEYVAAYPAIGKHYREYIGR
FT                   HFPAMTAVEVADLVEDRAKVEIEVTAVVPA"
FT   gene            complement(631430..632416)
FT                   /locus_tag="AXYL_00591"
FT   CDS_pept        complement(631430..632416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00591"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   AraC family protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13949"
FT                   /db_xref="GOA:E3HWP0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWP0"
FT                   /protein_id="ADP13949.1"
FT                   /translation="MHGWSRLTLAPLLKRRVFSSTQQDETRTLVSEALKEHRLTWKGGR
FT                   VDAELNRGRFGSLTVCTLRYGAEVHIEPDRLQDFMLVQVPLRGRACIECGNDRVDADPD
FT                   CAAVIAPNRPLKLHWEAGCEQLLLKIPRGKLEAIGLRAFGEAATRPLDFSPALRLDNPV
FT                   GAVWRSMVESLIHLLPTLDDGAPRPPAAWLEHLEDTLVLHLLYNQPNSWQAHAGIAPAV
FT                   PRRLSAAETYMRDHLAAPLTLADIARHAGASASALTRLFQEHRDTTPMNALRALRLDEA
FT                   RSRLRTSTAASVTEVALGVGFGHLGRFSEYYRERFGELPRETRRVMG"
FT   gene            632697..633875
FT                   /locus_tag="AXYL_00592"
FT   CDS_pept        632697..633875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00592"
FT                   /product="receptor family ligand binding region family
FT                   protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13950"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWP1"
FT                   /protein_id="ADP13950.1"
FT                   /translation="MNRNLWSRRALAALVCMTAAASATAADKVKVGLLTTLSGPGAALG
FT                   NEIRDGFNLALQHTGGKLGGLPAEVVVADDQQKADAGRQAVERLLKRDRVDVMTGIVFS
FT                   NVLLPVMPAILQSGTIYLSTNTGPENYAGAGCNPNFFAVAWQNEDIPAAMGKYASDQGY
FT                   KSVALIAPDYPGGRESLNGFKRLYKGGLSEEIYTQLGQLDYGVEITRLRASKPDAVFFF
FT                   LPGGMGVNFIKQFNGAGLSKEIALLAPGFSGDEDTIAAVGAPIEGMRNTSQWALELDNP
FT                   ANRKFVEDFKKTYNRSPTLYASQGYDAAMLLDSAVRQTGGKLEADALRPALRRADFKSV
FT                   RGDFKFNRNQYPVQNYYLRIVEAGAGGKLSNKLSGTVLTQYQDPFAAACQMK"
FT   gene            633904..635148
FT                   /gene="dlhH1"
FT                   /locus_tag="AXYL_00593"
FT   CDS_pept        633904..635148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dlhH1"
FT                   /locus_tag="AXYL_00593"
FT                   /product="carboxymethylenebutenolidase 1"
FT                   /EC_number="3.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13951"
FT                   /db_xref="GOA:E3HWP2"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWP2"
FT                   /protein_id="ADP13951.1"
FT                   /translation="MTQNITTREVTVASHDGKSFGAYLAVPASGHGPGLVLCQEIFGVN
FT                   DFMRRAAQLLAEEGYVVLVPDLFWRQQPGIQLTDGPADMPRAFELYQGFDVELGLQDIA
FT                   STIAALRGLPERQGGVGVLGYCLGGKLAYLAACRTDVDVAIGYYGVGIENSLDEASELR
FT                   GRLVLHIAEQDGFCPPEARQRILEALGNKPGVQIYVYPGMDHAFARTGGDHYDKPSALM
FT                   AHQRSMAALQRAIGPEFDYSYLWDKHCEYEFGTRDVAATMATMVAEPYVNHIPTMTGGV
FT                   GHKELSRFYQHHFVNSNPPDTRLVPLSRTVGATQIVDELLFCFTHTTEIDWLLPGVKPT
FT                   GKYVEIPLIAIVKFRGDKLYHEHIYWDQASVLVQVGLLDPKGLPVAGRETAAKLLDETL
FT                   PSNTLMARWKESENK"
FT   gene            635158..636504
FT                   /locus_tag="AXYL_00594"
FT   CDS_pept        635158..636504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00594"
FT                   /product="rieske [2Fe-2S] domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13952"
FT                   /db_xref="GOA:E3HWP3"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWP3"
FT                   /protein_id="ADP13952.1"
FT                   /translation="MSYTEEQLAAMVRGDSVHRGVYTDPAIFDLEMQRIYGRAWIYVGH
FT                   ESQVPKTGDYHTTRLGDQDVLMVRATDGRVHVLYNRCPHKGAKVVADGEGCVGKFFRCP
FT                   YHAWTFKLDGSHLGVPLKQGLEGTAYDPADPSFSMRRVARVESYRGFVFASQAKEGPAL
FT                   EDFLGGVRSSIDNLCDRSPVGEVEVAGGIFRVMQRSNWKVFYENLHDTMHARVTHESSY
FT                   AAARDEAKEMGEMPLELHIMDGNGEPYEFWEKLELRAYANGHGYMEGIFNPGAAERDPV
FT                   SRAHFETLTAAYGETRAREILGMNRHNTVIYGSGSPHTVFQQFRVIRPIAVDRTMIEIQ
FT                   TFRCKGAPDGVFKRAMLYANVINSPSSNVMPDDIELYNRCQEGNATRGGEWVSMHRYHG
FT                   SDRSDSEGLVSVNGTSELPMRNQFDAWKTYMEAGPAATEAAATGDRSCC"
FT   gene            636495..637028
FT                   /locus_tag="AXYL_00595"
FT   CDS_pept        636495..637028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00595"
FT                   /product="ring hydroxylating beta subunit family protein 1"
FT                   /EC_number="1.14.12.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13953"
FT                   /db_xref="GOA:E3HWP4"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWP4"
FT                   /protein_id="ADP13953.1"
FT                   /translation="MLLDLDFDVSTEGLSPAEVPADAYHRIAQFLYREARLLDERRYDD
FT                   WQALWMPDGMYWMPRVPGQQSPYDHISLFWEDRMLRDVRIRRLEHPRNWSQQPPTRSAR
FT                   LVGAVEIEGVDAAGNLVVHSTFQMTEWRKRQPRQLAGRYTHKLAAEGDSWRIRMKRVDL
FT                   VNCDDVHDVFEVFV"
FT   gene            637025..637636
FT                   /locus_tag="AXYL_00596"
FT   CDS_pept        637025..637636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00596"
FT                   /product="isochorismatase family protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13954"
FT                   /db_xref="GOA:E3HWP5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWP5"
FT                   /protein_id="ADP13954.1"
FT                   /translation="MTAADAAVLALHFQNDVLHPEGKIRVGLDADSGARQRLLDNAAAL
FT                   LAGARAHDLPIVHVRIAFRPDYADLMANCPIFRNVAAIGAVPEGQWGSAFYEGLQPLAG
FT                   SAREFVVKHTRISAFYGTPLEETLRLLGARRLVVAGVATHSVVEGTVRHAADIGFEVMV
FT                   AQDACASADPAVHDASLASMRLIAQTGPVAEAVRWAAAPH"
FT   gene            637650..638456
FT                   /locus_tag="AXYL_00597"
FT   CDS_pept        637650..638456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00597"
FT                   /product="short chain dehydrogenase family protein 12"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13955"
FT                   /db_xref="GOA:E3HWP6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWP6"
FT                   /protein_id="ADP13955.1"
FT                   /translation="MDFTGFPGLAGKTAIVTGSTQGLGADIARGLAAAGANVVLVGRNA
FT                   EAGRALEKELDGRALYCETDIGQDSQIQRCIDAAVTRFGRLDILVNNACQYADRGLASS
FT                   REEWHSTLDTNLVSAAIFTQLAAPLLRRGGVVVNMGSTGGKFGAAGRALYPASKAALLQ
FT                   ITKNFAVELAPAGVRVLAVSPAWTWSPSVEQLSGGSRPAADAVGAHFHPLGRVGSGEEI
FT                   AAAVCFACSDAASWMTGVDIPVDGGFSILGPDRGISPRTWFKELAP"
FT   gene            complement(638475..640232)
FT                   /locus_tag="AXYL_00598"
FT   CDS_pept        complement(638475..640232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00598"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13956"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWP7"
FT                   /protein_id="ADP13956.1"
FT                   /translation="MDAENTLLLTLDATTNVLTAVYTPPARPGAADSAFAPASPAAAAE
FT                   TDGAAALDAEASVAVADDDAEPRPHANADLPSWDTLAAAAVAQGWGAEALDSQAVLTFI
FT                   DLCRHATETVQAPVGQVIDGSLELELDAARMSALLTLLPPKGGKPVTLEAVRQVLAERG
FT                   IVHGILEQELIDAVTQGRRETTQIARGTPPTRGTPTRFESLLDRLKPRGQDIDELAQVD
FT                   YRDLGSLLLVTPGMPLMRRTPPLPGVDGATVLGEPILPDELPDTPFASDLAGAVVDPED
FT                   PLLLRAAIAGTPTLVSHGVQVNPMVEVDAVNLSTGNIHFEGSLLVRGDIAATMEVHVTG
FT                   DVVVNGTMEAALVEAGGNVTVKGGIIGLAEALQDAAAAARTARVVCGGALRAKFIENAV
FT                   ISAGKDVDVEREVRQSSIAAGGGVNVGPPNTQQSAITGGQTRAMQAVRAGTIGSPSGIP
FT                   TLVQAGLDPHADIKRAALARKRQKMHEEKSKLEQLLMFLKANPQRAPGDVADRARNTHV
FT                   KLSQDLLALDAEEAQLVLDLQPLASATIQAARRFCSGVTIQVGNKVQEFLEDQIGGKAA
FT                   VEEGQIVIR"
FT   gene            640492..641244
FT                   /locus_tag="AXYL_00599"
FT   CDS_pept        640492..641244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00599"
FT                   /product="transglycosylase SLT domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13957"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWP8"
FT                   /protein_id="ADP13957.1"
FT                   /translation="MHRHPRPVLPALRALLARAGSMAALAAVVGGVLALAPASPAQAAD
FT                   IYRYKDPYGVWRSMKVPTGYAKYYKRAQARTVWRGNSVKVCLECEPKSGDGARLVTLSS
FT                   ATRAQRWGDLKVPQAHDGLIARAARESGVDQALITAVIAIESGFRSDARSPKGALGLMQ
FT                   LMPATAAPLLSVTDVETALVDPATNVNAGSRHLRRLIDQYPGRLDLALAAYNAGEGAVR
FT                   KYDAVPPYAETQAYVRDVTALYEHYKAP"
FT   gene            complement(641278..642555)
FT                   /gene="hemL"
FT                   /locus_tag="AXYL_00600"
FT   CDS_pept        complement(641278..642555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="AXYL_00600"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13958"
FT                   /db_xref="GOA:E3HWP9"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWP9"
FT                   /protein_id="ADP13958.1"
FT                   /translation="MSSNAQLFERACRSIPGGVNSPVRAFRSVGGTPRFIKRAQGPYVW
FT                   DAEDKQYIDYVGSWGPAILGHSHPEVVRAVQEAAVNGLSFGAPTEAEIELAEVLISRLP
FT                   SLEQVRLVSSGTEATMTAIRLARGATGRAKIVKFEGCYHGHSDSLLVKAGSGLLTFGNP
FT                   SSAGVPPEFVSHTLTLEYNNLDAVREAFAQHGADIACIIVEPVAGNMNLIKPAPGFLEG
FT                   LREVCTQHGALLIFDEVMTGFRVGPQGVQGLTGVQPDITTLAKVIGGGMPVGAFGGSAE
FT                   IMKNIAPLGGVYQAGTLSGNPVAVAAGLATMRLIGAPGFYDKLSTQTAKLAQGLQERAR
FT                   AAGLAFSADSVGGMFGIYFSDQVPTSFAEVSACDTAAFNRFFHAMLDHGVHFAPSAFEA
FT                   GFVSATHDDAVIKSTLDIAEKVFASM"
FT   gene            complement(642561..643226)
FT                   /gene="thiE"
FT                   /locus_tag="AXYL_00601"
FT   CDS_pept        complement(642561..643226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="AXYL_00601"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13959"
FT                   /db_xref="GOA:E3HWQ0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWQ0"
FT                   /protein_id="ADP13959.1"
FT                   /translation="MKALRFPTGLYGVTPEWDDTDRLLLAVRQAADGGMRSLQLRRKNV
FT                   PDAVRAAQARALAPLCRELGVLFLINDDWRLALEVGADGAHVGREDESLARIRAEAGPD
FT                   LILGGSSYDDLGRAQELLAAGADYIAFGAMYASSVKPDTVRAPLSVLTEARRLTDNCDA
FT                   PRPAVVAIGGITPDNAPLVAQAGADAIAVITALFEAPSIRAAAAACSAPYSVNPNRKP"
FT   gene            complement(643223..644119)
FT                   /locus_tag="AXYL_00602"
FT   CDS_pept        complement(643223..644119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00602"
FT                   /product="phosphomethylpyrimidine kinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13960"
FT                   /db_xref="GOA:E3HWQ1"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWQ1"
FT                   /protein_id="ADP13960.1"
FT                   /translation="MGTILPKPNRGSPDSPQMSPGAPYSSAVHVAPVTPPLVLVFGPLD
FT                   PSGSDGLPADAVTCAGLGCHGLAAVTALTVRDTAGIEEIHPVTPDLLDDQARCLLEDMS
FT                   VQAIKVGGLYTAETASVAAQVAADYSQVPLVLHLGQRAQPPADAADEDEADDLLAATLE
FT                   LVLPQTDLLVIEHLRLAQWHADGDIDIGDAPTPMHALVAAGAEWVLVLGSPQRPGHYAN
FT                   MLLGPNGQTATLPWQAPPDRNGDAGGVAATAIAAMLARGLEMPEAVRQGLAHADTAVAA
FT                   SFLPGMGRRIPNRIPAQ"
FT   gene            644188..644352
FT                   /gene="rubA"
FT                   /locus_tag="AXYL_00603"
FT   CDS_pept        644188..644352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rubA"
FT                   /locus_tag="AXYL_00603"
FT                   /product="rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00603"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13961"
FT                   /db_xref="GOA:E3HWQ2"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWQ2"
FT                   /protein_id="ADP13961.1"
FT                   /translation="MRTWMCLICGWVYDEEAGLPDEGIAPGTRWEDVPPNWVCPECGAR
FT                   KEDFELMEI"
FT   gene            644505..645092
FT                   /locus_tag="AXYL_00604"
FT   CDS_pept        644505..645092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13962"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWQ3"
FT                   /protein_id="ADP13962.1"
FT                   /translation="MTEKHHEDATTEAANFANQFLIAMPGMVEGSLAGSVIYVCEHTER
FT                   GALGLVINRPTDLTLGTLFERIDLTLEIGPVKDTLVFFGGPVQTDRGFVLHAPAGDYSS
FT                   SIKLGDMALTTSRDVLQAVADGKGPARMLVTLGYAGWGAGQLESEMAQNAWLSVGADDS
FT                   IIFDVPPEERYPAALKLLGIDPVMLAGDAGHA"
FT   gene            645085..645486
FT                   /locus_tag="AXYL_00605"
FT   CDS_pept        645085..645486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00605"
FT                   /product="holliday junction resolvase-like protein"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13963"
FT                   /db_xref="GOA:E3HWQ4"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWQ4"
FT                   /protein_id="ADP13963.1"
FT                   /translation="MPEETLLAFDFGEKKIGIAIGNTLTRQARPLEIIFSEVREARFGR
FT                   IAALLQEWQPHRVVVGLALDAEGGEQPATARCRRFANQLHGRFGLAVELVDERGSSMEA
FT                   QRLLGTHAADDAMAAAVILQRYLDTLPAS"
FT   gene            645508..646425
FT                   /gene="pyrB1"
FT                   /locus_tag="AXYL_00606"
FT   CDS_pept        645508..646425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB1"
FT                   /locus_tag="AXYL_00606"
FT                   /product="aspartate carbamoyltransferase 1"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00606"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13964"
FT                   /db_xref="GOA:E3HWQ5"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWQ5"
FT                   /protein_id="ADP13964.1"
FT                   /translation="MLNPQLDRRGELIHLLTTEGLPRRHVERLLDAARGLAAGAAPACR
FT                   SSAVPVFLCLPDEAAKDRDAFAAAAQRLSLSAVTLEPQAGDALAETVARLAPGLLVLRH
FT                   GASGAAHCAAAHAAPGLRILNAGDGCHADPLPALALVQAMLDARQDLTNLAVTLVGDIR
FT                   HSRVARSIIHAMTTLGVPEVRAAAPRTLLPDGLPQLGVRACASLREGLQDADVVIVLPL
FT                   RVEGISGALLPSAREYAHAYGLTPDALAAARSDALLLPAGVLTPGIETDGDVSASLTPI
FT                   EAQLADIERHLRLAALDLLTGDAP"
FT   gene            646422..647711
FT                   /gene="pyrX"
FT                   /locus_tag="AXYL_00607"
FT   CDS_pept        646422..647711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrX"
FT                   /locus_tag="AXYL_00607"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00607"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13965"
FT                   /db_xref="GOA:E3HWQ6"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWQ6"
FT                   /protein_id="ADP13965.1"
FT                   /translation="MRLHIANGRLIDPANAVDGQHDLYVADGHVVAVGREPDGFHADRV
FT                   LDASGLALLPGLIDLSARVSQPGAAAFAPSELRAALAGGVTRLVLPPDPAAPLDEPGKA
FT                   EALMRHAEPGQCRIHPLGAMTVGLAGETLAEMGLLAQAGCLAYAQGEQGIADTRVLWGA
FT                   MRYASGMGHALWLRPQDPWLARGAVVASGAYAERLGLEGLPAQAETVALHTIFELQRAT
FT                   GARVHLTRLSTAAGLELLRAARREGLPVTADVSAHSLHLTDVDIGFFNTDFRLNPPLRG
FT                   QRDRDAIQAALADGTVDALCSDHTLVDDAAKAVPFPVATPGATGLELLLSLALKWSRDC
FT                   RRPLADALARVTCGPAAVLGKISPQAALAGQLGVGAPADLCLADLDAEWLVMPDALQSR
FT                   SGHTPFAGMMLPGRVRATVVGGSLAWETPV"
FT   gene            647708..648448
FT                   /locus_tag="AXYL_00608"
FT   CDS_pept        647708..648448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00608"
FT                   /product="acyltransferase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13966"
FT                   /db_xref="GOA:E3HWQ7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWQ7"
FT                   /protein_id="ADP13966.1"
FT                   /translation="MKLLRFVLRLFLVVPWILFGLLCVGLVYPLIGPKSRAWLNRRWSR
FT                   CLMAFCGLRVVLKGEPRLTGPVLLVANHVSWIDIFVLNSARATSFVAKSEIRSWPVIGW
FT                   LVAGAGTLFIERGQRHAVHAMGESMQARFKQGDAVGLFPEGTTTEGFELLPFHASLFEP
FT                   ARSAAIEIQPVALRFLQHGKRSGYAAFVGEESLVANLWRVLGVTGLAVEVVFLPPLAAR
FT                   HPDGSLPTRLELSHQARDAILSVL"
FT   gene            complement(649109..649942)
FT                   /gene="apaH"
FT                   /locus_tag="AXYL_00609"
FT   CDS_pept        complement(649109..649942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="AXYL_00609"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase (symmetrical)"
FT                   /EC_number="3.6.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00609"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13967"
FT                   /db_xref="GOA:E3HWQ8"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWQ8"
FT                   /protein_id="ADP13967.1"
FT                   /translation="MNGSIWMIGDVQGCCSPLDRLLSHPELVGDPQSRLWFAGDLVNRG
FT                   PQSLETLRRIIDLGDRATTVLGNHDLHLLATAAGVRKPSKSDTLEDVLRAPDAVDLINW
FT                   LRFRPLAHFEQNHLLVHAGTLAKWDVAKTLALAGEVQDALRGPNWQKALQKMYGNEPAT
FT                   WKEDHKGGKRMRVIINALTRIRLCTPNGHMEFATKVTPGAWPTGLVPWFDVPNRATRNI
FT                   TTVFGHWSTLGLLQRPDVICLDTGCVWGGSLTALRLQDRKLVQVKCSQFQDPLSE"
FT   gene            complement(649939..651117)
FT                   /locus_tag="AXYL_00610"
FT   CDS_pept        complement(649939..651117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13968"
FT                   /db_xref="GOA:E3HWQ9"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:E3HWQ9"
FT                   /protein_id="ADP13968.1"
FT                   /translation="MRTARRYLAREIYRSCAVVLMALLGLFTFFALVDDLDNVGDKFSM
FT                   MALLYMQALAIPTRLYDLLPIGLLIGAILALAGLAQRNELVILRVSGVSGMKLLRMLWI
FT                   VTIPLMIGAGLLSEYVTPWAEIKSGEANLLFRGKAGGDRLNSGYWFKEPTADGGTRIIN
FT                   IGELKGDGQVSAVTLYEFKKDQTLSALSTAPTGLFTQGDLLLKDVTETRLDDEAAEALA
FT                   NARPPKHPPATVVKLPERNIDTTLSAERLLARVLTPERMSIATLLDYVDYLRNNQLQYG
FT                   RQVVALWRKLAYPFTLLVMITIAAPIGLMQTRRGGVGAKVFIGILLGVGFFMLNQLALN
FT                   VGMLGKWPAWLTALGPNIGAMIVALGAMGYMEYRHTITRIAQQRWPWSKSPA"
FT   gene            complement(651197..651919)
FT                   /gene="mtgA"
FT                   /locus_tag="AXYL_00611"
FT   CDS_pept        complement(651197..651919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="AXYL_00611"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13969"
FT                   /db_xref="GOA:E3HE59"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE59"
FT                   /protein_id="ADP13969.1"
FT                   /translation="MATRKGRSWFRIISGALMALVCLVLLYQFWLFAQVVWYNYRPPGS
FT                   SAIMREERSRLSDGNPDFELKYEWVPYDKINRNLKRAVVASEDSNFTEHDGVEWDAIRK
FT                   AWEYNQKQQDAGRSKMRGGSTITQQLAKNLFLSSSRSYIRKGQELVLTYMIEHVMSKER
FT                   ILELYLNVAEWGEGVFGAQAAAKHYFNTTAANLGASQSARLAAMLPNPRFYDAHRNTRY
FT                   LNSRVGVLTRRMQMVEIP"
FT   gene            complement(651925..652788)
FT                   /gene="aroE"
FT                   /locus_tag="AXYL_00612"
FT   CDS_pept        complement(651925..652788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="AXYL_00612"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13970"
FT                   /db_xref="GOA:E3HE60"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE60"
FT                   /protein_id="ADP13970.1"
FT                   /translation="MTEAPPLARYAVIGNPIAHSRSPQIHAMFAEQTGKPLRYDRLLAP
FT                   VDGFADAVAAFVAEGGLGLNVTVPFKLDAYALAAGRLSSRARLAGAVNTLSWRDGAWHG
FT                   CNTDGVGLVSDLLRLGVRLTGASVLLVGAGGAARGVLQPLAEAGCGRIHIVNRTASKAE
FT                   ELAASWRDSGVSPQTAVTGGSLADAAQAGGWNLVINATASGLQNAAPDLPPGLYAAGAA
FT                   AYDMMYGARPTAFMKQAEADGAALTADGLGMLVGQAAESFYIWHGVRPDPAPVLVALRE
FT                   ALQAGQ"
FT   gene            complement(652785..653684)
FT                   /locus_tag="AXYL_00613"
FT   CDS_pept        complement(652785..653684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00613"
FT                   /product="TonB family C-terminal domain protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00613"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13971"
FT                   /db_xref="GOA:E3HE61"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE61"
FT                   /protein_id="ADP13971.1"
FT                   /translation="MQRLADSPSPLSRYLRWLGAPAQHYLRIGIAISLLVHAGALAWRF
FT                   GAPALSRPPVTSLEVVLLNARSETPPDTPRAQAQNQMSGGGNAERGMSTTPLPRTGESA
FT                   ETIVLEAMRRRQVQLEAEQTRLMTQLRAADKAGAERQAVNPWPDGADLGRDAEDQASLI
FT                   QSAQVAALAARVQQYSAEPRKQFVAPSAEASRYAAYLDAWRTRIEAVGTQHYPDEARGR
FT                   IYGSLRITVSVRADGSIADVEIDQPSPHAVLNQAARRIVQLAAPFPPFPPDIARDTDVL
FT                   VITRTWHFVNDTLETQAP"
FT   gene            complement(653814..654902)
FT                   /locus_tag="AXYL_00614"
FT   CDS_pept        complement(653814..654902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00614"
FT                   /product="ABC transporter family protein 11"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13972"
FT                   /db_xref="GOA:E3HE62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE62"
FT                   /protein_id="ADP13972.1"
FT                   /translation="MIELSVEDLHLDYGDNPVLKGVSMQLRQGEVVSLLGPSGSGKTTL
FT                   LRAVAGLEGPKRGRITIGDRVVYDGAAKKEIPAEERNLGLVFQSYALWPHKTVFENVAY
FT                   PLKLRKVPGAEVRERVQAVLDQLGLGKLGQRHPHALSGGQQQRVAIGRALVYSPPVILL
FT                   DEPLSNLDAKLREEARAFLRELIIRLGLSALMVTHDQSEAMAISDRILLLNNGKIEQQG
FT                   TPQEMYGSPSTLFTAEFMGSNNRLDGKVTEVRDGQARIEGRGFSVWGKASPGLAQGQDA
FT                   TAVIRVEQVRLADDPDGNHLDMPLLTSMYLGDRWEYLFRTPDADPAHTLALRAYGPEGR
FT                   EPGPCRLALPASKVWVFPRSAA"
FT   gene            complement(654895..656667)
FT                   /locus_tag="AXYL_00615"
FT   CDS_pept        complement(654895..656667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00615"
FT                   /product="binding-protein-dependent transport system inner
FT                   membrane component family protein 7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13973"
FT                   /db_xref="GOA:E3HE63"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE63"
FT                   /protein_id="ADP13973.1"
FT                   /translation="MQSLRSKWQSLPRGVVVLITALAIYVPLSFIIIQSFLSAPFFAPS
FT                   KTFSLDAFRFIFADPDFYKALKSGFILAFGLAVIAIPLGGMLAFLMIRTDLPGRRWIEP
FT                   LILVPVFVSPMVLGFGYVVAAGPVGFFSIWAQNLLGFVPWNVYSLTSIVVIAGLTHVPH
FT                   AYLYISSALRSMGSDVEEAARVAGASPLRVMVSVSLPMVRPAMLYATVLLFFLGLEVFG
FT                   LVLVLGDPEGNLVLATYLYKLTNKLGIPSYHLMAAVAVVLICMTIPLVMLQRRLMRTAN
FT                   RFVTVKGKASRARALPLGKWRWVAGAVVAFWLLVTIVVPLLGVLLRAFVSNWGMGVSLF
FT                   DVLSLDAFRTVFAQPNLMRAIVNSVAIGVFGGALAVMCYMFVGLAMHRKPDNITRFMDY
FT                   SVLVPRAVPGLLAGLAFLWVFLFVPMWLDNALDEGGWLSALPFAEWLRENFIEWLRAMR
FT                   STIFSVWLAYTVVWMAYGLRLISSTLLQVGPELEEAARSAGARRGQVTRHVTVPLAKYG
FT                   LIGSWLLMFLIFEREYSTGVYLLSPGTETIGSMLVSLWASGAIDIVAALSFINIVLVVI
FT                   GLGIALRFGVKLHD"
FT   gene            complement(656817..657914)
FT                   /locus_tag="AXYL_00616"
FT   CDS_pept        complement(656817..657914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00616"
FT                   /product="bacterial extracellular solute-binding family
FT                   protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00616"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13974"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE64"
FT                   /protein_id="ADP13974.1"
FT                   /translation="MLAKSQLAAACAAAFALAAGSAFAQQVPAGYPADYQKILDGAKKE
FT                   GKVVIYSTTDTKAAGPVIKGFEALYPGIKVEYNDMNSTELYNRYISEQAAGGTSGDIVW
FT                   SSSMDSALKLASDYALQYKSPEVGKLPAWAVWKDSAYGTTYEPAVFIYNKRLIPAAEVP
FT                   TTHGALAKLIASQPDKFKNKVTTYDIEKSAVGFMLAVQDKVNDPKYFETLKGIAAGGLI
FT                   VQSSTGTMMERVSSGENLIGYNILGSYAETRAKNDPSLGVAYPTDYALVLSRVAFISKK
FT                   AKNRNAAKLWMDYLLSQKGQTILANQADLASVRDDIEGDNDVDGMTKKLGASLKPIPVN
FT                   ETLLDYLEQNKRLQFIKDWRAAAGK"
FT   gene            complement(658067..660553)
FT                   /locus_tag="AXYL_00617"
FT   CDS_pept        complement(658067..660553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00617"
FT                   /product="HAMP domain protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13975"
FT                   /db_xref="GOA:E3HE65"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE65"
FT                   /protein_id="ADP13975.1"
FT                   /translation="MNNPENFSIRRRVFALGVLLLACALIGLVFFLRGYAQRAAEQAFD
FT                   RLLAASALTIAGSVQIEDNNVTVEPPVSSLAMLSGGERVFYEARTSNGRLITGYDDLAP
FT                   GLPLAQSATPVFAYLRYHDESVRVATVGRLVSASQHAGWVTVRVAETLGSREALADEIL
FT                   GRTALPLVVVSLVALGLLWFGVQRAFAPLGVVERELRSRAPDDLAPLVTPVPREVRRLV
FT                   EALNAFMQRLSGVMGTLNTLVADAAHQVRTPLASLRAQAEVALDETDPQRLHARLERIH
FT                   LNATHASQLINQLLMDATITHRLGKGSRTLVGVAETVNETRRRIGPLEAQRLRIEIAPE
FT                   VRRARIAGDRVALREMLRNLVDNALRYAPDGPVDIQATPVAGFRVALTVSDRGPGVADD
FT                   EKEAVQQRFTRGRAGETLPGSGLGLSIVRSVAVAHGGSLWLQDRPGGGLTARVILPLAR
FT                   SAPGRAAAACLGALCLAGLLLASSSNDARAADIPQIVTRYPAPQPTSRVLTIAGPTDTP
FT                   VVAPLIQGFQSQRPDVTVVYREMGSRELYEAAIAGQLKDVDVLMSSASDLQIRLANDGY
FT                   ALSYSSPYAAKLPSWAIWRHEVYGFTFEPAVIVYNPKRYTEATVPRSRQDLLRLLERDS
FT                   AKLRGRIGTYDIAASSVGYLLAEQDELVSSNFWGLANAMGQAGVRLSATSAEILDAIEH
FT                   DQIDIGYNILGSYALSRQAAGAAIGVVFPQDYVLVLARSVLIARKAPSPELGRALVDWL
FT                   LSPAGQQVASSHAALGSIMEDTPGRWTSEAVLARSQGIVQPVVLSPALLVGLDQRRHSR
FT                   FVQNWIRLVTDTPARP"
FT   gene            complement(660540..661211)
FT                   /locus_tag="AXYL_00618"
FT   CDS_pept        complement(660540..661211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00618"
FT                   /product="response regulator 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00618"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13976"
FT                   /db_xref="GOA:E3HE66"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE66"
FT                   /protein_id="ADP13976.1"
FT                   /translation="MRILLVEDNLDLGDAVESKLRFAGHSVQWVRDGVAALRWGLDETW
FT                   DALVLDINLPGKDGFTVIRELRAAGLEAPVLVMTARSEIEDKIDMLDLGADDYLVKPFD
FT                   LRELEARLRALMRRPAGQTSSLTVYGNLSLDLANRNVSVAGAPLELGRREFRLLEILLG
FT                   KLGQTVAKERLMNQLFDLDDGTLNALELLISRLRKKLAGASIDIVTVRGVGYQARSHEQ
FT                   P"
FT   gene            complement(662061..663965)
FT                   /locus_tag="AXYL_00619"
FT   CDS_pept        complement(662061..663965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00619"
FT                   /product="RNB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13977"
FT                   /db_xref="GOA:E3HE67"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE67"
FT                   /protein_id="ADP13977.1"
FT                   /translation="MYVFYEDDGSFKAGNILSETDASLQVESESGKRSKIKRANTLFTF
FT                   AAPEPAALMSQAAATAETLDLQFLWECAPQEEFDSPALAADYFGHAPTPVEQAALLMRL
FT                   HGAPAYFHRRGKGSYRPAPPDILAAALAALEKKQRQAEQQQEWVDEMAAGRLPEPIAQA
FT                   AESLLIRPDKNSQQWKALDAACAKLGKSPDRLLLELGAWPHALALHKRRFLAVNFPRGL
FT                   AFPDLELPPIDRELPLSDAEIYSVDDVTTTEIDDALSVSTLPDGRLRVGVHVAAPGITV
FT                   TRDSDFDKLARARLSTVYMPGDKIPMQPDSIIQAFSLDAGREVPALSLYVVADPETGEI
FT                   IESETRLERIVVRENLRHNMLDAQVTEASLSDPSADLPYGHWLRPLWKLAQALSAQREN
FT                   VRGKPENNSRVEYSFYLDGNPDDPDTPVRLVPRQRNAPLDRMVAEYMILANNLWGGLLH
FT                   QHGVPGIYRSQQAGRVRMSTQALPHEAIGVPQYAWSTSPLRRYVDLVNQWQLIAAVEHG
FT                   VSARLVAPFKPRDADLFAIIGAFDAQYAAWAEFQSAMERYWCLRWLKQHNVTRTVAHVL
FT                   RDDLVRFANAPLVTRVGGMPELERGTAVEIDILGMDELSLELDCRYIGEISPAVGGQE"
FT   gene            complement(664039..664641)
FT                   /locus_tag="AXYL_00620"
FT   CDS_pept        complement(664039..664641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13978"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE68"
FT                   /protein_id="ADP13978.1"
FT                   /translation="MILYLHGFRSSPTSLKARMMADAMAERGLSAAWACPQLPASPREA
FT                   IALAMGIARRQLEGADSPRVLTVIGSSLGGFYATWLAEQLGCKAVLLNPAVEAARDLAT
FT                   QIGEHRMYHSDAPFVFLPEYVDELAAIHAPRVTQPDRYFLLAATGDEVLDWREMRDRYA
FT                   GCRQRIVQGSDHGLSDFVEWMPEVLEFALGDKQVRPQ"
FT   gene            complement(664671..666041)
FT                   /gene="mpl"
FT                   /locus_tag="AXYL_00621"
FT   CDS_pept        complement(664671..666041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="AXYL_00621"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13979"
FT                   /db_xref="GOA:E3HE69"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE69"
FT                   /protein_id="ADP13979.1"
FT                   /translation="MHLHILGICGTFMGGLALIARAAGHKVTGCDAGVYPPMSTQLSEQ
FT                   GIELIEGFGAEQLALKPDLYVIGNVVSRGNPLMEAILESGARYVSGPQWLGDNILPGQH
FT                   VLAVAGTHGKTTTSSMLAWVLEAAGMAPNFLIGGVAQDLHVSARFDPSRRPFVIEADEY
FT                   DTAFFDKRSKFVHYRPRTAILNNLEYDHADIFPDLAAIETQFHHLVRTIPGSGRIVRPA
FT                   HCAALDRVIARGCWSETVTFGADGAWQATAPDAEGAFSVLRGGVTAGTVRWNLSGEHNR
FT                   MNALAALAAAEHVGVPAAQGIDALTRFAGVKRRMELRGTVDGIKVYDDFAHHPTAIATT
FT                   LEGLRRQVGAARILAVLEPRSNTMKLGTMAARLPEALADADLVFCFGAHAGKHALGWNP
FT                   AEVLAPLGDRASSYDDIGALVAAVAGAARPGDQVLVMSNGGFGGVHGKLLDALQARA"
FT   gene            666134..666667
FT                   /locus_tag="AXYL_00622"
FT   CDS_pept        666134..666667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00622"
FT                   /product="thioredoxin family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13980"
FT                   /db_xref="GOA:E3HE70"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE70"
FT                   /protein_id="ADP13980.1"
FT                   /translation="MNRRLLLSAGVAIAATVAGGYTLMGRKTSTPSAPADAGDPVAGLM
FT                   QMPLPDLNGASHTLAGWKGQPIVVNFWATWCAPCVREMPELDALQKKYPHVRFVGIGVD
FT                   SAANMQKFVEKVQVSYPLWVIGAGAIDTLRKLGNPSGGLPFTIVFNADGGINRKILGEI
FT                   QPDDLDRTLSGLKA"
FT   gene            666757..667191
FT                   /gene="aroQ1"
FT                   /locus_tag="AXYL_00623"
FT   CDS_pept        666757..667191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ1"
FT                   /locus_tag="AXYL_00623"
FT                   /product="3-dehydroquinate dehydratase 1"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00623"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13981"
FT                   /db_xref="GOA:E3HE71"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE71"
FT                   /protein_id="ADP13981.1"
FT                   /translation="MAQNILVLHGPNLNLLGTREPHIYGSLTLQQINEGLELLAGELGA
FT                   TLTAWQGNHEGALVDRIQAARQDGTDFIIINAAAYTHTSVAIRDALAGVAIPFIEVHLS
FT                   NLYKREPFRHHSYLSDLAVGLISGLGADGYEAALRYAVRH"
FT   gene            667279..667734
FT                   /gene="accB"
FT                   /locus_tag="AXYL_00624"
FT   CDS_pept        667279..667734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="AXYL_00624"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13982"
FT                   /db_xref="GOA:E3HE72"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE72"
FT                   /protein_id="ADP13982.1"
FT                   /translation="MDLRKLKTLIDLVAESGIAELEITEGEGKVRIVKFSQTLQPVAYH
FT                   HPEAGVPAAPAAQAVAPAAPAAEAAPVIQGHVVKAPMVGTFYRAPNPGAAPFIDVGATV
FT                   KEGDPLCIIEAMKLLNEIEADKSGVIKEILVENGEPVEYGQPLFVIG"
FT   gene            667744..669090
FT                   /gene="accC1"
FT                   /locus_tag="AXYL_00625"
FT   CDS_pept        667744..669090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC1"
FT                   /locus_tag="AXYL_00625"
FT                   /product="biotin carboxylase 1"
FT                   /EC_number="6.3.4.14"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13983"
FT                   /db_xref="GOA:E3HE73"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE73"
FT                   /protein_id="ADP13983.1"
FT                   /translation="MFEKILIANRGEIALRIQRACRELGIKTVVVHSEADREAKYVRLA
FT                   DESVCIGPAPSRESYLNMPAIISAAEVTDSEAIHPGYGFLSENADFADRVEKSGFVFIG
FT                   PRPDTIRLMGDKVSAKRAMIEAGVPVVPGSEGALPDDPQEIIRIAREVGYPVIIKAAGG
FT                   GGGRGMRVVYTEAALLNAVTMTRSEAGAAFNNPEVYMEKFLENPRHIEIQVLADGGRNA
FT                   VWLGERDCSMQRRHQKVIEEAPAPGVARRLIERIGDRCADACRKMGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTELITGIDLVQQQILIAAGEKFTLRQRDIEFKGHAIECRIN
FT                   AEDPFRFVPSPGRITNWHTPGGPGVRIDSHAFNGYFVPPNYDSMIAKVITYGDTRDQAL
FT                   ARMRTALSEMVVEGISTNIPLHREMLQDARFIEGGTSIHYLEHKLAQRP"
FT   gene            669194..670123
FT                   /gene="prmA"
FT                   /locus_tag="AXYL_00626"
FT   CDS_pept        669194..670123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="AXYL_00626"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00626"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13984"
FT                   /db_xref="GOA:E3HE74"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE74"
FT                   /protein_id="ADP13984.1"
FT                   /translation="MRELVLHCLEAQAEALSDALLEAGVLSVSVEDADLGTDDERPLFG
FT                   EPGTEPDVQAWDRNRVVALLPDGADPAQIMEEAAAAGELDPAVFKGWSLRDVPDADWVR
FT                   LTQSQFGPIHIAERLWIVPSWHRDNPDVPAFEPDAATQEGAIHIELDPGLAFGTGSHPT
FT                   THLCLAWLEAELPAGATLLDYGCGSGILAIAARKLGAGPTQAVDIDAQAVQSTIFNAEV
FT                   NHVDLQAMLPDALAEGTFEVVVANILSNPLKVLAPMLAGRVAAGGHLVLSGVLERQAEE
FT                   VAAAYAPWIAMSVWRARDGWVCLHGQKA"
FT   gene            670146..671603
FT                   /locus_tag="AXYL_00627"
FT   CDS_pept        670146..671603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00627"
FT                   /product="MJ0042 family finger-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00627"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13985"
FT                   /db_xref="GOA:E3HE75"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="InterPro:IPR021834"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE75"
FT                   /protein_id="ADP13985.1"
FT                   /translation="MALTTRCPQCGTTFKVVPDQLRVRNGLVRCGACSTVFDGRACLLP
FT                   AAGATPQSVPPAAPAMPLTPAASQAAPVLATPAAPVAPQAPAATQASLAPAAPIAPQPP
FT                   AAPPFQTARPAPPPAPAVDFSQTAPWDDEPEPARAPVAPPYRAPEGPPAVLRGRDDIRR
FT                   RAEPAHDAHEREQDEDDDLADDPVDDWAEGPVQHRTAHRPADEVIAQDENPPRWTVPAT
FT                   TQPAYRPDAVSRGAHAEPAFTIGRARADVRDEERDDEYDNEYADEHRDHERDDYSDHHG
FT                   PDRDESGEPVLGDTRTRYSSATDVGRAPPEFLDQDREERHGLLRKLWGYACLIGLIALG
FT                   LQLVYVYRTDIANSVPLLRPVLETACQPLGCTVGYARRLELIHITSSSLQPPTGAAAID
FT                   DGRSRLVLTVVMRNRHDKPQHWPALVLDLNDLSDTVVVRRALKPEDYLTPEQLRGPFAP
FT                   QAELKISVPIEVTGVQVNGFQLNKFFP"
FT   gene            671616..672557
FT                   /locus_tag="AXYL_00628"
FT   CDS_pept        671616..672557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00628"
FT                   /product="PfkB family carbohydrate kinase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00628"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13986"
FT                   /db_xref="GOA:E3HE76"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE76"
FT                   /protein_id="ADP13986.1"
FT                   /translation="MATPVLVCGSMAFDTIAVFEGRFKEHILADRIQSLSVSFLVPSMR
FT                   KEYGGCSGNIAYSMNLLGGKPVPVATVGEDAGEYMERMAGLGIDVSRVKVIPDTFTAQC
FT                   FITTDLDDNQITAFHPGAMAHAAENDLSDADAAWAIVAPDAKEGMFAHAERLHKRGIPF
FT                   IFDLGQAMPLFDGADLERMLKLAQALTVNDYEAGVVEQRTGRSMEDIARSLQAVVVTRG
FT                   AEGATLLTEGKTIQIAPVRAAQVVDPTGCGDAQRGGLLYGLTSGWNWEDSCRLGNVMGA
FT                   IKIASRGPQNHAPSRAEIDAVLHATYGIHLPV"
FT   gene            672753..673256
FT                   /locus_tag="AXYL_00629"
FT   CDS_pept        672753..673256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00629"
FT                   /product="rickettsia 17 kDa surface antigen family protein
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00629"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13987"
FT                   /db_xref="GOA:E3HE77"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE77"
FT                   /protein_id="ADP13987.1"
FT                   /translation="MNQSKTFSLVTPRAGRWLAIAAVVTSMAVLGGCANRSASSGVYSY
FT                   DQAQREQIVRTGTVTGVRPIVIQNDKSSGVGMVAGGALGGVAGNAIGGGTGRTIATVGG
FT                   VILGALAGNAIENQTGKNSGYEITVRLDNGETRVVAQEADVPISVGQRVQVISGSGPTR
FT                   VTPM"
FT   gene            673674..673913
FT                   /gene="acpP1"
FT                   /locus_tag="AXYL_00630"
FT   CDS_pept        673674..673913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP1"
FT                   /locus_tag="AXYL_00630"
FT                   /product="acyl carrier protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13988"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE78"
FT                   /protein_id="ADP13988.1"
FT                   /translation="MHTEQELHTKIGEIVESIVMKKVTPDTQLIATGLVDSLAAVDITL
FT                   AVESEYGCSIPAPEIAEHLQSVRTLAGYVAAHTS"
FT   gene            673891..675078
FT                   /gene="dltD"
FT                   /locus_tag="AXYL_00631"
FT   CDS_pept        673891..675078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /locus_tag="AXYL_00631"
FT                   /product="poly(glycerophosphate chain) D-alanine transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13989"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE79"
FT                   /protein_id="ADP13989.1"
FT                   /translation="MSLPILRNTRLLSHVAAAATAVALAVGTYCGADDLLSRVVNPMSA
FT                   PSASAAAKSNYLPNLGPDWGTQHVNLNRLGNALSDGTLVVLGSSELSSHDLRFVPYRFF
FT                   PEELKVPTLAYGHAMFQSYGIVSVLESVADSLTPNTRLVIMLSPAWFASGGQLPRSAFA
FT                   EHVTGPVWDRLWDQPSTREQMQTWISDNANWGLLWLIANGQVAELKDKLALWWHARKEP
FT                   APDRPRSKLSVPAHRYVSWPAAARLDQGQWGRLTHQARAVEQDLGGHNPYDVRDDYYKQ
FT                   YLAPLYSPARNEFADVDPITRAELGDLSRVMALLQKRKVHAYFVIQPFNPKLILDVERF
FT                   DPVVAAITGMCERYQMGCLDLYSIPFEPGMLRDDMHLAELGWAMADQGIAEYFSR"
FT   gene            675075..675284
FT                   /locus_tag="AXYL_00632"
FT   CDS_pept        675075..675284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00632"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13990"
FT                   /db_xref="GOA:E3HE80"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE80"
FT                   /protein_id="ADP13990.1"
FT                   /translation="MNKTLPAAAPEAGRADDAQDSRKAAAAWGRRFFWHLCLYIGLILV
FT                   FVLQAQPTTGSGGPIKVEFQYQQF"
FT   gene            675292..676419
FT                   /locus_tag="AXYL_00633"
FT   CDS_pept        675292..676419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00633"
FT                   /product="MBOAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00633"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13991"
FT                   /db_xref="GOA:E3HE81"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE81"
FT                   /protein_id="ADP13991.1"
FT                   /translation="MELFASLSFFGGALCGGLGLLAYRSFGMPFRIGYRHIIGVICLGV
FT                   WMAVFWARPYQPIALLAISGSALWAMRRNYIPTWLAVIITMTPLLLVKTGVSHLGAMLG
FT                   LSFATFRAIDVLLFAQRNERVSPLDYFIYLFFPLTLLAGPMYRWRNFQADLKRGYEGVN
FT                   LNTWLSGLELIMLGVIQKFGVAELIWRYGLATLDAHDYSFTGVALNASLYSAYLFFDFA
FT                   GYSTMAIGIGMLFGFTLPINFRNPLATLNPQDFWRRWHISLSEWLRDVVFMPIYKALSK
FT                   TKFFGRHRMAAQNIGIFATLLAMGVWNGLSLHYIVSGLMFGAYSVGHNLLINAARTRPG
FT                   LQAALAQPVMRFLGRVLTLILAALALYVFSGRSPI"
FT   gene            676436..677881
FT                   /gene="dltA"
FT                   /locus_tag="AXYL_00634"
FT   CDS_pept        676436..677881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /locus_tag="AXYL_00634"
FT                   /product="D-alanyl-poly(phosphoribitol) synthetase"
FT                   /EC_number="6.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00634"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13992"
FT                   /db_xref="GOA:E3HE82"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE82"
FT                   /protein_id="ADP13992.1"
FT                   /translation="MRFDLKSFQFIDCERAPDAPAVVAADRSLSWAQLRDEAGAWAEEA
FT                   RRHGAAPDVPVTIYGHKEASFFVAMVGALLIGAPFVPVDTIYPQERLRRIVEIVRAAAV
FT                   FDAASGSFTPGEGAMLAERGLAYVMFTSGSTGDPKGVQIGRESVGLLGDWMLGSFGLGE
FT                   APVFMNQAPFSFDLSMYEVFATLAAGGCCVLNAREQIAAPATWMARLAEHGVTAWVSTP
FT                   SFAHQQLANRDFSPAALPTLRTFLFCGEPLPSALAKKLRQRFPEAVILNTYGPTEATVA
FT                   TTWIEVTDAVLAAHDPLPVGHAKPDSVLIVDEGEICIVGDHVMRGYLNRPDLNQAKLYT
FT                   YADGRRAFRTGDLGQMEGDGLLFCRGRMDDQIKLNGYRIELAEIDEALHGLPGVEGGAC
FT                   AVLRRPDGTAVRLIGFVAGVEAGQAPCMLAPDALAGWKERLAQRLPPYMVPSELVACPA
FT                   LPMSNNHKIDRKKLVEIYAGISA"
FT   gene            complement(677914..678474)
FT                   /locus_tag="AXYL_00635"
FT   CDS_pept        complement(677914..678474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13993"
FT                   /db_xref="GOA:E3HE83"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE83"
FT                   /protein_id="ADP13993.1"
FT                   /translation="MLDEILRFLLEIVFTLFGAALIARAWMHAIRLHPFNPLSRFIYQV
FT                   TNWLVLPLRKIIPASNKIDWTSLVAVWLSALIYLVLVWLVAIGALIPVEYLPKAMGSAL
FT                   IMAIKWALNLVVWLTLIQAVLSWVNPMAPMMPLLQALTAPMLDPIRRLLPRTAIDFSPL
FT                   VLLIVAQVLLMVLSNISQRMMGL"
FT   gene            complement(678657..679322)
FT                   /gene="hctB"
FT                   /locus_tag="AXYL_00636"
FT   CDS_pept        complement(678657..679322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hctB"
FT                   /locus_tag="AXYL_00636"
FT                   /product="histone H1-like protein HC2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00636"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13994"
FT                   /db_xref="GOA:E3HE84"
FT                   /db_xref="InterPro:IPR009970"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE84"
FT                   /protein_id="ADP13994.1"
FT                   /translation="MATAKKAVKKAVKKPAAKKAVAKKAAPAKKAAVKKVAVKKVAAKK
FT                   QAVKKVAAKKPAVKKVAAKKAVAKKAVAKKAVAKKAVAKKAVAKKVVAKKAVAKKAVAK
FT                   KAVAKKAVAKKAVAKKVVAKKAVAKKAVAKKAVAKKAPAAKKAVAKKAVAKKAPAAKKA
FT                   PAAAKPAAAKKPAAAKKPAAKKAAPKKPVTPPSTAAAPGAKTALNPAASWPFPTGGRP"
FT   gene            complement(679743..680942)
FT                   /gene="nrdB"
FT                   /locus_tag="AXYL_00637"
FT   CDS_pept        complement(679743..680942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="AXYL_00637"
FT                   /product="ribonucleoside-diphosphate reductase subunit
FT                   beta"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00637"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13995"
FT                   /db_xref="GOA:E3HE85"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE85"
FT                   /protein_id="ADP13995.1"
FT                   /translation="MINWEDDTIATQAAQSPAPAAGGQAAPEVRAATGVFGDTAMPTPA
FT                   APEHAAGLAASGAATSQRVKVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHWMPQ
FT                   EINMSRDIALWKNPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQF
FT                   LLRQAFEEAIHTHAYQYIVESLDLDEAEIFNAYNEVPSIRAKDEFLIPFIDAIADPNFK
FT                   TGTPEADQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYMYILRDESMH
FT                   CNFGIDLINTVKLENPHLWTPEFREEIRELFRKAVELEYAYAEDTMPRGVLGLNAPMFK
FT                   SYLRFIANRRCQQIGIEPLYPQEENPFPWMAEMIDLKKERNFFETRVIEYQTGGTLSWE
FT                   "
FT   gene            complement(680963..683893)
FT                   /locus_tag="AXYL_00638"
FT   CDS_pept        complement(680963..683893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00638"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00638"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13996"
FT                   /db_xref="GOA:E3HE86"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE86"
FT                   /protein_id="ADP13996.1"
FT                   /translation="MQTTIASVTRPTAVPPSQTDSPADANGGQWASYNIIRRNGSVVGF
FT                   EPNKIAIAMTKAFLAVNGGQGAASARVRELVENLTGQAVNALVRNRPNGGTFHIEDIQD
FT                   QVELALMRSGEHDVARAYVLYREKRTQERAAAAAAADTQEKAAAPQEHVLNVTDAGVRR
FT                   PLDLAELRATIEAAGEGLAEFIDTEAILKETVKNLYDGIPVDEVFKSAILSARALVEKD
FT                   PAYSQVTARLLLHTIRKEVLGEEVSQDGMAARYAEYFPTFIARGIEGGLLSPDLASYDL
FT                   TKLGHALNAKRDLQFGYLGLQTLYDRYFLHIRGTRIELPQVFFMRVAMGLALREADRET
FT                   RAIEFYEILSSFDFMSSTPTLFNSGTLHSQLSSCYLTTVSDDLEGIYDAIKENALLAKY
FT                   AGGLGNDWTPVRALRSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCTYLESW
FT                   HLDIEEFLELRKNTGDERRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPSDCPDLHDKY
FT                   GRAFEEAYVGYEARVASGELKLFKKMPALNLWRKMLSMLFETGHPWITFKDPCNIRSPQ
FT                   QHVGVVHSSNLCTEITLNTNESEIAVCNLGSVNLVAHMKPAAGGGFELDHDKIKRTVSI
FT                   AMRMLDNVIDINYYAVDKARNSNARHRPVGMGIMGFQDCLQMMRVPYASQSAVEFADRS
FT                   MEAVCYHAYWASSLLAEERGRYQSYEGSLWSRGILPQDTLKMLRDERGGHVEVDESSTL
FT                   DWDTLRARIKKHGMRNSNCIAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFTVVN
FT                   DYLVRDLKKLGLWDEVMVADLKYFDGSLSRIDRVPSELRDLYATAFEVEPSWLVECASR
FT                   RQKWIDQAQSLNIYMAGASGKKLDDTYKLAWKRGLKTTYYLRTLGATSAEKSTGRGGEL
FT                   NAVSAGGQSTSAAVAAAPVLPEPEVLGAVCTMRPGDPGFEECEACQ"
FT   gene            complement(684197..687703)
FT                   /locus_tag="AXYL_00639"
FT   CDS_pept        complement(684197..687703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00639"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase
FT                   family protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00639"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13997"
FT                   /db_xref="GOA:E3HE87"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE87"
FT                   /protein_id="ADP13997.1"
FT                   /translation="MDGTPAAEPQLDLEYQLADNLTRSSGRIFLTGTQALVRIMLTQAR
FT                   MDRERGLNTAGFVSGYRGSPLGGVDMAMWKAQKALDANQITFLPAINEDMAATAVMGTQ
FT                   QAGVRADRNVDGVYAMWYGKGPGVDRAGDALHHGNAAGASRNGGVLVVVGDDHTAVSSS
FT                   IPHASEASLIGWQMPIVHPASIDEYETFALWGWALSRYSGTWVAFKAVSETIECGHSFV
FT                   PAPAQRYDMPADPDMPPESLEYSARDFLSLAIETRMNLRMKAVAAFARRHSIDRLTCPA
FT                   PKAAVGIVTVGKAHLDTMEALSRLGVDTVTANAPVRIYKPGLTWPLDSERLLEFARGLS
FT                   HILVIEEKGAVVESQIKDLLFNLPDRPSVIGKKGFDGEALVPSAGQLRPSLLAQPLASW
FT                   LSRAAGLPLAADLSAFACQAPLSNDADGMRRRPYFCSGCPHSTSTKVPEGSQALSGVGC
FT                   HYMAAWMDRDTGGLTQMGGEGVDWIGLSRYTKMPHIFQNMGEGTYYHSGYLAIRQAVAA
FT                   KANITYKILFNDATAMTGGQPIDGPISVPSICQQLRGENVTRIVVTTDEPEKYQGVDLG
FT                   AGIKVHHRRELDALQRELREIPGVTVLIHDQTCAAEKRRRRKKNQFPDPARRMQINSAV
FT                   CEGCGDCGVQSNCLSVVPLETPYGRKRAIDQSSCNKDYSCAEGFCPSFVSVMGGKPKKS
FT                   AAPKADQERLQKLIAQLPLPAMPALDHPYRLLVAGMGGTGVITIGAIVSMAAHLEGLSA
FT                   AVLDLTGLAQKGGTVVSHIRLAPAGAPAGPVRLDWQQADAAILCDPVASVAPDSLGALR
FT                   RGHTQVTVNSYVAPVSDFTRNPDAAMQPEALLAKIRHAAGESNTAAIDAHEAALALFGD
FT                   SILSNMFMLGYAWQRGGVPLSQAAINRAIELNGVAVAANRAAFDSGRLAAHQPDALEGA
FT                   LRPRAQVVQLHVPESFERAVARRIDDLTAYQDAGYARQFQDVVEAVAARERELAPEAKT
FT                   PRLALAVARGLFKLMAYKDEYEVARLYTGESFQAQLKGQFEGDYSLRFHMAPPIFARKD
FT                   PRTGVPRKMTLGPRTMTALKMLTRLKGLRGTWFDPFGHTAERKMERSLVREYRQTIDQL
FT                   LAGLTRDKLAQAATIAGLAETIRGFGHVKAANVEKYRTELGRLMQTYTAPAPQDMPLRK
FT                   TA"
FT   gene            687833..688282
FT                   /locus_tag="AXYL_00640"
FT   CDS_pept        687833..688282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00640"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   AsnC family protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13998"
FT                   /db_xref="GOA:E3HE88"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE88"
FT                   /protein_id="ADP13998.1"
FT                   /translation="MDKTDIGILKALQEDGRASAQQLSEKVGLSAAPVWRRVKAMEASG
FT                   VIQGYSAQVDRSKVGLGCMFAQISLERHSANTVENFERSVRDAPEILECYAVTGDSDFL
FT                   LKILVESPEAYDRFLHRFLFNMPGIRQTRTIVALREIKHEQRLPL"
FT   gene            complement(688328..689293)
FT                   /locus_tag="AXYL_00641"
FT   CDS_pept        complement(688328..689293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00641"
FT                   /product="extra-cytoplasmic solute receptor family protein
FT                   13"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ADP13999"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE89"
FT                   /protein_id="ADP13999.1"
FT                   /translation="MSIPRYIRPALIGAGLLLAATAHAAGWPEKPVTLIVPSAAGGAAD
FT                   LTARTLAQYLGEKTGQTVVVEDRPGAGGIVGTNAAKNAAADGYTFLLSTNSTHSANQFL
FT                   YKSLPYDAQKDFRQVGMLGTFGTVGVVSPDSPYRTVPDLVDYAKKHPGQVFFGYYSSSS
FT                   QVPSELLKQRAGIEITGAAYKNITQIITDLRGKQINFAFVDYLTAMGQIDGKGLVPIAV
FT                   TGAQPQAAWPSVPTMTTYYPDFVVAGWLGLSAPAGTPPEIVEKMNAHMQAAVKDEATAK
FT                   KLRALGLTPESMDVARFDAFVKEDTARWKEWIRISGIQPQ"
FT   gene            complement(689354..690199)
FT                   /locus_tag="AXYL_00642"
FT   CDS_pept        complement(689354..690199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00642"
FT                   /product="alpha/beta hydrolase fold domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14000"
FT                   /db_xref="GOA:E3HE90"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE90"
FT                   /protein_id="ADP14000.1"
FT                   /translation="MNADSLLFPPHACTDPLDFSLIDRLPDRPAGQGRLILGAAPQDGR
FT                   PGLLLVPGAYHGAWCYAHYLDYFARAGLACAALDLRGHGALPQDDAFTSAGIADLGQDV
FT                   ISALDALARPTVVVGHSMGALPALLAASQRAVAGVILLAPSPPGDLTGAQALPPVPVGM
FT                   LRRAPNDAEIRARFLATSPDRDVAPVSQRLCAESPQVLNDRYLLRVPVDAAAIGAPGLC
FT                   LEAGLDTHDRHPPGQDLAIARRFGFSHAVLAGQPHCMMYADQWQVSAAAILDWHRGQFG
FT                   "
FT   gene            690276..691184
FT                   /locus_tag="AXYL_00643"
FT   CDS_pept        690276..691184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00643"
FT                   /product="bacterial regulatory helix-turn-helix protein,
FT                   LysR family protein 20"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00643"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14001"
FT                   /db_xref="GOA:E3HE91"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE91"
FT                   /protein_id="ADP14001.1"
FT                   /translation="MPAMRPLPEISITHYRHFLLVAELRSFRAAAARAFRSQPALSLSI
FT                   REMEQRLGQPLFEPGNRGTLTRFGQDCLPLARELVQHHDRVAGALSGLASNEAGTLTMA
FT                   SVATVATHWLPELVAVYRERYPAVALRLFDDNSEGVERMVLAGEAELGVCSPVSQDRRL
FT                   SFEPLLRDAFGLVCHRGHSLARRKSVTWREIEDLPLVGTIAHRQLAGYPQAAFMLDRQV
FT                   FVSNMMSLLAMLERGVGVTVLARLGVPPDSRGLAFVPLSGPRIERELGITRLAGRSLSP
FT                   AAARMEEMLRAKAAKRGRTVA"
FT   gene            691374..691880
FT                   /locus_tag="AXYL_00644"
FT   CDS_pept        691374..691880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00644"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14002"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE92"
FT                   /protein_id="ADP14002.1"
FT                   /translation="MSSVYLRTAGIACAVLILAGCAARKPATITEAQPAEPPKPVACVP
FT                   AKAGDPMIGTWLSNTRPRDVSGDLQSLIVLSPDGTMAYESLLKIGRKTRPALRETGCWS
FT                   VADGIYTMQTTKSAGELVDANDPIYLNRYRVEKVEKTRLTMRELKNGGQVMTARRMPAG
FT                   YRLPY"
FT   gene            691979..693178
FT                   /locus_tag="AXYL_00645"
FT   CDS_pept        691979..693178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00645"
FT                   /product="major facilitator superfamily protein 11"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14003"
FT                   /db_xref="GOA:E3HE93"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE93"
FT                   /protein_id="ADP14003.1"
FT                   /translation="MPALSSEARAIALLALAAFVSASAFRICDPMLPQLAAEFGTTTGQ
FT                   AARAVTAFAVAYGVLQMFFGPLGDRYGKYRVVSIATFACALGSAGAVMAGSLDVLVFCR
FT                   VLSGAAGAGIVPLSMAWIGDNVPYERRQATLARFLTGTILGMSAGQLAGGLFADTVGWR
FT                   WAFAALVGGYLIVGVLLLLEVRRQQVSGLGRVDPGAVRQGFVAQARLVLGTPWARIVLA
FT                   TVFVEGLLVFGALAFAPSYLHERFDISLTAAGALVAVYAVGGLIYTVVAGRILKRLGER
FT                   GLAIAGGLVLGVAFLSYLLGPVWMWSLLASVLAGFGYYLLHATLQTNATQMVPSARGTA
FT                   VAWFASCLFMGQAAGVALAGAVVDEIGPGALFGGSAALLPLLGAFFARALKARAAIQQA
FT                   "
FT   gene            complement(693284..694690)
FT                   /gene="gltX"
FT                   /locus_tag="AXYL_00646"
FT   CDS_pept        complement(693284..694690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="AXYL_00646"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00646"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14004"
FT                   /db_xref="GOA:E3HE94"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE94"
FT                   /protein_id="ADP14004.1"
FT                   /translation="MTSNASTPIRTRFAPSPTGFLHLGGARTALFSWAFARHHQGTFVL
FT                   RIEDTDVERSTPEAVQAILDSMDWLGMQPDEGPFYQMQRMDRYREVVAQMLAAGTAYHC
FT                   YSSPEEVEAMREAARARGDKPRYDGTWRPEPGKTLPAIPEGRKPVVRFKNPQEGATSWN
FT                   DMVKGTISFDNTELDDLIIARPDGTPTYNFCVVVDDWDMGITHVLRGDDHVNNTPRQIN
FT                   ILRALGAALPEYGHVPMILGPDGEKLSKRHGAVNVMEYDNEGYLPEAMVNYLARLGWSH
FT                   GDDELFSREQLVSWFDTKHLSKSASQWDPKKLNWVNAHYIKQMDNAELAERVAPRVANR
FT                   GGHPEKIDLPGVMGLLKDRAETLEQLADGAMLFCAEFKGAPAELTEQHLTAPAREALAD
FT                   FAQRAQDTDWTREALSALIKAVLADRGMKMPQLAIPLRVAVTGQTQTPAVDAVLALLGK
FT                   QTVLKRLAAI"
FT   gene            694835..697252
FT                   /locus_tag="AXYL_00647"
FT   CDS_pept        694835..697252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00647"
FT                   /product="acetyltransferase, GNAT family protein 1"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00647"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14005"
FT                   /db_xref="GOA:E3HE95"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE95"
FT                   /protein_id="ADP14005.1"
FT                   /translation="MFEPASLVIVADRPLPAAASLPPTLKGKTTVVACEVGAAPDLPDT
FT                   LQGLAPGERPDLALVCVSPAVLPETLRRLSPLAPRSVILLPHELPDPYPRGTLALCRAW
FT                   AEENRCELLGPRSFGAQRPHAGLNLSQHPVLARAGRVALLAQSRSIMAAVMDWAEDVHI
FT                   GFSTAVSLGDEAVVGLSKVLDYLASDPRTDSIVLYLEDVGPAREFMSTLRAAASVKPVI
FT                   VLKAGRADTDSADAIFDAALRRAGAVRVRYFVQLFSAVKVLGYTRRPKGRRVALISNGS
FT                   GPPQLAMDLIGPDAAVLRAELAPATQRALVAMLEPDAATANPVITFTPLTPERIRAMLD
FT                   AVLDDAGVDGVLVLLAPDALADMPAVARELAQIAPKAKKPVVTCFMGDAGMRPLRRMLD
FT                   DAGTSAFRTPESAADAFGVLATHHYNQQLLLQTQPPEPATHVPDLTAAREILARVRAEC
FT                   RRELNTSEIRSLLALFYVPLRDTPMDVAAAEPESRPMAIRVRRDPQFGPVIRFGAGGPD
FT                   AVLSQSDRGVDLPPLNGFLARQLIERSRLWRRVLAPRIGHMAAEALQQAVVLVSELVSE
FT                   LPDIESLDIDPLYAGETHLRAGGLRMTLTEKPGCATPQTAGYPHMAIHPYPARLVQVRR
FT                   FADGIPWVLRPIRPEDADPLQEFIRGLSERSRYMRFVSMMRELTPRMVSRYTQVDYHRE
FT                   LALVAATQVPNPANRGHPREVLVGFAHYLRNPDGRGAEYALVIGDDWQRRGLGRQLMTA
FT                   LIDAAREQGLEYIDGLVLSTNRPMLALMTSLGFTNDADPEDPTMRRVWLDLA"
FT   gene            complement(697265..697957)
FT                   /locus_tag="AXYL_00648"
FT   CDS_pept        complement(697265..697957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00648"
FT                   /product="isochorismatase family protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00648"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14006"
FT                   /db_xref="GOA:E3HE96"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE96"
FT                   /protein_id="ADP14006.1"
FT                   /translation="MEFPQWVQDRVIARQGRLHPYDELPAARLAVVVVDMQQYFTLPGY
FT                   QGECAPAREIIAPINRLCDAVRAAGGTIVWVQTASDNADLFWSHHHRVMLTPERSARRL
FT                   ETLRRDAPGYALHPDLHAQDSDLRVTKRFYSAMAPGSSELEPLLRGRGVDTLLIAGTVT
FT                   NVCCESTARDAMMRDFRTIMVDDALAAVTPAEHEHALHGWMLFFGDVLSVDESIARLKP
FT                   AQTVRKTA"
FT   gene            complement(697967..698803)
FT                   /locus_tag="AXYL_00649"
FT   CDS_pept        complement(697967..698803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00649"
FT                   /product="binding-protein-dependent transport system inner
FT                   membrane component family protein 8"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00649"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14007"
FT                   /db_xref="GOA:E3HE97"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE97"
FT                   /protein_id="ADP14007.1"
FT                   /translation="MNAPVANTVPLRAVRAPSEKYLNYLQRDRARRRHIRIAQALLLAV
FT                   FLCAWEILPRMHILNPLLTSYPSALWPTFIELWNNGQLGKHIMTTLSATLVGFGLSMAI
FT                   GIVVAAALWWSDFLYKVLDPFLVVANAMPKIAFVPIFYLWLGSDYAVYGMAVAIAVFVT
FT                   IMVIYAGFRGIDLNKVKLAHTFGASRWQVLTKVVLPGSVPTLIAAVKMNIGLALVGVIV
FT                   GEFQSADSGLGFLIMNGSQVFKLNIVMTAIAILALISSVMYLIVYRIEAAIARRYG"
FT   gene            complement(698807..699622)
FT                   /locus_tag="AXYL_00650"
FT   CDS_pept        complement(698807..699622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00650"
FT                   /product="ABC transporter family protein 12"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14008"
FT                   /db_xref="GOA:E3HE98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE98"
FT                   /protein_id="ADP14008.1"
FT                   /translation="MMGAVIHNLKPDPATAKIELREVCLSYFTQEGETEALANVSFTLA
FT                   AGEFVSLIGQSGCGKSTLLSLIAGLIPPTSGAVMIDGQAVTKPNPRIGYMLQQDYLFEW
FT                   RTILDNVMLGAEIQGRRDARSEARAVHLLEKCGLGAFLSHTPRQLSGGMRQRAALARTL
FT                   VTEPDVILLDEPFSALDSQTRLAISDEVVDILRREGKTVVLVTHDIGEAIAMTDRVIVL
FT                   SRRPGRLKSQYRIHYGDGTRPTPFQARSRPEFNTYFKQLWDELDVHVEG"
FT   gene            complement(699619..700623)
FT                   /locus_tag="AXYL_00651"
FT   CDS_pept        complement(699619..700623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00651"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00651"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14009"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E3HE99"
FT                   /protein_id="ADP14009.1"
FT                   /translation="MKSLPSPRLAAAALLALLAPLAAQAEALNPPVKVRYEEVVRSILY
FT                   VPKYVALSQGYFKDAGLDVSMKTSQGTDKGMTALLSGSADIVLIGPEASIYVHNSESPV
FT                   KPKIFAGLTATDGFFLLARKPVEKFDWSMLKGKEVIGFRPGSNPIVFLETALRKHGVDP
FT                   QKDVKLLNNIGIPARAGAWMAGQGEYGIFLEPEAGELVRNGKGYIVASVGHEVGQVDYT
FT                   VFTATDKYIRDNPKVIQAWTNVVARAEKYVKDTPAATLTPQIMTYFPGMDQAAVTEAIE
FT                   RYKQYQIWKTTPLVTAEAMNQLQDMLIASAVMKDNARVKYEDVVVTDFAKKAQ"
FT   gene            complement(700959..701636)
FT                   /gene="estB"
FT                   /locus_tag="AXYL_00652"
FT   CDS_pept        complement(700959..701636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estB"
FT                   /locus_tag="AXYL_00652"
FT                   /product="carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00652"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14010"
FT                   /db_xref="GOA:E3HEA0"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HEA0"
FT                   /protein_id="ADP14010.1"
FT                   /translation="MNAPTDLLDCIEIETAPNPTHAVIWLHGLGADGNDFAPIVPELDL
FT                   PAGASVRFVFPNAPVQRVTINNGMAMRSWYDILVMDLVRVEDAHGIRASEAAIHKLIAR
FT                   ENARGIPTSRIVLAGFSQGCAMTLHTGIRLPEKLAGMMGLSGYLPLLDTAEAERHGANQ
FT                   DTPIFLAHGQYDPVVSLPRAQASLAELQRLGYDVQWHTYPMPHSVCAEEVADVSKFLNQ
FT                   VLV"
FT   gene            complement(701656..702207)
FT                   /locus_tag="AXYL_00653"
FT   CDS_pept        complement(701656..702207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00653"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14011"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:E3HEA1"
FT                   /protein_id="ADP14011.1"
FT                   /translation="MNSHTEEESVDDGYDENGYDRPSKSQVKREMHALLDLGKQLIELS
FT                   PERLKQLPLAERLYEAIRTAQRTTGREGKRRQVHFVGKLMRDAPADEIRTQLDIWENGS
FT                   REETAAMHRLETLRDRLLDDDEALTKLLNSNPQADVQQLRALIRAARKEKQANAALLQG
FT                   QEPQKKHYRALFQALKTLTL"
FT   gene            702266..703630
FT                   /locus_tag="AXYL_00654"
FT   CDS_pept        702266..703630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00654"
FT                   /product="modulator of DNA gyrase family protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00654"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14012"
FT                   /db_xref="GOA:E3HEA2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E3HEA2"
FT                   /protein_id="ADP14012.1"
FT                   /translation="MVKTSSSLPLAANHARFSELVEQTLAYARQIGASDAAAEVSESLG
FT                   LSVSVRKNDIETVEQTRDRSLDLTVYAGQSRGSASTSDFSEAALRQTVEAAWHIARHTA
FT                   ADPAAGLPDADQLATEFPDLDLHRAWSVSTEEAAELALRAERAAREVDARITNTDGATV
FT                   GTYEGQFVMGNTRGFLGGYPYSRHSLSVAPIAGRGNGMQRDYWYSSERDPAKLASPEAI
FT                   GRYAAERTLSRLSARRIRTGKFPVLFEAPLALGLVGALTQAANGGALYRKASFLLDALG
FT                   KPIFPDHINLTEDPHIRGAMGSSPFDDEGVRTRRRNVVSAGVLEGYFLSSYTARKLGMV
FT                   TTGNAGGSHNLVFSSTRTRRGDDFEAMLKKMGTGFLVTELIGQGVNYVTGDYSRGAFGY
FT                   WVENGQIQHAVQEITIAGNLADMFKQIVAIGADTISRGTKTTGSILIEQMAIAGT"
FT   gene            703803..704900
FT                   /locus_tag="AXYL_00655"
FT   CDS_pept        703803..704900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00655"
FT                   /product="Tat pathway signal sequence domain protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14013"
FT                   /db_xref="GOA:E3HEA3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E3HEA3"
FT                   /protein_id="ADP14013.1"
FT                   /translation="MQRRSFLKHAGLGAVATGAAVSAPAFAQDMPSLSWRLSSGFPSIL
FT                   DLRIGAGESFCKFVSEATGGKFNIRHFPEGEIVPAADLMEAVSTKKVECGHASSRAYYA
FT                   KNPVFCFDAAVPFGLNARQMNAWMNEGGGLRLTRELFKPEKIINFPLGNTGAQMGGWYT
FT                   KEIKRAGDLKDLKMRVGGLAGDVLAKLGVAPQQADPAKLAEAFEKDGLQAVAGAGPYDD
FT                   DKLGLNKVAKYYYAPGWWAPGEQLSLYINDEAWNALPKNYQAVVDAAAQAAHAATIARY
FT                   DARNAAALAQLTANGAQIRTFPRSIMDLAFEATQQVYKDLGAKDPRFKAMHDSYMGFRD
FT                   SEMPWFRLTESAYDQYLGVALSART"
FT   gene            705156..706310
FT                   /locus_tag="AXYL_00656"
FT   CDS_pept        705156..706310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00656"
FT                   /product="receptor family ligand binding region family
FT                   protein 7"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00656"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14014"
FT                   /db_xref="GOA:E3HEA4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3HEA4"
FT                   /protein_id="ADP14014.1"
FT                   /translation="MQSKTKKLLAALIAAGIVPAAHAADIKIGVAEALSGGAAQYGVSI
FT                   RNGFQLAADEINAAGGINGNKIVLVVEDEQGKKEEAINVFKKLIFKDNVLMVFGPTLSN
FT                   SAQAADPIAQAAKTVAFGTSNTADGITSIGNYVFRNSVTEADVLPATISTVKAKTGLKN
FT                   VAVLYGNDDVFTKSGYDNFKKALEDQKIPVTTTETFAKGDVDFKAQLTKIKGTNPDAIV
FT                   LSALLAEGAPIMVQARQLGLNVPVIGGNGMNSVKIFDLAPGGASNNLWIGSPWSIENKA
FT                   AENVKFIDAYKAKFNGAPDQFAAQSYDAMYIAAQALKNVKLSGDLPKDRTALRDALPSV
FT                   TWTGATGPFKFRQANDRAGKPAGYDADQAPIVSVTKDGKYVIEK"
FT   gene            706432..707361
FT                   /locus_tag="AXYL_00657"
FT   CDS_pept        706432..707361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00657"
FT                   /product="inner-membrane translocator 12"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00657"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14015"
FT                   /db_xref="GOA:E3HEA5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3HEA5"
FT                   /protein_id="ADP14015.1"
FT                   /translation="MQWALHGALTALESPIMFEQQFVNALSLGCVYALFALGFTLIFGV
FT                   LGVINLAHGAVFMVGAYAALFVVQQFSLPLWAGLMAAFFVAGFTGVIIDYLVLKPLRKR
FT                   NAPHLIPMIATIGVGIILNNGAQSIFGASNLRFPHGTVPEEVIEVAGLHLTVIELGIIF
FT                   LSFALMAVLMYVMRRTQFGRALRAIAESPKAAWLLGINVEKLFVTTSFAAAALGGVAGV
FT                   LIGLYSNALFPLMGQPMLHKGIAVIILGGMGDIRGAMLGGLFLGFAEVLSVAYIGSTMR
FT                   DAVAFGLLFLILLVRPQGLFGKVVQRKA"
FT   gene            707365..708240
FT                   /locus_tag="AXYL_00658"
FT   CDS_pept        707365..708240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AXYL_00658"
FT                   /product="inner-membrane translocator 13"
FT                   /db_xref="EnsemblGenomes-Gn:AXYL_00658"
FT                   /db_xref="EnsemblGenomes-Tr:ADP14016"
FT                   /db_xref="GOA:E3HEA6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:<